4I5KA

Pp2a pr70 holoenzyme model3_dica_rcsb.pdb bppnat5_extend.mtz
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
272
structure length
266
Chain Sequence
NHHDDASKFICLLAKPNCSSLEQEDFIPLLQDVVDTHPGLTFLKDAPEFHSRYITTVIQRIFYTVNRSWSGKITSTEIRKSNFLQTLALLEEEEDINQITDYFSYEHFYVIYCKFWELDTDHDLYISQADLSRYNDQASSSRIIERIFSGAVTKEGRMSYADFVWFLISEEDKRNPTSIEYWFRCMDVDGDGVLSMYELEYFYEEQCERMEAMGIEPLPFHDLLCQMLDLVKPAVDGKITLRDLKRCRMAHIFYDTFFNLEKYLDH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Serine/threonine-protein phosphatase 2A regulatory subunit B
publication title Structure of the Ca(2+)-dependent PP2A heterotrimer and insights into Cdc6 dephosphorylation.
pubmed doi rcsb
source organism Homo sapiens
total genus 98
structure length 266
sequence length 272
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
A PF17958 EF-hand_13 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4i5kA02
1.10.238.220 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Recoverin; domain 1 4i5kA01
2Y1NA 2RGIA 2LVIA 3LK0A 1YUUA 4NDDA 4CFRA 2BCXA 3CS1A 2LHIA 3OB1B 5CPVA 1XO5A 1UHNA 1K2HA 1SRAA 4D1EA 3ZWHA 1UUSA 2JTTA 1Y6WA 4CPVA 4YGDB 1A29A 4MZJA 2BECA 1XK4C 2M49B 5AXIA 3I5GC 3WHUB 3O78A 4PE7A 4M2OA 1S5GZ 1SCMB 1Y1UA 4MEWA 2K7BA 1F4OA 2NXQA 5HKZA 1QV0A 1L2OB 1XFVO 4C0KA 3ICBA 2LLSA 5BPJA 4PE1A 1Q80A 1B7TY 2BKHB 2LMVA 1WY9A 1QLSA 2H61C 1PVAA 3I5IB 1OSAA 2E6WA 2I7AA 4GGFA 1KK8B 1PRWA 1BLQA 1FF1A 5CSJA 2KBIA 2L0PA 4MZLA 1SPYA 1A75A 1NX2A 1J55A 4OVNF 3TDUA 1SMGA 1CDNA 2JXLA 3CR2A 2V53A 3I5FC 1DGVA 5FYXA 2F3YA 3EK4A 1OZSA 1HT9A 3VRPA 3AAKA 1JWDA 1YR5A 3BUOB 5ER4X 3M0WA 1LA0A 2KYFA 2B1UA 2LVKA 2ZN8A 3JTDC 1LVCD 2HETA 1TNXA 3PATA 4AOMA 2CT9A 1F54A 2M29A 2L2EA 4N5XA 1BODA 2KBMA 1LINA 1FI6A 1XVJA 1B47A 1HQVA 1MR8A 1SL7A 1WRZA 2K2FA 3LLEA 3VROA 3WHTB 2M0RA 1YURA 1DGUA 4MN0A 1RROA 4XJKB 3BOWB 4OKHA 2WC8A 2LVVA 2QACA 1EJ3A 2JULA 3KHEA 1CDLA 2MJWB 1BU3A 2JT8A 4P5OE 3SIAA 1QVIY 1L7ZA 2JU0A 2KI6C 2AAOA 2LVJA 4JQ0D 5KU1A 1XFXO 1FI5A 1DJZA 1EG3A 4M2QA 1F4QA 1AK8A 2HQ8A 1CM4A 3EVVA 3PFVA 1QTXA 2Q91A 3SJSA 4FTGA 4YRUA 2BCBA 4E68A 3CZTX 2MRDA 1Y1XA 3I5FB 4YGBB 4DS7A 3SIBA 1MF8B 1OZOA 2LC5A 3SG3A 1F71A 2M8UA 1KFXS 1SCVA 2D8NA 4WQ2A 4WRIA 2Q4UA 4PE4A 2KFGA 2LAPA 5F6TA 1H4BA 5CSFA 1ZMZA 2DOQA 2JC2A 2LMUA 1TNWA 4AQIA 3JTDB 1KK7Z 1SYMA 1JSAA 1DJXA 5CSNA 5KSZA 4HSZA 1K93D 5CSIA 1UHJA 1K8UA 4ZCVA 5AANA 4MSPA 4C0JA 2JWWA 3K21A 4IL1A 3OX6A 3OX5A 1F8HA 4XYNA 1DT7B 5KTYA 1IG5A 1Y0VH 1GQMA 2M1KB 2KFHA 2MAZA 3BYAA 2M97A 5G08A 2BKIB 3CR4X 1Y1AA 1U5IB 3DF0A 2LP2A 4R1EA 5AEQA 1TN4A 3GOFA 2JNXA 1CMFA 3NSKA 1AJ4A 4U8DA 1PVBA 1A4PA 1QASA 1RFJA 2BE4A 4CFQA 4PE0A 1MHOA 3MSEB 1SL8A 1QATA 2KGRA 2R2IA 1NSHA 2M7NA 4GGFC 5AFPA 3IF7A 1RJVA 3BUWB 1JF0A 1TIZA 1K90D 2IS9A 2CNPA 1VRKA 1GJYA 1S36A 2CCMA 1K94A 1OMDA 2LNKA 3HCMA 1BOCA 1LA3A 4QJ3B 1BMOA 1NCZA 2AMIA 2Y5IA 1B8LA 1QX5B 1WRLA 2CTNA 4I5JA 3GK2A 1MUXA 2HQWA 1WLMA 1M46A 2BBMA 1MXLC 2F2PA 4MBEA 3RM1A 4QJ5B 4JWQA 3KEVA 4YGAA 2JPTA 1JBAA 2HF5A 1KK7Y 1QVIZ 4USLA 2F8PA 2JT3A 1QXPA 4I5NB 2M7LA 3FS7A 2KGBC 2I2RE 3AAJA 2BBNA 1OMVA 3CR5X 5HKWA 2ZNDA 2KI6D 1QIWA 2ZRTA 1KSOA 2LCPA 2F2OA 4NQGA 1K9PA 2M1UA 1IJ6A 2MLEC 3EVRA 2NCOA 1K96A 4AQJA 1CFFA 1RWYA 1J7RA 1KWOC 1M31A 4CLNA 3IQOA 3LCPC 2KI4B 1IH0A 1FPWA 2KAVA 2TN4A 3LL8B 3EKHA 2NLNA 1KCYA 5PALA 1DF0B 1B1GA 2PSRA 4ORCB 4WQ3A 3TUYC 3O4YA 2GV5A 1W7JB 3VRQA 2K7DA 1TOPA 1V1GA 1C07A 2OPOA 3BUNB 1DJWA 5DKQA 1DJGA 1PSBA 2EGDA 2L50A 3VGOA 4JPZB 4MRYA 3KO0A 2NZ0A 1IRJA 1QV1A 3I5GB 5I2LA 3EVUA 1BR4B 4XJKA 3BOWA 3WXAA 2WOSA 1K9KA 3BXKA 3NXAA 1IWQA 1PSRA 3PLFB 2PVBA 1S6IA 3EK7A 1AHRA 1KSMA 1X02A 2I94A 1CFCA 3SG4A 4YI9A 4OR9B 1PK0D 2CXJA 2EHBA 1BG1A 4HRGA 1XA5A 3NSLA 1QX2A 1J7OA 2K7OA 2PALA 1DTLA 1FW4A 4TNCA 1N0YA 2ZNEA 2LV7A 1A2XA 2JNFA 4ORBB 2KOTA 1KWOB 4PCWA 1UURA 3CTNA 1ALVA 2ZFDA 5I8NA 3A4UB 2PASA 2PRUA 1NPQA 1RTP1 1OE9B 2G2BA 2LHLA 2KFFA 2P6BB 2PMYA 4GFTA 2KSPA 1YTZC 3I5HC 1SNLA 2JXCA 1BF5A 2KYCA 1BJFA 3TUYB 4GPLB 1OQPA 1AJ5A 1ZFSA 3F45A 3TZ1A 1JUOA 2KHNA 1R2UA 4DRWA 4ETOA 3KF9A 2K7CA 5IBWA 3PALA 1B9AA 1NCXA 1KFUS 1ZOTB 1RK9A 3D0YA 4UPGA 1SR6C 2FCEA 3H4SE 1N2DA 1IQ5A 2CBLA 4CIDA 1SW8A 1B4CA 1SL9A 1QIVA 2OS8C 5GQQC 1E8AA 3AKAA 5D7FA 2ZRSA 1M63B 4PHKA 1CLBA 5DKNA 1G4YR 1G8IA 4ZCUA 2L4IA 1DMOA 1BR1B 5JJGA 3O2PA 1V1FA 1CFDA 2KNEA 2L51A 3EKJA 4NDBA 1CDMA 1WLZA 1LKJA 4L9MA 1XYDA 1EG4A 5JOLA 5J3XA 3RLZA 1QJTA 1EXRA 1TNPA 3FIAA 4YBHB 1YUTA 1OMRA 1WRKA 2Y4QA 1J1DA 2LUXA 3IQQA 1BT6A 2LANA 3C1VA 2VRGA 1MXEA 1NYAA 2JTZA 2K8MB 2O60A 2MA2A 3KPXA 4DCKA 2JRFA 1B8CA 1CTRA 1UP5A 2WNDA 2KAYA 1NX3A 4GAOA 4DUQA 2JQ6A 2BL0C 2JOJA 1TCOB 3ZNIA 1NUBA 3OP0A 1DJYA 3PM8A 1S1EA 2L5XB 3OHMB 2HPSA 2K0JA 4OCIA 3I5HB 2FOTA 1AUIB 3JVTC 4MLWA 1KQMC 2WORA 5HLOA 1M39A 1ODBA 1C7VA 4MZKA 1UHIA 2ZN9A 4A4BA 3PSRA 2LP3A 1CM1A 1SR6B 4A4CA 3DVMA 2LE9B 2OS8B 5B8IB 1GGWA 2H2KA 1IGVA 1AP4A 1DJHA 4N1GA 1NCYA 1YVLA 1ALWA 2AUCA 4YGCB 4NDCA 1B8RA 3TS5C 1CLMA 1KFXL 3FWCA 1UHHA 3NSIA 2OTGC 1G33A 2M9GA 3PN7C 1W7IB 2I18A 1UHKA 1ZUZA 2LMTA 1PULA 1PALA 4PHJA 3DVJA 1KQVA 2MHHA 1A75B 1IJ5A 1DF0A 5AERA 4PHMA 2G9BA 4HRHA 2MLFC 1NIWA 5TNCA 1KFUL 2BL0B 1NP8A 2E30A 1S3PA 1WDCC 2L4HA 2BE6A 2Y1MA 5DKRA 2JT0A 3BQ3A 1NX0A 2MBXA 1YRTB 1NWDA 3TDZA 3JVTB 1NX1A 1R6PA 2L98A 3D10A 1SBJA 1XK4A 4PHNA 1KQMB 1YX8A 1S6JA 1CDPA 1J7QA 1F55A 1TRFA 2EC6C 4OV2A 4I5LB 1TNQA 1N65A 4QJ4B 2KDHA 3VRNA 3CWGA 1OOJA 1JC2A 2ISDA 3SG7A 2H61A 5HYDA 4BY4A 1CLLA 1XFWO 1JF2A 1SY9A 1YUSA 5HKYA 1DVIA 1QX7A 1XFYO 2F33A 1CB1A 1ZACA 1YRUB 4GUKA 1QLKA 2ZKMX 1RECA 1S5GY 3TS5B 3GK4X 4ICBA 2LM5A 4FQOA 3HX4A 3SG2A 2OTGB 4HREE 1LXFC 3PN7B 2WCEA 2GGMA 1SK6D 1JFJA 2KAXA 2SCPA 3LK1A 2M3WA 5D69A 3SG6A 3AKBA 4GGNA 2O5GA 1K95A 1FBVA 3TDIA 2QPTA 3EK8A 2WCBA 1CMGA 2K2AA 2SASA 1YX7A 1TTXA 2LLUA 1TCFA 1QS7A 1WDCB 1YVHA 4GBAA 2A4JA 4DIRA 4F0ZB 2COLB 1C7WA 3OB2B 1S6CA 1CNPA 4I5KA 3VRRA 2LUCA 5K89A 3E3RA 3QRXA 1MQ1A 2LLTA 2EC6B 2GGZA 5I2OA 2JZIA 3SG5A 3DVKA 3FWBA 1SCMC 4C0LA 1EH2A 5ER5A 4P2YB 4PALA 1U5IA 2KQ6A 1J1EA 1UWOA 2NCPA 4M2PA 3A8RA 3DD4A 3WNXB 4MRXA 1L2OC 4GNKB 1B7TZ 1J7PA 1F70A 1S26D 3D0YB 1A03A 1SKTA 2F3ZA 1M45A 5I2QA 1CKKA 4BY5A 1EL4A 3O6BA 4MVFA 4PDZA 3I5IC 4YGEB 4Q04A 1KK8C 1JFKA 1MWNA 1XFZO 2WCFA 3GK1A 3CLNA 3DF0B 2FJUB 1H8BA 2FCDA 2BCAA 2K61A 5HLVA 1DJIA 3NSOA 1GGZA 3CGAA 1K9UA 3DVEA 1AVSA 3BUXB 1CFPA 2KI4C 4ORAB 1IKUA 4N1FA 4YI8A 1XFUO 2KQYA 1D1OA 3BUMB 1IQ3A
chains in the Genus database with same CATH superfamily
2Y1NA 3B88A 2RGIA 2LVIA 3LK0A 1YUUA 3SS5A 4NDDA 4CFRA 2BCXA 3CS1A 2LHIA 3OB1B 5CPVA 1XO5A 1UHNA 1K2HA 1SRAA 4D1EA 3ZWHA 3FE9A 1UUSA 2JTTA 1Y6WA 2GTEA 4CPVA 4YGDB 1A29A 4MZJA 2BECA 1XK4C 2M49B 5AXIA 3I5GC 3WHUB 3O78A 4PE7A 4M2OA 1S5GZ 1SCMB 3CDNA 3DY9A 1Y1UA 4MEWA 2K7BA 3R1OA 1F4OA 2NXQA 5HKZA 1QV0A 1L2OB 1XFVO 4C0KA 2WCJA 2LLSA 3ICBA 5BPJA 4PE1A 1Q80A 1B7TY 2BKHB 2LMVA 2WCHA 1WY9A 1QLSA 2H61C 1PVAA 3I5IB 1OSAA 2E6WA 2I7AA 4GGFA 1KK8B 1PRWA 3Q8IA 1BLQA 1FF1A 5CSJA 2KBIA 2L0PA 4MZLA 1SPYA 1A75A 1NX2A 1J55A 5JOLA 4OVNF 3TDUA 1SMGA 3D76A 1CDNA 2JXLA 3CR2A 2V53A 3I5FC 1DGVA 5FYXA 5I94A 1W9ZA 2F3YA 3EK4A 1OZSA 1HT9A 2WCKA 3IVTA 3AAKA 3VRPA 1YR5A 3BUOB 1JWDA 5ER4X 3M0WA 1LA0A 2KYFA 2B1UA 1OOGA 2LVKA 2P70A 2ZN8A 3JTDC 1LVCD 3FE8A 2HETA 1TNXA 3PATA 4AOMA 2CT9A 1F54A 2M29A 2L2EA 4N5XA 1BODA 2KBMA 1LINA 1FI6A 1XVJA 1B47A 1HQVA 1MR8A 1SL7A 1WRZA 2K2FA 3LLEA 3VROA 2BNXA 2M0RA 3WHTB 1YURA 1DGUA 4MN0A 1RROA 4XJKB 3BOWB 4OKHA 2WC8A 1Z2CB 2LVVA 2QACA 1EJ3A 2JULA 3KHEA 1CDLA 2QEBA 2MJWB 1BU3A 2JT8A 4P5OE 3SIAA 1QVIY 1L7ZA 2JU0A 3NHTA 2KI6C 2QEOA 3R72A 2AAOA 2LVJA 4JQ0D 5KU1A 1XFXO 1FI5A 1DJZA 1EG3A 4M2QA 1F4QA 1ORGA 3D74A 1AK8A 2HQ8A 1CM4A 3CZ2A 3EVVA 1QTXA 2Q91A 3PFVA 3S0BA 3SJSA 3R1VA 4FTGA 4YRUA 2BCBA 4F7FA 3OGNA 4E68A 3CZTX 2MRDA 2H8VA 1Y1XA 3I5FB 4YGBB 4DS7A 3SIBA 1MF8B 1OZOA 2LC5A 3SG3A 1F71A 2M8UA 1KFXS 1SCVA 2D8NA 2L5YA 4WQ2A 2Q4UA 4PE4A 2KFGA 2LAPA 4WRIA 1H4BA 5CSFA 1ZMZA 2DOQA 2JC2A 2LMUA 3S0FA 3NHIA 1TNWA 4AQIA 3JTDB 1KK7Z 1SYMA 1JSAA 1DJXA 5CSNA 5KSZA 4HSZA 1OOIX 1K93D 5CSIA 1UHJA 1K8UA 4ZCVA 5AANA 2WCLA 4MSPA 4C0JA 2JWWA 3K21A 3RZSA 4IL1A 3OX6A 3OX5A 1F8HA 4XYNA 1DT7B 2KLEA 1IG5A 3CZ1A 1Y0VH 5KTYA 1GQMA 2M1KB 2KFHA 1OW4A 2MAZA 3BYAA 1Z4HA 2M97A 3BFHA 5G08A 2BKIB 3CR4X 1Y1AA 1U5IB 3DF0A 2LP2A 4R1EA 5AEQA 1TN4A 3GOFA 3SS3A 2JNXA 1CMFA 4INWA 3NSKA 1AJ4A 5F6TA 4U8DA 1PVBA 1A4PA 1QASA 1RFJA 2BE4A 5DICA 4CFQA 4PE0A 1MHOA 3MSEB 1SL8A 1QATA 2K60A 2KGRA 2R2IA 1NSHA 2M7NA 4GGFC 5AFPA 3IF7A 1RJVA 3BUWB 1JF0A 1TIZA 1K90D 2IS9A 2KPHA 2CNPA 1VRKA 1GJYA 1S36A 3L47A 2CCMA 1K94A 1OMDA 2LNKA 3HCMA 1BOCA 1LA3A 4QJ3B 1BMOA 1NCZA 2AMIA 2Y5IA 1B8LA 1QX5B 1WRLA 2CTNA 4I5JA 3OBVA 3GK2A 1MUXA 2HQWA 1OOHA 1WLMA 1M46A 3O4XA 2BBMA 1MXLC 2F2PA 4MBEA 3RM1A 4QJ5B 1IIOA 2WC5A 4JWQA 3BFAA 3KEVA 4YGAA 2JPTA 1JBAA 2HF5A 1KK7Y 1QVIZ 4USLA 2F8PA 2JT3A 1QXPA 4I5NB 2M7LA 3FS7A 2KGBC 2I2RE 3AAJA 2BBNA 4JD9A 1OMVA 3CR5X 5HKWA 2ZNDA 2KI6D 1QIWA 5D3OA 2ZRTA 1KSOA 2LCPA 2F2OA 4NQGA 3S0EA 1K9PA 2M1UA 1IJ6A 2MLEC 3EVRA 2NCOA 1K96A 5FI2A 4AQJA 1CFFA 1RWYA 1J7RA 1KWOC 1M31A 4CLNA 3IQOA 3LCPC 2KI4B 1IH0A 1FPWA 2KAVA 2TN4A 3LL8B 3EKHA 2NLNA 1KCYA 5PALA 1DF0B 1B1GA 4OZDA 2PSRA 4ORCB 4WQ3A 3D78A 3TUYC 3O4YA 2GV5A 1W7JB 1DELA 3VRQA 1TWOA 2K7DA 1TOPA 1V1GA 1C07A 2OPOA 3BUNB 1DJWA 5DKQA 1DJGA 1PSBA 2EGDA 3R1PA 2L50A 3VGOA 4JPZB 4MRYA 3KO0A 2NZ0A 2QEVA 3VB1A 1IRJA 1DC1A 1QV1A 3I5GB 5I2LA 3D73A 1BR4B 3EVUA 3BOWA 4XJKA 3WXAA 2WOSA 1K9KA 3BXKA 3NXAA 1SSEB 1IWQA 1PSRA 3PLFB 2PVBA 1S6IA 3EK7A 1AHRA 1KSMA 1X02A 3D77A 2I94A 1CFCA 3SG4A 4YI9A 4OR9B 1PK0D 2CXJA 2EHBA 1BG1A 4HRGA 1XA5A 3NSLA 1QX2A 1J7OA 2K7OA 3D75A 2PALA 1DTLA 1FW4A 4TNCA 1N0YA 2ZNEA 3B7AA 2LV7A 1A2XA 2JNFA 4ORBB 2KOTA 1KWOB 4PCWA 1UURA 3CTNA 1ALVA 2ZFDA 5I8NA 3A4UB 2PASA 2PRUA 1NPQA 1RTP1 1OE9B 2G2BA 2LHLA 2KFFA 2P6BB 2PMYA 4GFTA 2KSPA 1YTZC 3I5HC 1SNLA 2JXCA 2PYQA 2KYCA 1BJFA 3TUYB 4GPLB 1OQPA 1AJ5A 1ZFSA 3F45A 3TZ1A 1JUOA 2KHNA 1DQEA 1R2UA 1GM0A 4DRWA 4ETOA 3KF9A 2K7CA 2PQLA 5IBWA 3PALA 1B9AA 1NCXA 1KFUS 1ZOTB 4FQTA 1RK9A 3PM2A 3D0YA 2ERBA 1SR6C 4UPGA 2FCEA 3H4SE 1N2DA 1IQ5A 2CBLA 4CIDA 1SW8A 1B4CA 1SL9A 1QIVA 2OS8C 5GQQC 1E8AA 3AKAA 5D7FA 2ZRSA 1M63B 4PHKA 3FE6A 1CLBA 5DKNA 1G4YR 1G8IA 5FI7A 4ZCUA 2L4IA 1DMOA 1BR1B 5JJGA 3O2PA 2WCMA 4JKTA 1V1FA 1CFDA 2KNEA 2L51A 3EKJA 4NDBA 1CDMA 1WLZA 1LKJA 4L9MA 1XYDA 1EG4A 4PT1A 5FI6A 5J3XA 1QJTA 1EXRA 1TNPA 3FIAA 3K1EA 3RLZA 4YBHB 1YUTA 1OMRA 1WRKA 2Y4QA 1J1DA 2LUXA 3IQQA 2WC6A 1BT6A 2LANA 3C1VA 2VRGA 1MXEA 1NYAA 2JTZA 2K8MB 2O60A 2MA2A 3KPXA 4IJ7A 4DCKA 2JRFA 1B8CA 1CTRA 1UP5A 2WNDA 2KAYA 1NX3A 4GAOA 4DUQA 1BF5A 2JQ6A 3SS4A 2BL0C 2JOJA 1TCOB 3V2LA 3ZNIA 1NUBA 1LS8A 1DJYA 3OP0A 3PM8A 1S1EA 2L5XB 3DZTA 2HPSA 2K0JA 3OHMB 3PJIA 3I5HB 2FOTA 1AUIB 3JVTC 4MLWA 4OCIA 3BFBA 1KQMC 2WORA 5HLOA 1M39A 1ODBA 1C7VA 4MZKA 1UHIA 2ZN9A 4A4BA 3PSRA 1TUJA 1XFRA 2BAPA 3CZ0A 2LP3A 1CM1A 1SR6B 4A4CA 1QWVA 3DVMA 2LE9B 2OS8B 5B8IB 1P28A 1GGWA 2H2KA 1IGVA 1AP4A 1DJHA 3B6XA 4N1GA 3S0DA 1NCYA 1YVLA 1ALWA 2AUCA 4YGCB 4NDCA 1B8RA 3TS5C 1CLMA 1KFXL 3FWCA 1UHHA 3EG5B 3NSIA 2OTGC 1G33A 1DEKA 2M9GA 3PN7C 1W7IB 2I18A 1UHKA 1ZUZA 2LMTA 3S0GA 1PULA 1PALA 1OOFA 3DVJA 4PHJA 1KQVA 2MHHA 1A75B 1IJ5A 1DF0A 1C3YA 5AERA 4PHMA 2G9BA 2KLDA 4HRHA 2MLFC 1NIWA 5TNCA 1KFUL 2BL0B 1NP8A 2E30A 1S3PA 1WDCC 2L4HA 2BE6A 2Y1MA 5DKRA 2JT0A 3BQ3A 1NX0A 2MBXA 1YRTB 2JPOA 1NWDA 3TDZA 3JVTB 1NX1A 1R6PA 2L98A 2QEHA 3D10A 1SBJA 1XK4A 4PHNA 1KQMB 1YX8A 1S6JA 1CDPA 2QDIA 1J7QA 1F55A 1TRFA 2EC6C 4OV2A 4I5LB 1TNQA 1N65A 4QJ4B 2KDHA 3VRNA 3CWGA 1OOJA 1JC2A 3L4AA 2ISDA 2YGUA 3SG7A 2H61A 5HYDA 4BY4A 1CLLA 1XFWO 1JF2A 1SY9A 1YUSA 5HKYA 1DVIA 1QX7A 1XFYO 2F33A 1CB1A 1ZACA 1YRUB 4GUKA 1QLKA 2ZKMX 1RECA 1S5GY 3TS5B 3GK4X 4ICBA 2LM5A 4FQOA 3HX4A 3SG2A 2OTGB 4HREE 1LXFC 3PN7B 2WCEA 2GGMA 1SK6D 1JFJA 2KAXA 2SCPA 3B87A 3LK1A 2M3WA 3CYZA 5D69A 3SG6A 3AKBA 4GGNA 2O5GA 3N7HA 1K95A 1FBVA 3TDIA 2QPTA 2P71A 3EK8A 1TUZA 2WCBA 1CMGA 2K2AA 2SASA 1YX7A 1TTXA 2LLUA 1TCFA 1QS7A 1WDCB 1YVHA 4GBAA 2A4JA 4DIRA 4F0ZB 2COLB 1C7WA 3OB2B 1S6CA 1CNPA 4INXA 4I5KA 5EL2A 3VRRA 2LUCA 5K89A 3DYEA 3E3RA 3QRXA 1MQ1A 2LLTA 2EC6B 2GGZA 3UO9A 5I2OA 2JZIA 3BJHA 3DVKA 3FWBA 1SCMC 3SG5A 4C0LA 1EH2A 5ER5A 4P2YB 4PALA 1U5IA 2KQ6A 1J1EA 1UWOA 2NCPA 4M2PA 3A8RA 3DD4A 3WNXB 3B86A 4MRXA 1L2OC 4GNKB 1B7TZ 1J7PA 1T14A 1F70A 1S26D 3D0YB 1A03A 1SKTA 2F3ZA 1M45A 5I2QA 1CKKA 4BY5A 1EL4A 3O6BA 4MVFA 3QMEA 4PDZA 5HL1A 1C3ZA 3I5IC 4YGEB 4Q04A 1KK8C 1JFKA 1MWNA 1XFZO 2WCFA 3GK1A 3CLNA 3DF0B 2FJUB 1H8BA 2FCDA 3UNWA 3L4LA 2L2CA 2BCAA 2K61A 5HLVA 1DJIA 3NSOA 1GGZA 3CGAA 1K9UA 3S0AA 3DVEA 1AVSA 4KYNA 3BUXB 3CABA 3NGVA 1CFPA 2KI4C 4ORAB 1IKUA 4N1FA 4YI8A 3DXLA 1XFUO 2KQYA 1D1OA 2FJYA 3BUMB 1IQ3A
chains in the Genus database with same CATH topology
2Y1NA 2RGIA 2LVIA 3LK0A 1YUUA 3SS5A 4NDDA 4CFRA 2BCXA 3CS1A 2LHIA 3OB1B 5CPVA 1XO5A 1UHNA 1K2HA 1SRAA 4D1EA 3ZWHA 1UUSA 2JTTA 1Y6WA 4CPVA 4YGDB 1A29A 4MZJA 2BECA 1XK4C 2M49B 5AXIA 3I5GC 3WHUB 3O78A 4PE7A 4M2OA 1S5GZ 1SCMB 1Y1UA 4MEWA 2K7BA 1F4OA 2NXQA 5HKZA 1QV0A 1L2OB 1XFVO 4C0KA 3ICBA 2LLSA 5BPJA 4PE1A 1Q80A 1B7TY 2BKHB 2LMVA 1WY9A 1QLSA 2H61C 1PVAA 3I5IB 1OSAA 2E6WA 2I7AA 4GGFA 1KK8B 1PRWA 1BLQA 1FF1A 5CSJA 2KBIA 2L0PA 4MZLA 1SPYA 1A75A 1NX2A 1J55A 4OVNF 3TDUA 1SMGA 1CDNA 2JXLA 3CR2A 2V53A 3I5FC 1DGVA 5FYXA 5I94A 1W9ZA 2F3YA 3EK4A 1OZSA 1HT9A 3VRPA 3AAKA 1JWDA 1YR5A 3BUOB 3IVTA 5ER4X 3M0WA 1LA0A 2KYFA 2B1UA 2LVKA 2ZN8A 3JTDC 1LVCD 2HETA 1TNXA 3PATA 4AOMA 2CT9A 1F54A 2M29A 2L2EA 4N5XA 1BODA 2KBMA 1LINA 1FI6A 1XVJA 1B47A 1HQVA 1MR8A 1SL7A 1WRZA 2K2FA 3LLEA 3VROA 3WHTB 2M0RA 2BNXA 1YURA 1DGUA 4MN0A 1RROA 4XJKB 3BOWB 4OKHA 2WC8A 1Z2CB 2LVVA 2QACA 1EJ3A 2JULA 3KHEA 1CDLA 2MJWB 1BU3A 2JT8A 4P5OE 3SIAA 1QVIY 1L7ZA 2JU0A 2KI6C 2AAOA 2LVJA 4JQ0D 5KU1A 1XFXO 1FI5A 1DJZA 1EG3A 4M2QA 1F4QA 1AK8A 2HQ8A 1CM4A 3EVVA 3PFVA 1QTXA 2Q91A 3SJSA 4FTGA 4YRUA 2BCBA 4E68A 3CZTX 2MRDA 1Y1XA 3I5FB 4YGBB 4DS7A 3SIBA 1MF8B 1OZOA 2LC5A 3SG3A 1F71A 2M8UA 1KFXS 1SCVA 2D8NA 4WQ2A 4WRIA 2Q4UA 4PE4A 2KFGA 2LAPA 5F6TA 1H4BA 5CSFA 1ZMZA 2DOQA 2JC2A 2LMUA 1TNWA 4AQIA 3JTDB 1KK7Z 1SYMA 1JSAA 1DJXA 5CSNA 5KSZA 4HSZA 1K93D 5CSIA 1UHJA 1K8UA 4ZCVA 5AANA 4MSPA 4C0JA 2JWWA 3K21A 4IL1A 3OX6A 3OX5A 1F8HA 4XYNA 1DT7B 5KTYA 1IG5A 2KLEA 1Y0VH 1GQMA 2M1KB 2KFHA 2MAZA 3BYAA 2M97A 1Z4HA 5G08A 2BKIB 3CR4X 1Y1AA 1U5IB 3DF0A 2LP2A 4R1EA 5AEQA 1TN4A 3GOFA 3SS3A 2JNXA 1CMFA 3NSKA 1AJ4A 4U8DA 1PVBA 1A4PA 1QASA 1RFJA 2BE4A 4CFQA 4PE0A 1MHOA 3MSEB 1SL8A 1QATA 2KGRA 2R2IA 2K60A 1NSHA 2M7NA 4GGFC 5AFPA 3IF7A 1RJVA 3BUWB 1JF0A 1TIZA 1K90D 2IS9A 2CNPA 1VRKA 1GJYA 1S36A 2CCMA 1K94A 1OMDA 2LNKA 3HCMA 1BOCA 1LA3A 4QJ3B 1BMOA 1NCZA 2AMIA 2Y5IA 1B8LA 1QX5B 1WRLA 2CTNA 4I5JA 3OBVA 3GK2A 1MUXA 2HQWA 1WLMA 1M46A 3O4XA 2BBMA 1MXLC 2F2PA 4MBEA 3RM1A 4QJ5B 4JWQA 3KEVA 4YGAA 2JPTA 1JBAA 2HF5A 1KK7Y 1QVIZ 4USLA 2F8PA 2JT3A 1QXPA 4I5NB 2M7LA 3FS7A 2KGBC 2I2RE 3AAJA 2BBNA 1OMVA 3CR5X 5HKWA 2ZNDA 2KI6D 1QIWA 5D3OA 2ZRTA 1KSOA 2LCPA 2F2OA 4NQGA 1K9PA 2M1UA 1IJ6A 2MLEC 3EVRA 2NCOA 1K96A 5FI2A 4AQJA 1CFFA 1RWYA 1J7RA 1KWOC 1M31A 4CLNA 3IQOA 3LCPC 2KI4B 1IH0A 1FPWA 2KAVA 2TN4A 3LL8B 3EKHA 2NLNA 1KCYA 5PALA 1DF0B 1B1GA 2PSRA 4ORCB 4WQ3A 3TUYC 3O4YA 2GV5A 1W7JB 3VRQA 1DELA 2K7DA 1TOPA 1V1GA 1C07A 2OPOA 3BUNB 1DJWA 5DKQA 1DJGA 1PSBA 2EGDA 2L50A 3VGOA 4JPZB 4MRYA 3KO0A 2NZ0A 1IRJA 1DC1A 1QV1A 3I5GB 5I2LA 3EVUA 1BR4B 4XJKA 3BOWA 3WXAA 2WOSA 1K9KA 3BXKA 3NXAA 1IWQA 1PSRA 3PLFB 2PVBA 1S6IA 3EK7A 1AHRA 1KSMA 1X02A 2I94A 1CFCA 3SG4A 4YI9A 4OR9B 1PK0D 2CXJA 2EHBA 1BG1A 4HRGA 1XA5A 3NSLA 1QX2A 1J7OA 2K7OA 2PALA 1DTLA 1FW4A 4TNCA 1N0YA 2ZNEA 2LV7A 1A2XA 2JNFA 4ORBB 2KOTA 1KWOB 4PCWA 1UURA 3CTNA 1ALVA 2ZFDA 5I8NA 3A4UB 2PASA 2PRUA 1NPQA 1RTP1 1OE9B 2G2BA 2LHLA 2KFFA 2P6BB 2PMYA 4GFTA 2KSPA 1YTZC 3I5HC 1SNLA 2JXCA 1BF5A 2KYCA 1BJFA 3TUYB 4GPLB 1OQPA 1AJ5A 1ZFSA 3F45A 3TZ1A 1JUOA 2KHNA 1R2UA 4DRWA 4ETOA 3KF9A 2K7CA 5IBWA 3PALA 1B9AA 1NCXA 1KFUS 1ZOTB 1RK9A 3PM2A 3D0YA 4UPGA 1SR6C 2FCEA 3H4SE 1N2DA 1IQ5A 2CBLA 4CIDA 1SW8A 1B4CA 1SL9A 1QIVA 2OS8C 5GQQC 1E8AA 3AKAA 5D7FA 2ZRSA 1M63B 4PHKA 1CLBA 5DKNA 1G4YR 1G8IA 4ZCUA 5FI7A 2L4IA 1DMOA 1BR1B 5JJGA 3O2PA 4JKTA 1V1FA 1CFDA 2KNEA 2L51A 3EKJA 4NDBA 1CDMA 1WLZA 1LKJA 4L9MA 1XYDA 1EG4A 5JOLA 5J3XA 3RLZA 1QJTA 1EXRA 1TNPA 3FIAA 4YBHB 1YUTA 1OMRA 1WRKA 2Y4QA 1J1DA 2LUXA 3IQQA 1BT6A 2LANA 3C1VA 2VRGA 1MXEA 1NYAA 2JTZA 2K8MB 2O60A 2MA2A 3KPXA 4IJ7A 4DCKA 2JRFA 1B8CA 1CTRA 1UP5A 2WNDA 2KAYA 1NX3A 4GAOA 4DUQA 2JQ6A 3SS4A 2BL0C 2JOJA 1TCOB 3ZNIA 1NUBA 3OP0A 1DJYA 3PM8A 1S1EA 2L5XB 3OHMB 2HPSA 2K0JA 4OCIA 3I5HB 2FOTA 1AUIB 3JVTC 4MLWA 1KQMC 2WORA 5HLOA 1M39A 1ODBA 1C7VA 4MZKA 1UHIA 2ZN9A 4A4BA 3PSRA 2BAPA 2LP3A 1CM1A 1SR6B 4A4CA 3DVMA 2LE9B 2OS8B 5B8IB 1GGWA 2H2KA 1IGVA 1AP4A 1DJHA 4N1GA 1NCYA 1YVLA 1ALWA 2AUCA 4YGCB 4NDCA 1B8RA 3TS5C 1CLMA 1KFXL 3FWCA 1UHHA 3EG5B 3NSIA 2OTGC 1G33A 1DEKA 2M9GA 3PN7C 1W7IB 2I18A 1UHKA 1ZUZA 2LMTA 1PULA 1PALA 4PHJA 3DVJA 1KQVA 2MHHA 1A75B 1IJ5A 1DF0A 5AERA 4PHMA 2G9BA 2KLDA 4HRHA 2MLFC 1NIWA 5TNCA 1KFUL 2BL0B 1NP8A 2E30A 1S3PA 1WDCC 2L4HA 2BE6A 2Y1MA 5DKRA 2JT0A 3BQ3A 1NX0A 2MBXA 1YRTB 1NWDA 3TDZA 3JVTB 1NX1A 1R6PA 2L98A 3D10A 1SBJA 1XK4A 4PHNA 1KQMB 1YX8A 1S6JA 1CDPA 1J7QA 1F55A 1TRFA 2EC6C 4OV2A 4I5LB 1TNQA 1N65A 4QJ4B 2KDHA 3VRNA 3CWGA 1OOJA 1JC2A 2ISDA 2YGUA 3SG7A 2H61A 5HYDA 4BY4A 1CLLA 1XFWO 1JF2A 1SY9A 1YUSA 5HKYA 2L5YA 1DVIA 1QX7A 1XFYO 2F33A 1CB1A 5FI6A 1ZACA 1YRUB 4GUKA 1QLKA 2ZKMX 1RECA 1S5GY 3TS5B 3GK4X 4ICBA 2LM5A 4FQOA 3HX4A 3SG2A 2OTGB 4HREE 1LXFC 3PN7B 2WCEA 2GGMA 1SK6D 1JFJA 2KAXA 2SCPA 3LK1A 2M3WA 5D69A 3SG6A 3AKBA 4GGNA 2O5GA 1K95A 1FBVA 3TDIA 2QPTA 3EK8A 2WCBA 1CMGA 2K2AA 2SASA 1YX7A 1TTXA 2LLUA 1TCFA 1QS7A 1WDCB 1YVHA 4GBAA 2A4JA 4DIRA 4F0ZB 2COLB 1C7WA 3OB2B 1S6CA 1CNPA 4I5KA 3VRRA 2LUCA 5K89A 3E3RA 3QRXA 1MQ1A 2LLTA 2EC6B 2GGZA 3UO9A 5I2OA 2JZIA 3SG5A 3DVKA 3FWBA 1SCMC 4C0LA 1EH2A 5ER5A 4P2YB 4PALA 1U5IA 2KQ6A 1J1EA 1UWOA 2NCPA 4M2PA 3A8RA 3DD4A 3WNXB 4MRXA 1L2OC 4GNKB 1B7TZ 1J7PA 1F70A 1S26D 3D0YB 1A03A 1SKTA 2F3ZA 1M45A 5I2QA 1CKKA 4BY5A 1EL4A 3O6BA 4MVFA 4PDZA 5HL1A 3I5IC 4YGEB 4Q04A 1KK8C 1JFKA 1MWNA 1XFZO 2WCFA 3GK1A 3CLNA 3DF0B 2FJUB 1H8BA 2FCDA 3UNWA 2BCAA 2K61A 5HLVA 1DJIA 3NSOA 1GGZA 3CGAA 1K9UA 3DVEA 1AVSA 4KYNA 3BUXB 1CFPA 2KI4C 4ORAB 1IKUA 4N1FA 4YI8A 1XFUO 2KQYA 1D1OA 3BUMB 1IQ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y1N A;  2RGI A;  2LVI A;  3LK0 A;  1YUU A;  4NDD A;  4CFR A;  2BCX A;  3CS1 A;  2LHI A;  3OB1 B;  5CPV A;  1XO5 A;  1UHN A;  1K2H A;  1SRA A;  4D1E A;  3ZWH A;  1UUS A;  2JTT A;  1Y6W A;  4CPV A;  4YGD B;  1A29 A;  4MZJ A;  2BEC A;  1XK4 C;  2M49 B;  5AXI A;  3I5G C;  3WHU B;  3O78 A;  4PE7 A;  4M2O A;  1S5G Z;  1SCM B;  1Y1U A;  4MEW A;  2K7B A;  1F4O A;  2NXQ A;  5HKZ A;  1QV0 A;  1L2O B;  1XFV O;  4C0K A;  3ICB A;  2LLS A;  5BPJ A;  4PE1 A;  1Q80 A;  1B7T Y;  2BKH B;  2LMV A;  1WY9 A;  1QLS A;  2H61 C;  1PVA A;  3I5I B;  1OSA A;  2E6W A;  2I7A A;  4GGF A;  1KK8 B;  1PRW A;  1BLQ A;  1FF1 A;  5CSJ A;  2KBI A;  2L0P A;  4MZL A;  1SPY A;  1A75 A;  1NX2 A;  1J55 A;  4OVN F;  3TDU A;  1SMG A;  1CDN A;  2JXL A;  3CR2 A;  2V53 A;  3I5F C;  1DGV A;  5FYX A;  2F3Y A;  3EK4 A;  1OZS A;  1HT9 A;  3VRP A;  3AAK A;  1JWD A;  1YR5 A;  3BUO B;  5ER4 X;  3M0W A;  1LA0 A;  2KYF A;  2B1U A;  2LVK A;  2ZN8 A;  3JTD C;  1LVC D;  2HET A;  1TNX A;  3PAT A;  4AOM A;  2CT9 A;  1F54 A;  2M29 A;  2L2E A;  4N5X A;  1BOD A;  2KBM A;  1LIN A;  1FI6 A;  1XVJ A;  1B47 A;  1HQV A;  1MR8 A;  1SL7 A;  1WRZ A;  2K2F A;  3LLE A;  3VRO A;  3WHT B;  2M0R A;  1YUR A;  1DGU A;  4MN0 A;  1RRO A;  4XJK B;  3BOW B;  4OKH A;  2WC8 A;  2LVV A;  2QAC A;  1EJ3 A;  2JUL A;  3KHE A;  1CDL A;  2MJW B;  1BU3 A;  2JT8 A;  4P5O E;  3SIA A;  1QVI Y;  1L7Z A;  2JU0 A;  2KI6 C;  2AAO A;  2LVJ A;  4JQ0 D;  5KU1 A;  1XFX O;  1FI5 A;  1DJZ A;  1EG3 A;  4M2Q A;  1F4Q A;  1AK8 A;  2HQ8 A;  1CM4 A;  3EVV A;  3PFV A;  1QTX A;  2Q91 A;  3SJS A;  4FTG A;  4YRU A;  2BCB A;  4E68 A;  3CZT X;  2MRD A;  1Y1X A;  3I5F B;  4YGB B;  4DS7 A;  3SIB A;  1MF8 B;  1OZO A;  2LC5 A;  3SG3 A;  1F71 A;  2M8U A;  1KFX S;  1SCV A;  2D8N A;  4WQ2 A;  4WRI A;  2Q4U A;  4PE4 A;  2KFG A;  2LAP A;  5F6T A;  1H4B A;  5CSF A;  1ZMZ A;  2DOQ A;  2JC2 A;  2LMU A;  1TNW A;  4AQI A;  3JTD B;  1KK7 Z;  1SYM A;  1JSA A;  1DJX A;  5CSN A;  5KSZ A;  4HSZ A;  1K93 D;  5CSI A;  1UHJ A;  1K8U A;  4ZCV A;  5AAN A;  4MSP A;  4C0J A;  2JWW A;  3K21 A;  4IL1 A;  3OX6 A;  3OX5 A;  1F8H A;  4XYN A;  1DT7 B;  5KTY A;  1IG5 A;  1Y0V H;  1GQM A;  2M1K B;  2KFH A;  2MAZ A;  3BYA A;  2M97 A;  5G08 A;  2BKI B;  3CR4 X;  1Y1A A;  1U5I B;  3DF0 A;  2LP2 A;  4R1E A;  5AEQ A;  1TN4 A;  3GOF A;  2JNX A;  1CMF A;  3NSK A;  1AJ4 A;  4U8D A;  1PVB A;  1A4P A;  1QAS A;  1RFJ A;  2BE4 A;  4CFQ A;  4PE0 A;  1MHO A;  3MSE B;  1SL8 A;  1QAT A;  2KGR A;  2R2I A;  1NSH A;  2M7N A;  4GGF C;  5AFP A;  3IF7 A;  1RJV A;  3BUW B;  1JF0 A;  1TIZ A;  1K90 D;  2IS9 A;  2CNP A;  1VRK A;  1GJY A;  1S36 A;  2CCM A;  1K94 A;  1OMD A;  2LNK A;  3HCM A;  1BOC A;  1LA3 A;  4QJ3 B;  1BMO A;  1NCZ A;  2AMI A;  2Y5I A;  1B8L A;  1QX5 B;  1WRL A;  2CTN A;  4I5J A;  3GK2 A;  1MUX A;  2HQW A;  1WLM A;  1M46 A;  2BBM A;  1MXL C;  2F2P A;  4MBE A;  3RM1 A;  4QJ5 B;  4JWQ A;  3KEV A;  4YGA A;  2JPT A;  1JBA A;  2HF5 A;  1KK7 Y;  1QVI Z;  4USL A;  2F8P A;  2JT3 A;  1QXP A;  4I5N B;  2M7L A;  3FS7 A;  2KGB C;  2I2R E;  3AAJ A;  2BBN A;  1OMV A;  3CR5 X;  5HKW A;  2ZND A;  2KI6 D;  1QIW A;  2ZRT A;  1KSO A;  2LCP A;  2F2O A;  4NQG A;  1K9P A;  2M1U A;  1IJ6 A;  2MLE C;  3EVR A;  2NCO A;  1K96 A;  4AQJ A;  1CFF A;  1RWY A;  1J7R A;  1KWO C;  1M31 A;  4CLN A;  3IQO A;  3LCP C;  2KI4 B;  1IH0 A;  1FPW A;  2KAV A;  2TN4 A;  3LL8 B;  3EKH A;  2NLN A;  1KCY A;  5PAL A;  1DF0 B;  1B1G A;  2PSR A;  4ORC B;  4WQ3 A;  3TUY C;  3O4Y A;  2GV5 A;  1W7J B;  3VRQ A;  2K7D A;  1TOP A;  1V1G A;  1C07 A;  2OPO A;  3BUN B;  1DJW A;  5DKQ A;  1DJG A;  1PSB A;  2EGD A;  2L50 A;  3VGO A;  4JPZ B;  4MRY A;  3KO0 A;  2NZ0 A;  1IRJ A;  1QV1 A;  3I5G B;  5I2L A;  3EVU A;  1BR4 B;  4XJK A;  3BOW A;  3WXA A;  2WOS A;  1K9K A;  3BXK A;  3NXA A;  1IWQ A;  1PSR A;  3PLF B;  2PVB A;  1S6I A;  3EK7 A;  1AHR A;  1KSM A;  1X02 A;  2I94 A;  1CFC A;  3SG4 A;  4YI9 A;  4OR9 B;  1PK0 D;  2CXJ A;  2EHB A;  1BG1 A;  4HRG A;  1XA5 A;  3NSL A;  1QX2 A;  1J7O A;  2K7O A;  2PAL A;  1DTL A;  1FW4 A;  4TNC A;  1N0Y A;  2ZNE A;  2LV7 A;  1A2X A;  2JNF A;  4ORB B;  2KOT A;  1KWO B;  4PCW A;  1UUR A;  3CTN A;  1ALV A;  2ZFD A;  5I8N A;  3A4U B;  2PAS A;  2PRU A;  1NPQ A;  1RTP 1;  1OE9 B;  2G2B A;  2LHL A;  2KFF A;  2P6B B;  2PMY A;  4GFT A;  2KSP A;  1YTZ C;  3I5H C;  1SNL A;  2JXC A;  1BF5 A;  2KYC A;  1BJF A;  3TUY B;  4GPL B;  1OQP A;  1AJ5 A;  1ZFS A;  3F45 A;  3TZ1 A;  1JUO A;  2KHN A;  1R2U A;  4DRW A;  4ETO A;  3KF9 A;  2K7C A;  5IBW A;  3PAL A;  1B9A A;  1NCX A;  1KFU S;  1ZOT B;  1RK9 A;  3D0Y A;  4UPG A;  1SR6 C;  2FCE A;  3H4S E;  1N2D A;  1IQ5 A;  2CBL A;  4CID A;  1SW8 A;  1B4C A;  1SL9 A;  1QIV A;  2OS8 C;  5GQQ C;  1E8A A;  3AKA A;  5D7F A;  2ZRS A;  1M63 B;  4PHK A;  1CLB A;  5DKN A;  1G4Y R;  1G8I A;  4ZCU A;  2L4I A;  1DMO A;  1BR1 B;  5JJG A;  3O2P A;  1V1F A;  1CFD A;  2KNE A;  2L51 A;  3EKJ A;  4NDB A;  1CDM A;  1WLZ A;  1LKJ A;  4L9M A;  1XYD A;  1EG4 A;  5JOL A;  5J3X A;  3RLZ A;  1QJT A;  1EXR A;  1TNP A;  3FIA A;  4YBH B;  1YUT A;  1OMR A;  1WRK A;  2Y4Q A;  1J1D A;  2LUX A;  3IQQ A;  1BT6 A;  2LAN A;  3C1V A;  2VRG A;  1MXE A;  1NYA A;  2JTZ A;  2K8M B;  2O60 A;  2MA2 A;  3KPX A;  4DCK A;  2JRF A;  1B8C A;  1CTR A;  1UP5 A;  2WND A;  2KAY A;  1NX3 A;  4GAO A;  4DUQ A;  2JQ6 A;  2BL0 C;  2JOJ A;  1TCO B;  3ZNI A;  1NUB A;  3OP0 A;  1DJY A;  3PM8 A;  1S1E A;  2L5X B;  3OHM B;  2HPS A;  2K0J A;  4OCI A;  3I5H B;  2FOT A;  1AUI B;  3JVT C;  4MLW A;  1KQM C;  2WOR A;  5HLO A;  1M39 A;  1ODB A;  1C7V A;  4MZK A;  1UHI A;  2ZN9 A;  4A4B A;  3PSR A;  2LP3 A;  1CM1 A;  1SR6 B;  4A4C A;  3DVM A;  2LE9 B;  2OS8 B;  5B8I B;  1GGW A;  2H2K A;  1IGV A;  1AP4 A;  1DJH A;  4N1G A;  1NCY A;  1YVL A;  1ALW A;  2AUC A;  4YGC B;  4NDC A;  1B8R A;  3TS5 C;  1CLM A;  1KFX L;  3FWC A;  1UHH A;  3NSI A;  2OTG C;  1G33 A;  2M9G A;  3PN7 C;  1W7I B;  2I18 A;  1UHK A;  1ZUZ A;  2LMT A;  1PUL A;  1PAL A;  4PHJ A;  3DVJ A;  1KQV A;  2MHH A;  1A75 B;  1IJ5 A;  1DF0 A;  5AER A;  4PHM A;  2G9B A;  4HRH A;  2MLF C;  1NIW A;  5TNC A;  1KFU L;  2BL0 B;  1NP8 A;  2E30 A;  1S3P A;  1WDC C;  2L4H A;  2BE6 A;  2Y1M A;  5DKR A;  2JT0 A;  3BQ3 A;  1NX0 A;  2MBX A;  1YRT B;  1NWD A;  3TDZ A;  3JVT B;  1NX1 A;  1R6P A;  2L98 A;  3D10 A;  1SBJ A;  1XK4 A;  4PHN A;  1KQM B;  1YX8 A;  1S6J A;  1CDP A;  1J7Q A;  1F55 A;  1TRF A;  2EC6 C;  4OV2 A;  4I5L B;  1TNQ A;  1N65 A;  4QJ4 B;  2KDH A;  3VRN A;  3CWG A;  1OOJ A;  1JC2 A;  2ISD A;  3SG7 A;  2H61 A;  5HYD A;  4BY4 A;  1CLL A;  1XFW O;  1JF2 A;  1SY9 A;  1YUS A;  5HKY A;  1DVI A;  1QX7 A;  1XFY O;  2F33 A;  1CB1 A;  1ZAC A;  1YRU B;  4GUK A;  1QLK A;  2ZKM X;  1REC A;  1S5G Y;  3TS5 B;  3GK4 X;  4ICB A;  2LM5 A;  4FQO A;  3HX4 A;  3SG2 A;  2OTG B;  4HRE E;  1LXF C;  3PN7 B;  2WCE A;  2GGM A;  1SK6 D;  1JFJ A;  2KAX A;  2SCP A;  3LK1 A;  2M3W A;  5D69 A;  3SG6 A;  3AKB A;  4GGN A;  2O5G A;  1K95 A;  1FBV A;  3TDI A;  2QPT A;  3EK8 A;  2WCB A;  1CMG A;  2K2A A;  2SAS A;  1YX7 A;  1TTX A;  2LLU A;  1TCF A;  1QS7 A;  1WDC B;  1YVH A;  4GBA A;  2A4J A;  4DIR A;  4F0Z B;  2COL B;  1C7W A;  3OB2 B;  1S6C A;  1CNP A;  4I5K A;  3VRR A;  2LUC A;  5K89 A;  3E3R A;  3QRX A;  1MQ1 A;  2LLT A;  2EC6 B;  2GGZ A;  5I2O A;  2JZI A;  3SG5 A;  3DVK A;  3FWB A;  1SCM C;  4C0L A;  1EH2 A;  5ER5 A;  4P2Y B;  4PAL A;  1U5I A;  2KQ6 A;  1J1E A;  1UWO A;  2NCP A;  4M2P A;  3A8R A;  3DD4 A;  3WNX B;  4MRX A;  1L2O C;  4GNK B;  1B7T Z;  1J7P A;  1F70 A;  1S26 D;  3D0Y B;  1A03 A;  1SKT A;  2F3Z A;  1M45 A;  5I2Q A;  1CKK A;  4BY5 A;  1EL4 A;  3O6B A;  4MVF A;  4PDZ A;  3I5I C;  4YGE B;  4Q04 A;  1KK8 C;  1JFK A;  1MWN A;  1XFZ O;  2WCF A;  3GK1 A;  3CLN A;  3DF0 B;  2FJU B;  1H8B A;  2FCD A;  2BCA A;  2K61 A;  5HLV A;  1DJI A;  3NSO A;  1GGZ A;  3CGA A;  1K9U A;  3DVE A;  1AVS A;  3BUX B;  1CFP A;  2KI4 C;  4ORA B;  1IKU A;  4N1F A;  4YI8 A;  1XFU O;  2KQY A;  1D1O A;  3BUM B;  1IQ3 A; 
#chains in the Genus database with same CATH topology
 2Y1N A;  3B88 A;  2RGI A;  2LVI A;  3LK0 A;  1YUU A;  3SS5 A;  4NDD A;  4CFR A;  2BCX A;  3CS1 A;  2LHI A;  3OB1 B;  5CPV A;  1XO5 A;  1UHN A;  1K2H A;  1SRA A;  4D1E A;  3ZWH A;  3FE9 A;  1UUS A;  2JTT A;  1Y6W A;  2GTE A;  4CPV A;  4YGD B;  1A29 A;  4MZJ A;  2BEC A;  1XK4 C;  2M49 B;  5AXI A;  3I5G C;  3WHU B;  3O78 A;  4PE7 A;  4M2O A;  1S5G Z;  1SCM B;  3CDN A;  3DY9 A;  1Y1U A;  4MEW A;  2K7B A;  3R1O A;  1F4O A;  2NXQ A;  5HKZ A;  1QV0 A;  1L2O B;  1XFV O;  4C0K A;  2WCJ A;  2LLS A;  3ICB A;  5BPJ A;  4PE1 A;  1Q80 A;  1B7T Y;  2BKH B;  2LMV A;  2WCH A;  1WY9 A;  1QLS A;  2H61 C;  1PVA A;  3I5I B;  1OSA A;  2E6W A;  2I7A A;  4GGF A;  1KK8 B;  1PRW A;  3Q8I A;  1BLQ A;  1FF1 A;  5CSJ A;  2KBI A;  2L0P A;  4MZL A;  1SPY A;  1A75 A;  1NX2 A;  1J55 A;  5JOL A;  4OVN F;  3TDU A;  1SMG A;  3D76 A;  1CDN A;  2JXL A;  3CR2 A;  2V53 A;  3I5F C;  1DGV A;  5FYX A;  5I94 A;  1W9Z A;  2F3Y A;  3EK4 A;  1OZS A;  1HT9 A;  2WCK A;  3IVT A;  3AAK A;  3VRP A;  1YR5 A;  3BUO B;  1JWD A;  5ER4 X;  3M0W A;  1LA0 A;  2KYF A;  2B1U A;  1OOG A;  2LVK A;  2P70 A;  2ZN8 A;  3JTD C;  1LVC D;  3FE8 A;  2HET A;  1TNX A;  3PAT A;  4AOM A;  2CT9 A;  1F54 A;  2M29 A;  2L2E A;  4N5X A;  1BOD A;  2KBM A;  1LIN A;  1FI6 A;  1XVJ A;  1B47 A;  1HQV A;  1MR8 A;  1SL7 A;  1WRZ A;  2K2F A;  3LLE A;  3VRO A;  2BNX A;  2M0R A;  3WHT B;  1YUR A;  1DGU A;  4MN0 A;  1RRO A;  4XJK B;  3BOW B;  4OKH A;  2WC8 A;  1Z2C B;  2LVV A;  2QAC A;  1EJ3 A;  2JUL A;  3KHE A;  1CDL A;  2QEB A;  2MJW B;  1BU3 A;  2JT8 A;  4P5O E;  3SIA A;  1QVI Y;  1L7Z A;  2JU0 A;  3NHT A;  2KI6 C;  2QEO A;  3R72 A;  2AAO A;  2LVJ A;  4JQ0 D;  5KU1 A;  1XFX O;  1FI5 A;  1DJZ A;  1EG3 A;  4M2Q A;  1F4Q A;  1ORG A;  3D74 A;  1AK8 A;  2HQ8 A;  1CM4 A;  3CZ2 A;  3EVV A;  1QTX A;  2Q91 A;  3PFV A;  3S0B A;  3SJS A;  3R1V A;  4FTG A;  4YRU A;  2BCB A;  4F7F A;  3OGN A;  4E68 A;  3CZT X;  2MRD A;  2H8V A;  1Y1X A;  3I5F B;  4YGB B;  4DS7 A;  3SIB A;  1MF8 B;  1OZO A;  2LC5 A;  3SG3 A;  1F71 A;  2M8U A;  1KFX S;  1SCV A;  2D8N A;  2L5Y A;  4WQ2 A;  2Q4U A;  4PE4 A;  2KFG A;  2LAP A;  4WRI A;  1H4B A;  5CSF A;  1ZMZ A;  2DOQ A;  2JC2 A;  2LMU A;  3S0F A;  3NHI A;  1TNW A;  4AQI A;  3JTD B;  1KK7 Z;  1SYM A;  1JSA A;  1DJX A;  5CSN A;  5KSZ A;  4HSZ A;  1OOI X;  1K93 D;  5CSI A;  1UHJ A;  1K8U A;  4ZCV A;  5AAN A;  2WCL A;  4MSP A;  4C0J A;  2JWW A;  3K21 A;  3RZS A;  4IL1 A;  3OX6 A;  3OX5 A;  1F8H A;  4XYN A;  1DT7 B;  2KLE A;  1IG5 A;  3CZ1 A;  1Y0V H;  5KTY A;  1GQM A;  2M1K B;  2KFH A;  1OW4 A;  2MAZ A;  3BYA A;  1Z4H A;  2M97 A;  3BFH A;  5G08 A;  2BKI B;  3CR4 X;  1Y1A A;  1U5I B;  3DF0 A;  2LP2 A;  4R1E A;  5AEQ A;  1TN4 A;  3GOF A;  3SS3 A;  2JNX A;  1CMF A;  4INW A;  3NSK A;  1AJ4 A;  5F6T A;  4U8D A;  1PVB A;  1A4P A;  1QAS A;  1RFJ A;  2BE4 A;  5DIC A;  4CFQ A;  4PE0 A;  1MHO A;  3MSE B;  1SL8 A;  1QAT A;  2K60 A;  2KGR A;  2R2I A;  1NSH A;  2M7N A;  4GGF C;  5AFP A;  3IF7 A;  1RJV A;  3BUW B;  1JF0 A;  1TIZ A;  1K90 D;  2IS9 A;  2KPH A;  2CNP A;  1VRK A;  1GJY A;  1S36 A;  3L47 A;  2CCM A;  1K94 A;  1OMD A;  2LNK A;  3HCM A;  1BOC A;  1LA3 A;  4QJ3 B;  1BMO A;  1NCZ A;  2AMI A;  2Y5I A;  1B8L A;  1QX5 B;  1WRL A;  2CTN A;  4I5J A;  3OBV A;  3GK2 A;  1MUX A;  2HQW A;  1OOH A;  1WLM A;  1M46 A;  3O4X A;  2BBM A;  1MXL C;  2F2P A;  4MBE A;  3RM1 A;  4QJ5 B;  1IIO A;  2WC5 A;  4JWQ A;  3BFA A;  3KEV A;  4YGA A;  2JPT A;  1JBA A;  2HF5 A;  1KK7 Y;  1QVI Z;  4USL A;  2F8P A;  2JT3 A;  1QXP A;  4I5N B;  2M7L A;  3FS7 A;  2KGB C;  2I2R E;  3AAJ A;  2BBN A;  4JD9 A;  1OMV A;  3CR5 X;  5HKW A;  2ZND A;  2KI6 D;  1QIW A;  5D3O A;  2ZRT A;  1KSO A;  2LCP A;  2F2O A;  4NQG A;  3S0E A;  1K9P A;  2M1U A;  1IJ6 A;  2MLE C;  3EVR A;  2NCO A;  1K96 A;  5FI2 A;  4AQJ A;  1CFF A;  1RWY A;  1J7R A;  1KWO C;  1M31 A;  4CLN A;  3IQO A;  3LCP C;  2KI4 B;  1IH0 A;  1FPW A;  2KAV A;  2TN4 A;  3LL8 B;  3EKH A;  2NLN A;  1KCY A;  5PAL A;  1DF0 B;  1B1G A;  4OZD A;  2PSR A;  4ORC B;  4WQ3 A;  3D78 A;  3TUY C;  3O4Y A;  2GV5 A;  1W7J B;  1DEL A;  3VRQ A;  1TWO A;  2K7D A;  1TOP A;  1V1G A;  1C07 A;  2OPO A;  3BUN B;  1DJW A;  5DKQ A;  1DJG A;  1PSB A;  2EGD A;  3R1P A;  2L50 A;  3VGO A;  4JPZ B;  4MRY A;  3KO0 A;  2NZ0 A;  2QEV A;  3VB1 A;  1IRJ A;  1DC1 A;  1QV1 A;  3I5G B;  5I2L A;  3D73 A;  1BR4 B;  3EVU A;  3BOW A;  4XJK A;  3WXA A;  2WOS A;  1K9K A;  3BXK A;  3NXA A;  1SSE B;  1IWQ A;  1PSR A;  3PLF B;  2PVB A;  1S6I A;  3EK7 A;  1AHR A;  1KSM A;  1X02 A;  3D77 A;  2I94 A;  1CFC A;  3SG4 A;  4YI9 A;  4OR9 B;  1PK0 D;  2CXJ A;  2EHB A;  1BG1 A;  4HRG A;  1XA5 A;  3NSL A;  1QX2 A;  1J7O A;  2K7O A;  3D75 A;  2PAL A;  1DTL A;  1FW4 A;  4TNC A;  1N0Y A;  2ZNE A;  3B7A A;  2LV7 A;  1A2X A;  2JNF A;  4ORB B;  2KOT A;  1KWO B;  4PCW A;  1UUR A;  3CTN A;  1ALV A;  2ZFD A;  5I8N A;  3A4U B;  2PAS A;  2PRU A;  1NPQ A;  1RTP 1;  1OE9 B;  2G2B A;  2LHL A;  2KFF A;  2P6B B;  2PMY A;  4GFT A;  2KSP A;  1YTZ C;  3I5H C;  1SNL A;  2JXC A;  2PYQ A;  2KYC A;  1BJF A;  3TUY B;  4GPL B;  1OQP A;  1AJ5 A;  1ZFS A;  3F45 A;  3TZ1 A;  1JUO A;  2KHN A;  1DQE A;  1R2U A;  1GM0 A;  4DRW A;  4ETO A;  3KF9 A;  2K7C A;  2PQL A;  5IBW A;  3PAL A;  1B9A A;  1NCX A;  1KFU S;  1ZOT B;  4FQT A;  1RK9 A;  3PM2 A;  3D0Y A;  2ERB A;  1SR6 C;  4UPG A;  2FCE A;  3H4S E;  1N2D A;  1IQ5 A;  2CBL A;  4CID A;  1SW8 A;  1B4C A;  1SL9 A;  1QIV A;  2OS8 C;  5GQQ C;  1E8A A;  3AKA A;  5D7F A;  2ZRS A;  1M63 B;  4PHK A;  3FE6 A;  1CLB A;  5DKN A;  1G4Y R;  1G8I A;  5FI7 A;  4ZCU A;  2L4I A;  1DMO A;  1BR1 B;  5JJG A;  3O2P A;  2WCM A;  4JKT A;  1V1F A;  1CFD A;  2KNE A;  2L51 A;  3EKJ A;  4NDB A;  1CDM A;  1WLZ A;  1LKJ A;  4L9M A;  1XYD A;  1EG4 A;  4PT1 A;  5FI6 A;  5J3X A;  1QJT A;  1EXR A;  1TNP A;  3FIA A;  3K1E A;  3RLZ A;  4YBH B;  1YUT A;  1OMR A;  1WRK A;  2Y4Q A;  1J1D A;  2LUX A;  3IQQ A;  2WC6 A;  1BT6 A;  2LAN A;  3C1V A;  2VRG A;  1MXE A;  1NYA A;  2JTZ A;  2K8M B;  2O60 A;  2MA2 A;  3KPX A;  4IJ7 A;  4DCK A;  2JRF A;  1B8C A;  1CTR A;  1UP5 A;  2WND A;  2KAY A;  1NX3 A;  4GAO A;  4DUQ A;  1BF5 A;  2JQ6 A;  3SS4 A;  2BL0 C;  2JOJ A;  1TCO B;  3V2L A;  3ZNI A;  1NUB A;  1LS8 A;  1DJY A;  3OP0 A;  3PM8 A;  1S1E A;  2L5X B;  3DZT A;  2HPS A;  2K0J A;  3OHM B;  3PJI A;  3I5H B;  2FOT A;  1AUI B;  3JVT C;  4MLW A;  4OCI A;  3BFB A;  1KQM C;  2WOR A;  5HLO A;  1M39 A;  1ODB A;  1C7V A;  4MZK A;  1UHI A;  2ZN9 A;  4A4B A;  3PSR A;  1TUJ A;  1XFR A;  2BAP A;  3CZ0 A;  2LP3 A;  1CM1 A;  1SR6 B;  4A4C A;  1QWV A;  3DVM A;  2LE9 B;  2OS8 B;  5B8I B;  1P28 A;  1GGW A;  2H2K A;  1IGV A;  1AP4 A;  1DJH A;  3B6X A;  4N1G A;  3S0D A;  1NCY A;  1YVL A;  1ALW A;  2AUC A;  4YGC B;  4NDC A;  1B8R A;  3TS5 C;  1CLM A;  1KFX L;  3FWC A;  1UHH A;  3EG5 B;  3NSI A;  2OTG C;  1G33 A;  1DEK A;  2M9G A;  3PN7 C;  1W7I B;  2I18 A;  1UHK A;  1ZUZ A;  2LMT A;  3S0G A;  1PUL A;  1PAL A;  1OOF A;  3DVJ A;  4PHJ A;  1KQV A;  2MHH A;  1A75 B;  1IJ5 A;  1DF0 A;  1C3Y A;  5AER A;  4PHM A;  2G9B A;  2KLD A;  4HRH A;  2MLF C;  1NIW A;  5TNC A;  1KFU L;  2BL0 B;  1NP8 A;  2E30 A;  1S3P A;  1WDC C;  2L4H A;  2BE6 A;  2Y1M A;  5DKR A;  2JT0 A;  3BQ3 A;  1NX0 A;  2MBX A;  1YRT B;  2JPO A;  1NWD A;  3TDZ A;  3JVT B;  1NX1 A;  1R6P A;  2L98 A;  2QEH A;  3D10 A;  1SBJ A;  1XK4 A;  4PHN A;  1KQM B;  1YX8 A;  1S6J A;  1CDP A;  2QDI A;  1J7Q A;  1F55 A;  1TRF A;  2EC6 C;  4OV2 A;  4I5L B;  1TNQ A;  1N65 A;  4QJ4 B;  2KDH A;  3VRN A;  3CWG A;  1OOJ A;  1JC2 A;  3L4A A;  2ISD A;  2YGU A;  3SG7 A;  2H61 A;  5HYD A;  4BY4 A;  1CLL A;  1XFW O;  1JF2 A;  1SY9 A;  1YUS A;  5HKY A;  1DVI A;  1QX7 A;  1XFY O;  2F33 A;  1CB1 A;  1ZAC A;  1YRU B;  4GUK A;  1QLK A;  2ZKM X;  1REC A;  1S5G Y;  3TS5 B;  3GK4 X;  4ICB A;  2LM5 A;  4FQO A;  3HX4 A;  3SG2 A;  2OTG B;  4HRE E;  1LXF C;  3PN7 B;  2WCE A;  2GGM A;  1SK6 D;  1JFJ A;  2KAX A;  2SCP A;  3B87 A;  3LK1 A;  2M3W A;  3CYZ A;  5D69 A;  3SG6 A;  3AKB A;  4GGN A;  2O5G A;  3N7H A;  1K95 A;  1FBV A;  3TDI A;  2QPT A;  2P71 A;  3EK8 A;  1TUZ A;  2WCB A;  1CMG A;  2K2A A;  2SAS A;  1YX7 A;  1TTX A;  2LLU A;  1TCF A;  1QS7 A;  1WDC B;  1YVH A;  4GBA A;  2A4J A;  4DIR A;  4F0Z B;  2COL B;  1C7W A;  3OB2 B;  1S6C A;  1CNP A;  4INX A;  4I5K A;  5EL2 A;  3VRR A;  2LUC A;  5K89 A;  3DYE A;  3E3R A;  3QRX A;  1MQ1 A;  2LLT A;  2EC6 B;  2GGZ A;  3UO9 A;  5I2O A;  2JZI A;  3BJH A;  3DVK A;  3FWB A;  1SCM C;  3SG5 A;  4C0L A;  1EH2 A;  5ER5 A;  4P2Y B;  4PAL A;  1U5I A;  2KQ6 A;  1J1E A;  1UWO A;  2NCP A;  4M2P A;  3A8R A;  3DD4 A;  3WNX B;  3B86 A;  4MRX A;  1L2O C;  4GNK B;  1B7T Z;  1J7P A;  1T14 A;  1F70 A;  1S26 D;  3D0Y B;  1A03 A;  1SKT A;  2F3Z A;  1M45 A;  5I2Q A;  1CKK A;  4BY5 A;  1EL4 A;  3O6B A;  4MVF A;  3QME A;  4PDZ A;  5HL1 A;  1C3Z A;  3I5I C;  4YGE B;  4Q04 A;  1KK8 C;  1JFK A;  1MWN A;  1XFZ O;  2WCF A;  3GK1 A;  3CLN A;  3DF0 B;  2FJU B;  1H8B A;  2FCD A;  3UNW A;  3L4L A;  2L2C A;  2BCA A;  2K61 A;  5HLV A;  1DJI A;  3NSO A;  1GGZ A;  3CGA A;  1K9U A;  3S0A A;  3DVE A;  1AVS A;  4KYN A;  3BUX B;  3CAB A;  3NGV A;  1CFP A;  2KI4 C;  4ORA B;  1IKU A;  4N1F A;  4YI8 A;  3DXL A;  1XFU O;  2KQY A;  1D1O A;  2FJY A;  3BUM B;  1IQ3 A; 
#chains in the Genus database with same CATH homology
 2Y1N A;  2RGI A;  2LVI A;  3LK0 A;  1YUU A;  3SS5 A;  4NDD A;  4CFR A;  2BCX A;  3CS1 A;  2LHI A;  3OB1 B;  5CPV A;  1XO5 A;  1UHN A;  1K2H A;  1SRA A;  4D1E A;  3ZWH A;  1UUS A;  2JTT A;  1Y6W A;  4CPV A;  4YGD B;  1A29 A;  4MZJ A;  2BEC A;  1XK4 C;  2M49 B;  5AXI A;  3I5G C;  3WHU B;  3O78 A;  4PE7 A;  4M2O A;  1S5G Z;  1SCM B;  1Y1U A;  4MEW A;  2K7B A;  1F4O A;  2NXQ A;  5HKZ A;  1QV0 A;  1L2O B;  1XFV O;  4C0K A;  3ICB A;  2LLS A;  5BPJ A;  4PE1 A;  1Q80 A;  1B7T Y;  2BKH B;  2LMV A;  1WY9 A;  1QLS A;  2H61 C;  1PVA A;  3I5I B;  1OSA A;  2E6W A;  2I7A A;  4GGF A;  1KK8 B;  1PRW A;  1BLQ A;  1FF1 A;  5CSJ A;  2KBI A;  2L0P A;  4MZL A;  1SPY A;  1A75 A;  1NX2 A;  1J55 A;  4OVN F;  3TDU A;  1SMG A;  1CDN A;  2JXL A;  3CR2 A;  2V53 A;  3I5F C;  1DGV A;  5FYX A;  5I94 A;  1W9Z A;  2F3Y A;  3EK4 A;  1OZS A;  1HT9 A;  3VRP A;  3AAK A;  1JWD A;  1YR5 A;  3BUO B;  3IVT A;  5ER4 X;  3M0W A;  1LA0 A;  2KYF A;  2B1U A;  2LVK A;  2ZN8 A;  3JTD C;  1LVC D;  2HET A;  1TNX A;  3PAT A;  4AOM A;  2CT9 A;  1F54 A;  2M29 A;  2L2E A;  4N5X A;  1BOD A;  2KBM A;  1LIN A;  1FI6 A;  1XVJ A;  1B47 A;  1HQV A;  1MR8 A;  1SL7 A;  1WRZ A;  2K2F A;  3LLE A;  3VRO A;  3WHT B;  2M0R A;  2BNX A;  1YUR A;  1DGU A;  4MN0 A;  1RRO A;  4XJK B;  3BOW B;  4OKH A;  2WC8 A;  1Z2C B;  2LVV A;  2QAC A;  1EJ3 A;  2JUL A;  3KHE A;  1CDL A;  2MJW B;  1BU3 A;  2JT8 A;  4P5O E;  3SIA A;  1QVI Y;  1L7Z A;  2JU0 A;  2KI6 C;  2AAO A;  2LVJ A;  4JQ0 D;  5KU1 A;  1XFX O;  1FI5 A;  1DJZ A;  1EG3 A;  4M2Q A;  1F4Q A;  1AK8 A;  2HQ8 A;  1CM4 A;  3EVV A;  3PFV A;  1QTX A;  2Q91 A;  3SJS A;  4FTG A;  4YRU A;  2BCB A;  4E68 A;  3CZT X;  2MRD A;  1Y1X A;  3I5F B;  4YGB B;  4DS7 A;  3SIB A;  1MF8 B;  1OZO A;  2LC5 A;  3SG3 A;  1F71 A;  2M8U A;  1KFX S;  1SCV A;  2D8N A;  4WQ2 A;  4WRI A;  2Q4U A;  4PE4 A;  2KFG A;  2LAP A;  5F6T A;  1H4B A;  5CSF A;  1ZMZ A;  2DOQ A;  2JC2 A;  2LMU A;  1TNW A;  4AQI A;  3JTD B;  1KK7 Z;  1SYM A;  1JSA A;  1DJX A;  5CSN A;  5KSZ A;  4HSZ A;  1K93 D;  5CSI A;  1UHJ A;  1K8U A;  4ZCV A;  5AAN A;  4MSP A;  4C0J A;  2JWW A;  3K21 A;  4IL1 A;  3OX6 A;  3OX5 A;  1F8H A;  4XYN A;  1DT7 B;  5KTY A;  1IG5 A;  2KLE A;  1Y0V H;  1GQM A;  2M1K B;  2KFH A;  2MAZ A;  3BYA A;  2M97 A;  1Z4H A;  5G08 A;  2BKI B;  3CR4 X;  1Y1A A;  1U5I B;  3DF0 A;  2LP2 A;  4R1E A;  5AEQ A;  1TN4 A;  3GOF A;  3SS3 A;  2JNX A;  1CMF A;  3NSK A;  1AJ4 A;  4U8D A;  1PVB A;  1A4P A;  1QAS A;  1RFJ A;  2BE4 A;  4CFQ A;  4PE0 A;  1MHO A;  3MSE B;  1SL8 A;  1QAT A;  2KGR A;  2R2I A;  2K60 A;  1NSH A;  2M7N A;  4GGF C;  5AFP A;  3IF7 A;  1RJV A;  3BUW B;  1JF0 A;  1TIZ A;  1K90 D;  2IS9 A;  2CNP A;  1VRK A;  1GJY A;  1S36 A;  2CCM A;  1K94 A;  1OMD A;  2LNK A;  3HCM A;  1BOC A;  1LA3 A;  4QJ3 B;  1BMO A;  1NCZ A;  2AMI A;  2Y5I A;  1B8L A;  1QX5 B;  1WRL A;  2CTN A;  4I5J A;  3OBV A;  3GK2 A;  1MUX A;  2HQW A;  1WLM A;  1M46 A;  3O4X A;  2BBM A;  1MXL C;  2F2P A;  4MBE A;  3RM1 A;  4QJ5 B;  4JWQ A;  3KEV A;  4YGA A;  2JPT A;  1JBA A;  2HF5 A;  1KK7 Y;  1QVI Z;  4USL A;  2F8P A;  2JT3 A;  1QXP A;  4I5N B;  2M7L A;  3FS7 A;  2KGB C;  2I2R E;  3AAJ A;  2BBN A;  1OMV A;  3CR5 X;  5HKW A;  2ZND A;  2KI6 D;  1QIW A;  5D3O A;  2ZRT A;  1KSO A;  2LCP A;  2F2O A;  4NQG A;  1K9P A;  2M1U A;  1IJ6 A;  2MLE C;  3EVR A;  2NCO A;  1K96 A;  5FI2 A;  4AQJ A;  1CFF A;  1RWY A;  1J7R A;  1KWO C;  1M31 A;  4CLN A;  3IQO A;  3LCP C;  2KI4 B;  1IH0 A;  1FPW A;  2KAV A;  2TN4 A;  3LL8 B;  3EKH A;  2NLN A;  1KCY A;  5PAL A;  1DF0 B;  1B1G A;  2PSR A;  4ORC B;  4WQ3 A;  3TUY C;  3O4Y A;  2GV5 A;  1W7J B;  3VRQ A;  1DEL A;  2K7D A;  1TOP A;  1V1G A;  1C07 A;  2OPO A;  3BUN B;  1DJW A;  5DKQ A;  1DJG A;  1PSB A;  2EGD A;  2L50 A;  3VGO A;  4JPZ B;  4MRY A;  3KO0 A;  2NZ0 A;  1IRJ A;  1DC1 A;  1QV1 A;  3I5G B;  5I2L A;  3EVU A;  1BR4 B;  4XJK A;  3BOW A;  3WXA A;  2WOS A;  1K9K A;  3BXK A;  3NXA A;  1IWQ A;  1PSR A;  3PLF B;  2PVB A;  1S6I A;  3EK7 A;  1AHR A;  1KSM A;  1X02 A;  2I94 A;  1CFC A;  3SG4 A;  4YI9 A;  4OR9 B;  1PK0 D;  2CXJ A;  2EHB A;  1BG1 A;  4HRG A;  1XA5 A;  3NSL A;  1QX2 A;  1J7O A;  2K7O A;  2PAL A;  1DTL A;  1FW4 A;  4TNC A;  1N0Y A;  2ZNE A;  2LV7 A;  1A2X A;  2JNF A;  4ORB B;  2KOT A;  1KWO B;  4PCW A;  1UUR A;  3CTN A;  1ALV A;  2ZFD A;  5I8N A;  3A4U B;  2PAS A;  2PRU A;  1NPQ A;  1RTP 1;  1OE9 B;  2G2B A;  2LHL A;  2KFF A;  2P6B B;  2PMY A;  4GFT A;  2KSP A;  1YTZ C;  3I5H C;  1SNL A;  2JXC A;  1BF5 A;  2KYC A;  1BJF A;  3TUY B;  4GPL B;  1OQP A;  1AJ5 A;  1ZFS A;  3F45 A;  3TZ1 A;  1JUO A;  2KHN A;  1R2U A;  4DRW A;  4ETO A;  3KF9 A;  2K7C A;  5IBW A;  3PAL A;  1B9A A;  1NCX A;  1KFU S;  1ZOT B;  1RK9 A;  3PM2 A;  3D0Y A;  4UPG A;  1SR6 C;  2FCE A;  3H4S E;  1N2D A;  1IQ5 A;  2CBL A;  4CID A;  1SW8 A;  1B4C A;  1SL9 A;  1QIV A;  2OS8 C;  5GQQ C;  1E8A A;  3AKA A;  5D7F A;  2ZRS A;  1M63 B;  4PHK A;  1CLB A;  5DKN A;  1G4Y R;  1G8I A;  4ZCU A;  5FI7 A;  2L4I A;  1DMO A;  1BR1 B;  5JJG A;  3O2P A;  4JKT A;  1V1F A;  1CFD A;  2KNE A;  2L51 A;  3EKJ A;  4NDB A;  1CDM A;  1WLZ A;  1LKJ A;  4L9M A;  1XYD A;  1EG4 A;  5JOL A;  5J3X A;  3RLZ A;  1QJT A;  1EXR A;  1TNP A;  3FIA A;  4YBH B;  1YUT A;  1OMR A;  1WRK A;  2Y4Q A;  1J1D A;  2LUX A;  3IQQ A;  1BT6 A;  2LAN A;  3C1V A;  2VRG A;  1MXE A;  1NYA A;  2JTZ A;  2K8M B;  2O60 A;  2MA2 A;  3KPX A;  4IJ7 A;  4DCK A;  2JRF A;  1B8C A;  1CTR A;  1UP5 A;  2WND A;  2KAY A;  1NX3 A;  4GAO A;  4DUQ A;  2JQ6 A;  3SS4 A;  2BL0 C;  2JOJ A;  1TCO B;  3ZNI A;  1NUB A;  3OP0 A;  1DJY A;  3PM8 A;  1S1E A;  2L5X B;  3OHM B;  2HPS A;  2K0J A;  4OCI A;  3I5H B;  2FOT A;  1AUI B;  3JVT C;  4MLW A;  1KQM C;  2WOR A;  5HLO A;  1M39 A;  1ODB A;  1C7V A;  4MZK A;  1UHI A;  2ZN9 A;  4A4B A;  3PSR A;  2BAP A;  2LP3 A;  1CM1 A;  1SR6 B;  4A4C A;  3DVM A;  2LE9 B;  2OS8 B;  5B8I B;  1GGW A;  2H2K A;  1IGV A;  1AP4 A;  1DJH A;  4N1G A;  1NCY A;  1YVL A;  1ALW A;  2AUC A;  4YGC B;  4NDC A;  1B8R A;  3TS5 C;  1CLM A;  1KFX L;  3FWC A;  1UHH A;  3EG5 B;  3NSI A;  2OTG C;  1G33 A;  1DEK A;  2M9G A;  3PN7 C;  1W7I B;  2I18 A;  1UHK A;  1ZUZ A;  2LMT A;  1PUL A;  1PAL A;  4PHJ A;  3DVJ A;  1KQV A;  2MHH A;  1A75 B;  1IJ5 A;  1DF0 A;  5AER A;  4PHM A;  2G9B A;  2KLD A;  4HRH A;  2MLF C;  1NIW A;  5TNC A;  1KFU L;  2BL0 B;  1NP8 A;  2E30 A;  1S3P A;  1WDC C;  2L4H A;  2BE6 A;  2Y1M A;  5DKR A;  2JT0 A;  3BQ3 A;  1NX0 A;  2MBX A;  1YRT B;  1NWD A;  3TDZ A;  3JVT B;  1NX1 A;  1R6P A;  2L98 A;  3D10 A;  1SBJ A;  1XK4 A;  4PHN A;  1KQM B;  1YX8 A;  1S6J A;  1CDP A;  1J7Q A;  1F55 A;  1TRF A;  2EC6 C;  4OV2 A;  4I5L B;  1TNQ A;  1N65 A;  4QJ4 B;  2KDH A;  3VRN A;  3CWG A;  1OOJ A;  1JC2 A;  2ISD A;  2YGU A;  3SG7 A;  2H61 A;  5HYD A;  4BY4 A;  1CLL A;  1XFW O;  1JF2 A;  1SY9 A;  1YUS A;  5HKY A;  2L5Y A;  1DVI A;  1QX7 A;  1XFY O;  2F33 A;  1CB1 A;  5FI6 A;  1ZAC A;  1YRU B;  4GUK A;  1QLK A;  2ZKM X;  1REC A;  1S5G Y;  3TS5 B;  3GK4 X;  4ICB A;  2LM5 A;  4FQO A;  3HX4 A;  3SG2 A;  2OTG B;  4HRE E;  1LXF C;  3PN7 B;  2WCE A;  2GGM A;  1SK6 D;  1JFJ A;  2KAX A;  2SCP A;  3LK1 A;  2M3W A;  5D69 A;  3SG6 A;  3AKB A;  4GGN A;  2O5G A;  1K95 A;  1FBV A;  3TDI A;  2QPT A;  3EK8 A;  2WCB A;  1CMG A;  2K2A A;  2SAS A;  1YX7 A;  1TTX A;  2LLU A;  1TCF A;  1QS7 A;  1WDC B;  1YVH A;  4GBA A;  2A4J A;  4DIR A;  4F0Z B;  2COL B;  1C7W A;  3OB2 B;  1S6C A;  1CNP A;  4I5K A;  3VRR A;  2LUC A;  5K89 A;  3E3R A;  3QRX A;  1MQ1 A;  2LLT A;  2EC6 B;  2GGZ A;  3UO9 A;  5I2O A;  2JZI A;  3SG5 A;  3DVK A;  3FWB A;  1SCM C;  4C0L A;  1EH2 A;  5ER5 A;  4P2Y B;  4PAL A;  1U5I A;  2KQ6 A;  1J1E A;  1UWO A;  2NCP A;  4M2P A;  3A8R A;  3DD4 A;  3WNX B;  4MRX A;  1L2O C;  4GNK B;  1B7T Z;  1J7P A;  1F70 A;  1S26 D;  3D0Y B;  1A03 A;  1SKT A;  2F3Z A;  1M45 A;  5I2Q A;  1CKK A;  4BY5 A;  1EL4 A;  3O6B A;  4MVF A;  4PDZ A;  5HL1 A;  3I5I C;  4YGE B;  4Q04 A;  1KK8 C;  1JFK A;  1MWN A;  1XFZ O;  2WCF A;  3GK1 A;  3CLN A;  3DF0 B;  2FJU B;  1H8B A;  2FCD A;  3UNW A;  2BCA A;  2K61 A;  5HLV A;  1DJI A;  3NSO A;  1GGZ A;  3CGA A;  1K9U A;  3DVE A;  1AVS A;  4KYN A;  3BUX B;  1CFP A;  2KI4 C;  4ORA B;  1IKU A;  4N1F A;  4YI8 A;  1XFU O;  2KQY A;  1D1O A;  3BUM B;  1IQ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...