2LUXA

Calcium saturated form of human c85m s100a1 mutant
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
93
structure length
93
Chain Sequence
GSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVAMNNFFWENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-A1
publication title Solution structure of human holo-S100A1 C85M mutant
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 27
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2luxA00
4YGAA 1F4QA 1JFKA 3EVRA 1M31A 2DOQA 4CIDA 2JRFA 1EG4A 4I5NB 1EL4A 1F70A 1NCZA 1PALA 2M9GA 1L2OC 2SCPA 1BR1B 1IQ3A 2LUXA 3CGAA 1QXPA 3TDZA 3JVTB 3JVTC 5JJGA 2WC8A 3I5IC 3I5IB 1IQ5A 4FTGA 5JOLA 1QASA 1KK7Y 2BKIB 1QTXA 2L98A 2MAZA 4BY4A 5HLOA 1A75B 1MWNA 4USLA 2WCBA 1TNQA 4HREE 1RK9A 2L5XB 2LVIA 1KQMB 1KQMC 1ZMZA 1PSBA 2K2AA 2LV7A 4P2YB 2MLEC 1NX1A 2P6BB 5DKNA 1BOCA 1QX2A 1WRZA 2BBMA 3A8RA 3BUMB 3PFVA 1ALWA 4GBAA 3BXKA 2NZ0A 3MSEB 1FI6A 2CXJA 4YGEB 5D7FA 3KF9A 5PALA 3WHUB 1DF0A 1Y0VH 2KDHA 2Y5IA 3LL8B 4P5OE 4DRWA 4L9MA 1C07A 1K90D 1GGWA 2EHBA 1FW4A 2OS8C 1SCVA 2OS8B 2ZN9A 4MLWA 2D8NA 1M45A 4DCKA 3CWGA 2GV5A 1S6CA 3LCPC 1PSRA 1B9AA 1WDCB 1B7TY 2KNEA 2M3WA 3PATA 1QJTA 3O2PA 5D69A 4MRYA 3VGOA 1S26D 1YTZC 1B8LA 1UHHA 3TUYB 1LXFC 1ODBA 1DMOA 3A4UB 4YGBB 5K89A 4WRIA 1WRKA 3TS5B 2M1UA 5HYDA 4WQ3A 2L4IA 1GQMA 2CTNA 2JXCA 3KPXA 1JFJA 3E3RA 1CNPA 1W7JB 4JWQA 1QVIZ 2R2IA 3EK8A 2LLSA 3SG6A 1UUSA 2JTTA 1D1OA 5F6TA 1QV1A 1CDMA 1EH2A 3SJSA 3SG2A 1YVLA 2ZN8A 4A4BA 1FI5A 1H4BA 3BOWA 5AEQA 4GPLB 2LVVA 2KFGA 1XK4C 1LVCD 4GGFA 3RM1A 3VRPA 1IG5A 1ZACA 1HT9A 5B8IB 1K2HA 2B1UA 4PE0A 1MXLC 4ZCUA 1RFJA 2GGMA 2I94A 1B4CA 1LINA 4PE4A 1MR8A 4GFTA 5AFPA 4PE1A 1KQVA 2KGBC 2Y4QA 3AAJA 1TCFA 2M7LA 3HCMA 3PM8A 3IF7A 4XJKA 4PE7A 4BY5A 4QJ5B 4CLNA 1TIZA 1EXRA 1XYDA 4N5XA 4QJ3B 2BCAA 2JNXA 1A75A 1JUOA 2JC2A 2QACA 1NUBA 1JF2A 1AJ5A 5AERA 4TNCA 3OX5A 4JQ0D 1XVJA 2K7BA 4IL1A 1HQVA 2KI6D 1K95A 1R6PA 2O60A 4NDCA 1YRUB 1BR4B 2O5GA 3DVKA 1SY9A 5I2LA 4ORAB 3KEVA 1G8IA 1UP5A 3LK1A 3BUWB 1C7VA 3FIAA 2V53A 1OSAA 1YVHA 3IQOA 4Q04A 2F2PA 1OMRA 3SIAA 4ORBB 3SG7A 5KSZA 2JTZA 2EC6B 1LA3A 2EC6C 1YURA 1W7IB 2KFFA 2ZFDA 4M2PA 3GOFA 4PDZA 1BF5A 1K93D 1SNLA 2Q4UA 5I2OA 1QLKA 5HLVA 1EJ3A 1S6JA 3PALA 1CFDA 1UHKA 4NDBA 1S5GY 2VRGA 5KU1A 1SR6B 1SR6C 4FQOA 2LAPA 4MRXA 1NCXA 2JT0A 5AANA 4GGNA 2Q91A 4CFRA 1U5IA 1SMGA 2JT8A 1JC2A 1G4YR 1AJ4A 1EG3A 1AVSA 2LMTA 1S36A 1CLMA 5TNCA 1V1GA 2NXQA 1CDLA 1DJGA 3I5HB 4OR9B 5CSNA 1QATA 1KFUS 1RROA 2M49B 1TNPA 1UWOA 2H61C 2HETA 1NX0A 1QIVA 2NLNA 2JQ6A 2K8MB 2OPOA 1NSHA 4WQ2A 2H2KA 2NCOA 2COLB 1MXEA 1MQ1A 1H8BA 2FCDA 1SL7A 1XK4A 1JBAA 4C0JA 1TN4A 4A4CA 1CFPA 1WDCC 1A2XA 1NWDA 3CZTX 3WHTB 5BPJA 2KGRA 1UURA 1M63B 2I2RE 4C0KA 3FWCA 1Y1XA 3TUYC 1UHNA 1ZUZA 2LLUA 4GAOA 1XFWO 2CCMA 4N1GA 3DD4A 1K9PA 5IBWA 1YX8A 3TS5C 4PHJA 1OOJA 4GNKB 3K21A 4PALA 3SG4A 1LKJA 1DTLA 3SIBA 2PVBA 2FCEA 1KWOB 4ORCB 1DJIA 3O78A 3KO0A 4QJ4B 1F8HA 2GGZA 2KSPA 2QPTA 3DVJA 3CR4X 1K9KA 1YUTA 4ICBA 5CSIA 2BE6A 2MHHA 4YRUA 4NQGA 5I8NA 1K96A 1YUUA 4F0ZB 5CSFA 1TCOB 2E30A 3GK4X 1NP8A 1KFXS 4YGDB 1NX2A 1QX5B 2LVJA 4PHNA 3ICBA 3NSOA 1QX7A 4MZJA 2K7CA 3CTNA 2WCFA 4I5LB 4UPGA 1QVIY 2AMIA 2A4JA 2LVKA 3GK1A 2L2EA 4MZLA 1SW8A 1YRTB 2KAYA 2CBLA 2OTGC 2OTGB 5ER5A 2ISDA 1J1EA 1CKKA 2FJUB 1KCYA 1XA5A 5GQQC 1XFYO 1YX7A 4MBEA 1IJ6A 2F8PA 2ZNDA 3I5FB 3I5FC 3JTDB 1XFVO 3RLZA 3WNXB 3CR5X 3KHEA 4NDDA 2CNPA 5HKZA 1B47A 2KAXA 2LHLA 3DF0B 1FPWA 2ZKMX 4E68A 3VRQA 2TN4A 2LM5A 1QV0A 2BCBA 3CLNA 3TDUA 2M29A 2L0PA 1Q80A 2WCEA 4C0LA 2BL0B 2BL0C 2KQYA 3EKJA 1XFZO 4YGCB 1WLZA 2CT9A 2SASA 4N1FA 1E8AA 1CMGA 3VROA 2LE9B 1BLQA 1KSMA 2L50A 1ZOTB 2K61A 1RJVA 1CMFA 2M0RA 1UHIA 1A03A 3NSLA 2AAOA 2F3ZA 1CLBA 2K7DA 2MRDA 3IQQA 1B8CA 2BKHB 1XFXO 2H61A 1CFCA 1AUIB 1SPYA 1IGVA 1JSAA 2RGIA 1NIWA 1BJFA 2BCXA 1DJWA 2IS9A 3NSKA 2MJWB 2LMVA 4YBHB 1S1EA 2LNKA 3OB1B 4OKHA 1TOPA 2KOTA 3FS7A 1B8RA 3ZWHA 1IH0A 1WRLA 1M39A 2BBNA 1KK8B 1K94A 1KK8C 3AAKA 1CM1A 1TNXA 2PSRA 4YI8A 4DIRA 3DVEA 1G33A 3H4SE 1WLMA 2HQ8A 1KSOA 4OCIA 1NYAA 4YI9A 1FF1A 1DT7B 1A4PA 2KAVA 1C7WA 1N65A 1SYMA 3BUXB 4DUQA 1KK7Z 1PRWA 3AKAA 1CB1A 1CLLA 2KQ6A 3EVVA 3PN7C 3PN7B 2ZRSA 3D0YB 1IRJA 1AK8A 1L2OB 2EGDA 2HF5A 3I5HC 2LMUA 1BU3A 1DJXA 1J1DA 2BECA 2FOTA 1QIWA 1TTXA 3LLEA 4CPVA 3FWBA 2JPTA 1R2UA 4XJKB 4AQIA 3PLFB 1SK6D 3PSRA 5CSJA 1L7ZA 3EK7A 3CR2A 1F4OA 2K7OA 4JPZB 2PMYA 1J7QA 1BT6A 1IWQA 2MA2A 1SBJA 2I7AA 1PK0D 3GK2A 1B7TZ 2LCPA 1DJHA 1XO5A 2F33A 2LANA 5J3XA 2WNDA 1PULA 1OE9B 2KYCA 2KHNA 4M2OA 1X02A 1DJYA 1GJYA 1RTP1 2Y1MA 4GUKA 1M46A 3DF0A 3TZ1A 5DKQA 2ZRTA 1RECA 1CDNA 4PHMA 1PVBA 1CTRA 1IJ5A 1A29A 2JULA 2JWWA 2LP2A 1SKTA 1AP4A 2K0JA 1KWOC 3EVUA 2JOJA 4ZCVA 1CM4A 1PVAA 3AKBA 2Y1NA 3F45A 1K9UA 3BYAA 4XYNA 1DJZA 3EK4A 1J7RA 5AXIA 2I18A 2K2FA 3DVMA 5CPVA 1SL8A 2BE4A 4I5JA 3C1VA 4DS7A 2HPSA 5DKRA 4D1EA 2JZIA 2KI6C 1OQPA 1KFUL 2AUCA 3VRRA 3OB2B 4MVFA 3O4YA 2M1KB 1JF0A 1NPQA 1F71A 2MBXA 4HRGA 1YR5A 4HSZA 2PRUA 4MN0A 5KTYA 2JXLA 2JT3A 1U5IB 1DVIA 1J7PA 2PASA 3NXAA 2M8UA 1Y1AA 1GGZA 1QS7A 3JTDC 4U8DA 1JWDA 4PCWA 2E6WA 1OZSA 1UHJA 1AHRA 1RWYA 1DF0B 3NSIA 4M2QA 2JU0A 1S6IA 1MF8B 1DGUA 1N2DA 1SL9A 3BUOB 1SCMB 1SCMC 3D10A 4CFQA 3M0WA 1FBVA 2KYFA 2L4HA 1K8UA 1Y6WA 5G08A 4MZKA 2G2BA 1XFUO 3QRXA 2WORA 2WOSA 1V1FA 2M7NA 1OMVA 2LLTA 2KBIA 1KFXL 3TDIA 1BMOA 2LC5A 3D0YA 3OP0A 4OVNF 5FYXA 3WXAA 2G9BA 1IKUA 1BODA 2JNFA 1NCYA 1MUXA 1NX3A 1J55A 1VRKA 2KFHA 3HX4A 1B1GA 3BQ3A 4ETOA 2MLFC 2F2OA 3SG5A 4R1EA 2NCPA 1QLSA 1S3PA 2LHIA 1OMDA 3OHMB 3VRNA 1Y1UA 4OV2A 1CDPA 1DGVA 1TRFA 2LP3A 1OZOA 3I5GC 3I5GB 5HKYA 2L51A 5I2QA 4AQJA 5ER4X 3O6BA 1SRAA 1N0YA 2F3YA 2PALA 3BOWB 4PHKA 5HKWA 4AOMA 1BG1A 3OX6A 1CFFA 1ALVA 1ZFSA 3LK0A 1F55A 4GGFC 4HRHA 4I5KA 1F54A 3ZNIA 3SG3A 3BUNB 2M97A 2KBMA 1J7OA 3CS1A 1S5GZ 1YUSA 2HQWA 4MEWA 2KI4C 2KI4B 3EKHA 1TNWA 2ZNEA 2LUCA 1WY9A 4MSPA 1MHOA 1LA0A
chains in the Genus database with same CATH superfamily
4YGAA 1F4QA 1JFKA 3EVRA 1M31A 2DOQA 3SS3A 2JRFA 4CIDA 1EG4A 4I5NB 1EL4A 1F70A 1NCZA 1PALA 2M9GA 1L2OC 2SCPA 1BR1B 3NHTA 1IQ3A 2LUXA 3CGAA 1QXPA 4IJ7A 3TDZA 3JVTB 3JVTC 5JJGA 3BJHA 2WC8A 3I5IC 3I5IB 3SS4A 1IQ5A 4FTGA 5JOLA 1QASA 1KK7Y 2BKIB 1QTXA 2L98A 2MAZA 4BY4A 5HLOA 1A75B 1MWNA 4USLA 2WCBA 1TNQA 4HREE 1RK9A 2L5XB 2LVIA 1DQEA 1KQMB 1KQMC 2QDIA 2WCJA 1ZMZA 1PSBA 2K2AA 2LV7A 4P2YB 1LS8A 1NX1A 1TWOA 2MLEC 2P6BB 5DKNA 1BOCA 1QX2A 1WRZA 2BBMA 3A8RA 3BUMB 3PFVA 1ALWA 4GBAA 3BXKA 3PJIA 2NZ0A 3MSEB 1FI6A 2CXJA 4YGEB 5D7FA 3VB1A 3KF9A 5PALA 3WHUB 1DF0A 1ORGA 1Y0VH 2KDHA 2Y5IA 3LL8B 4P5OE 4L9MA 3SS5A 1K90D 4DRWA 1C07A 2EHBA 1FW4A 2OS8C 1SCVA 2OS8B 2ZN9A 4JD9A 4MLWA 2D8NA 1M45A 3R1VA 4DCKA 3CWGA 2GV5A 1S6CA 3LCPC 4INXA 1PSRA 1B9AA 1WDCB 3CZ0A 1B7TY 2KNEA 2M3WA 3PM2A 2YGUA 3PATA 1QJTA 3O2PA 5D69A 4MRYA 3OBVA 3VGOA 1S26D 1YTZC 4MEWA 1B8LA 1UHHA 3TUYB 1LXFC 1ODBA 1DMOA 3A4UB 4YGBB 5K89A 4WRIA 1WRKA 3TS5B 2M1UA 5HYDA 4KYNA 4WQ3A 2L4IA 1GQMA 2CTNA 2JXCA 3KPXA 1JFJA 3E3RA 1CNPA 1W7JB 3CZ1A 4JWQA 1QVIZ 2R2IA 3EK8A 2LLSA 1OOIX 3SG6A 1UUSA 2JTTA 1D1OA 5F6TA 1QV1A 1CDMA 1W9ZA 1EH2A 3SJSA 3SG2A 1YVLA 2ZN8A 4A4BA 1FI5A 1H4BA 3CZ2A 3BOWA 5AEQA 4GPLB 3D74A 2LVVA 2KFGA 1XK4C 1LVCD 4GGFA 3S0GA 3RM1A 3VRPA 1IG5A 1ZACA 1GGWA 1HT9A 5B8IB 1K2HA 2B1UA 1DC1A 2H8VA 4PE0A 1MXLC 4ZCUA 1TUJA 1RFJA 2QEOA 2GGMA 2I94A 1B4CA 1LINA 4PE4A 1MR8A 4GFTA 5AFPA 3UNWA 1C3YA 2WCKA 4PE1A 3FE9A 1KQVA 2KGBC 2Y4QA 3AAJA 1TCFA 2M7LA 3HCMA 2GTEA 2QEHA 2KLDA 3PM8A 3IF7A 4XJKA 4PE7A 4BY5A 3EG5B 4QJ5B 4CLNA 1TIZA 1EXRA 1XYDA 4N5XA 3BFHA 4QJ3B 1T14A 2BCAA 2JNXA 1A75A 1JUOA 2JC2A 2QACA 1NUBA 1JF2A 2KPHA 1AJ5A 5AERA 4TNCA 3OX5A 3D75A 4JQ0D 1XVJA 2K7BA 2PYQA 3RZSA 4IL1A 1HQVA 2KI6D 3DXLA 1K95A 1R6PA 3IVTA 2O60A 4NDCA 1YRUB 1BR4B 2O5GA 1DELA 1SY9A 3DVKA 5I2LA 4ORAB 3KEVA 1G8IA 1UP5A 1Z4HA 3FE6A 3LK1A 3BUWB 1C7VA 3FIAA 2V53A 1OSAA 1YVHA 3IQOA 4Q04A 2F2PA 1OMRA 3SIAA 4ORBB 3SG7A 5KSZA 2JTZA 2EC6B 1LA3A 2EC6C 1YURA 1W7IB 2K60A 2KFFA 2ZFDA 3GOFA 4M2PA 4PDZA 3DYEA 5FI6A 2PQLA 1K93D 1SNLA 1BF5A 2Q4UA 5I2OA 1QLKA 5HLVA 1EJ3A 1S6JA 3PALA 1CFDA 1UHKA 4NDBA 2BNXA 1S5GY 2VRGA 5KU1A 1SR6B 1SR6C 4FQOA 2LAPA 4MRXA 1NCXA 2JT0A 5AANA 4GGNA 2Q91A 4CFRA 1U5IA 1SMGA 2JT8A 1JC2A 1G4YR 1AJ4A 1EG3A 1AVSA 2LMTA 1S36A 2L5YA 1CLMA 5TNCA 1V1GA 2NXQA 1CDLA 1DJGA 3I5HB 4OR9B 5CSNA 1QATA 1KFUS 3DY9A 1RROA 2M49B 1TNPA 1UWOA 2H61C 2HETA 1NX0A 1QIVA 2NLNA 3N7HA 2JQ6A 2K8MB 2OPOA 1NSHA 2WC5A 4WQ2A 2H2KA 2NCOA 2COLB 1MXEA 1MQ1A 1H8BA 2FCDA 1SL7A 1XK4A 1JBAA 4C0JA 5CSIA 3D76A 1TN4A 4A4CA 1CFPA 1WDCC 1A2XA 1NWDA 3CZTX 3WHTB 5BPJA 2KGRA 1UURA 1M63B 2I2RE 4C0KA 3FWCA 1Y1XA 3TUYC 1UHNA 1ZUZA 2LLUA 4GAOA 1XFWO 2CCMA 4N1GA 3DD4A 1K9PA 2BAPA 5IBWA 1YX8A 3TS5C 4PHJA 1OOJA 4GNKB 3K21A 1XFRA 4PALA 3SG4A 1LKJA 1DTLA 3SIBA 2PVBA 2FCEA 1KWOB 3R1OA 1OOHA 4ORCB 1DJIA 3O78A 1IIOA 3KO0A 3L4AA 4QJ4B 1F8HA 2GGZA 1C3ZA 2KSPA 2QPTA 3CR4X 1K9KA 1YUTA 3DVJA 4ICBA 2BE6A 2MHHA 5EL2A 4YRUA 4NQGA 5I8NA 1K96A 1YUUA 4F0ZB 1SSEB 5CSFA 1TCOB 2E30A 3GK4X 1NP8A 1KFXS 4YGDB 1NX2A 1Z2CB 1QX5B 5I94A 2LVJA 4PHNA 3ICBA 3NSOA 4FQTA 1QX7A 4MZJA 2K7CA 3CTNA 2WCFA 4I5LB 4UPGA 1QVIY 2AMIA 2A4JA 2L2CA 2LVKA 3CABA 2L2EA 3GK1A 1SW8A 1YRTB 2KAYA 2CBLA 2OTGC 2OTGB 4MZLA 5ER5A 2ISDA 1J1EA 1CKKA 2FJUB 1KCYA 1XA5A 5GQQC 1XFYO 1YX7A 4MBEA 4F7FA 3S0FA 5HL1A 1IJ6A 2F8PA 2ZNDA 3I5FB 3I5FC 3JTDB 1XFVO 3RLZA 3WNXB 3CR5X 3KHEA 4M2OA 4NDDA 2CNPA 5HKZA 1B47A 2KAXA 2LHLA 3DF0B 1FPWA 2ZKMX 4E68A 3VRQA 2TN4A 2LM5A 1QV0A 2BCBA 1QWVA 3CLNA 3TDUA 2M29A 2L0PA 1Q80A 2WCEA 3V2LA 4C0LA 2BL0B 2BL0C 2KQYA 3EKJA 3O4XA 1XFZO 4YGCB 1WLZA 2CT9A 2SASA 4N1FA 1E8AA 1CMGA 3VROA 2LE9B 1BLQA 1KSMA 3S0BA 2L50A 1ZOTB 2K61A 1RJVA 1CMFA 2M0RA 1UHIA 1A03A 3BFBA 3R72A 3NSLA 2AAOA 2F3ZA 5FI7A 1CLBA 2K7DA 2MRDA 3IQQA 1B8CA 2BKHB 1XFXO 2H61A 1CFCA 1AUIB 1SPYA 1IGVA 1JSAA 2FJYA 2RGIA 1NIWA 1BJFA 2BCXA 1DJWA 2IS9A 3NSKA 2MJWB 2LMVA 4YBHB 1S1EA 2LNKA 3OB1B 4OKHA 1TOPA 2KOTA 3FS7A 1B8RA 3ZWHA 1IH0A 1WRLA 3FE8A 1M39A 2BBNA 1KK8B 1K94A 1KK8C 3AAKA 3D77A 1CM1A 1TNXA 2PSRA 4YI8A 4DIRA 3DVEA 1TUZA 1G33A 3H4SE 1WLMA 2HQ8A 1KSOA 4OCIA 1NYAA 4YI9A 1FF1A 1DT7B 1A4PA 2KAVA 1C7WA 1N65A 1SYMA 3BUXB 4DUQA 1KK7Z 1PRWA 3S0AA 3AKAA 1CB1A 1CLLA 2KQ6A 2WCMA 3EVVA 3PN7C 3PN7B 2ZRSA 3CYZA 3NHIA 3D0YB 1IRJA 1AK8A 1L2OB 2EGDA 2HF5A 3I5HC 5FI2A 2LMUA 3D78A 1BU3A 1DJXA 1J1DA 2BECA 2FOTA 1QIWA 1TTXA 3LLEA 4CPVA 3FWBA 2JPTA 1R2UA 4XJKB 4AQIA 3PLFB 1SK6D 3PSRA 5CSJA 1L7ZA 3EK7A 3CR2A 1F4OA 2K7OA 2JPOA 4JPZB 2PMYA 1J7QA 1BT6A 1IWQA 2MA2A 3CDNA 1SBJA 2I7AA 3L4LA 1PK0D 2P70A 3GK2A 1B7TZ 2LCPA 1DJHA 1XO5A 2F33A 2LANA 5DICA 5J3XA 2WNDA 1PULA 1OOGA 1OE9B 4OZDA 2KYCA 2KHNA 2P71A 1X02A 1DJYA 1GJYA 1RTP1 2Y1MA 4GUKA 1M46A 3B87A 3DF0A 5DKQA 3TZ1A 3B88A 2ZRTA 1RECA 3QMEA 1CDNA 4PHMA 1PVBA 2WC6A 1CTRA 1IJ5A 1A29A 1GM0A 2JULA 2JWWA 2LP2A 1SKTA 1AP4A 2K0JA 1KWOC 3EVUA 2JOJA 4ZCVA 1CM4A 1PVAA 3AKBA 2Y1NA 3F45A 1K9UA 3BYAA 4XYNA 1DJZA 3EK4A 1J7RA 5AXIA 2I18A 2K2FA 3DVMA 5CPVA 1SL8A 2BE4A 4I5JA 3C1VA 4DS7A 2HPSA 5DKRA 4D1EA 2WCLA 2JZIA 2KI6C 3B86A 1OQPA 1KFUL 2AUCA 3L47A 3VRRA 3OB2B 4MVFA 3O4YA 2M1KB 1JF0A 1DEKA 1NPQA 1F71A 2MBXA 4HRGA 1YR5A 4HSZA 3NGVA 3K1EA 2PRUA 4MN0A 3S0EA 5KTYA 2JXLA 2JT3A 1U5IB 1DVIA 1J7PA 2PASA 3NXAA 2M8UA 1Y1AA 1GGZA 1QS7A 2ERBA 3JTDC 2KLEA 4U8DA 1JWDA 4PCWA 2E6WA 1OZSA 1UHJA 1AHRA 4INWA 1RWYA 1DF0B 3NSIA 4M2QA 2JU0A 1OOFA 1S6IA 3UO9A 1MF8B 1DGUA 1N2DA 1SL9A 3BUOB 2WCHA 1SCMB 1SCMC 3D10A 4CFQA 3M0WA 1FBVA 2KYFA 2L4HA 2QEVA 1K8UA 1Y6WA 5G08A 4MZKA 4JKTA 2G2BA 1XFUO 1OW4A 3QRXA 2WORA 2WOSA 1V1FA 2M7NA 1OMVA 2LLTA 2KBIA 3OGNA 1KFXL 3TDIA 1BMOA 2LC5A 3D0YA 3OP0A 4OVNF 5D3OA 5FYXA 2G9BA 3WXAA 1IKUA 2JNFA 1BODA 1NCYA 1MUXA 1NX3A 2QEBA 1J55A 3BFAA 1VRKA 2KFHA 3HX4A 1B1GA 3BQ3A 4ETOA 2MLFC 1P28A 2F2OA 3SG5A 4PT1A 4R1EA 2NCPA 1QLSA 3S0DA 1S3PA 2LHIA 1OMDA 3DZTA 3OHMB 3D73A 3VRNA 1Y1UA 4OV2A 1CDPA 1DGVA 1TRFA 2LP3A 1OZOA 3I5GC 3I5GB 5HKYA 2L51A 5I2QA 4AQJA 5ER4X 3O6BA 1SRAA 1N0YA 2F3YA 2PALA 3BOWB 4PHKA 3B7AA 5HKWA 4AOMA 1BG1A 3OX6A 1CFFA 1ALVA 1ZFSA 3LK0A 1F55A 3B6XA 4GGFC 4HRHA 4I5KA 1F54A 3R1PA 3ZNIA 3SG3A 3BUNB 2M97A 2KBMA 1J7OA 3CS1A 1S5GZ 1YUSA 2HQWA 3Q8IA 2KI4C 2KI4B 3EKHA 1TNWA 2ZNEA 2LUCA 1WY9A 4MSPA 1MHOA 1LA0A
chains in the Genus database with same CATH topology
4YGAA 1F4QA 1JFKA 3EVRA 1M31A 2DOQA 4CIDA 2JRFA 1EG4A 4I5NB 1EL4A 1F70A 1NCZA 1PALA 2M9GA 1L2OC 2SCPA 1BR1B 1IQ3A 2LUXA 3CGAA 1QXPA 3TDZA 3JVTB 3JVTC 5JJGA 2WC8A 3I5IC 3I5IB 1IQ5A 4FTGA 5JOLA 1QASA 1KK7Y 2BKIB 1QTXA 2L98A 2MAZA 4BY4A 5HLOA 1A75B 1MWNA 4USLA 2WCBA 1TNQA 4HREE 1RK9A 2L5XB 2LVIA 1KQMB 1KQMC 1ZMZA 1PSBA 2K2AA 2LV7A 4P2YB 2MLEC 1NX1A 2P6BB 5DKNA 1BOCA 1QX2A 1WRZA 2BBMA 3A8RA 3BUMB 3PFVA 1ALWA 4GBAA 3BXKA 2NZ0A 3MSEB 1FI6A 2CXJA 4YGEB 5D7FA 3KF9A 5PALA 3WHUB 1DF0A 1Y0VH 2KDHA 2Y5IA 3LL8B 4P5OE 4DRWA 4L9MA 1C07A 1K90D 1GGWA 2EHBA 1FW4A 2OS8C 1SCVA 2OS8B 2ZN9A 4MLWA 2D8NA 1M45A 4DCKA 3CWGA 2GV5A 1S6CA 3LCPC 1PSRA 1B9AA 1WDCB 1B7TY 2KNEA 2M3WA 3PATA 1QJTA 3O2PA 5D69A 4MRYA 3VGOA 1S26D 1YTZC 1B8LA 1UHHA 3TUYB 1LXFC 1ODBA 1DMOA 3A4UB 4YGBB 5K89A 4WRIA 1WRKA 3TS5B 2M1UA 5HYDA 4WQ3A 2L4IA 1GQMA 2CTNA 2JXCA 3KPXA 1JFJA 3E3RA 1CNPA 1W7JB 4JWQA 1QVIZ 2R2IA 3EK8A 2LLSA 3SG6A 1UUSA 2JTTA 1D1OA 5F6TA 1QV1A 1CDMA 1EH2A 3SJSA 3SG2A 1YVLA 2ZN8A 4A4BA 1FI5A 1H4BA 3BOWA 5AEQA 4GPLB 2LVVA 2KFGA 1XK4C 1LVCD 4GGFA 3RM1A 3VRPA 1IG5A 1ZACA 1HT9A 5B8IB 1K2HA 2B1UA 4PE0A 1MXLC 4ZCUA 1RFJA 2GGMA 2I94A 1B4CA 1LINA 4PE4A 1MR8A 4GFTA 5AFPA 4PE1A 1KQVA 2KGBC 2Y4QA 3AAJA 1TCFA 2M7LA 3HCMA 3PM8A 3IF7A 4XJKA 4PE7A 4BY5A 4QJ5B 4CLNA 1TIZA 1EXRA 1XYDA 4N5XA 4QJ3B 2BCAA 2JNXA 1A75A 1JUOA 2JC2A 2QACA 1NUBA 1JF2A 1AJ5A 5AERA 4TNCA 3OX5A 4JQ0D 1XVJA 2K7BA 4IL1A 1HQVA 2KI6D 1K95A 1R6PA 2O60A 4NDCA 1YRUB 1BR4B 2O5GA 3DVKA 1SY9A 5I2LA 4ORAB 3KEVA 1G8IA 1UP5A 3LK1A 3BUWB 1C7VA 3FIAA 2V53A 1OSAA 1YVHA 3IQOA 4Q04A 2F2PA 1OMRA 3SIAA 4ORBB 3SG7A 5KSZA 2JTZA 2EC6B 1LA3A 2EC6C 1YURA 1W7IB 2KFFA 2ZFDA 4M2PA 3GOFA 4PDZA 1BF5A 1K93D 1SNLA 2Q4UA 5I2OA 1QLKA 5HLVA 1EJ3A 1S6JA 3PALA 1CFDA 1UHKA 4NDBA 1S5GY 2VRGA 5KU1A 1SR6B 1SR6C 4FQOA 2LAPA 4MRXA 1NCXA 2JT0A 5AANA 4GGNA 2Q91A 4CFRA 1U5IA 1SMGA 2JT8A 1JC2A 1G4YR 1AJ4A 1EG3A 1AVSA 2LMTA 1S36A 1CLMA 5TNCA 1V1GA 2NXQA 1CDLA 1DJGA 3I5HB 4OR9B 5CSNA 1QATA 1KFUS 1RROA 2M49B 1TNPA 1UWOA 2H61C 2HETA 1NX0A 1QIVA 2NLNA 2JQ6A 2K8MB 2OPOA 1NSHA 4WQ2A 2H2KA 2NCOA 2COLB 1MXEA 1MQ1A 1H8BA 2FCDA 1SL7A 1XK4A 1JBAA 4C0JA 1TN4A 4A4CA 1CFPA 1WDCC 1A2XA 1NWDA 3CZTX 3WHTB 5BPJA 2KGRA 1UURA 1M63B 2I2RE 4C0KA 3FWCA 1Y1XA 3TUYC 1UHNA 1ZUZA 2LLUA 4GAOA 1XFWO 2CCMA 4N1GA 3DD4A 1K9PA 5IBWA 1YX8A 3TS5C 4PHJA 1OOJA 4GNKB 3K21A 4PALA 3SG4A 1LKJA 1DTLA 3SIBA 2PVBA 2FCEA 1KWOB 4ORCB 1DJIA 3O78A 3KO0A 4QJ4B 1F8HA 2GGZA 2KSPA 2QPTA 3DVJA 3CR4X 1K9KA 1YUTA 4ICBA 5CSIA 2BE6A 2MHHA 4YRUA 4NQGA 5I8NA 1K96A 1YUUA 4F0ZB 5CSFA 1TCOB 2E30A 3GK4X 1NP8A 1KFXS 4YGDB 1NX2A 1QX5B 2LVJA 4PHNA 3ICBA 3NSOA 1QX7A 4MZJA 2K7CA 3CTNA 2WCFA 4I5LB 4UPGA 1QVIY 2AMIA 2A4JA 2LVKA 3GK1A 2L2EA 4MZLA 1SW8A 1YRTB 2KAYA 2CBLA 2OTGC 2OTGB 5ER5A 2ISDA 1J1EA 1CKKA 2FJUB 1KCYA 1XA5A 5GQQC 1XFYO 1YX7A 4MBEA 1IJ6A 2F8PA 2ZNDA 3I5FB 3I5FC 3JTDB 1XFVO 3RLZA 3WNXB 3CR5X 3KHEA 4NDDA 2CNPA 5HKZA 1B47A 2KAXA 2LHLA 3DF0B 1FPWA 2ZKMX 4E68A 3VRQA 2TN4A 2LM5A 1QV0A 2BCBA 3CLNA 3TDUA 2M29A 2L0PA 1Q80A 2WCEA 4C0LA 2BL0B 2BL0C 2KQYA 3EKJA 1XFZO 4YGCB 1WLZA 2CT9A 2SASA 4N1FA 1E8AA 1CMGA 3VROA 2LE9B 1BLQA 1KSMA 2L50A 1ZOTB 2K61A 1RJVA 1CMFA 2M0RA 1UHIA 1A03A 3NSLA 2AAOA 2F3ZA 1CLBA 2K7DA 2MRDA 3IQQA 1B8CA 2BKHB 1XFXO 2H61A 1CFCA 1AUIB 1SPYA 1IGVA 1JSAA 2RGIA 1NIWA 1BJFA 2BCXA 1DJWA 2IS9A 3NSKA 2MJWB 2LMVA 4YBHB 1S1EA 2LNKA 3OB1B 4OKHA 1TOPA 2KOTA 3FS7A 1B8RA 3ZWHA 1IH0A 1WRLA 1M39A 2BBNA 1KK8B 1K94A 1KK8C 3AAKA 1CM1A 1TNXA 2PSRA 4YI8A 4DIRA 3DVEA 1G33A 3H4SE 1WLMA 2HQ8A 1KSOA 4OCIA 1NYAA 4YI9A 1FF1A 1DT7B 1A4PA 2KAVA 1C7WA 1N65A 1SYMA 3BUXB 4DUQA 1KK7Z 1PRWA 3AKAA 1CB1A 1CLLA 2KQ6A 3EVVA 3PN7C 3PN7B 2ZRSA 3D0YB 1IRJA 1AK8A 1L2OB 2EGDA 2HF5A 3I5HC 2LMUA 1BU3A 1DJXA 1J1DA 2BECA 2FOTA 1QIWA 1TTXA 3LLEA 4CPVA 3FWBA 2JPTA 1R2UA 4XJKB 4AQIA 3PLFB 1SK6D 3PSRA 5CSJA 1L7ZA 3EK7A 3CR2A 1F4OA 2K7OA 4JPZB 2PMYA 1J7QA 1BT6A 1IWQA 2MA2A 1SBJA 2I7AA 1PK0D 3GK2A 1B7TZ 2LCPA 1DJHA 1XO5A 2F33A 2LANA 5J3XA 2WNDA 1PULA 1OE9B 2KYCA 2KHNA 4M2OA 1X02A 1DJYA 1GJYA 1RTP1 2Y1MA 4GUKA 1M46A 3DF0A 3TZ1A 5DKQA 2ZRTA 1RECA 1CDNA 4PHMA 1PVBA 1CTRA 1IJ5A 1A29A 2JULA 2JWWA 2LP2A 1SKTA 1AP4A 2K0JA 1KWOC 3EVUA 2JOJA 4ZCVA 1CM4A 1PVAA 3AKBA 2Y1NA 3F45A 1K9UA 3BYAA 4XYNA 1DJZA 3EK4A 1J7RA 5AXIA 2I18A 2K2FA 3DVMA 5CPVA 1SL8A 2BE4A 4I5JA 3C1VA 4DS7A 2HPSA 5DKRA 4D1EA 2JZIA 2KI6C 1OQPA 1KFUL 2AUCA 3VRRA 3OB2B 4MVFA 3O4YA 2M1KB 1JF0A 1NPQA 1F71A 2MBXA 4HRGA 1YR5A 4HSZA 2PRUA 4MN0A 5KTYA 2JXLA 2JT3A 1U5IB 1DVIA 1J7PA 2PASA 3NXAA 2M8UA 1Y1AA 1GGZA 1QS7A 3JTDC 4U8DA 1JWDA 4PCWA 2E6WA 1OZSA 1UHJA 1AHRA 1RWYA 1DF0B 3NSIA 4M2QA 2JU0A 1S6IA 1MF8B 1DGUA 1N2DA 1SL9A 3BUOB 1SCMB 1SCMC 3D10A 4CFQA 3M0WA 1FBVA 2KYFA 2L4HA 1K8UA 1Y6WA 5G08A 4MZKA 2G2BA 1XFUO 3QRXA 2WORA 2WOSA 1V1FA 2M7NA 1OMVA 2LLTA 2KBIA 1KFXL 3TDIA 1BMOA 2LC5A 3D0YA 3OP0A 4OVNF 5FYXA 3WXAA 2G9BA 1IKUA 1BODA 2JNFA 1NCYA 1MUXA 1NX3A 1J55A 1VRKA 2KFHA 3HX4A 1B1GA 3BQ3A 4ETOA 2MLFC 2F2OA 3SG5A 4R1EA 2NCPA 1QLSA 1S3PA 2LHIA 1OMDA 3OHMB 3VRNA 1Y1UA 4OV2A 1CDPA 1DGVA 1TRFA 2LP3A 1OZOA 3I5GC 3I5GB 5HKYA 2L51A 5I2QA 4AQJA 5ER4X 3O6BA 1SRAA 1N0YA 2F3YA 2PALA 3BOWB 4PHKA 5HKWA 4AOMA 1BG1A 3OX6A 1CFFA 1ALVA 1ZFSA 3LK0A 1F55A 4GGFC 4HRHA 4I5KA 1F54A 3ZNIA 3SG3A 3BUNB 2M97A 2KBMA 1J7OA 3CS1A 1S5GZ 1YUSA 2HQWA 4MEWA 2KI4C 2KI4B 3EKHA 1TNWA 2ZNEA 2LUCA 1WY9A 4MSPA 1MHOA 1LA0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YGA A;  1F4Q A;  1JFK A;  3EVR A;  1M31 A;  2DOQ A;  4CID A;  2JRF A;  1EG4 A;  4I5N B;  1EL4 A;  1F70 A;  1NCZ A;  1PAL A;  2M9G A;  1L2O C;  2SCP A;  1BR1 B;  1IQ3 A;  2LUX A;  3CGA A;  1QXP A;  3TDZ A;  3JVT B;  3JVT C;  5JJG A;  2WC8 A;  3I5I C;  3I5I B;  1IQ5 A;  4FTG A;  5JOL A;  1QAS A;  1KK7 Y;  2BKI B;  1QTX A;  2L98 A;  2MAZ A;  4BY4 A;  5HLO A;  1A75 B;  1MWN A;  4USL A;  2WCB A;  1TNQ A;  4HRE E;  1RK9 A;  2L5X B;  2LVI A;  1KQM B;  1KQM C;  1ZMZ A;  1PSB A;  2K2A A;  2LV7 A;  4P2Y B;  2MLE C;  1NX1 A;  2P6B B;  5DKN A;  1BOC A;  1QX2 A;  1WRZ A;  2BBM A;  3A8R A;  3BUM B;  3PFV A;  1ALW A;  4GBA A;  3BXK A;  2NZ0 A;  3MSE B;  1FI6 A;  2CXJ A;  4YGE B;  5D7F A;  3KF9 A;  5PAL A;  3WHU B;  1DF0 A;  1Y0V H;  2KDH A;  2Y5I A;  3LL8 B;  4P5O E;  4DRW A;  4L9M A;  1C07 A;  1K90 D;  1GGW A;  2EHB A;  1FW4 A;  2OS8 C;  1SCV A;  2OS8 B;  2ZN9 A;  4MLW A;  2D8N A;  1M45 A;  4DCK A;  3CWG A;  2GV5 A;  1S6C A;  3LCP C;  1PSR A;  1B9A A;  1WDC B;  1B7T Y;  2KNE A;  2M3W A;  3PAT A;  1QJT A;  3O2P A;  5D69 A;  4MRY A;  3VGO A;  1S26 D;  1YTZ C;  1B8L A;  1UHH A;  3TUY B;  1LXF C;  1ODB A;  1DMO A;  3A4U B;  4YGB B;  5K89 A;  4WRI A;  1WRK A;  3TS5 B;  2M1U A;  5HYD A;  4WQ3 A;  2L4I A;  1GQM A;  2CTN A;  2JXC A;  3KPX A;  1JFJ A;  3E3R A;  1CNP A;  1W7J B;  4JWQ A;  1QVI Z;  2R2I A;  3EK8 A;  2LLS A;  3SG6 A;  1UUS A;  2JTT A;  1D1O A;  5F6T A;  1QV1 A;  1CDM A;  1EH2 A;  3SJS A;  3SG2 A;  1YVL A;  2ZN8 A;  4A4B A;  1FI5 A;  1H4B A;  3BOW A;  5AEQ A;  4GPL B;  2LVV A;  2KFG A;  1XK4 C;  1LVC D;  4GGF A;  3RM1 A;  3VRP A;  1IG5 A;  1ZAC A;  1HT9 A;  5B8I B;  1K2H A;  2B1U A;  4PE0 A;  1MXL C;  4ZCU A;  1RFJ A;  2GGM A;  2I94 A;  1B4C A;  1LIN A;  4PE4 A;  1MR8 A;  4GFT A;  5AFP A;  4PE1 A;  1KQV A;  2KGB C;  2Y4Q A;  3AAJ A;  1TCF A;  2M7L A;  3HCM A;  3PM8 A;  3IF7 A;  4XJK A;  4PE7 A;  4BY5 A;  4QJ5 B;  4CLN A;  1TIZ A;  1EXR A;  1XYD A;  4N5X A;  4QJ3 B;  2BCA A;  2JNX A;  1A75 A;  1JUO A;  2JC2 A;  2QAC A;  1NUB A;  1JF2 A;  1AJ5 A;  5AER A;  4TNC A;  3OX5 A;  4JQ0 D;  1XVJ A;  2K7B A;  4IL1 A;  1HQV A;  2KI6 D;  1K95 A;  1R6P A;  2O60 A;  4NDC A;  1YRU B;  1BR4 B;  2O5G A;  3DVK A;  1SY9 A;  5I2L A;  4ORA B;  3KEV A;  1G8I A;  1UP5 A;  3LK1 A;  3BUW B;  1C7V A;  3FIA A;  2V53 A;  1OSA A;  1YVH A;  3IQO A;  4Q04 A;  2F2P A;  1OMR A;  3SIA A;  4ORB B;  3SG7 A;  5KSZ A;  2JTZ A;  2EC6 B;  1LA3 A;  2EC6 C;  1YUR A;  1W7I B;  2KFF A;  2ZFD A;  4M2P A;  3GOF A;  4PDZ A;  1BF5 A;  1K93 D;  1SNL A;  2Q4U A;  5I2O A;  1QLK A;  5HLV A;  1EJ3 A;  1S6J A;  3PAL A;  1CFD A;  1UHK A;  4NDB A;  1S5G Y;  2VRG A;  5KU1 A;  1SR6 B;  1SR6 C;  4FQO A;  2LAP A;  4MRX A;  1NCX A;  2JT0 A;  5AAN A;  4GGN A;  2Q91 A;  4CFR A;  1U5I A;  1SMG A;  2JT8 A;  1JC2 A;  1G4Y R;  1AJ4 A;  1EG3 A;  1AVS A;  2LMT A;  1S36 A;  1CLM A;  5TNC A;  1V1G A;  2NXQ A;  1CDL A;  1DJG A;  3I5H B;  4OR9 B;  5CSN A;  1QAT A;  1KFU S;  1RRO A;  2M49 B;  1TNP A;  1UWO A;  2H61 C;  2HET A;  1NX0 A;  1QIV A;  2NLN A;  2JQ6 A;  2K8M B;  2OPO A;  1NSH A;  4WQ2 A;  2H2K A;  2NCO A;  2COL B;  1MXE A;  1MQ1 A;  1H8B A;  2FCD A;  1SL7 A;  1XK4 A;  1JBA A;  4C0J A;  1TN4 A;  4A4C A;  1CFP A;  1WDC C;  1A2X A;  1NWD A;  3CZT X;  3WHT B;  5BPJ A;  2KGR A;  1UUR A;  1M63 B;  2I2R E;  4C0K A;  3FWC A;  1Y1X A;  3TUY C;  1UHN A;  1ZUZ A;  2LLU A;  4GAO A;  1XFW O;  2CCM A;  4N1G A;  3DD4 A;  1K9P A;  5IBW A;  1YX8 A;  3TS5 C;  4PHJ A;  1OOJ A;  4GNK B;  3K21 A;  4PAL A;  3SG4 A;  1LKJ A;  1DTL A;  3SIB A;  2PVB A;  2FCE A;  1KWO B;  4ORC B;  1DJI A;  3O78 A;  3KO0 A;  4QJ4 B;  1F8H A;  2GGZ A;  2KSP A;  2QPT A;  3DVJ A;  3CR4 X;  1K9K A;  1YUT A;  4ICB A;  5CSI A;  2BE6 A;  2MHH A;  4YRU A;  4NQG A;  5I8N A;  1K96 A;  1YUU A;  4F0Z B;  5CSF A;  1TCO B;  2E30 A;  3GK4 X;  1NP8 A;  1KFX S;  4YGD B;  1NX2 A;  1QX5 B;  2LVJ A;  4PHN A;  3ICB A;  3NSO A;  1QX7 A;  4MZJ A;  2K7C A;  3CTN A;  2WCF A;  4I5L B;  4UPG A;  1QVI Y;  2AMI A;  2A4J A;  2LVK A;  3GK1 A;  2L2E A;  4MZL A;  1SW8 A;  1YRT B;  2KAY A;  2CBL A;  2OTG C;  2OTG B;  5ER5 A;  2ISD A;  1J1E A;  1CKK A;  2FJU B;  1KCY A;  1XA5 A;  5GQQ C;  1XFY O;  1YX7 A;  4MBE A;  1IJ6 A;  2F8P A;  2ZND A;  3I5F B;  3I5F C;  3JTD B;  1XFV O;  3RLZ A;  3WNX B;  3CR5 X;  3KHE A;  4NDD A;  2CNP A;  5HKZ A;  1B47 A;  2KAX A;  2LHL A;  3DF0 B;  1FPW A;  2ZKM X;  4E68 A;  3VRQ A;  2TN4 A;  2LM5 A;  1QV0 A;  2BCB A;  3CLN A;  3TDU A;  2M29 A;  2L0P A;  1Q80 A;  2WCE A;  4C0L A;  2BL0 B;  2BL0 C;  2KQY A;  3EKJ A;  1XFZ O;  4YGC B;  1WLZ A;  2CT9 A;  2SAS A;  4N1F A;  1E8A A;  1CMG A;  3VRO A;  2LE9 B;  1BLQ A;  1KSM A;  2L50 A;  1ZOT B;  2K61 A;  1RJV A;  1CMF A;  2M0R A;  1UHI A;  1A03 A;  3NSL A;  2AAO A;  2F3Z A;  1CLB A;  2K7D A;  2MRD A;  3IQQ A;  1B8C A;  2BKH B;  1XFX O;  2H61 A;  1CFC A;  1AUI B;  1SPY A;  1IGV A;  1JSA A;  2RGI A;  1NIW A;  1BJF A;  2BCX A;  1DJW A;  2IS9 A;  3NSK A;  2MJW B;  2LMV A;  4YBH B;  1S1E A;  2LNK A;  3OB1 B;  4OKH A;  1TOP A;  2KOT A;  3FS7 A;  1B8R A;  3ZWH A;  1IH0 A;  1WRL A;  1M39 A;  2BBN A;  1KK8 B;  1K94 A;  1KK8 C;  3AAK A;  1CM1 A;  1TNX A;  2PSR A;  4YI8 A;  4DIR A;  3DVE A;  1G33 A;  3H4S E;  1WLM A;  2HQ8 A;  1KSO A;  4OCI A;  1NYA A;  4YI9 A;  1FF1 A;  1DT7 B;  1A4P A;  2KAV A;  1C7W A;  1N65 A;  1SYM A;  3BUX B;  4DUQ A;  1KK7 Z;  1PRW A;  3AKA A;  1CB1 A;  1CLL A;  2KQ6 A;  3EVV A;  3PN7 C;  3PN7 B;  2ZRS A;  3D0Y B;  1IRJ A;  1AK8 A;  1L2O B;  2EGD A;  2HF5 A;  3I5H C;  2LMU A;  1BU3 A;  1DJX A;  1J1D A;  2BEC A;  2FOT A;  1QIW A;  1TTX A;  3LLE A;  4CPV A;  3FWB A;  2JPT A;  1R2U A;  4XJK B;  4AQI A;  3PLF B;  1SK6 D;  3PSR A;  5CSJ A;  1L7Z A;  3EK7 A;  3CR2 A;  1F4O A;  2K7O A;  4JPZ B;  2PMY A;  1J7Q A;  1BT6 A;  1IWQ A;  2MA2 A;  1SBJ A;  2I7A A;  1PK0 D;  3GK2 A;  1B7T Z;  2LCP A;  1DJH A;  1XO5 A;  2F33 A;  2LAN A;  5J3X A;  2WND A;  1PUL A;  1OE9 B;  2KYC A;  2KHN A;  4M2O A;  1X02 A;  1DJY A;  1GJY A;  1RTP 1;  2Y1M A;  4GUK A;  1M46 A;  3DF0 A;  3TZ1 A;  5DKQ A;  2ZRT A;  1REC A;  1CDN A;  4PHM A;  1PVB A;  1CTR A;  1IJ5 A;  1A29 A;  2JUL A;  2JWW A;  2LP2 A;  1SKT A;  1AP4 A;  2K0J A;  1KWO C;  3EVU A;  2JOJ A;  4ZCV A;  1CM4 A;  1PVA A;  3AKB A;  2Y1N A;  3F45 A;  1K9U A;  3BYA A;  4XYN A;  1DJZ A;  3EK4 A;  1J7R A;  5AXI A;  2I18 A;  2K2F A;  3DVM A;  5CPV A;  1SL8 A;  2BE4 A;  4I5J A;  3C1V A;  4DS7 A;  2HPS A;  5DKR A;  4D1E A;  2JZI A;  2KI6 C;  1OQP A;  1KFU L;  2AUC A;  3VRR A;  3OB2 B;  4MVF A;  3O4Y A;  2M1K B;  1JF0 A;  1NPQ A;  1F71 A;  2MBX A;  4HRG A;  1YR5 A;  4HSZ A;  2PRU A;  4MN0 A;  5KTY A;  2JXL A;  2JT3 A;  1U5I B;  1DVI A;  1J7P A;  2PAS A;  3NXA A;  2M8U A;  1Y1A A;  1GGZ A;  1QS7 A;  3JTD C;  4U8D A;  1JWD A;  4PCW A;  2E6W A;  1OZS A;  1UHJ A;  1AHR A;  1RWY A;  1DF0 B;  3NSI A;  4M2Q A;  2JU0 A;  1S6I A;  1MF8 B;  1DGU A;  1N2D A;  1SL9 A;  3BUO B;  1SCM B;  1SCM C;  3D10 A;  4CFQ A;  3M0W A;  1FBV A;  2KYF A;  2L4H A;  1K8U A;  1Y6W A;  5G08 A;  4MZK A;  2G2B A;  1XFU O;  3QRX A;  2WOR A;  2WOS A;  1V1F A;  2M7N A;  1OMV A;  2LLT A;  2KBI A;  1KFX L;  3TDI A;  1BMO A;  2LC5 A;  3D0Y A;  3OP0 A;  4OVN F;  5FYX A;  3WXA A;  2G9B A;  1IKU A;  1BOD A;  2JNF A;  1NCY A;  1MUX A;  1NX3 A;  1J55 A;  1VRK A;  2KFH A;  3HX4 A;  1B1G A;  3BQ3 A;  4ETO A;  2MLF C;  2F2O A;  3SG5 A;  4R1E A;  2NCP A;  1QLS A;  1S3P A;  2LHI A;  1OMD A;  3OHM B;  3VRN A;  1Y1U A;  4OV2 A;  1CDP A;  1DGV A;  1TRF A;  2LP3 A;  1OZO A;  3I5G C;  3I5G B;  5HKY A;  2L51 A;  5I2Q A;  4AQJ A;  5ER4 X;  3O6B A;  1SRA A;  1N0Y A;  2F3Y A;  2PAL A;  3BOW B;  4PHK A;  5HKW A;  4AOM A;  1BG1 A;  3OX6 A;  1CFF A;  1ALV A;  1ZFS A;  3LK0 A;  1F55 A;  4GGF C;  4HRH A;  4I5K A;  1F54 A;  3ZNI A;  3SG3 A;  3BUN B;  2M97 A;  2KBM A;  1J7O A;  3CS1 A;  1S5G Z;  1YUS A;  2HQW A;  4MEW A;  2KI4 C;  2KI4 B;  3EKH A;  1TNW A;  2ZNE A;  2LUC A;  1WY9 A;  4MSP A;  1MHO A;  1LA0 A; 
#chains in the Genus database with same CATH topology
 4YGA A;  1F4Q A;  1JFK A;  3EVR A;  1M31 A;  2DOQ A;  3SS3 A;  2JRF A;  4CID A;  1EG4 A;  4I5N B;  1EL4 A;  1F70 A;  1NCZ A;  1PAL A;  2M9G A;  1L2O C;  2SCP A;  1BR1 B;  3NHT A;  1IQ3 A;  2LUX A;  3CGA A;  1QXP A;  4IJ7 A;  3TDZ A;  3JVT B;  3JVT C;  5JJG A;  3BJH A;  2WC8 A;  3I5I C;  3I5I B;  3SS4 A;  1IQ5 A;  4FTG A;  5JOL A;  1QAS A;  1KK7 Y;  2BKI B;  1QTX A;  2L98 A;  2MAZ A;  4BY4 A;  5HLO A;  1A75 B;  1MWN A;  4USL A;  2WCB A;  1TNQ A;  4HRE E;  1RK9 A;  2L5X B;  2LVI A;  1DQE A;  1KQM B;  1KQM C;  2QDI A;  2WCJ A;  1ZMZ A;  1PSB A;  2K2A A;  2LV7 A;  4P2Y B;  1LS8 A;  1NX1 A;  1TWO A;  2MLE C;  2P6B B;  5DKN A;  1BOC A;  1QX2 A;  1WRZ A;  2BBM A;  3A8R A;  3BUM B;  3PFV A;  1ALW A;  4GBA A;  3BXK A;  3PJI A;  2NZ0 A;  3MSE B;  1FI6 A;  2CXJ A;  4YGE B;  5D7F A;  3VB1 A;  3KF9 A;  5PAL A;  3WHU B;  1DF0 A;  1ORG A;  1Y0V H;  2KDH A;  2Y5I A;  3LL8 B;  4P5O E;  4L9M A;  3SS5 A;  1K90 D;  4DRW A;  1C07 A;  2EHB A;  1FW4 A;  2OS8 C;  1SCV A;  2OS8 B;  2ZN9 A;  4JD9 A;  4MLW A;  2D8N A;  1M45 A;  3R1V A;  4DCK A;  3CWG A;  2GV5 A;  1S6C A;  3LCP C;  4INX A;  1PSR A;  1B9A A;  1WDC B;  3CZ0 A;  1B7T Y;  2KNE A;  2M3W A;  3PM2 A;  2YGU A;  3PAT A;  1QJT A;  3O2P A;  5D69 A;  4MRY A;  3OBV A;  3VGO A;  1S26 D;  1YTZ C;  4MEW A;  1B8L A;  1UHH A;  3TUY B;  1LXF C;  1ODB A;  1DMO A;  3A4U B;  4YGB B;  5K89 A;  4WRI A;  1WRK A;  3TS5 B;  2M1U A;  5HYD A;  4KYN A;  4WQ3 A;  2L4I A;  1GQM A;  2CTN A;  2JXC A;  3KPX A;  1JFJ A;  3E3R A;  1CNP A;  1W7J B;  3CZ1 A;  4JWQ A;  1QVI Z;  2R2I A;  3EK8 A;  2LLS A;  1OOI X;  3SG6 A;  1UUS A;  2JTT A;  1D1O A;  5F6T A;  1QV1 A;  1CDM A;  1W9Z A;  1EH2 A;  3SJS A;  3SG2 A;  1YVL A;  2ZN8 A;  4A4B A;  1FI5 A;  1H4B A;  3CZ2 A;  3BOW A;  5AEQ A;  4GPL B;  3D74 A;  2LVV A;  2KFG A;  1XK4 C;  1LVC D;  4GGF A;  3S0G A;  3RM1 A;  3VRP A;  1IG5 A;  1ZAC A;  1GGW A;  1HT9 A;  5B8I B;  1K2H A;  2B1U A;  1DC1 A;  2H8V A;  4PE0 A;  1MXL C;  4ZCU A;  1TUJ A;  1RFJ A;  2QEO A;  2GGM A;  2I94 A;  1B4C A;  1LIN A;  4PE4 A;  1MR8 A;  4GFT A;  5AFP A;  3UNW A;  1C3Y A;  2WCK A;  4PE1 A;  3FE9 A;  1KQV A;  2KGB C;  2Y4Q A;  3AAJ A;  1TCF A;  2M7L A;  3HCM A;  2GTE A;  2QEH A;  2KLD A;  3PM8 A;  3IF7 A;  4XJK A;  4PE7 A;  4BY5 A;  3EG5 B;  4QJ5 B;  4CLN A;  1TIZ A;  1EXR A;  1XYD A;  4N5X A;  3BFH A;  4QJ3 B;  1T14 A;  2BCA A;  2JNX A;  1A75 A;  1JUO A;  2JC2 A;  2QAC A;  1NUB A;  1JF2 A;  2KPH A;  1AJ5 A;  5AER A;  4TNC A;  3OX5 A;  3D75 A;  4JQ0 D;  1XVJ A;  2K7B A;  2PYQ A;  3RZS A;  4IL1 A;  1HQV A;  2KI6 D;  3DXL A;  1K95 A;  1R6P A;  3IVT A;  2O60 A;  4NDC A;  1YRU B;  1BR4 B;  2O5G A;  1DEL A;  1SY9 A;  3DVK A;  5I2L A;  4ORA B;  3KEV A;  1G8I A;  1UP5 A;  1Z4H A;  3FE6 A;  3LK1 A;  3BUW B;  1C7V A;  3FIA A;  2V53 A;  1OSA A;  1YVH A;  3IQO A;  4Q04 A;  2F2P A;  1OMR A;  3SIA A;  4ORB B;  3SG7 A;  5KSZ A;  2JTZ A;  2EC6 B;  1LA3 A;  2EC6 C;  1YUR A;  1W7I B;  2K60 A;  2KFF A;  2ZFD A;  3GOF A;  4M2P A;  4PDZ A;  3DYE A;  5FI6 A;  2PQL A;  1K93 D;  1SNL A;  1BF5 A;  2Q4U A;  5I2O A;  1QLK A;  5HLV A;  1EJ3 A;  1S6J A;  3PAL A;  1CFD A;  1UHK A;  4NDB A;  2BNX A;  1S5G Y;  2VRG A;  5KU1 A;  1SR6 B;  1SR6 C;  4FQO A;  2LAP A;  4MRX A;  1NCX A;  2JT0 A;  5AAN A;  4GGN A;  2Q91 A;  4CFR A;  1U5I A;  1SMG A;  2JT8 A;  1JC2 A;  1G4Y R;  1AJ4 A;  1EG3 A;  1AVS A;  2LMT A;  1S36 A;  2L5Y A;  1CLM A;  5TNC A;  1V1G A;  2NXQ A;  1CDL A;  1DJG A;  3I5H B;  4OR9 B;  5CSN A;  1QAT A;  1KFU S;  3DY9 A;  1RRO A;  2M49 B;  1TNP A;  1UWO A;  2H61 C;  2HET A;  1NX0 A;  1QIV A;  2NLN A;  3N7H A;  2JQ6 A;  2K8M B;  2OPO A;  1NSH A;  2WC5 A;  4WQ2 A;  2H2K A;  2NCO A;  2COL B;  1MXE A;  1MQ1 A;  1H8B A;  2FCD A;  1SL7 A;  1XK4 A;  1JBA A;  4C0J A;  5CSI A;  3D76 A;  1TN4 A;  4A4C A;  1CFP A;  1WDC C;  1A2X A;  1NWD A;  3CZT X;  3WHT B;  5BPJ A;  2KGR A;  1UUR A;  1M63 B;  2I2R E;  4C0K A;  3FWC A;  1Y1X A;  3TUY C;  1UHN A;  1ZUZ A;  2LLU A;  4GAO A;  1XFW O;  2CCM A;  4N1G A;  3DD4 A;  1K9P A;  2BAP A;  5IBW A;  1YX8 A;  3TS5 C;  4PHJ A;  1OOJ A;  4GNK B;  3K21 A;  1XFR A;  4PAL A;  3SG4 A;  1LKJ A;  1DTL A;  3SIB A;  2PVB A;  2FCE A;  1KWO B;  3R1O A;  1OOH A;  4ORC B;  1DJI A;  3O78 A;  1IIO A;  3KO0 A;  3L4A A;  4QJ4 B;  1F8H A;  2GGZ A;  1C3Z A;  2KSP A;  2QPT A;  3CR4 X;  1K9K A;  1YUT A;  3DVJ A;  4ICB A;  2BE6 A;  2MHH A;  5EL2 A;  4YRU A;  4NQG A;  5I8N A;  1K96 A;  1YUU A;  4F0Z B;  1SSE B;  5CSF A;  1TCO B;  2E30 A;  3GK4 X;  1NP8 A;  1KFX S;  4YGD B;  1NX2 A;  1Z2C B;  1QX5 B;  5I94 A;  2LVJ A;  4PHN A;  3ICB A;  3NSO A;  4FQT A;  1QX7 A;  4MZJ A;  2K7C A;  3CTN A;  2WCF A;  4I5L B;  4UPG A;  1QVI Y;  2AMI A;  2A4J A;  2L2C A;  2LVK A;  3CAB A;  2L2E A;  3GK1 A;  1SW8 A;  1YRT B;  2KAY A;  2CBL A;  2OTG C;  2OTG B;  4MZL A;  5ER5 A;  2ISD A;  1J1E A;  1CKK A;  2FJU B;  1KCY A;  1XA5 A;  5GQQ C;  1XFY O;  1YX7 A;  4MBE A;  4F7F A;  3S0F A;  5HL1 A;  1IJ6 A;  2F8P A;  2ZND A;  3I5F B;  3I5F C;  3JTD B;  1XFV O;  3RLZ A;  3WNX B;  3CR5 X;  3KHE A;  4M2O A;  4NDD A;  2CNP A;  5HKZ A;  1B47 A;  2KAX A;  2LHL A;  3DF0 B;  1FPW A;  2ZKM X;  4E68 A;  3VRQ A;  2TN4 A;  2LM5 A;  1QV0 A;  2BCB A;  1QWV A;  3CLN A;  3TDU A;  2M29 A;  2L0P A;  1Q80 A;  2WCE A;  3V2L A;  4C0L A;  2BL0 B;  2BL0 C;  2KQY A;  3EKJ A;  3O4X A;  1XFZ O;  4YGC B;  1WLZ A;  2CT9 A;  2SAS A;  4N1F A;  1E8A A;  1CMG A;  3VRO A;  2LE9 B;  1BLQ A;  1KSM A;  3S0B A;  2L50 A;  1ZOT B;  2K61 A;  1RJV A;  1CMF A;  2M0R A;  1UHI A;  1A03 A;  3BFB A;  3R72 A;  3NSL A;  2AAO A;  2F3Z A;  5FI7 A;  1CLB A;  2K7D A;  2MRD A;  3IQQ A;  1B8C A;  2BKH B;  1XFX O;  2H61 A;  1CFC A;  1AUI B;  1SPY A;  1IGV A;  1JSA A;  2FJY A;  2RGI A;  1NIW A;  1BJF A;  2BCX A;  1DJW A;  2IS9 A;  3NSK A;  2MJW B;  2LMV A;  4YBH B;  1S1E A;  2LNK A;  3OB1 B;  4OKH A;  1TOP A;  2KOT A;  3FS7 A;  1B8R A;  3ZWH A;  1IH0 A;  1WRL A;  3FE8 A;  1M39 A;  2BBN A;  1KK8 B;  1K94 A;  1KK8 C;  3AAK A;  3D77 A;  1CM1 A;  1TNX A;  2PSR A;  4YI8 A;  4DIR A;  3DVE A;  1TUZ A;  1G33 A;  3H4S E;  1WLM A;  2HQ8 A;  1KSO A;  4OCI A;  1NYA A;  4YI9 A;  1FF1 A;  1DT7 B;  1A4P A;  2KAV A;  1C7W A;  1N65 A;  1SYM A;  3BUX B;  4DUQ A;  1KK7 Z;  1PRW A;  3S0A A;  3AKA A;  1CB1 A;  1CLL A;  2KQ6 A;  2WCM A;  3EVV A;  3PN7 C;  3PN7 B;  2ZRS A;  3CYZ A;  3NHI A;  3D0Y B;  1IRJ A;  1AK8 A;  1L2O B;  2EGD A;  2HF5 A;  3I5H C;  5FI2 A;  2LMU A;  3D78 A;  1BU3 A;  1DJX A;  1J1D A;  2BEC A;  2FOT A;  1QIW A;  1TTX A;  3LLE A;  4CPV A;  3FWB A;  2JPT A;  1R2U A;  4XJK B;  4AQI A;  3PLF B;  1SK6 D;  3PSR A;  5CSJ A;  1L7Z A;  3EK7 A;  3CR2 A;  1F4O A;  2K7O A;  2JPO A;  4JPZ B;  2PMY A;  1J7Q A;  1BT6 A;  1IWQ A;  2MA2 A;  3CDN A;  1SBJ A;  2I7A A;  3L4L A;  1PK0 D;  2P70 A;  3GK2 A;  1B7T Z;  2LCP A;  1DJH A;  1XO5 A;  2F33 A;  2LAN A;  5DIC A;  5J3X A;  2WND A;  1PUL A;  1OOG A;  1OE9 B;  4OZD A;  2KYC A;  2KHN A;  2P71 A;  1X02 A;  1DJY A;  1GJY A;  1RTP 1;  2Y1M A;  4GUK A;  1M46 A;  3B87 A;  3DF0 A;  5DKQ A;  3TZ1 A;  3B88 A;  2ZRT A;  1REC A;  3QME A;  1CDN A;  4PHM A;  1PVB A;  2WC6 A;  1CTR A;  1IJ5 A;  1A29 A;  1GM0 A;  2JUL A;  2JWW A;  2LP2 A;  1SKT A;  1AP4 A;  2K0J A;  1KWO C;  3EVU A;  2JOJ A;  4ZCV A;  1CM4 A;  1PVA A;  3AKB A;  2Y1N A;  3F45 A;  1K9U A;  3BYA A;  4XYN A;  1DJZ A;  3EK4 A;  1J7R A;  5AXI A;  2I18 A;  2K2F A;  3DVM A;  5CPV A;  1SL8 A;  2BE4 A;  4I5J A;  3C1V A;  4DS7 A;  2HPS A;  5DKR A;  4D1E A;  2WCL A;  2JZI A;  2KI6 C;  3B86 A;  1OQP A;  1KFU L;  2AUC A;  3L47 A;  3VRR A;  3OB2 B;  4MVF A;  3O4Y A;  2M1K B;  1JF0 A;  1DEK A;  1NPQ A;  1F71 A;  2MBX A;  4HRG A;  1YR5 A;  4HSZ A;  3NGV A;  3K1E A;  2PRU A;  4MN0 A;  3S0E A;  5KTY A;  2JXL A;  2JT3 A;  1U5I B;  1DVI A;  1J7P A;  2PAS A;  3NXA A;  2M8U A;  1Y1A A;  1GGZ A;  1QS7 A;  2ERB A;  3JTD C;  2KLE A;  4U8D A;  1JWD A;  4PCW A;  2E6W A;  1OZS A;  1UHJ A;  1AHR A;  4INW A;  1RWY A;  1DF0 B;  3NSI A;  4M2Q A;  2JU0 A;  1OOF A;  1S6I A;  3UO9 A;  1MF8 B;  1DGU A;  1N2D A;  1SL9 A;  3BUO B;  2WCH A;  1SCM B;  1SCM C;  3D10 A;  4CFQ A;  3M0W A;  1FBV A;  2KYF A;  2L4H A;  2QEV A;  1K8U A;  1Y6W A;  5G08 A;  4MZK A;  4JKT A;  2G2B A;  1XFU O;  1OW4 A;  3QRX A;  2WOR A;  2WOS A;  1V1F A;  2M7N A;  1OMV A;  2LLT A;  2KBI A;  3OGN A;  1KFX L;  3TDI A;  1BMO A;  2LC5 A;  3D0Y A;  3OP0 A;  4OVN F;  5D3O A;  5FYX A;  2G9B A;  3WXA A;  1IKU A;  2JNF A;  1BOD A;  1NCY A;  1MUX A;  1NX3 A;  2QEB A;  1J55 A;  3BFA A;  1VRK A;  2KFH A;  3HX4 A;  1B1G A;  3BQ3 A;  4ETO A;  2MLF C;  1P28 A;  2F2O A;  3SG5 A;  4PT1 A;  4R1E A;  2NCP A;  1QLS A;  3S0D A;  1S3P A;  2LHI A;  1OMD A;  3DZT A;  3OHM B;  3D73 A;  3VRN A;  1Y1U A;  4OV2 A;  1CDP A;  1DGV A;  1TRF A;  2LP3 A;  1OZO A;  3I5G C;  3I5G B;  5HKY A;  2L51 A;  5I2Q A;  4AQJ A;  5ER4 X;  3O6B A;  1SRA A;  1N0Y A;  2F3Y A;  2PAL A;  3BOW B;  4PHK A;  3B7A A;  5HKW A;  4AOM A;  1BG1 A;  3OX6 A;  1CFF A;  1ALV A;  1ZFS A;  3LK0 A;  1F55 A;  3B6X A;  4GGF C;  4HRH A;  4I5K A;  1F54 A;  3R1P A;  3ZNI A;  3SG3 A;  3BUN B;  2M97 A;  2KBM A;  1J7O A;  3CS1 A;  1S5G Z;  1YUS A;  2HQW A;  3Q8I A;  2KI4 C;  2KI4 B;  3EKH A;  1TNW A;  2ZNE A;  2LUC A;  1WY9 A;  4MSP A;  1MHO A;  1LA0 A; 
#chains in the Genus database with same CATH homology
 4YGA A;  1F4Q A;  1JFK A;  3EVR A;  1M31 A;  2DOQ A;  4CID A;  2JRF A;  1EG4 A;  4I5N B;  1EL4 A;  1F70 A;  1NCZ A;  1PAL A;  2M9G A;  1L2O C;  2SCP A;  1BR1 B;  1IQ3 A;  2LUX A;  3CGA A;  1QXP A;  3TDZ A;  3JVT B;  3JVT C;  5JJG A;  2WC8 A;  3I5I C;  3I5I B;  1IQ5 A;  4FTG A;  5JOL A;  1QAS A;  1KK7 Y;  2BKI B;  1QTX A;  2L98 A;  2MAZ A;  4BY4 A;  5HLO A;  1A75 B;  1MWN A;  4USL A;  2WCB A;  1TNQ A;  4HRE E;  1RK9 A;  2L5X B;  2LVI A;  1KQM B;  1KQM C;  1ZMZ A;  1PSB A;  2K2A A;  2LV7 A;  4P2Y B;  2MLE C;  1NX1 A;  2P6B B;  5DKN A;  1BOC A;  1QX2 A;  1WRZ A;  2BBM A;  3A8R A;  3BUM B;  3PFV A;  1ALW A;  4GBA A;  3BXK A;  2NZ0 A;  3MSE B;  1FI6 A;  2CXJ A;  4YGE B;  5D7F A;  3KF9 A;  5PAL A;  3WHU B;  1DF0 A;  1Y0V H;  2KDH A;  2Y5I A;  3LL8 B;  4P5O E;  4DRW A;  4L9M A;  1C07 A;  1K90 D;  1GGW A;  2EHB A;  1FW4 A;  2OS8 C;  1SCV A;  2OS8 B;  2ZN9 A;  4MLW A;  2D8N A;  1M45 A;  4DCK A;  3CWG A;  2GV5 A;  1S6C A;  3LCP C;  1PSR A;  1B9A A;  1WDC B;  1B7T Y;  2KNE A;  2M3W A;  3PAT A;  1QJT A;  3O2P A;  5D69 A;  4MRY A;  3VGO A;  1S26 D;  1YTZ C;  1B8L A;  1UHH A;  3TUY B;  1LXF C;  1ODB A;  1DMO A;  3A4U B;  4YGB B;  5K89 A;  4WRI A;  1WRK A;  3TS5 B;  2M1U A;  5HYD A;  4WQ3 A;  2L4I A;  1GQM A;  2CTN A;  2JXC A;  3KPX A;  1JFJ A;  3E3R A;  1CNP A;  1W7J B;  4JWQ A;  1QVI Z;  2R2I A;  3EK8 A;  2LLS A;  3SG6 A;  1UUS A;  2JTT A;  1D1O A;  5F6T A;  1QV1 A;  1CDM A;  1EH2 A;  3SJS A;  3SG2 A;  1YVL A;  2ZN8 A;  4A4B A;  1FI5 A;  1H4B A;  3BOW A;  5AEQ A;  4GPL B;  2LVV A;  2KFG A;  1XK4 C;  1LVC D;  4GGF A;  3RM1 A;  3VRP A;  1IG5 A;  1ZAC A;  1HT9 A;  5B8I B;  1K2H A;  2B1U A;  4PE0 A;  1MXL C;  4ZCU A;  1RFJ A;  2GGM A;  2I94 A;  1B4C A;  1LIN A;  4PE4 A;  1MR8 A;  4GFT A;  5AFP A;  4PE1 A;  1KQV A;  2KGB C;  2Y4Q A;  3AAJ A;  1TCF A;  2M7L A;  3HCM A;  3PM8 A;  3IF7 A;  4XJK A;  4PE7 A;  4BY5 A;  4QJ5 B;  4CLN A;  1TIZ A;  1EXR A;  1XYD A;  4N5X A;  4QJ3 B;  2BCA A;  2JNX A;  1A75 A;  1JUO A;  2JC2 A;  2QAC A;  1NUB A;  1JF2 A;  1AJ5 A;  5AER A;  4TNC A;  3OX5 A;  4JQ0 D;  1XVJ A;  2K7B A;  4IL1 A;  1HQV A;  2KI6 D;  1K95 A;  1R6P A;  2O60 A;  4NDC A;  1YRU B;  1BR4 B;  2O5G A;  3DVK A;  1SY9 A;  5I2L A;  4ORA B;  3KEV A;  1G8I A;  1UP5 A;  3LK1 A;  3BUW B;  1C7V A;  3FIA A;  2V53 A;  1OSA A;  1YVH A;  3IQO A;  4Q04 A;  2F2P A;  1OMR A;  3SIA A;  4ORB B;  3SG7 A;  5KSZ A;  2JTZ A;  2EC6 B;  1LA3 A;  2EC6 C;  1YUR A;  1W7I B;  2KFF A;  2ZFD A;  4M2P A;  3GOF A;  4PDZ A;  1BF5 A;  1K93 D;  1SNL A;  2Q4U A;  5I2O A;  1QLK A;  5HLV A;  1EJ3 A;  1S6J A;  3PAL A;  1CFD A;  1UHK A;  4NDB A;  1S5G Y;  2VRG A;  5KU1 A;  1SR6 B;  1SR6 C;  4FQO A;  2LAP A;  4MRX A;  1NCX A;  2JT0 A;  5AAN A;  4GGN A;  2Q91 A;  4CFR A;  1U5I A;  1SMG A;  2JT8 A;  1JC2 A;  1G4Y R;  1AJ4 A;  1EG3 A;  1AVS A;  2LMT A;  1S36 A;  1CLM A;  5TNC A;  1V1G A;  2NXQ A;  1CDL A;  1DJG A;  3I5H B;  4OR9 B;  5CSN A;  1QAT A;  1KFU S;  1RRO A;  2M49 B;  1TNP A;  1UWO A;  2H61 C;  2HET A;  1NX0 A;  1QIV A;  2NLN A;  2JQ6 A;  2K8M B;  2OPO A;  1NSH A;  4WQ2 A;  2H2K A;  2NCO A;  2COL B;  1MXE A;  1MQ1 A;  1H8B A;  2FCD A;  1SL7 A;  1XK4 A;  1JBA A;  4C0J A;  1TN4 A;  4A4C A;  1CFP A;  1WDC C;  1A2X A;  1NWD A;  3CZT X;  3WHT B;  5BPJ A;  2KGR A;  1UUR A;  1M63 B;  2I2R E;  4C0K A;  3FWC A;  1Y1X A;  3TUY C;  1UHN A;  1ZUZ A;  2LLU A;  4GAO A;  1XFW O;  2CCM A;  4N1G A;  3DD4 A;  1K9P A;  5IBW A;  1YX8 A;  3TS5 C;  4PHJ A;  1OOJ A;  4GNK B;  3K21 A;  4PAL A;  3SG4 A;  1LKJ A;  1DTL A;  3SIB A;  2PVB A;  2FCE A;  1KWO B;  4ORC B;  1DJI A;  3O78 A;  3KO0 A;  4QJ4 B;  1F8H A;  2GGZ A;  2KSP A;  2QPT A;  3DVJ A;  3CR4 X;  1K9K A;  1YUT A;  4ICB A;  5CSI A;  2BE6 A;  2MHH A;  4YRU A;  4NQG A;  5I8N A;  1K96 A;  1YUU A;  4F0Z B;  5CSF A;  1TCO B;  2E30 A;  3GK4 X;  1NP8 A;  1KFX S;  4YGD B;  1NX2 A;  1QX5 B;  2LVJ A;  4PHN A;  3ICB A;  3NSO A;  1QX7 A;  4MZJ A;  2K7C A;  3CTN A;  2WCF A;  4I5L B;  4UPG A;  1QVI Y;  2AMI A;  2A4J A;  2LVK A;  3GK1 A;  2L2E A;  4MZL A;  1SW8 A;  1YRT B;  2KAY A;  2CBL A;  2OTG C;  2OTG B;  5ER5 A;  2ISD A;  1J1E A;  1CKK A;  2FJU B;  1KCY A;  1XA5 A;  5GQQ C;  1XFY O;  1YX7 A;  4MBE A;  1IJ6 A;  2F8P A;  2ZND A;  3I5F B;  3I5F C;  3JTD B;  1XFV O;  3RLZ A;  3WNX B;  3CR5 X;  3KHE A;  4NDD A;  2CNP A;  5HKZ A;  1B47 A;  2KAX A;  2LHL A;  3DF0 B;  1FPW A;  2ZKM X;  4E68 A;  3VRQ A;  2TN4 A;  2LM5 A;  1QV0 A;  2BCB A;  3CLN A;  3TDU A;  2M29 A;  2L0P A;  1Q80 A;  2WCE A;  4C0L A;  2BL0 B;  2BL0 C;  2KQY A;  3EKJ A;  1XFZ O;  4YGC B;  1WLZ A;  2CT9 A;  2SAS A;  4N1F A;  1E8A A;  1CMG A;  3VRO A;  2LE9 B;  1BLQ A;  1KSM A;  2L50 A;  1ZOT B;  2K61 A;  1RJV A;  1CMF A;  2M0R A;  1UHI A;  1A03 A;  3NSL A;  2AAO A;  2F3Z A;  1CLB A;  2K7D A;  2MRD A;  3IQQ A;  1B8C A;  2BKH B;  1XFX O;  2H61 A;  1CFC A;  1AUI B;  1SPY A;  1IGV A;  1JSA A;  2RGI A;  1NIW A;  1BJF A;  2BCX A;  1DJW A;  2IS9 A;  3NSK A;  2MJW B;  2LMV A;  4YBH B;  1S1E A;  2LNK A;  3OB1 B;  4OKH A;  1TOP A;  2KOT A;  3FS7 A;  1B8R A;  3ZWH A;  1IH0 A;  1WRL A;  1M39 A;  2BBN A;  1KK8 B;  1K94 A;  1KK8 C;  3AAK A;  1CM1 A;  1TNX A;  2PSR A;  4YI8 A;  4DIR A;  3DVE A;  1G33 A;  3H4S E;  1WLM A;  2HQ8 A;  1KSO A;  4OCI A;  1NYA A;  4YI9 A;  1FF1 A;  1DT7 B;  1A4P A;  2KAV A;  1C7W A;  1N65 A;  1SYM A;  3BUX B;  4DUQ A;  1KK7 Z;  1PRW A;  3AKA A;  1CB1 A;  1CLL A;  2KQ6 A;  3EVV A;  3PN7 C;  3PN7 B;  2ZRS A;  3D0Y B;  1IRJ A;  1AK8 A;  1L2O B;  2EGD A;  2HF5 A;  3I5H C;  2LMU A;  1BU3 A;  1DJX A;  1J1D A;  2BEC A;  2FOT A;  1QIW A;  1TTX A;  3LLE A;  4CPV A;  3FWB A;  2JPT A;  1R2U A;  4XJK B;  4AQI A;  3PLF B;  1SK6 D;  3PSR A;  5CSJ A;  1L7Z A;  3EK7 A;  3CR2 A;  1F4O A;  2K7O A;  4JPZ B;  2PMY A;  1J7Q A;  1BT6 A;  1IWQ A;  2MA2 A;  1SBJ A;  2I7A A;  1PK0 D;  3GK2 A;  1B7T Z;  2LCP A;  1DJH A;  1XO5 A;  2F33 A;  2LAN A;  5J3X A;  2WND A;  1PUL A;  1OE9 B;  2KYC A;  2KHN A;  4M2O A;  1X02 A;  1DJY A;  1GJY A;  1RTP 1;  2Y1M A;  4GUK A;  1M46 A;  3DF0 A;  3TZ1 A;  5DKQ A;  2ZRT A;  1REC A;  1CDN A;  4PHM A;  1PVB A;  1CTR A;  1IJ5 A;  1A29 A;  2JUL A;  2JWW A;  2LP2 A;  1SKT A;  1AP4 A;  2K0J A;  1KWO C;  3EVU A;  2JOJ A;  4ZCV A;  1CM4 A;  1PVA A;  3AKB A;  2Y1N A;  3F45 A;  1K9U A;  3BYA A;  4XYN A;  1DJZ A;  3EK4 A;  1J7R A;  5AXI A;  2I18 A;  2K2F A;  3DVM A;  5CPV A;  1SL8 A;  2BE4 A;  4I5J A;  3C1V A;  4DS7 A;  2HPS A;  5DKR A;  4D1E A;  2JZI A;  2KI6 C;  1OQP A;  1KFU L;  2AUC A;  3VRR A;  3OB2 B;  4MVF A;  3O4Y A;  2M1K B;  1JF0 A;  1NPQ A;  1F71 A;  2MBX A;  4HRG A;  1YR5 A;  4HSZ A;  2PRU A;  4MN0 A;  5KTY A;  2JXL A;  2JT3 A;  1U5I B;  1DVI A;  1J7P A;  2PAS A;  3NXA A;  2M8U A;  1Y1A A;  1GGZ A;  1QS7 A;  3JTD C;  4U8D A;  1JWD A;  4PCW A;  2E6W A;  1OZS A;  1UHJ A;  1AHR A;  1RWY A;  1DF0 B;  3NSI A;  4M2Q A;  2JU0 A;  1S6I A;  1MF8 B;  1DGU A;  1N2D A;  1SL9 A;  3BUO B;  1SCM B;  1SCM C;  3D10 A;  4CFQ A;  3M0W A;  1FBV A;  2KYF A;  2L4H A;  1K8U A;  1Y6W A;  5G08 A;  4MZK A;  2G2B A;  1XFU O;  3QRX A;  2WOR A;  2WOS A;  1V1F A;  2M7N A;  1OMV A;  2LLT A;  2KBI A;  1KFX L;  3TDI A;  1BMO A;  2LC5 A;  3D0Y A;  3OP0 A;  4OVN F;  5FYX A;  3WXA A;  2G9B A;  1IKU A;  1BOD A;  2JNF A;  1NCY A;  1MUX A;  1NX3 A;  1J55 A;  1VRK A;  2KFH A;  3HX4 A;  1B1G A;  3BQ3 A;  4ETO A;  2MLF C;  2F2O A;  3SG5 A;  4R1E A;  2NCP A;  1QLS A;  1S3P A;  2LHI A;  1OMD A;  3OHM B;  3VRN A;  1Y1U A;  4OV2 A;  1CDP A;  1DGV A;  1TRF A;  2LP3 A;  1OZO A;  3I5G C;  3I5G B;  5HKY A;  2L51 A;  5I2Q A;  4AQJ A;  5ER4 X;  3O6B A;  1SRA A;  1N0Y A;  2F3Y A;  2PAL A;  3BOW B;  4PHK A;  5HKW A;  4AOM A;  1BG1 A;  3OX6 A;  1CFF A;  1ALV A;  1ZFS A;  3LK0 A;  1F55 A;  4GGF C;  4HRH A;  4I5K A;  1F54 A;  3ZNI A;  3SG3 A;  3BUN B;  2M97 A;  2KBM A;  1J7O A;  3CS1 A;  1S5G Z;  1YUS A;  2HQW A;  4MEW A;  2KI4 C;  2KI4 B;  3EKH A;  1TNW A;  2ZNE A;  2LUC A;  1WY9 A;  4MSP A;  1MHO A;  1LA0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...