2LUXA

Calcium saturated form of human c85m s100a1 mutant
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
93
structure length
93
Chain Sequence
GSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVAMNNFFWENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Protein S100-A1
publication title Solution structure of human holo-S100A1 C85M mutant
rcsb
source organism Homo sapiens
total genus 27
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2luxA00
3FWCA 1QXPA 1KFUL 1CDLA 3ZNIA 3LCPC 1XFUO 3OHMB 1GGWA 4MRYA 2M49B 4YGEB 2FCDA 1DJZA 2KI4C 3IQOA 4YGDB 3DVKA 1RWYA 1M39A 3BUWB 3EKHA 1CFFA 1TNXA 1F8HA 5HKYA 2L51A 1IQ3A 2H2KA 2KYFA 1GJYA 1UURA 1YTZC 2F2PA 2KAXA 2MHHA 4YI8A 1YVLA 1B9AA 3DF0B 2KOTA 2Y5IA 1UHIA 1XK4A 3RM1A 4R1EA 3OB2B 4YGBB 4CFRA 2JT8A 1QASA 1WLZA 3I5HB 4NQGA 3I5FB 4YGCB 1FF1A 2LM5A 2ZNDA 2JU0A 1IKUA 1F55A 1J1EA 1V1GA 1PSBA 2LVJA 1G33A 2KFHA 1SL9A 2LLUA 1YUUA 2A4JA 1MUXA 1BJFA 1XFZO 4U8DA 3JTDB 1MHOA 3BUNB 1B8LA 2WCEA 1RROA 1QS7A 1SR6C 5CSFA 1NIWA 1NYAA 5KSZA 3SIBA 2NZ0A 1QJTA 1E8AA 5D7FA 1F4QA 2I2RE 4MZJA 3SIAA 4CPVA 4IL1A 2CBLA 2KGRA 2BE4A 1K2HA 5I2QA 3WNXB 4DCKA 1UHJA 1K96A 1KCYA 2SASA 3NSLA 5HKZA 2HQ8A 1K9PA 2LLSA 3AAJA 3IF7A 1K8UA 4GGNA 3TS5B 1CDNA 3BOWB 3DD4A 3M0WA 3DF0A 1SCVA 1S5GY 1TIZA 1ZUZA 4UPGA 4JPZB 1OOJA 1S6IA 2BCXA 2O5GA 1MXEA 3GOFA 2ZN8A 1NX2A 3ICBA 1PVBA 1JUOA 1AJ5A 1BT6A 1LA0A 1ZOTB 2LUXA 1S3PA 1W7IB 1J1DA 2LVKA 1WRKA 2NCPA 1BR4B 1OZOA 4GPLB 4P2YB 1TCFA 3TUYB 3HCMA 1L2OB 5GQQC 5I8NA 4MRXA 4OV2A 5J3XA 1N0YA 1SRAA 4HRGA 3D10A 4OVNF 1J55A 1LKJA 1QLSA 5F6TA 3TZ1A 1UHHA 4ORCB 3A4UB 1PULA 3A8RA 4I5NB 1G4YR 1PSRA 3KPXA 5DKNA 1HQVA 4OR9B 2F8PA 2L4HA 4PCWA 1AK8A 3EVVA 1UHNA 1NX1A 1UHKA 1QX7A 1TNWA 4NDDA 1KSMA 3EK8A 1AHRA 1M46A 1YR5A 4CIDA 1S1EA 3PN7B 1JSAA 1ZFSA 2F3ZA 1OZSA 1RECA 1SCMB 4HSZA 4USLA 2KFFA 2ZN9A 1DGVA 1OMRA 2LLTA 4PHMA 1OE9B 1FW4A 1MR8A 2HF5A 4P5OE 1ZMZA 3KF9A 1SL8A 2P6BB 2MLEC 3CZTX 1EG4A 1AJ4A 3MSEB 5AANA 4MN0A 1WDCB 3VRPA 3PALA 1TOPA 2ZNEA 1W7JB 2M0RA 3O78A 3I5IC 4JQ0D 2MRDA 4ORBB 2CXJA 4MEWA 2LMTA 3EVRA 2FJUB 4GGFA 2M3WA 2OS8C 1IGVA 2EC6B 1NWDA 1S26D 2ZKMX 1OQPA 2ISDA 1PVAA 4PHNA 1JF0A 2LNKA 1ALVA 1A75B 4I5KA 5JOLA 2PASA 2BL0B 3H4SE 4C0JA 2L0PA 5CSNA 1GQMA 3SG4A 4ETOA 2I7AA 2JWWA 1XO5A 2L4IA 4M2PA 2LAPA 1J7QA 1A4PA 1IG5A 2WNDA 2PSRA 1WRZA 3QRXA 3WHTB 2L98A 2HQWA 1B7TY 1CFPA 1CMFA 2CNPA 2K7OA 4DUQA 5K89A 4D1EA 2K61A 1KK8B 2F3YA 5D69A 1M45A 3JVTB 1K95A 3BQ3A 3C1VA 1C07A 2AMIA 1KQMC 3NSOA 1YVHA 2LHLA 1X02A 3NSIA 2MBXA 4QJ4B 1F71A 2BKHB 2LMUA 1K93D 3TDUA 5IBWA 1AVSA 2FOTA 3SG6A 2GGMA 3LK1A 4GNKB 1SMGA 1K90D 1YUTA 1IWQA 3SG5A 1SBJA 2BBMA 1A29A 2M1UA 3CR2A 1DJWA 2JXCA 2KGBC 2M29A 1KFXS 2V53A 4DRWA 2JT3A 4XYNA 2PMYA 1A75A 1OSAA 2LE9B 2K7DA 3I5FC 4QJ3B 1JBAA 4BY5A 1CB1A 1PALA 1S5GZ 2KQ6A 2ZRSA 4NDBA 1RJVA 2K8MB 3K21A 3OP0A 1N65A 3AAKA 1QLKA 1K94A 1CDPA 2KFGA 4CLNA 5I2OA 2JULA 1WY9A 1IH0A 2PRUA 1RK9A 1F70A 2IS9A 3RLZA 3CR4X 2ZFDA 4BY4A 3NXAA 1KSOA 1DJXA 3VRQA 1BG1A 2H61C 2Q91A 1TN4A 3CR5X 1CM1A 3VGOA 1NCYA 2K7BA 4MZLA 4XJKA 1KFXL 1TNQA 2JOJA 4AQJA 5ER4X 1U5IB 3OX5A 1EXRA 1KK7Y 3SG2A 1J7RA 3SJSA 1SKTA 1ALWA 1BODA 3F45A 4CFQA 1DF0B 1QATA 4F0ZB 4QJ5B 1Y0VH 3EK7A 2LP3A 1J7PA 1CM4A 1DJHA 1L2OC 1QIVA 1QX2A 1CLBA 1H4BA 1SNLA 2CT9A 4WQ3A 5I2LA 1NSHA 1SYMA 4OCIA 2EHBA 1A2XA 4YBHB 1OMVA 1ODBA 1BR1B 2K2FA 4MVFA 4MLWA 2JPTA 1OMDA 2LCPA 1LINA 1NPQA 2E30A 1L7ZA 3LLEA 2CTNA 4N5XA 1DGUA 1B8RA 4ICBA 1B4CA 1SL7A 4GFTA 1BLQA 5JJGA 2BBNA 3CWGA 1NP8A 1F54A 1IJ5A 2JT0A 1YUSA 2L50A 3PN7C 1U5IA 5PALA 1AUIB 1KWOC 5KTYA 2Y4QA 2H61A 5KU1A 3BUMB 3SG3A 4N1GA 2WCFA 2AAOA 4PDZA 4A4BA 1LVCD 2KI6C 1J7OA 1NX0A 2JNFA 2KQYA 1DF0A 1DTLA 3EKJA 1CNPA 1QV0A 1WDCC 3I5GC 2AUCA 2JC2A 1M63B 4PE0A 1K9UA 1B7TZ 3KEVA 1QV1A 1XFVO 2I18A 3HX4A 4JWQA 4MSPA 2M97A 2KAYA 5TNCA 4AQIA 1Y6WA 3DVMA 1WLMA 3I5IB 2E6WA 2Y1MA 2EC6C 2CCMA 2OTGB 1MXLC 4WQ2A 2OS8B 4YGAA 1G8IA 5HLOA 2MAZA 2BCAA 1UWOA 2O60A 4GAOA 1EL4A 1Y1UA 3AKAA 3CLNA 2R2IA 1CKKA 5DKQA 1Y1AA 4OKHA 5ER5A 1DT7B 2JTZA 4ORAB 2WCBA 2KBMA 1DVIA 2K7CA 1S6CA 2M7LA 1B47A 2TN4A 4ZCUA 2HETA 1DMOA 1NX3A 2KI4B 1QTXA 5AEQA 1CDMA 1LXFC 5CSIA 2KYCA 2KHNA 2MLFC 3BUOB 2L2EA 3D0YA 3GK4X 1KK8C 1MQ1A 1K9KA 4XJKB 1D1OA 1Q80A 3JVTC 1SW8A 1S36A 3VRNA 1CMGA 1JC2A 2PALA 3BYAA 1UUSA 2LMVA 1CFDA 1XFYO 2LANA 1KQMB 2BE6A 2B1UA 1YX7A 2GV5A 4N1FA 1C7VA 2LC5A 1IJ6A 1XYDA 4Q04A 5AXIA 3I5HC 5DKRA 5B8IB 1XFXO 4I5JA 1R2UA 3PLFB 5HYDA 4YRUA 2KI6D 3PSRA 2WOSA 1JF2A 1CTRA 3JTDC 3OB1B 4ZCVA 1FBVA 1HT9A 1SR6B 2G2BA 5AFPA 1NCXA 4DS7A 2HPSA 1R6PA 2NLNA 1RFJA 1KK7Z 1NUBA 2Q4UA 3SG7A 3FWBA 1MWNA 2M1KB 2ZRTA 3CTNA 3DVJA 1JWDA 1M31A 2COLB 4MZKA 2MJWB 1IQ5A 2QACA 3BXKA 1SK6D 3WXAA 3FS7A 4L9MA 2M7NA 2F33A 3KO0A 2LVVA 1FI6A 3AKBA 4GUKA 2GGZA 3VRRA 1KQVA 3IQQA 3TS5C 4C0LA 2NCOA 2DOQA 4PALA 4E68A 1QIWA 3GK1A 1JFKA 1QX5B 2D8NA 2LV7A 3ZWHA 1F4OA 4DIRA 2MA2A 3KHEA 4FTGA 4I5LB 5HKWA 1YRTB 3TDIA 2JXLA 2I94A 3TUYC 1JFJA 4M2QA 2SCPA 1CLMA 1ZACA 2M9GA 1YURA 2K0JA 3DVEA 4GGFC 3LL8B 1A03A 1BU3A 1RTP1 4PHJA 1NCZA 3E3RA 3O6BA 2EGDA 2FCEA 2BCBA 1IRJA 1PK0D 2JRFA 3GK2A 1QVIZ 2Y1NA 3EVUA 1PRWA 4TNCA 4C0KA 1B1GA 1GGZA 1B8CA 5HLVA 4PE7A 2KSPA 1DJYA 4NDCA 1FI5A 2JTTA 2RGIA 3LK0A 1SPYA 4HRHA 2KAVA 5CSJA 2F2OA 1TNPA 2BKIB 2G9BA 5G08A 1SCMC 1AP4A 4YI9A 1EH2A 3D0YB 2BECA 1DJGA 3EK4A 4PE1A 1XA5A 2JZIA 5BPJA 3CS1A 4M2OA 1WRLA 3TDZA 1QVIY 1FPWA 3PM8A 1KFUS 2LHIA 2K2AA 4GBAA 1BMOA 5AERA 3BOWA 3O4YA 3VROA 1BF5A 1CLLA 1XK4C 2WORA 3BUXB 1KWOB 1H8BA 2JNXA 3PFVA 2PVBA 1BOCA 1VRKA 2KDHA 1XVJA 2OPOA 1TCOB 1XFWO 1TRFA 1YX8A 4FQOA 4MBEA 1Y1XA 2LUCA 2NXQA 1YRUB 2JQ6A 1SY9A 2QPTA 1MF8B 2WC8A 3CGAA 2KBIA 1S6JA 4PHKA 3I5GB 2LP2A 1V1FA 3NSKA 2VRGA 4HREE 1EG3A 1EJ3A 3WHUB 1TTXA 3O2PA 1DJIA 1LA3A 2BL0C 3PATA 3FIAA 2L5XB 2OTGC 2LVIA 1CFCA 1UP5A 5CPVA 5FYXA 4AOMA 2KNEA 3OX6A 1N2DA 4WRIA 4A4CA 2M8UA 1C7WA 4PE4A
chains in the Genus database with same CATH superfamily
3FWCA 1QXPA 2KLEA 1KFUL 1CDLA 3ZNIA 3LCPC 1XFUO 3NGVA 3OHMB 1GGWA 4MRYA 2M49B 4YGEB 2FCDA 1DJZA 2KI4C 3SS3A 3IQOA 3OBVA 4YGDB 3DVKA 1RWYA 1M39A 3BUWB 3EKHA 1CFFA 1TNXA 1F8HA 5HKYA 2L51A 3K1EA 3R1PA 1IQ3A 2H2KA 5FI2A 2KYFA 1GJYA 4INWA 1UURA 1YTZC 2F2PA 2KAXA 2MHHA 4YI8A 1YVLA 1B9AA 3DF0B 3NHTA 3R1OA 2KOTA 2Y5IA 3S0BA 1UHIA 1XK4A 3RM1A 2BAPA 4R1EA 3OB2B 4YGBB 4OZDA 4CFRA 5I94A 2JT8A 1QASA 1WLZA 3I5HB 3L47A 3I5FB 4NQGA 1QWVA 4YGCB 2LM5A 2ZNDA 1FF1A 2JU0A 1IKUA 3S0EA 1F55A 1J1EA 5DICA 1V1GA 1PSBA 2LVJA 1G33A 2KFHA 1SL9A 2LLUA 1YUUA 2A4JA 1MUXA 1BJFA 1XFZO 4U8DA 3JTDB 1MHOA 3BUNB 1B8LA 2WCEA 1RROA 1QS7A 1SR6C 5CSFA 1NIWA 1NYAA 3DZTA 5KSZA 3SIBA 1GM0A 2NZ0A 1QJTA 1E8AA 5D7FA 1F4QA 2I2RE 4MZJA 3SIAA 4CPVA 4IL1A 2CBLA 2KGRA 2BE4A 1K2HA 1T14A 5I2QA 3WNXB 4DCKA 1UHJA 1K96A 1KCYA 2SASA 3NSLA 5HKZA 2HQ8A 1K9PA 2LLSA 2WC6A 3AAJA 3IF7A 1K8UA 4GGNA 3TS5B 1CDNA 3BOWB 4PT1A 3DD4A 3M0WA 3DF0A 1SCVA 1S5GY 1TIZA 1ZUZA 2QEOA 4UPGA 4JPZB 1OOJA 1S6IA 2BCXA 2O5GA 1MXEA 3GOFA 2ZN8A 1NX2A 3ICBA 1PVBA 1JUOA 1AJ5A 1BT6A 1LA0A 1ZOTB 2LUXA 1S3PA 1W7IB 1J1DA 2LVKA 1WRKA 2KLDA 2NCPA 1BR4B 1OZOA 4GPLB 4P2YB 1TCFA 3TUYB 2QEHA 3HCMA 1L2OB 1OOIX 1C3YA 5GQQC 5I8NA 4MRXA 4OV2A 5J3XA 1N0YA 1SRAA 4HRGA 3D10A 4OVNF 1J55A 1LKJA 1QLSA 5F6TA 3TZ1A 1UHHA 4ORCB 3A4UB 1OOHA 1PULA 3A8RA 4I5NB 1G4YR 1PSRA 4JKTA 3KPXA 5DKNA 1HQVA 4OR9B 2F8PA 2L4HA 4PCWA 1AK8A 3EVVA 1UHNA 4JD9A 1NX1A 1UHKA 1QX7A 1TNWA 4NDDA 1KSMA 3EK8A 1AHRA 1M46A 3D77A 1YR5A 4CIDA 1S1EA 3PN7B 4F7FA 1JSAA 1ZFSA 2F3ZA 1OZSA 1RECA 1SCMB 4HSZA 4USLA 2KFFA 2ZN9A 1DGVA 1OMRA 2LLTA 4PHMA 1OE9B 1FW4A 1MR8A 2HF5A 4P5OE 1ZMZA 3KF9A 1SL8A 1TUZA 1OOFA 2MLEC 2P6BB 1EG4A 2PYQA 3CZTX 1AJ4A 3MSEB 5AANA 4MN0A 1WDCB 3R72A 3VRPA 2QEBA 3PALA 1TOPA 2ZNEA 1W7JB 2M0RA 2PQLA 3D74A 3O78A 3I5IC 3IVTA 4JQ0D 2ERBA 2MRDA 4ORBB 2CXJA 4MEWA 2LMTA 3EVRA 2FJUB 4GGFA 2M3WA 2OS8C 1IGVA 2EC6B 3QMEA 1NWDA 1IIOA 1S26D 2ZKMX 1OQPA 2ISDA 1PVAA 1DELA 4PHNA 1JF0A 2LNKA 1ALVA 1A75B 4I5KA 5JOLA 2PASA 2BL0B 3H4SE 4C0JA 2L0PA 5CSNA 1GQMA 3SG4A 4ETOA 2I7AA 2JWWA 1XO5A 2L4IA 3SS5A 4M2PA 2LAPA 1J7QA 1A4PA 1IG5A 2WNDA 2PSRA 1WRZA 3QRXA 4FQTA 3WHTB 2L98A 5HL1A 2HQWA 1B7TY 1CFPA 1CMFA 3CYZA 2CNPA 2K7OA 4DUQA 5K89A 4D1EA 1DEKA 2K61A 1KK8B 2BNXA 2F3YA 5D69A 1M45A 1TWOA 3JVTB 1K95A 3BQ3A 3C1VA 2KPHA 1C07A 2AMIA 1KQMC 3CZ0A 3NSOA 1YVHA 2LHLA 1X02A 3NSIA 3BFHA 2MBXA 4QJ4B 2BKHB 2LMUA 1K93D 1F71A 3TDUA 5IBWA 1AVSA 2FOTA 3B6XA 3SG6A 2GGMA 3LK1A 4GNKB 1SMGA 2GTEA 2JPOA 3FE9A 1K90D 1YUTA 1IWQA 3BFBA 3SG5A 1SBJA 2BBMA 1A29A 2M1UA 3CR2A 1DJWA 2JXCA 2KGBC 2M29A 1KFXS 2V53A 3L4LA 4DRWA 2JT3A 4XYNA 2PMYA 3S0DA 1A75A 1OSAA 2LE9B 2K7DA 3I5FC 4QJ3B 1JBAA 4BY5A 1CB1A 1PALA 2WCKA 1S5GZ 2KQ6A 2ZRSA 4NDBA 1RJVA 2K8MB 3K21A 3OP0A 1N65A 2WC5A 1QLKA 3AAKA 3B87A 1K94A 3BFAA 1CDPA 2KFGA 4CLNA 3S0GA 5I2OA 2QDIA 3B88A 2JULA 1WY9A 1IH0A 2PRUA 1RK9A 1F70A 2IS9A 3RLZA 3CR4X 3D78A 2ZFDA 3UO9A 3NXAA 1KSOA 1DJXA 3VRQA 4BY4A 1BG1A 2H61C 2H8VA 2Q91A 2P71A 3V2LA 1TN4A 3CR5X 1CM1A 3VGOA 1NCYA 2K7BA 4MZLA 4XJKA 1KFXL 1TNQA 2JOJA 4AQJA 3OGNA 5ER4X 1U5IB 3OX5A 1EXRA 3UNWA 1KK7Y 5FI7A 1J7RA 3SG2A 3SJSA 1SKTA 1ALWA 3CDNA 2L5YA 1BODA 3F45A 4CFQA 1DF0B 1QATA 4F0ZB 4QJ5B 1Y0VH 3EK7A 2LP3A 1J7PA 1CM4A 1DJHA 1L2OC 1QIVA 1QX2A 1CLBA 1H4BA 1SNLA 2CT9A 4WQ3A 5I2LA 1NSHA 1SYMA 3FE6A 4OCIA 2EHBA 1A2XA 1SSEB 4YBHB 1OMVA 1ODBA 1BR1B 2K2FA 4MVFA 4MLWA 1P28A 2JPTA 1OMDA 2LCPA 1LINA 1NPQA 2E30A 1L7ZA 3LLEA 2CTNA 4N5XA 1DGUA 1B8RA 4ICBA 1B4CA 1SL7A 1XFRA 4GFTA 5JJGA 1BLQA 2BBNA 3CWGA 1NP8A 1F54A 1IJ5A 3DYEA 2JT0A 1YUSA 2L50A 3PN7C 1U5IA 5PALA 1AUIB 1KWOC 5KTYA 2WCJA 2Y4QA 2H61A 5KU1A 3BUMB 3SG3A 4N1GA 3SS4A 2WCFA 2AAOA 4PDZA 2QEVA 4A4BA 1LVCD 2KI6C 1J7OA 1NX0A 2JNFA 2WCMA 2KQYA 1DF0A 1DTLA 3R1VA 3EKJA 1CNPA 1QV0A 1WDCC 3I5GC 2AUCA 2JC2A 1M63B 4PE0A 1K9UA 1B7TZ 3KEVA 1QV1A 1XFVO 2I18A 3HX4A 4JWQA 4MSPA 2M97A 2KAYA 5TNCA 4AQIA 1Y6WA 3DVMA 1WLMA 3B86A 3I5IB 2E6WA 2Y1MA 2EC6C 2CCMA 2OTGB 1MXLC 4WQ2A 2OS8B 4YGAA 1G8IA 5HLOA 2MAZA 3FE8A 2BCAA 1UWOA 2O60A 4GAOA 1EL4A 1Y1UA 3AKAA 3CLNA 2R2IA 1CKKA 5DKQA 1Y1AA 4OKHA 5ER5A 3D73A 1DT7B 2JTZA 4ORAB 2WCBA 2KBMA 1DVIA 2K7CA 1S6CA 2M7LA 3BJHA 1B47A 2TN4A 3NHIA 4ZCUA 3CABA 2HETA 1DMOA 1NX3A 2KI4B 1QTXA 1TUJA 5AEQA 1CDMA 1LXFC 5CSIA 2KYCA 2KHNA 2MLFC 3BUOB 5FI6A 2L2EA 3D0YA 3GK4X 1KK8C 1MQ1A 3Q8IA 1K9KA 4INXA 4XJKB 1D1OA 1Q80A 3JVTC 1SW8A 1S36A 3VRNA 1CMGA 1JC2A 2PALA 3BYAA 1UUSA 2LMVA 1CFDA 1XFYO 2LANA 1KQMB 2BE6A 2B1UA 1LS8A 1YX7A 2GV5A 4N1FA 1C7VA 2LC5A 1IJ6A 1XYDA 4Q04A 5AXIA 3I5HC 1OOGA 5DKRA 5B8IB 1XFXO 4I5JA 1R2UA 3PLFB 5HYDA 4YRUA 2KI6D 3CZ2A 3PSRA 2WOSA 1JF2A 1CTRA 3JTDC 3OB1B 2YGUA 3DXLA 4ZCVA 1FBVA 1HT9A 1SR6B 2G2BA 5AFPA 1NCXA 4DS7A 2HPSA 1R6PA 2NLNA 2WCLA 1RFJA 1KK7Z 1NUBA 2Q4UA 3SG7A 2P70A 1Z4HA 1MWNA 2M1KB 2ZRTA 3CTNA 3DVJA 3FWBA 1JWDA 1M31A 2COLB 3D76A 3O4XA 4MZKA 2MJWB 1IQ5A 1W9ZA 2QACA 1SK6D 3BXKA 3FS7A 4L9MA 3WXAA 2M7NA 2F33A 3KO0A 3DY9A 2LVVA 1FI6A 3AKBA 4GUKA 2GGZA 3VRRA 1KQVA 3IQQA 3TS5C 4C0LA 2NCOA 2DOQA 4PALA 4E68A 1QIWA 3GK1A 1JFKA 1QX5B 2D8NA 2LV7A 3PM2A 3ZWHA 1F4OA 4DIRA 2MA2A 3CZ1A 3KHEA 2WCHA 4FTGA 4I5LB 5HKWA 1YRTB 1OW4A 3S0AA 1C3ZA 3TDIA 2JXLA 2I94A 3TUYC 1JFJA 4M2QA 2SCPA 1CLMA 1Z2CB 1ZACA 2M9GA 1YURA 2K0JA 3DVEA 4GGFC 3LL8B 1A03A 2L2CA 1BU3A 1RTP1 4PHJA 1NCZA 3E3RA 3O6BA 2EGDA 2FCEA 2BCBA 1IRJA 1PK0D 2JRFA 3GK2A 1QVIZ 2FJYA 3EG5B 2Y1NA 3EVUA 1PRWA 4TNCA 4C0KA 1B1GA 1GGZA 3PJIA 1B8CA 5HLVA 4PE7A 2KSPA 1DJYA 4NDCA 1FI5A 2JTTA 1DC1A 2RGIA 3LK0A 1SPYA 4HRHA 2KAVA 5CSJA 2F2OA 1TNPA 3L4AA 2BKIB 2G9BA 5G08A 1SCMC 1AP4A 4YI9A 1EH2A 3D0YB 4IJ7A 1ORGA 2BECA 1DJGA 3EK4A 5EL2A 4PE1A 1XA5A 2JZIA 5BPJA 3CS1A 4M2OA 1WRLA 3TDZA 1QVIY 1FPWA 3PM8A 1KFUS 2LHIA 2K2AA 4GBAA 1BMOA 5AERA 3BOWA 3O4YA 3VROA 1BF5A 3VB1A 1CLLA 1XK4C 2WORA 3BUXB 1KWOB 2K60A 1H8BA 2JNXA 3PFVA 2PVBA 1BOCA 1VRKA 2KDHA 3D75A 1XVJA 2OPOA 1TCOB 1XFWO 3N7HA 1TRFA 1YX8A 4FQOA 4MBEA 1Y1XA 2LUCA 2NXQA 3S0FA 1YRUB 3B7AA 2JQ6A 1SY9A 2QPTA 1MF8B 2WC8A 3CGAA 4KYNA 2KBIA 1S6JA 4PHKA 3I5GB 3RZSA 2LP2A 1V1FA 3NSKA 2VRGA 4HREE 1EG3A 1EJ3A 3WHUB 1TTXA 3O2PA 1DJIA 1LA3A 2BL0C 3PATA 3FIAA 2L5XB 2OTGC 2LVIA 1CFCA 1UP5A 5CPVA 1DQEA 5FYXA 5D3OA 2KNEA 4AOMA 3OX6A 1N2DA 4WRIA 4A4CA 2M8UA 1C7WA 4PE4A
chains in the Genus database with same CATH topology
3FWCA 1QXPA 1KFUL 1CDLA 3ZNIA 3LCPC 1XFUO 3OHMB 1GGWA 4MRYA 2M49B 4YGEB 2FCDA 1DJZA 2KI4C 3IQOA 4YGDB 3DVKA 1RWYA 1M39A 3BUWB 3EKHA 1CFFA 1TNXA 1F8HA 5HKYA 2L51A 1IQ3A 2H2KA 2KYFA 1GJYA 1UURA 1YTZC 2F2PA 2KAXA 2MHHA 4YI8A 1YVLA 1B9AA 3DF0B 2KOTA 2Y5IA 1UHIA 1XK4A 3RM1A 4R1EA 3OB2B 4YGBB 4CFRA 2JT8A 1QASA 1WLZA 3I5HB 4NQGA 3I5FB 4YGCB 1FF1A 2LM5A 2ZNDA 2JU0A 1IKUA 1F55A 1J1EA 1V1GA 1PSBA 2LVJA 1G33A 2KFHA 1SL9A 2LLUA 1YUUA 2A4JA 1MUXA 1BJFA 1XFZO 4U8DA 3JTDB 1MHOA 3BUNB 1B8LA 2WCEA 1RROA 1QS7A 1SR6C 5CSFA 1NIWA 1NYAA 5KSZA 3SIBA 2NZ0A 1QJTA 1E8AA 5D7FA 1F4QA 2I2RE 4MZJA 3SIAA 4CPVA 4IL1A 2CBLA 2KGRA 2BE4A 1K2HA 5I2QA 3WNXB 4DCKA 1UHJA 1K96A 1KCYA 2SASA 3NSLA 5HKZA 2HQ8A 1K9PA 2LLSA 3AAJA 3IF7A 1K8UA 4GGNA 3TS5B 1CDNA 3BOWB 3DD4A 3M0WA 3DF0A 1SCVA 1S5GY 1TIZA 1ZUZA 4UPGA 4JPZB 1OOJA 1S6IA 2BCXA 2O5GA 1MXEA 3GOFA 2ZN8A 1NX2A 3ICBA 1PVBA 1JUOA 1AJ5A 1BT6A 1LA0A 1ZOTB 2LUXA 1S3PA 1W7IB 1J1DA 2LVKA 1WRKA 2NCPA 1BR4B 1OZOA 4GPLB 4P2YB 1TCFA 3TUYB 3HCMA 1L2OB 5GQQC 5I8NA 4MRXA 4OV2A 5J3XA 1N0YA 1SRAA 4HRGA 3D10A 4OVNF 1J55A 1LKJA 1QLSA 5F6TA 3TZ1A 1UHHA 4ORCB 3A4UB 1PULA 3A8RA 4I5NB 1G4YR 1PSRA 3KPXA 5DKNA 1HQVA 4OR9B 2F8PA 2L4HA 4PCWA 1AK8A 3EVVA 1UHNA 1NX1A 1UHKA 1QX7A 1TNWA 4NDDA 1KSMA 3EK8A 1AHRA 1M46A 1YR5A 4CIDA 1S1EA 3PN7B 1JSAA 1ZFSA 2F3ZA 1OZSA 1RECA 1SCMB 4HSZA 4USLA 2KFFA 2ZN9A 1DGVA 1OMRA 2LLTA 4PHMA 1OE9B 1FW4A 1MR8A 2HF5A 4P5OE 1ZMZA 3KF9A 1SL8A 2P6BB 2MLEC 3CZTX 1EG4A 1AJ4A 3MSEB 5AANA 4MN0A 1WDCB 3VRPA 3PALA 1TOPA 2ZNEA 1W7JB 2M0RA 3O78A 3I5IC 4JQ0D 2MRDA 4ORBB 2CXJA 4MEWA 2LMTA 3EVRA 2FJUB 4GGFA 2M3WA 2OS8C 1IGVA 2EC6B 1NWDA 1S26D 2ZKMX 1OQPA 2ISDA 1PVAA 4PHNA 1JF0A 2LNKA 1ALVA 1A75B 4I5KA 5JOLA 2PASA 2BL0B 3H4SE 4C0JA 2L0PA 5CSNA 1GQMA 3SG4A 4ETOA 2I7AA 2JWWA 1XO5A 2L4IA 4M2PA 2LAPA 1J7QA 1A4PA 1IG5A 2WNDA 2PSRA 1WRZA 3QRXA 3WHTB 2L98A 2HQWA 1B7TY 1CFPA 1CMFA 2CNPA 2K7OA 4DUQA 5K89A 4D1EA 2K61A 1KK8B 2F3YA 5D69A 1M45A 3JVTB 1K95A 3BQ3A 3C1VA 1C07A 2AMIA 1KQMC 3NSOA 1YVHA 2LHLA 1X02A 3NSIA 2MBXA 4QJ4B 1F71A 2BKHB 2LMUA 1K93D 3TDUA 5IBWA 1AVSA 2FOTA 3SG6A 2GGMA 3LK1A 4GNKB 1SMGA 1K90D 1YUTA 1IWQA 3SG5A 1SBJA 2BBMA 1A29A 2M1UA 3CR2A 1DJWA 2JXCA 2KGBC 2M29A 1KFXS 2V53A 4DRWA 2JT3A 4XYNA 2PMYA 1A75A 1OSAA 2LE9B 2K7DA 3I5FC 4QJ3B 1JBAA 4BY5A 1CB1A 1PALA 1S5GZ 2KQ6A 2ZRSA 4NDBA 1RJVA 2K8MB 3K21A 3OP0A 1N65A 3AAKA 1QLKA 1K94A 1CDPA 2KFGA 4CLNA 5I2OA 2JULA 1WY9A 1IH0A 2PRUA 1RK9A 1F70A 2IS9A 3RLZA 3CR4X 2ZFDA 4BY4A 3NXAA 1KSOA 1DJXA 3VRQA 1BG1A 2H61C 2Q91A 1TN4A 3CR5X 1CM1A 3VGOA 1NCYA 2K7BA 4MZLA 4XJKA 1KFXL 1TNQA 2JOJA 4AQJA 5ER4X 1U5IB 3OX5A 1EXRA 1KK7Y 3SG2A 1J7RA 3SJSA 1SKTA 1ALWA 1BODA 3F45A 4CFQA 1DF0B 1QATA 4F0ZB 4QJ5B 1Y0VH 3EK7A 2LP3A 1J7PA 1CM4A 1DJHA 1L2OC 1QIVA 1QX2A 1CLBA 1H4BA 1SNLA 2CT9A 4WQ3A 5I2LA 1NSHA 1SYMA 4OCIA 2EHBA 1A2XA 4YBHB 1OMVA 1ODBA 1BR1B 2K2FA 4MVFA 4MLWA 2JPTA 1OMDA 2LCPA 1LINA 1NPQA 2E30A 1L7ZA 3LLEA 2CTNA 4N5XA 1DGUA 1B8RA 4ICBA 1B4CA 1SL7A 4GFTA 1BLQA 5JJGA 2BBNA 3CWGA 1NP8A 1F54A 1IJ5A 2JT0A 1YUSA 2L50A 3PN7C 1U5IA 5PALA 1AUIB 1KWOC 5KTYA 2Y4QA 2H61A 5KU1A 3BUMB 3SG3A 4N1GA 2WCFA 2AAOA 4PDZA 4A4BA 1LVCD 2KI6C 1J7OA 1NX0A 2JNFA 2KQYA 1DF0A 1DTLA 3EKJA 1CNPA 1QV0A 1WDCC 3I5GC 2AUCA 2JC2A 1M63B 4PE0A 1K9UA 1B7TZ 3KEVA 1QV1A 1XFVO 2I18A 3HX4A 4JWQA 4MSPA 2M97A 2KAYA 5TNCA 4AQIA 1Y6WA 3DVMA 1WLMA 3I5IB 2E6WA 2Y1MA 2EC6C 2CCMA 2OTGB 1MXLC 4WQ2A 2OS8B 4YGAA 1G8IA 5HLOA 2MAZA 2BCAA 1UWOA 2O60A 4GAOA 1EL4A 1Y1UA 3AKAA 3CLNA 2R2IA 1CKKA 5DKQA 1Y1AA 4OKHA 5ER5A 1DT7B 2JTZA 4ORAB 2WCBA 2KBMA 1DVIA 2K7CA 1S6CA 2M7LA 1B47A 2TN4A 4ZCUA 2HETA 1DMOA 1NX3A 2KI4B 1QTXA 5AEQA 1CDMA 1LXFC 5CSIA 2KYCA 2KHNA 2MLFC 3BUOB 2L2EA 3D0YA 3GK4X 1KK8C 1MQ1A 1K9KA 4XJKB 1D1OA 1Q80A 3JVTC 1SW8A 1S36A 3VRNA 1CMGA 1JC2A 2PALA 3BYAA 1UUSA 2LMVA 1CFDA 1XFYO 2LANA 1KQMB 2BE6A 2B1UA 1YX7A 2GV5A 4N1FA 1C7VA 2LC5A 1IJ6A 1XYDA 4Q04A 5AXIA 3I5HC 5DKRA 5B8IB 1XFXO 4I5JA 1R2UA 3PLFB 5HYDA 4YRUA 2KI6D 3PSRA 2WOSA 1JF2A 1CTRA 3JTDC 3OB1B 4ZCVA 1FBVA 1HT9A 1SR6B 2G2BA 5AFPA 1NCXA 4DS7A 2HPSA 1R6PA 2NLNA 1RFJA 1KK7Z 1NUBA 2Q4UA 3SG7A 3FWBA 1MWNA 2M1KB 2ZRTA 3CTNA 3DVJA 1JWDA 1M31A 2COLB 4MZKA 2MJWB 1IQ5A 2QACA 3BXKA 1SK6D 3WXAA 3FS7A 4L9MA 2M7NA 2F33A 3KO0A 2LVVA 1FI6A 3AKBA 4GUKA 2GGZA 3VRRA 1KQVA 3IQQA 3TS5C 4C0LA 2NCOA 2DOQA 4PALA 4E68A 1QIWA 3GK1A 1JFKA 1QX5B 2D8NA 2LV7A 3ZWHA 1F4OA 4DIRA 2MA2A 3KHEA 4FTGA 4I5LB 5HKWA 1YRTB 3TDIA 2JXLA 2I94A 3TUYC 1JFJA 4M2QA 2SCPA 1CLMA 1ZACA 2M9GA 1YURA 2K0JA 3DVEA 4GGFC 3LL8B 1A03A 1BU3A 1RTP1 4PHJA 1NCZA 3E3RA 3O6BA 2EGDA 2FCEA 2BCBA 1IRJA 1PK0D 2JRFA 3GK2A 1QVIZ 2Y1NA 3EVUA 1PRWA 4TNCA 4C0KA 1B1GA 1GGZA 1B8CA 5HLVA 4PE7A 2KSPA 1DJYA 4NDCA 1FI5A 2JTTA 2RGIA 3LK0A 1SPYA 4HRHA 2KAVA 5CSJA 2F2OA 1TNPA 2BKIB 2G9BA 5G08A 1SCMC 1AP4A 4YI9A 1EH2A 3D0YB 2BECA 1DJGA 3EK4A 4PE1A 1XA5A 2JZIA 5BPJA 3CS1A 4M2OA 1WRLA 3TDZA 1QVIY 1FPWA 3PM8A 1KFUS 2LHIA 2K2AA 4GBAA 1BMOA 5AERA 3BOWA 3O4YA 3VROA 1BF5A 1CLLA 1XK4C 2WORA 3BUXB 1KWOB 1H8BA 2JNXA 3PFVA 2PVBA 1BOCA 1VRKA 2KDHA 1XVJA 2OPOA 1TCOB 1XFWO 1TRFA 1YX8A 4FQOA 4MBEA 1Y1XA 2LUCA 2NXQA 1YRUB 2JQ6A 1SY9A 2QPTA 1MF8B 2WC8A 3CGAA 2KBIA 1S6JA 4PHKA 3I5GB 2LP2A 1V1FA 3NSKA 2VRGA 4HREE 1EG3A 1EJ3A 3WHUB 1TTXA 3O2PA 1DJIA 1LA3A 2BL0C 3PATA 3FIAA 2L5XB 2OTGC 2LVIA 1CFCA 1UP5A 5CPVA 5FYXA 4AOMA 2KNEA 3OX6A 1N2DA 4WRIA 4A4CA 2M8UA 1C7WA 4PE4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FWC A;  1QXP A;  1KFU L;  1CDL A;  3ZNI A;  3LCP C;  1XFU O;  3OHM B;  1GGW A;  4MRY A;  2M49 B;  4YGE B;  2FCD A;  1DJZ A;  2KI4 C;  3IQO A;  4YGD B;  3DVK A;  1RWY A;  1M39 A;  3BUW B;  3EKH A;  1CFF A;  1TNX A;  1F8H A;  5HKY A;  2L51 A;  1IQ3 A;  2H2K A;  2KYF A;  1GJY A;  1UUR A;  1YTZ C;  2F2P A;  2KAX A;  2MHH A;  4YI8 A;  1YVL A;  1B9A A;  3DF0 B;  2KOT A;  2Y5I A;  1UHI A;  1XK4 A;  3RM1 A;  4R1E A;  3OB2 B;  4YGB B;  4CFR A;  2JT8 A;  1QAS A;  1WLZ A;  3I5H B;  4NQG A;  3I5F B;  4YGC B;  1FF1 A;  2LM5 A;  2ZND A;  2JU0 A;  1IKU A;  1F55 A;  1J1E A;  1V1G A;  1PSB A;  2LVJ A;  1G33 A;  2KFH A;  1SL9 A;  2LLU A;  1YUU A;  2A4J A;  1MUX A;  1BJF A;  1XFZ O;  4U8D A;  3JTD B;  1MHO A;  3BUN B;  1B8L A;  2WCE A;  1RRO A;  1QS7 A;  1SR6 C;  5CSF A;  1NIW A;  1NYA A;  5KSZ A;  3SIB A;  2NZ0 A;  1QJT A;  1E8A A;  5D7F A;  1F4Q A;  2I2R E;  4MZJ A;  3SIA A;  4CPV A;  4IL1 A;  2CBL A;  2KGR A;  2BE4 A;  1K2H A;  5I2Q A;  3WNX B;  4DCK A;  1UHJ A;  1K96 A;  1KCY A;  2SAS A;  3NSL A;  5HKZ A;  2HQ8 A;  1K9P A;  2LLS A;  3AAJ A;  3IF7 A;  1K8U A;  4GGN A;  3TS5 B;  1CDN A;  3BOW B;  3DD4 A;  3M0W A;  3DF0 A;  1SCV A;  1S5G Y;  1TIZ A;  1ZUZ A;  4UPG A;  4JPZ B;  1OOJ A;  1S6I A;  2BCX A;  2O5G A;  1MXE A;  3GOF A;  2ZN8 A;  1NX2 A;  3ICB A;  1PVB A;  1JUO A;  1AJ5 A;  1BT6 A;  1LA0 A;  1ZOT B;  2LUX A;  1S3P A;  1W7I B;  1J1D A;  2LVK A;  1WRK A;  2NCP A;  1BR4 B;  1OZO A;  4GPL B;  4P2Y B;  1TCF A;  3TUY B;  3HCM A;  1L2O B;  5GQQ C;  5I8N A;  4MRX A;  4OV2 A;  5J3X A;  1N0Y A;  1SRA A;  4HRG A;  3D10 A;  4OVN F;  1J55 A;  1LKJ A;  1QLS A;  5F6T A;  3TZ1 A;  1UHH A;  4ORC B;  3A4U B;  1PUL A;  3A8R A;  4I5N B;  1G4Y R;  1PSR A;  3KPX A;  5DKN A;  1HQV A;  4OR9 B;  2F8P A;  2L4H A;  4PCW A;  1AK8 A;  3EVV A;  1UHN A;  1NX1 A;  1UHK A;  1QX7 A;  1TNW A;  4NDD A;  1KSM A;  3EK8 A;  1AHR A;  1M46 A;  1YR5 A;  4CID A;  1S1E A;  3PN7 B;  1JSA A;  1ZFS A;  2F3Z A;  1OZS A;  1REC A;  1SCM B;  4HSZ A;  4USL A;  2KFF A;  2ZN9 A;  1DGV A;  1OMR A;  2LLT A;  4PHM A;  1OE9 B;  1FW4 A;  1MR8 A;  2HF5 A;  4P5O E;  1ZMZ A;  3KF9 A;  1SL8 A;  2P6B B;  2MLE C;  3CZT X;  1EG4 A;  1AJ4 A;  3MSE B;  5AAN A;  4MN0 A;  1WDC B;  3VRP A;  3PAL A;  1TOP A;  2ZNE A;  1W7J B;  2M0R A;  3O78 A;  3I5I C;  4JQ0 D;  2MRD A;  4ORB B;  2CXJ A;  4MEW A;  2LMT A;  3EVR A;  2FJU B;  4GGF A;  2M3W A;  2OS8 C;  1IGV A;  2EC6 B;  1NWD A;  1S26 D;  2ZKM X;  1OQP A;  2ISD A;  1PVA A;  4PHN A;  1JF0 A;  2LNK A;  1ALV A;  1A75 B;  4I5K A;  5JOL A;  2PAS A;  2BL0 B;  3H4S E;  4C0J A;  2L0P A;  5CSN A;  1GQM A;  3SG4 A;  4ETO A;  2I7A A;  2JWW A;  1XO5 A;  2L4I A;  4M2P A;  2LAP A;  1J7Q A;  1A4P A;  1IG5 A;  2WND A;  2PSR A;  1WRZ A;  3QRX A;  3WHT B;  2L98 A;  2HQW A;  1B7T Y;  1CFP A;  1CMF A;  2CNP A;  2K7O A;  4DUQ A;  5K89 A;  4D1E A;  2K61 A;  1KK8 B;  2F3Y A;  5D69 A;  1M45 A;  3JVT B;  1K95 A;  3BQ3 A;  3C1V A;  1C07 A;  2AMI A;  1KQM C;  3NSO A;  1YVH A;  2LHL A;  1X02 A;  3NSI A;  2MBX A;  4QJ4 B;  1F71 A;  2BKH B;  2LMU A;  1K93 D;  3TDU A;  5IBW A;  1AVS A;  2FOT A;  3SG6 A;  2GGM A;  3LK1 A;  4GNK B;  1SMG A;  1K90 D;  1YUT A;  1IWQ A;  3SG5 A;  1SBJ A;  2BBM A;  1A29 A;  2M1U A;  3CR2 A;  1DJW A;  2JXC A;  2KGB C;  2M29 A;  1KFX S;  2V53 A;  4DRW A;  2JT3 A;  4XYN A;  2PMY A;  1A75 A;  1OSA A;  2LE9 B;  2K7D A;  3I5F C;  4QJ3 B;  1JBA A;  4BY5 A;  1CB1 A;  1PAL A;  1S5G Z;  2KQ6 A;  2ZRS A;  4NDB A;  1RJV A;  2K8M B;  3K21 A;  3OP0 A;  1N65 A;  3AAK A;  1QLK A;  1K94 A;  1CDP A;  2KFG A;  4CLN A;  5I2O A;  2JUL A;  1WY9 A;  1IH0 A;  2PRU A;  1RK9 A;  1F70 A;  2IS9 A;  3RLZ A;  3CR4 X;  2ZFD A;  4BY4 A;  3NXA A;  1KSO A;  1DJX A;  3VRQ A;  1BG1 A;  2H61 C;  2Q91 A;  1TN4 A;  3CR5 X;  1CM1 A;  3VGO A;  1NCY A;  2K7B A;  4MZL A;  4XJK A;  1KFX L;  1TNQ A;  2JOJ A;  4AQJ A;  5ER4 X;  1U5I B;  3OX5 A;  1EXR A;  1KK7 Y;  3SG2 A;  1J7R A;  3SJS A;  1SKT A;  1ALW A;  1BOD A;  3F45 A;  4CFQ A;  1DF0 B;  1QAT A;  4F0Z B;  4QJ5 B;  1Y0V H;  3EK7 A;  2LP3 A;  1J7P A;  1CM4 A;  1DJH A;  1L2O C;  1QIV A;  1QX2 A;  1CLB A;  1H4B A;  1SNL A;  2CT9 A;  4WQ3 A;  5I2L A;  1NSH A;  1SYM A;  4OCI A;  2EHB A;  1A2X A;  4YBH B;  1OMV A;  1ODB A;  1BR1 B;  2K2F A;  4MVF A;  4MLW A;  2JPT A;  1OMD A;  2LCP A;  1LIN A;  1NPQ A;  2E30 A;  1L7Z A;  3LLE A;  2CTN A;  4N5X A;  1DGU A;  1B8R A;  4ICB A;  1B4C A;  1SL7 A;  4GFT A;  1BLQ A;  5JJG A;  2BBN A;  3CWG A;  1NP8 A;  1F54 A;  1IJ5 A;  2JT0 A;  1YUS A;  2L50 A;  3PN7 C;  1U5I A;  5PAL A;  1AUI B;  1KWO C;  5KTY A;  2Y4Q A;  2H61 A;  5KU1 A;  3BUM B;  3SG3 A;  4N1G A;  2WCF A;  2AAO A;  4PDZ A;  4A4B A;  1LVC D;  2KI6 C;  1J7O A;  1NX0 A;  2JNF A;  2KQY A;  1DF0 A;  1DTL A;  3EKJ A;  1CNP A;  1QV0 A;  1WDC C;  3I5G C;  2AUC A;  2JC2 A;  1M63 B;  4PE0 A;  1K9U A;  1B7T Z;  3KEV A;  1QV1 A;  1XFV O;  2I18 A;  3HX4 A;  4JWQ A;  4MSP A;  2M97 A;  2KAY A;  5TNC A;  4AQI A;  1Y6W A;  3DVM A;  1WLM A;  3I5I B;  2E6W A;  2Y1M A;  2EC6 C;  2CCM A;  2OTG B;  1MXL C;  4WQ2 A;  2OS8 B;  4YGA A;  1G8I A;  5HLO A;  2MAZ A;  2BCA A;  1UWO A;  2O60 A;  4GAO A;  1EL4 A;  1Y1U A;  3AKA A;  3CLN A;  2R2I A;  1CKK A;  5DKQ A;  1Y1A A;  4OKH A;  5ER5 A;  1DT7 B;  2JTZ A;  4ORA B;  2WCB A;  2KBM A;  1DVI A;  2K7C A;  1S6C A;  2M7L A;  1B47 A;  2TN4 A;  4ZCU A;  2HET A;  1DMO A;  1NX3 A;  2KI4 B;  1QTX A;  5AEQ A;  1CDM A;  1LXF C;  5CSI A;  2KYC A;  2KHN A;  2MLF C;  3BUO B;  2L2E A;  3D0Y A;  3GK4 X;  1KK8 C;  1MQ1 A;  1K9K A;  4XJK B;  1D1O A;  1Q80 A;  3JVT C;  1SW8 A;  1S36 A;  3VRN A;  1CMG A;  1JC2 A;  2PAL A;  3BYA A;  1UUS A;  2LMV A;  1CFD A;  1XFY O;  2LAN A;  1KQM B;  2BE6 A;  2B1U A;  1YX7 A;  2GV5 A;  4N1F A;  1C7V A;  2LC5 A;  1IJ6 A;  1XYD A;  4Q04 A;  5AXI A;  3I5H C;  5DKR A;  5B8I B;  1XFX O;  4I5J A;  1R2U A;  3PLF B;  5HYD A;  4YRU A;  2KI6 D;  3PSR A;  2WOS A;  1JF2 A;  1CTR A;  3JTD C;  3OB1 B;  4ZCV A;  1FBV A;  1HT9 A;  1SR6 B;  2G2B A;  5AFP A;  1NCX A;  4DS7 A;  2HPS A;  1R6P A;  2NLN A;  1RFJ A;  1KK7 Z;  1NUB A;  2Q4U A;  3SG7 A;  3FWB A;  1MWN A;  2M1K B;  2ZRT A;  3CTN A;  3DVJ A;  1JWD A;  1M31 A;  2COL B;  4MZK A;  2MJW B;  1IQ5 A;  2QAC A;  3BXK A;  1SK6 D;  3WXA A;  3FS7 A;  4L9M A;  2M7N A;  2F33 A;  3KO0 A;  2LVV A;  1FI6 A;  3AKB A;  4GUK A;  2GGZ A;  3VRR A;  1KQV A;  3IQQ A;  3TS5 C;  4C0L A;  2NCO A;  2DOQ A;  4PAL A;  4E68 A;  1QIW A;  3GK1 A;  1JFK A;  1QX5 B;  2D8N A;  2LV7 A;  3ZWH A;  1F4O A;  4DIR A;  2MA2 A;  3KHE A;  4FTG A;  4I5L B;  5HKW A;  1YRT B;  3TDI A;  2JXL A;  2I94 A;  3TUY C;  1JFJ A;  4M2Q A;  2SCP A;  1CLM A;  1ZAC A;  2M9G A;  1YUR A;  2K0J A;  3DVE A;  4GGF C;  3LL8 B;  1A03 A;  1BU3 A;  1RTP 1;  4PHJ A;  1NCZ A;  3E3R A;  3O6B A;  2EGD A;  2FCE A;  2BCB A;  1IRJ A;  1PK0 D;  2JRF A;  3GK2 A;  1QVI Z;  2Y1N A;  3EVU A;  1PRW A;  4TNC A;  4C0K A;  1B1G A;  1GGZ A;  1B8C A;  5HLV A;  4PE7 A;  2KSP A;  1DJY A;  4NDC A;  1FI5 A;  2JTT A;  2RGI A;  3LK0 A;  1SPY A;  4HRH A;  2KAV A;  5CSJ A;  2F2O A;  1TNP A;  2BKI B;  2G9B A;  5G08 A;  1SCM C;  1AP4 A;  4YI9 A;  1EH2 A;  3D0Y B;  2BEC A;  1DJG A;  3EK4 A;  4PE1 A;  1XA5 A;  2JZI A;  5BPJ A;  3CS1 A;  4M2O A;  1WRL A;  3TDZ A;  1QVI Y;  1FPW A;  3PM8 A;  1KFU S;  2LHI A;  2K2A A;  4GBA A;  1BMO A;  5AER A;  3BOW A;  3O4Y A;  3VRO A;  1BF5 A;  1CLL A;  1XK4 C;  2WOR A;  3BUX B;  1KWO B;  1H8B A;  2JNX A;  3PFV A;  2PVB A;  1BOC A;  1VRK A;  2KDH A;  1XVJ A;  2OPO A;  1TCO B;  1XFW O;  1TRF A;  1YX8 A;  4FQO A;  4MBE A;  1Y1X A;  2LUC A;  2NXQ A;  1YRU B;  2JQ6 A;  1SY9 A;  2QPT A;  1MF8 B;  2WC8 A;  3CGA A;  2KBI A;  1S6J A;  4PHK A;  3I5G B;  2LP2 A;  1V1F A;  3NSK A;  2VRG A;  4HRE E;  1EG3 A;  1EJ3 A;  3WHU B;  1TTX A;  3O2P A;  1DJI A;  1LA3 A;  2BL0 C;  3PAT A;  3FIA A;  2L5X B;  2OTG C;  2LVI A;  1CFC A;  1UP5 A;  5CPV A;  5FYX A;  4AOM A;  2KNE A;  3OX6 A;  1N2D A;  4WRI A;  4A4C A;  2M8U A;  1C7W A;  4PE4 A; 
#chains in the Genus database with same CATH topology
 3FWC A;  1QXP A;  2KLE A;  1KFU L;  1CDL A;  3ZNI A;  3LCP C;  1XFU O;  3NGV A;  3OHM B;  1GGW A;  4MRY A;  2M49 B;  4YGE B;  2FCD A;  1DJZ A;  2KI4 C;  3SS3 A;  3IQO A;  3OBV A;  4YGD B;  3DVK A;  1RWY A;  1M39 A;  3BUW B;  3EKH A;  1CFF A;  1TNX A;  1F8H A;  5HKY A;  2L51 A;  3K1E A;  3R1P A;  1IQ3 A;  2H2K A;  5FI2 A;  2KYF A;  1GJY A;  4INW A;  1UUR A;  1YTZ C;  2F2P A;  2KAX A;  2MHH A;  4YI8 A;  1YVL A;  1B9A A;  3DF0 B;  3NHT A;  3R1O A;  2KOT A;  2Y5I A;  3S0B A;  1UHI A;  1XK4 A;  3RM1 A;  2BAP A;  4R1E A;  3OB2 B;  4YGB B;  4OZD A;  4CFR A;  5I94 A;  2JT8 A;  1QAS A;  1WLZ A;  3I5H B;  3L47 A;  3I5F B;  4NQG A;  1QWV A;  4YGC B;  2LM5 A;  2ZND A;  1FF1 A;  2JU0 A;  1IKU A;  3S0E A;  1F55 A;  1J1E A;  5DIC A;  1V1G A;  1PSB A;  2LVJ A;  1G33 A;  2KFH A;  1SL9 A;  2LLU A;  1YUU A;  2A4J A;  1MUX A;  1BJF A;  1XFZ O;  4U8D A;  3JTD B;  1MHO A;  3BUN B;  1B8L A;  2WCE A;  1RRO A;  1QS7 A;  1SR6 C;  5CSF A;  1NIW A;  1NYA A;  3DZT A;  5KSZ A;  3SIB A;  1GM0 A;  2NZ0 A;  1QJT A;  1E8A A;  5D7F A;  1F4Q A;  2I2R E;  4MZJ A;  3SIA A;  4CPV A;  4IL1 A;  2CBL A;  2KGR A;  2BE4 A;  1K2H A;  1T14 A;  5I2Q A;  3WNX B;  4DCK A;  1UHJ A;  1K96 A;  1KCY A;  2SAS A;  3NSL A;  5HKZ A;  2HQ8 A;  1K9P A;  2LLS A;  2WC6 A;  3AAJ A;  3IF7 A;  1K8U A;  4GGN A;  3TS5 B;  1CDN A;  3BOW B;  4PT1 A;  3DD4 A;  3M0W A;  3DF0 A;  1SCV A;  1S5G Y;  1TIZ A;  1ZUZ A;  2QEO A;  4UPG A;  4JPZ B;  1OOJ A;  1S6I A;  2BCX A;  2O5G A;  1MXE A;  3GOF A;  2ZN8 A;  1NX2 A;  3ICB A;  1PVB A;  1JUO A;  1AJ5 A;  1BT6 A;  1LA0 A;  1ZOT B;  2LUX A;  1S3P A;  1W7I B;  1J1D A;  2LVK A;  1WRK A;  2KLD A;  2NCP A;  1BR4 B;  1OZO A;  4GPL B;  4P2Y B;  1TCF A;  3TUY B;  2QEH A;  3HCM A;  1L2O B;  1OOI X;  1C3Y A;  5GQQ C;  5I8N A;  4MRX A;  4OV2 A;  5J3X A;  1N0Y A;  1SRA A;  4HRG A;  3D10 A;  4OVN F;  1J55 A;  1LKJ A;  1QLS A;  5F6T A;  3TZ1 A;  1UHH A;  4ORC B;  3A4U B;  1OOH A;  1PUL A;  3A8R A;  4I5N B;  1G4Y R;  1PSR A;  4JKT A;  3KPX A;  5DKN A;  1HQV A;  4OR9 B;  2F8P A;  2L4H A;  4PCW A;  1AK8 A;  3EVV A;  1UHN A;  4JD9 A;  1NX1 A;  1UHK A;  1QX7 A;  1TNW A;  4NDD A;  1KSM A;  3EK8 A;  1AHR A;  1M46 A;  3D77 A;  1YR5 A;  4CID A;  1S1E A;  3PN7 B;  4F7F A;  1JSA A;  1ZFS A;  2F3Z A;  1OZS A;  1REC A;  1SCM B;  4HSZ A;  4USL A;  2KFF A;  2ZN9 A;  1DGV A;  1OMR A;  2LLT A;  4PHM A;  1OE9 B;  1FW4 A;  1MR8 A;  2HF5 A;  4P5O E;  1ZMZ A;  3KF9 A;  1SL8 A;  1TUZ A;  1OOF A;  2MLE C;  2P6B B;  1EG4 A;  2PYQ A;  3CZT X;  1AJ4 A;  3MSE B;  5AAN A;  4MN0 A;  1WDC B;  3R72 A;  3VRP A;  2QEB A;  3PAL A;  1TOP A;  2ZNE A;  1W7J B;  2M0R A;  2PQL A;  3D74 A;  3O78 A;  3I5I C;  3IVT A;  4JQ0 D;  2ERB A;  2MRD A;  4ORB B;  2CXJ A;  4MEW A;  2LMT A;  3EVR A;  2FJU B;  4GGF A;  2M3W A;  2OS8 C;  1IGV A;  2EC6 B;  3QME A;  1NWD A;  1IIO A;  1S26 D;  2ZKM X;  1OQP A;  2ISD A;  1PVA A;  1DEL A;  4PHN A;  1JF0 A;  2LNK A;  1ALV A;  1A75 B;  4I5K A;  5JOL A;  2PAS A;  2BL0 B;  3H4S E;  4C0J A;  2L0P A;  5CSN A;  1GQM A;  3SG4 A;  4ETO A;  2I7A A;  2JWW A;  1XO5 A;  2L4I A;  3SS5 A;  4M2P A;  2LAP A;  1J7Q A;  1A4P A;  1IG5 A;  2WND A;  2PSR A;  1WRZ A;  3QRX A;  4FQT A;  3WHT B;  2L98 A;  5HL1 A;  2HQW A;  1B7T Y;  1CFP A;  1CMF A;  3CYZ A;  2CNP A;  2K7O A;  4DUQ A;  5K89 A;  4D1E A;  1DEK A;  2K61 A;  1KK8 B;  2BNX A;  2F3Y A;  5D69 A;  1M45 A;  1TWO A;  3JVT B;  1K95 A;  3BQ3 A;  3C1V A;  2KPH A;  1C07 A;  2AMI A;  1KQM C;  3CZ0 A;  3NSO A;  1YVH A;  2LHL A;  1X02 A;  3NSI A;  3BFH A;  2MBX A;  4QJ4 B;  2BKH B;  2LMU A;  1K93 D;  1F71 A;  3TDU A;  5IBW A;  1AVS A;  2FOT A;  3B6X A;  3SG6 A;  2GGM A;  3LK1 A;  4GNK B;  1SMG A;  2GTE A;  2JPO A;  3FE9 A;  1K90 D;  1YUT A;  1IWQ A;  3BFB A;  3SG5 A;  1SBJ A;  2BBM A;  1A29 A;  2M1U A;  3CR2 A;  1DJW A;  2JXC A;  2KGB C;  2M29 A;  1KFX S;  2V53 A;  3L4L A;  4DRW A;  2JT3 A;  4XYN A;  2PMY A;  3S0D A;  1A75 A;  1OSA A;  2LE9 B;  2K7D A;  3I5F C;  4QJ3 B;  1JBA A;  4BY5 A;  1CB1 A;  1PAL A;  2WCK A;  1S5G Z;  2KQ6 A;  2ZRS A;  4NDB A;  1RJV A;  2K8M B;  3K21 A;  3OP0 A;  1N65 A;  2WC5 A;  1QLK A;  3AAK A;  3B87 A;  1K94 A;  3BFA A;  1CDP A;  2KFG A;  4CLN A;  3S0G A;  5I2O A;  2QDI A;  3B88 A;  2JUL A;  1WY9 A;  1IH0 A;  2PRU A;  1RK9 A;  1F70 A;  2IS9 A;  3RLZ A;  3CR4 X;  3D78 A;  2ZFD A;  3UO9 A;  3NXA A;  1KSO A;  1DJX A;  3VRQ A;  4BY4 A;  1BG1 A;  2H61 C;  2H8V A;  2Q91 A;  2P71 A;  3V2L A;  1TN4 A;  3CR5 X;  1CM1 A;  3VGO A;  1NCY A;  2K7B A;  4MZL A;  4XJK A;  1KFX L;  1TNQ A;  2JOJ A;  4AQJ A;  3OGN A;  5ER4 X;  1U5I B;  3OX5 A;  1EXR A;  3UNW A;  1KK7 Y;  5FI7 A;  1J7R A;  3SG2 A;  3SJS A;  1SKT A;  1ALW A;  3CDN A;  2L5Y A;  1BOD A;  3F45 A;  4CFQ A;  1DF0 B;  1QAT A;  4F0Z B;  4QJ5 B;  1Y0V H;  3EK7 A;  2LP3 A;  1J7P A;  1CM4 A;  1DJH A;  1L2O C;  1QIV A;  1QX2 A;  1CLB A;  1H4B A;  1SNL A;  2CT9 A;  4WQ3 A;  5I2L A;  1NSH A;  1SYM A;  3FE6 A;  4OCI A;  2EHB A;  1A2X A;  1SSE B;  4YBH B;  1OMV A;  1ODB A;  1BR1 B;  2K2F A;  4MVF A;  4MLW A;  1P28 A;  2JPT A;  1OMD A;  2LCP A;  1LIN A;  1NPQ A;  2E30 A;  1L7Z A;  3LLE A;  2CTN A;  4N5X A;  1DGU A;  1B8R A;  4ICB A;  1B4C A;  1SL7 A;  1XFR A;  4GFT A;  5JJG A;  1BLQ A;  2BBN A;  3CWG A;  1NP8 A;  1F54 A;  1IJ5 A;  3DYE A;  2JT0 A;  1YUS A;  2L50 A;  3PN7 C;  1U5I A;  5PAL A;  1AUI B;  1KWO C;  5KTY A;  2WCJ A;  2Y4Q A;  2H61 A;  5KU1 A;  3BUM B;  3SG3 A;  4N1G A;  3SS4 A;  2WCF A;  2AAO A;  4PDZ A;  2QEV A;  4A4B A;  1LVC D;  2KI6 C;  1J7O A;  1NX0 A;  2JNF A;  2WCM A;  2KQY A;  1DF0 A;  1DTL A;  3R1V A;  3EKJ A;  1CNP A;  1QV0 A;  1WDC C;  3I5G C;  2AUC A;  2JC2 A;  1M63 B;  4PE0 A;  1K9U A;  1B7T Z;  3KEV A;  1QV1 A;  1XFV O;  2I18 A;  3HX4 A;  4JWQ A;  4MSP A;  2M97 A;  2KAY A;  5TNC A;  4AQI A;  1Y6W A;  3DVM A;  1WLM A;  3B86 A;  3I5I B;  2E6W A;  2Y1M A;  2EC6 C;  2CCM A;  2OTG B;  1MXL C;  4WQ2 A;  2OS8 B;  4YGA A;  1G8I A;  5HLO A;  2MAZ A;  3FE8 A;  2BCA A;  1UWO A;  2O60 A;  4GAO A;  1EL4 A;  1Y1U A;  3AKA A;  3CLN A;  2R2I A;  1CKK A;  5DKQ A;  1Y1A A;  4OKH A;  5ER5 A;  3D73 A;  1DT7 B;  2JTZ A;  4ORA B;  2WCB A;  2KBM A;  1DVI A;  2K7C A;  1S6C A;  2M7L A;  3BJH A;  1B47 A;  2TN4 A;  3NHI A;  4ZCU A;  3CAB A;  2HET A;  1DMO A;  1NX3 A;  2KI4 B;  1QTX A;  1TUJ A;  5AEQ A;  1CDM A;  1LXF C;  5CSI A;  2KYC A;  2KHN A;  2MLF C;  3BUO B;  5FI6 A;  2L2E A;  3D0Y A;  3GK4 X;  1KK8 C;  1MQ1 A;  3Q8I A;  1K9K A;  4INX A;  4XJK B;  1D1O A;  1Q80 A;  3JVT C;  1SW8 A;  1S36 A;  3VRN A;  1CMG A;  1JC2 A;  2PAL A;  3BYA A;  1UUS A;  2LMV A;  1CFD A;  1XFY O;  2LAN A;  1KQM B;  2BE6 A;  2B1U A;  1LS8 A;  1YX7 A;  2GV5 A;  4N1F A;  1C7V A;  2LC5 A;  1IJ6 A;  1XYD A;  4Q04 A;  5AXI A;  3I5H C;  1OOG A;  5DKR A;  5B8I B;  1XFX O;  4I5J A;  1R2U A;  3PLF B;  5HYD A;  4YRU A;  2KI6 D;  3CZ2 A;  3PSR A;  2WOS A;  1JF2 A;  1CTR A;  3JTD C;  3OB1 B;  2YGU A;  3DXL A;  4ZCV A;  1FBV A;  1HT9 A;  1SR6 B;  2G2B A;  5AFP A;  1NCX A;  4DS7 A;  2HPS A;  1R6P A;  2NLN A;  2WCL A;  1RFJ A;  1KK7 Z;  1NUB A;  2Q4U A;  3SG7 A;  2P70 A;  1Z4H A;  1MWN A;  2M1K B;  2ZRT A;  3CTN A;  3DVJ A;  3FWB A;  1JWD A;  1M31 A;  2COL B;  3D76 A;  3O4X A;  4MZK A;  2MJW B;  1IQ5 A;  1W9Z A;  2QAC A;  1SK6 D;  3BXK A;  3FS7 A;  4L9M A;  3WXA A;  2M7N A;  2F33 A;  3KO0 A;  3DY9 A;  2LVV A;  1FI6 A;  3AKB A;  4GUK A;  2GGZ A;  3VRR A;  1KQV A;  3IQQ A;  3TS5 C;  4C0L A;  2NCO A;  2DOQ A;  4PAL A;  4E68 A;  1QIW A;  3GK1 A;  1JFK A;  1QX5 B;  2D8N A;  2LV7 A;  3PM2 A;  3ZWH A;  1F4O A;  4DIR A;  2MA2 A;  3CZ1 A;  3KHE A;  2WCH A;  4FTG A;  4I5L B;  5HKW A;  1YRT B;  1OW4 A;  3S0A A;  1C3Z A;  3TDI A;  2JXL A;  2I94 A;  3TUY C;  1JFJ A;  4M2Q A;  2SCP A;  1CLM A;  1Z2C B;  1ZAC A;  2M9G A;  1YUR A;  2K0J A;  3DVE A;  4GGF C;  3LL8 B;  1A03 A;  2L2C A;  1BU3 A;  1RTP 1;  4PHJ A;  1NCZ A;  3E3R A;  3O6B A;  2EGD A;  2FCE A;  2BCB A;  1IRJ A;  1PK0 D;  2JRF A;  3GK2 A;  1QVI Z;  2FJY A;  3EG5 B;  2Y1N A;  3EVU A;  1PRW A;  4TNC A;  4C0K A;  1B1G A;  1GGZ A;  3PJI A;  1B8C A;  5HLV A;  4PE7 A;  2KSP A;  1DJY A;  4NDC A;  1FI5 A;  2JTT A;  1DC1 A;  2RGI A;  3LK0 A;  1SPY A;  4HRH A;  2KAV A;  5CSJ A;  2F2O A;  1TNP A;  3L4A A;  2BKI B;  2G9B A;  5G08 A;  1SCM C;  1AP4 A;  4YI9 A;  1EH2 A;  3D0Y B;  4IJ7 A;  1ORG A;  2BEC A;  1DJG A;  3EK4 A;  5EL2 A;  4PE1 A;  1XA5 A;  2JZI A;  5BPJ A;  3CS1 A;  4M2O A;  1WRL A;  3TDZ A;  1QVI Y;  1FPW A;  3PM8 A;  1KFU S;  2LHI A;  2K2A A;  4GBA A;  1BMO A;  5AER A;  3BOW A;  3O4Y A;  3VRO A;  1BF5 A;  3VB1 A;  1CLL A;  1XK4 C;  2WOR A;  3BUX B;  1KWO B;  2K60 A;  1H8B A;  2JNX A;  3PFV A;  2PVB A;  1BOC A;  1VRK A;  2KDH A;  3D75 A;  1XVJ A;  2OPO A;  1TCO B;  1XFW O;  3N7H A;  1TRF A;  1YX8 A;  4FQO A;  4MBE A;  1Y1X A;  2LUC A;  2NXQ A;  3S0F A;  1YRU B;  3B7A A;  2JQ6 A;  1SY9 A;  2QPT A;  1MF8 B;  2WC8 A;  3CGA A;  4KYN A;  2KBI A;  1S6J A;  4PHK A;  3I5G B;  3RZS A;  2LP2 A;  1V1F A;  3NSK A;  2VRG A;  4HRE E;  1EG3 A;  1EJ3 A;  3WHU B;  1TTX A;  3O2P A;  1DJI A;  1LA3 A;  2BL0 C;  3PAT A;  3FIA A;  2L5X B;  2OTG C;  2LVI A;  1CFC A;  1UP5 A;  5CPV A;  1DQE A;  5FYX A;  5D3O A;  2KNE A;  4AOM A;  3OX6 A;  1N2D A;  4WRI A;  4A4C A;  2M8U A;  1C7W A;  4PE4 A; 
#chains in the Genus database with same CATH homology
 3FWC A;  1QXP A;  1KFU L;  1CDL A;  3ZNI A;  3LCP C;  1XFU O;  3OHM B;  1GGW A;  4MRY A;  2M49 B;  4YGE B;  2FCD A;  1DJZ A;  2KI4 C;  3IQO A;  4YGD B;  3DVK A;  1RWY A;  1M39 A;  3BUW B;  3EKH A;  1CFF A;  1TNX A;  1F8H A;  5HKY A;  2L51 A;  1IQ3 A;  2H2K A;  2KYF A;  1GJY A;  1UUR A;  1YTZ C;  2F2P A;  2KAX A;  2MHH A;  4YI8 A;  1YVL A;  1B9A A;  3DF0 B;  2KOT A;  2Y5I A;  1UHI A;  1XK4 A;  3RM1 A;  4R1E A;  3OB2 B;  4YGB B;  4CFR A;  2JT8 A;  1QAS A;  1WLZ A;  3I5H B;  4NQG A;  3I5F B;  4YGC B;  1FF1 A;  2LM5 A;  2ZND A;  2JU0 A;  1IKU A;  1F55 A;  1J1E A;  1V1G A;  1PSB A;  2LVJ A;  1G33 A;  2KFH A;  1SL9 A;  2LLU A;  1YUU A;  2A4J A;  1MUX A;  1BJF A;  1XFZ O;  4U8D A;  3JTD B;  1MHO A;  3BUN B;  1B8L A;  2WCE A;  1RRO A;  1QS7 A;  1SR6 C;  5CSF A;  1NIW A;  1NYA A;  5KSZ A;  3SIB A;  2NZ0 A;  1QJT A;  1E8A A;  5D7F A;  1F4Q A;  2I2R E;  4MZJ A;  3SIA A;  4CPV A;  4IL1 A;  2CBL A;  2KGR A;  2BE4 A;  1K2H A;  5I2Q A;  3WNX B;  4DCK A;  1UHJ A;  1K96 A;  1KCY A;  2SAS A;  3NSL A;  5HKZ A;  2HQ8 A;  1K9P A;  2LLS A;  3AAJ A;  3IF7 A;  1K8U A;  4GGN A;  3TS5 B;  1CDN A;  3BOW B;  3DD4 A;  3M0W A;  3DF0 A;  1SCV A;  1S5G Y;  1TIZ A;  1ZUZ A;  4UPG A;  4JPZ B;  1OOJ A;  1S6I A;  2BCX A;  2O5G A;  1MXE A;  3GOF A;  2ZN8 A;  1NX2 A;  3ICB A;  1PVB A;  1JUO A;  1AJ5 A;  1BT6 A;  1LA0 A;  1ZOT B;  2LUX A;  1S3P A;  1W7I B;  1J1D A;  2LVK A;  1WRK A;  2NCP A;  1BR4 B;  1OZO A;  4GPL B;  4P2Y B;  1TCF A;  3TUY B;  3HCM A;  1L2O B;  5GQQ C;  5I8N A;  4MRX A;  4OV2 A;  5J3X A;  1N0Y A;  1SRA A;  4HRG A;  3D10 A;  4OVN F;  1J55 A;  1LKJ A;  1QLS A;  5F6T A;  3TZ1 A;  1UHH A;  4ORC B;  3A4U B;  1PUL A;  3A8R A;  4I5N B;  1G4Y R;  1PSR A;  3KPX A;  5DKN A;  1HQV A;  4OR9 B;  2F8P A;  2L4H A;  4PCW A;  1AK8 A;  3EVV A;  1UHN A;  1NX1 A;  1UHK A;  1QX7 A;  1TNW A;  4NDD A;  1KSM A;  3EK8 A;  1AHR A;  1M46 A;  1YR5 A;  4CID A;  1S1E A;  3PN7 B;  1JSA A;  1ZFS A;  2F3Z A;  1OZS A;  1REC A;  1SCM B;  4HSZ A;  4USL A;  2KFF A;  2ZN9 A;  1DGV A;  1OMR A;  2LLT A;  4PHM A;  1OE9 B;  1FW4 A;  1MR8 A;  2HF5 A;  4P5O E;  1ZMZ A;  3KF9 A;  1SL8 A;  2P6B B;  2MLE C;  3CZT X;  1EG4 A;  1AJ4 A;  3MSE B;  5AAN A;  4MN0 A;  1WDC B;  3VRP A;  3PAL A;  1TOP A;  2ZNE A;  1W7J B;  2M0R A;  3O78 A;  3I5I C;  4JQ0 D;  2MRD A;  4ORB B;  2CXJ A;  4MEW A;  2LMT A;  3EVR A;  2FJU B;  4GGF A;  2M3W A;  2OS8 C;  1IGV A;  2EC6 B;  1NWD A;  1S26 D;  2ZKM X;  1OQP A;  2ISD A;  1PVA A;  4PHN A;  1JF0 A;  2LNK A;  1ALV A;  1A75 B;  4I5K A;  5JOL A;  2PAS A;  2BL0 B;  3H4S E;  4C0J A;  2L0P A;  5CSN A;  1GQM A;  3SG4 A;  4ETO A;  2I7A A;  2JWW A;  1XO5 A;  2L4I A;  4M2P A;  2LAP A;  1J7Q A;  1A4P A;  1IG5 A;  2WND A;  2PSR A;  1WRZ A;  3QRX A;  3WHT B;  2L98 A;  2HQW A;  1B7T Y;  1CFP A;  1CMF A;  2CNP A;  2K7O A;  4DUQ A;  5K89 A;  4D1E A;  2K61 A;  1KK8 B;  2F3Y A;  5D69 A;  1M45 A;  3JVT B;  1K95 A;  3BQ3 A;  3C1V A;  1C07 A;  2AMI A;  1KQM C;  3NSO A;  1YVH A;  2LHL A;  1X02 A;  3NSI A;  2MBX A;  4QJ4 B;  1F71 A;  2BKH B;  2LMU A;  1K93 D;  3TDU A;  5IBW A;  1AVS A;  2FOT A;  3SG6 A;  2GGM A;  3LK1 A;  4GNK B;  1SMG A;  1K90 D;  1YUT A;  1IWQ A;  3SG5 A;  1SBJ A;  2BBM A;  1A29 A;  2M1U A;  3CR2 A;  1DJW A;  2JXC A;  2KGB C;  2M29 A;  1KFX S;  2V53 A;  4DRW A;  2JT3 A;  4XYN A;  2PMY A;  1A75 A;  1OSA A;  2LE9 B;  2K7D A;  3I5F C;  4QJ3 B;  1JBA A;  4BY5 A;  1CB1 A;  1PAL A;  1S5G Z;  2KQ6 A;  2ZRS A;  4NDB A;  1RJV A;  2K8M B;  3K21 A;  3OP0 A;  1N65 A;  3AAK A;  1QLK A;  1K94 A;  1CDP A;  2KFG A;  4CLN A;  5I2O A;  2JUL A;  1WY9 A;  1IH0 A;  2PRU A;  1RK9 A;  1F70 A;  2IS9 A;  3RLZ A;  3CR4 X;  2ZFD A;  4BY4 A;  3NXA A;  1KSO A;  1DJX A;  3VRQ A;  1BG1 A;  2H61 C;  2Q91 A;  1TN4 A;  3CR5 X;  1CM1 A;  3VGO A;  1NCY A;  2K7B A;  4MZL A;  4XJK A;  1KFX L;  1TNQ A;  2JOJ A;  4AQJ A;  5ER4 X;  1U5I B;  3OX5 A;  1EXR A;  1KK7 Y;  3SG2 A;  1J7R A;  3SJS A;  1SKT A;  1ALW A;  1BOD A;  3F45 A;  4CFQ A;  1DF0 B;  1QAT A;  4F0Z B;  4QJ5 B;  1Y0V H;  3EK7 A;  2LP3 A;  1J7P A;  1CM4 A;  1DJH A;  1L2O C;  1QIV A;  1QX2 A;  1CLB A;  1H4B A;  1SNL A;  2CT9 A;  4WQ3 A;  5I2L A;  1NSH A;  1SYM A;  4OCI A;  2EHB A;  1A2X A;  4YBH B;  1OMV A;  1ODB A;  1BR1 B;  2K2F A;  4MVF A;  4MLW A;  2JPT A;  1OMD A;  2LCP A;  1LIN A;  1NPQ A;  2E30 A;  1L7Z A;  3LLE A;  2CTN A;  4N5X A;  1DGU A;  1B8R A;  4ICB A;  1B4C A;  1SL7 A;  4GFT A;  1BLQ A;  5JJG A;  2BBN A;  3CWG A;  1NP8 A;  1F54 A;  1IJ5 A;  2JT0 A;  1YUS A;  2L50 A;  3PN7 C;  1U5I A;  5PAL A;  1AUI B;  1KWO C;  5KTY A;  2Y4Q A;  2H61 A;  5KU1 A;  3BUM B;  3SG3 A;  4N1G A;  2WCF A;  2AAO A;  4PDZ A;  4A4B A;  1LVC D;  2KI6 C;  1J7O A;  1NX0 A;  2JNF A;  2KQY A;  1DF0 A;  1DTL A;  3EKJ A;  1CNP A;  1QV0 A;  1WDC C;  3I5G C;  2AUC A;  2JC2 A;  1M63 B;  4PE0 A;  1K9U A;  1B7T Z;  3KEV A;  1QV1 A;  1XFV O;  2I18 A;  3HX4 A;  4JWQ A;  4MSP A;  2M97 A;  2KAY A;  5TNC A;  4AQI A;  1Y6W A;  3DVM A;  1WLM A;  3I5I B;  2E6W A;  2Y1M A;  2EC6 C;  2CCM A;  2OTG B;  1MXL C;  4WQ2 A;  2OS8 B;  4YGA A;  1G8I A;  5HLO A;  2MAZ A;  2BCA A;  1UWO A;  2O60 A;  4GAO A;  1EL4 A;  1Y1U A;  3AKA A;  3CLN A;  2R2I A;  1CKK A;  5DKQ A;  1Y1A A;  4OKH A;  5ER5 A;  1DT7 B;  2JTZ A;  4ORA B;  2WCB A;  2KBM A;  1DVI A;  2K7C A;  1S6C A;  2M7L A;  1B47 A;  2TN4 A;  4ZCU A;  2HET A;  1DMO A;  1NX3 A;  2KI4 B;  1QTX A;  5AEQ A;  1CDM A;  1LXF C;  5CSI A;  2KYC A;  2KHN A;  2MLF C;  3BUO B;  2L2E A;  3D0Y A;  3GK4 X;  1KK8 C;  1MQ1 A;  1K9K A;  4XJK B;  1D1O A;  1Q80 A;  3JVT C;  1SW8 A;  1S36 A;  3VRN A;  1CMG A;  1JC2 A;  2PAL A;  3BYA A;  1UUS A;  2LMV A;  1CFD A;  1XFY O;  2LAN A;  1KQM B;  2BE6 A;  2B1U A;  1YX7 A;  2GV5 A;  4N1F A;  1C7V A;  2LC5 A;  1IJ6 A;  1XYD A;  4Q04 A;  5AXI A;  3I5H C;  5DKR A;  5B8I B;  1XFX O;  4I5J A;  1R2U A;  3PLF B;  5HYD A;  4YRU A;  2KI6 D;  3PSR A;  2WOS A;  1JF2 A;  1CTR A;  3JTD C;  3OB1 B;  4ZCV A;  1FBV A;  1HT9 A;  1SR6 B;  2G2B A;  5AFP A;  1NCX A;  4DS7 A;  2HPS A;  1R6P A;  2NLN A;  1RFJ A;  1KK7 Z;  1NUB A;  2Q4U A;  3SG7 A;  3FWB A;  1MWN A;  2M1K B;  2ZRT A;  3CTN A;  3DVJ A;  1JWD A;  1M31 A;  2COL B;  4MZK A;  2MJW B;  1IQ5 A;  2QAC A;  3BXK A;  1SK6 D;  3WXA A;  3FS7 A;  4L9M A;  2M7N A;  2F33 A;  3KO0 A;  2LVV A;  1FI6 A;  3AKB A;  4GUK A;  2GGZ A;  3VRR A;  1KQV A;  3IQQ A;  3TS5 C;  4C0L A;  2NCO A;  2DOQ A;  4PAL A;  4E68 A;  1QIW A;  3GK1 A;  1JFK A;  1QX5 B;  2D8N A;  2LV7 A;  3ZWH A;  1F4O A;  4DIR A;  2MA2 A;  3KHE A;  4FTG A;  4I5L B;  5HKW A;  1YRT B;  3TDI A;  2JXL A;  2I94 A;  3TUY C;  1JFJ A;  4M2Q A;  2SCP A;  1CLM A;  1ZAC A;  2M9G A;  1YUR A;  2K0J A;  3DVE A;  4GGF C;  3LL8 B;  1A03 A;  1BU3 A;  1RTP 1;  4PHJ A;  1NCZ A;  3E3R A;  3O6B A;  2EGD A;  2FCE A;  2BCB A;  1IRJ A;  1PK0 D;  2JRF A;  3GK2 A;  1QVI Z;  2Y1N A;  3EVU A;  1PRW A;  4TNC A;  4C0K A;  1B1G A;  1GGZ A;  1B8C A;  5HLV A;  4PE7 A;  2KSP A;  1DJY A;  4NDC A;  1FI5 A;  2JTT A;  2RGI A;  3LK0 A;  1SPY A;  4HRH A;  2KAV A;  5CSJ A;  2F2O A;  1TNP A;  2BKI B;  2G9B A;  5G08 A;  1SCM C;  1AP4 A;  4YI9 A;  1EH2 A;  3D0Y B;  2BEC A;  1DJG A;  3EK4 A;  4PE1 A;  1XA5 A;  2JZI A;  5BPJ A;  3CS1 A;  4M2O A;  1WRL A;  3TDZ A;  1QVI Y;  1FPW A;  3PM8 A;  1KFU S;  2LHI A;  2K2A A;  4GBA A;  1BMO A;  5AER A;  3BOW A;  3O4Y A;  3VRO A;  1BF5 A;  1CLL A;  1XK4 C;  2WOR A;  3BUX B;  1KWO B;  1H8B A;  2JNX A;  3PFV A;  2PVB A;  1BOC A;  1VRK A;  2KDH A;  1XVJ A;  2OPO A;  1TCO B;  1XFW O;  1TRF A;  1YX8 A;  4FQO A;  4MBE A;  1Y1X A;  2LUC A;  2NXQ A;  1YRU B;  2JQ6 A;  1SY9 A;  2QPT A;  1MF8 B;  2WC8 A;  3CGA A;  2KBI A;  1S6J A;  4PHK A;  3I5G B;  2LP2 A;  1V1F A;  3NSK A;  2VRG A;  4HRE E;  1EG3 A;  1EJ3 A;  3WHU B;  1TTX A;  3O2P A;  1DJI A;  1LA3 A;  2BL0 C;  3PAT A;  3FIA A;  2L5X B;  2OTG C;  2LVI A;  1CFC A;  1UP5 A;  5CPV A;  5FYX A;  4AOM A;  2KNE A;  3OX6 A;  1N2D A;  4WRI A;  4A4C A;  2M8U A;  1C7W A;  4PE4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...