4I5KA

Pp2a pr70 holoenzyme model3_dica_rcsb.pdb bppnat5_extend.mtz
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
272
structure length
266
Chain Sequence
NHHDDASKFICLLAKPNCSSLEQEDFIPLLQDVVDTHPGLTFLKDAPEFHSRYITTVIQRIFYTVNRSWSGKITSTEIRKSNFLQTLALLEEEEDINQITDYFSYEHFYVIYCKFWELDTDHDLYISQADLSRYNDQASSSRIIERIFSGAVTKEGRMSYADFVWFLISEEDKRNPTSIEYWFRCMDVDGDGVLSMYELEYFYEEQCERMEAMGIEPLPFHDLLCQMLDLVKPAVDGKITLRDLKRCRMAHIFYDTFFNLEKYLDH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein phosphatase 2A regulatory subunit B
publication title Structure of the Ca(2+)-dependent PP2A heterotrimer and insights into Cdc6 dephosphorylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 98
structure length 266
sequence length 272
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
A PF17958 EF-hand_13 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4i5kA02
1.10.238.220 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Recoverin; domain 1 4i5kA01
1M45A 1M39A 1IRJA 1TNQA 4AOMA 4ETOA 2K7OA 1L7ZA 2LLSA 1AVSA 1YUUA 1ZFSA 4Q04A 1XFVO 2KHNA 1CM1A 2BCXA 2L51A 3CTNA 1KK8B 1HQVA 2KI4B 4MSPA 1LA3A 2GGZA 1JWDA 1C7VA 4CPVA 1TTXA 3EK8A 3SG5A 4L9MA 1W7JB 3KF9A 2LMUA 5I2QA 1K8UA 1NP8A 2KI4C 4AQIA 1B4CA 2SASA 3TDUA 1J7OA 1DJZA 4BY4A 4GAOA 4I5KA 1PSBA 1DJYA 2M0RA 2LV7A 1EL4A 2JNFA 1YVLA 4MZLA 4CFRA 3KO0A 1CKKA 2KFFA 3VRRA 1KWOC 3LL8B 1XA5A 2LLUA 2BKIB 1QS7A 3SIBA 5KU1A 1SPYA 1NSHA 1XO5A 1SL9A 1E8AA 1MR8A 2MA2A 2KAVA 3GK1A 1FBVA 1YTZC 3DF0A 2F3ZA 2M3WA 1FI6A 3I5HB 1ALVA 4PE0A 1MXLC 4I5LB 4TNCA 3K21A 1DGVA 3CLNA 3EK7A 1IG5A 3CS1A 2BCBA 2JT8A 2G2BA 1C07A 3SG7A 1BMOA 1L2OC 2RGIA 2CXJA 1RECA 5CSIA 2H2KA 1K9UA 2KFGA 3AKBA 4OVNF 2M9GA 2KI6C 1SW8A 1J7QA 4XJKA 3AKAA 2Y1MA 1F4QA 4P2YB 5I8NA 1BT6A 2LCPA 1FPWA 1RK9A 4MEWA 4PHNA 1SY9A 1OMVA 1CFCA 1UHJA 2M7LA 2CNPA 1V1GA 3DF0B 1IJ6A 1BF5A 1IGVA 2KFHA 4NDBA 1S1EA 1CDLA 1B47A 3JVTB 2KAXA 4N5XA 5ER4X 3WHTB 1IH0A 1XFYO 1XVJA 1ZMZA 4MBEA 2L4HA 2WCFA 3O4YA 4I5NB 2I7AA 3EVVA 1CMGA 2LUCA 2G9BA 2KAYA 2LVJA 3LK1A 4XJKB 2JXCA 1QIWA 3A4UB 1J55A 1WRLA 1BODA 1RTP1 1YRUB 3BUOB 2O5GA 3TZ1A 1YX8A 2WOSA 1K96A 1H4BA 2ZNDA 5J3XA 2LLTA 4GFTA 4WRIA 2KNEA 5AXIA 3I5FB 3TUYB 2KYCA 2TN4A 3DVJA 3IQOA 4N1GA 4C0KA 1JFJA 2FJUB 1NIWA 1M31A 1S5GY 1TCFA 1QV1A 2Y5IA 3MSEB 4A4CA 1AJ4A 5AEQA 2JT0A 1SCMB 1A03A 1S5GZ 3LCPC 2AAOA 1NX1A 2ISDA 5JOLA 2KSPA 2JXLA 1NCYA 2ZNEA 4PALA 1XFXO 1NX3A 2DOQA 3E3RA 2L0PA 1R6PA 4F0ZB 1CDMA 4OCIA 1VRKA 3RLZA 1JBAA 4AQJA 1QX2A 1UURA 2BE6A 1K9KA 1Q80A 2MLEC 1G33A 1B8RA 2K2FA 3JTDC 1AP4A 3FS7A 3SG3A 1SMGA 5K89A 1ODBA 1PVBA 2I18A 1RROA 2BCAA 2F33A 1SL7A 2BKHB 2ZN9A 1DJWA 3A8RA 2SCPA 1ZACA 3NSOA 1KQVA 1AUIB 1KQMC 4PE1A 1OSAA 1EJ3A 2NXQA 4PDZA 1EG4A 4HSZA 3WHUB 1TRFA 2EGDA 1W7IB 2BL0B 3WNXB 5DKQA 5D7FA 2WNDA 4N1FA 1F54A 5BPJA 1JFKA 1K94A 1WDCC 1RWYA 2BL0C 2PSRA 2PRUA 1K95A 1UUSA 2LVVA 1R2UA 2LM5A 4OV2A 1KCYA 3EVRA 2LVKA 2KGBC 1DGUA 1AHRA 1KWOB 3QRXA 2R2IA 1JF0A 4YRUA 4R1EA 1IQ5A 1CB1A 3BUWB 4M2PA 1SCVA 1SNLA 3EKJA 3ZNIA 4C0LA 4A4BA 2OS8C 2F8PA 1BG1A 1N0YA 2L98A 1NCXA 1SBJA 1TCOB 2CBLA 3I5IC 4JPZB 5ER5A 1QVIZ 3TDIA 4CLNA 1DT7B 1N65A 5CSFA 5TNCA 1L2OB 3BUMB 4DUQA 1MWNA 1SL8A 2ZRTA 1BLQA 2M1KB 1PK0D 2KQYA 2LMTA 2LMVA 4QJ4B 1C7WA 3PALA 2LP3A 5B8IB 1YVHA 2LVIA 2HETA 3BYAA 2MHHA 1MXEA 4NDDA 4ORAB 1XK4A 2QPTA 2Y1NA 1B8LA 2KDHA 1EXRA 2MLFC 2PVBA 1FI5A 2HF5A 1RJVA 4USLA 3DVEA 1A75A 3BXKA 3OX5A 3LK0A 2JNXA 4FTGA 2OPOA 3TDZA 1GGWA 2K2AA 1A2XA 1DTLA 5HYDA 2MJWB 2JPTA 1K9PA 2H61C 1XFUO 1G8IA 2JULA 2IS9A 3CWGA 3EVUA 1ZOTB 2WC8A 1KFUS 1QLKA 1TOPA 3PN7C 1UP5A 1OQPA 3DVKA 1J7RA 2KBMA 4CFQA 1B8CA 2K0JA 4CIDA 2HQWA 1F8HA 1ZUZA 1SRAA 2L50A 3CR2A 5JJGA 2K7CA 3SG4A 2Q91A 2JTTA 1M46A 3OP0A 1KK7Y 2WCBA 1QV0A 1QIVA 1BR4B 2L2EA 1EH2A 1XK4C 1A75B 1CFFA 1KK7Z 1S6JA 2JC2A 1KSMA 3LLEA 4OR9B 1OE9B 1NWDA 4I5JA 2KBIA 1B1GA 5IBWA 3ICBA 4YGBB 1KFUL 1WLMA 4PHMA 4MZJA 2BBMA 2FCDA 2I2RE 3AAKA 2HQ8A 1H8BA 1UHHA 5G08A 2L4IA 1TIZA 1K90D 3I5GB 1QXPA 5HKZA 1S6CA 2KOTA 3GOFA 1B7TZ 1U5IA 1CLBA 1NX2A 2FOTA 2MBXA 2HPSA 1F70A 3I5GC 3NSKA 1UHKA 4P5OE 3DD4A 1Y1XA 1MUXA 2KYFA 4WQ2A 3DVMA 1IKUA 4DRWA 1JSAA 5CSJA 1WLZA 3JTDB 1NUBA 2GV5A 2M7NA 2ZN8A 1BR1B 3CGAA 2E30A 1WRKA 1WRZA 3AAJA 4XYNA 2PMYA 5CPVA 2OTGC 1KQMB 4PHJA 3PLFB 2ZFDA 2CT9A 1DF0A 1LKJA 2M29A 2MAZA 3VRPA 2LAPA 1S3PA 1PULA 1CLMA 2LE9B 1CTRA 1GJYA 1MF8B 3VRQA 5HLOA 2FCEA 1U5IB 1SYMA 5KSZA 1YUTA 4HREE 1WDCB 2A4JA 1PSRA 2JU0A 3NSIA 3PFVA 1DJXA 1Y0VH 2B1UA 1XFZO 3HCMA 4M2QA 5I2OA 1DJGA 4D1EA 4YGAA 5KTYA 5CSNA 4ZCUA 1SK6D 3D0YA 1LA0A 1DF0B 1J1DA 1QJTA 3O2PA 4C0JA 3OB1B 3EKHA 1N2DA 1LINA 2BBNA 4ICBA 1D1OA 3SG2A 1M63B 3C1VA 2E6WA 2OS8B 4JQ0D 5D69A 1KFXS 2PALA 4ORBB 3I5IB 5PALA 4DCKA 2QACA 1Y1UA 3BOWA 3H4SE 1PALA 1CMFA 4PE7A 4FQOA 4GNKB 1QVIY 2H61A 2ZRSA 2EHBA 3KPXA 1JF2A 5DKRA 4ZCVA 1RFJA 2AUCA 4PHKA 3GK4X 4YI9A 2BE4A 2AMIA 1V1FA 1PRWA 2NZ0A 1K2HA 1KK8C 1XFWO 1CNPA 3KHEA 2KGRA 3OX6A 2CTNA 2K61A 2LANA 3HX4A 3D0YB 2Q4UA 4BY5A 1DVIA 1F71A 1PVAA 1NPQA 3PATA 1AK8A 1JUOA 1KFXL 2JT3A 3SIAA 5AFPA 2JWWA 3FWBA 1YX7A 4GBAA 4GPLB 1UHIA 4QJ5B 1QX5B 2MRDA 3CR5X 4HRGA 4OKHA 1AJ5A 1TNXA 2WCEA 4HRHA 1FF1A 5I2LA 1S26D 1A4PA 3BOWB 1CM4A 1KSOA 3WXAA 1F4OA 1SR6B 3GK2A 1QATA 2O60A 2LHLA 1Y6WA 3IQQA 1LXFC 2JZIA 2LNKA 1YUSA 1K93D 3O78A 2M1UA 2LHIA 1SKTA 3PN7B 1SR6C 1BOCA 1X02A 2KQ6A 3VRNA 1CDNA 3CR4X 1ALWA 3I5HC 4YGDB 1J7PA 2JOJA 2F3YA 4MRYA 3RM1A 1QTXA 3FWCA 1LVCD 1CDPA 4YI8A 2NLNA 1F55A 2LP2A 4IL1A 4YGEB 3BUNB 3NXAA 1CLLA 4DS7A 4YGCB 2NCOA 2P6BB 1G4YR 4MRXA 1TNWA 3D10A 4WQ3A 1YRTB 4GGFA 3IF7A 2F2PA 3BQ3A 3OB2B 3CZTX 1QX7A 1NYAA 2K7DA 5FYXA 1DJIA 2VRGA 1MHOA 1EG3A 5AANA 1GGZA 3JVTC 2LUXA 1B7TY 1MQ1A 4JWQA 5F6TA 3VROA 4QJ3B 3FIAA 4YBHB 3TS5B 5HKWA 4M2OA 5DKNA 1QASA 5HKYA 3NSLA 1S36A 1OZOA 1TN4A 1IWQA 2K7BA 3ZWHA 3EK4A 1XYDA 3TS5C 4UPGA 2LC5A 2OTGB 3F45A 1NX0A 1DMOA 1UHNA 2ZKMX 1HT9A 4PE4A 2CCMA 5GQQC 3M0WA 2EC6B 1OZSA 1QLSA 5AERA 1IQ3A 2M8UA 1DJHA 3KEVA 1YURA 4GGFC 1CFDA 3O6BA 2M49B 2PASA 1TNPA 2I94A 4DIRA 4MVFA 2EC6C 2JTZA 4NDCA 3I5FC 3TUYC 1B9AA 4U8DA 3VGOA 4NQGA 2D8NA 2M97A 3SJSA 2K8MB 1IJ5A 1BJFA 2L5XB 2BECA 1SCMC 4GGNA 4PCWA 2COLB 2JRFA 1FW4A 3SG6A 1S6IA 1OMDA 1WY9A 1UWOA 3BUXB 4E68A 4GUKA 1GQMA 1YR5A 4MN0A 3OHMB 1J1EA 2F2OA 2KI6D 3PSRA 2NCPA 1NCZA 2V53A 4MZKA 2JQ6A 1OMRA 4ORCB 2Y4QA 1Y1AA 1BU3A 1OOJA 2WORA 1JC2A 2GGMA 3PM8A 1CFPA 4MLWA 1A29A 5HLVA
chains in the Genus database with same CATH superfamily
1M45A 1M39A 1IRJA 1TNQA 4AOMA 4ETOA 2K7OA 4PT1A 1L7ZA 2LLSA 2YGUA 1AVSA 1YUUA 1ZFSA 4Q04A 1XFVO 2KHNA 1CM1A 2BCXA 2L51A 3CTNA 1KK8B 1HQVA 2KI4B 4MSPA 1LA3A 2GGZA 1JWDA 1C7VA 3OBVA 4CPVA 1TTXA 3EK8A 3SG5A 4L9MA 1W7JB 3KF9A 2LMUA 5I2QA 1K8UA 1NP8A 2KI4C 4AQIA 2WC5A 1B4CA 2SASA 3TDUA 1J7OA 1Z2CB 1DJZA 4BY4A 4GAOA 4I5KA 1PSBA 1DJYA 2M0RA 2LV7A 3L47A 1EL4A 2JNFA 1YVLA 4MZLA 4CFRA 3KO0A 1CKKA 2KFFA 3VRRA 1KWOC 3LL8B 1XA5A 2LLUA 2BKIB 1QS7A 3SIBA 5KU1A 1SPYA 3CDNA 1NSHA 1XO5A 1SL9A 1E8AA 1MR8A 2MA2A 2KAVA 3GK1A 1FBVA 1YTZC 3DF0A 2F3ZA 2KLEA 3D76A 1OOFA 2P71A 2M3WA 1FI6A 2L5YA 3I5HB 1ALVA 4PE0A 1MXLC 4I5LB 4TNCA 3K21A 1DGVA 3CLNA 3EK7A 3S0AA 1IG5A 3CS1A 2BCBA 1LS8A 2JT8A 2G2BA 1C07A 3SG7A 1BMOA 1L2OC 2RGIA 2CXJA 1RECA 5CSIA 2H2KA 1K9UA 2KFGA 3AKBA 4OVNF 2M9GA 2KI6C 1SW8A 2QDIA 1J7QA 4XJKA 1TWOA 3AKAA 2Y1MA 3CZ1A 1F4QA 4P2YB 3BFHA 5I8NA 1BT6A 3NHTA 2LCPA 1FPWA 1RK9A 1TUJA 4MEWA 1SY9A 4PHNA 1DC1A 1OMVA 3Q8IA 1UHJA 2M7LA 2CNPA 1CFCA 1V1GA 3DF0B 1IJ6A 1BF5A 1IGVA 2KFHA 4NDBA 1S1EA 1CDLA 1DEKA 1B47A 3JVTB 2KAXA 3D73A 4N5XA 5ER4X 3WHTB 1IH0A 1XFYO 1XVJA 1ZMZA 4MBEA 2L4HA 2WCFA 3O4YA 4I5NB 2I7AA 3EVVA 1CMGA 2LUCA 2G9BA 2KAYA 2LVJA 3LK1A 4XJKB 2JXCA 1QIWA 3A4UB 1J55A 1WRLA 1BODA 1RTP1 1YRUB 3BUOB 2O5GA 3TZ1A 1YX8A 2WOSA 1K96A 1Z4HA 3D74A 2ZNDA 5J3XA 1H4BA 2LLTA 3B6XA 4GFTA 4WRIA 2KNEA 5AXIA 3I5FB 1SSEB 2BAPA 2KYCA 2TN4A 3DVJA 3IQOA 4N1GA 3TUYB 4C0KA 2FJUB 1NIWA 1M31A 2WCHA 1S5GY 1TCFA 1QV1A 2Y5IA 3MSEB 4A4CA 1AJ4A 1TUZA 2JT0A 2P70A 5AEQA 1SCMB 3BJHA 3SS5A 3OGNA 1A03A 1S5GZ 3LCPC 2AAOA 1NX1A 2ISDA 5JOLA 2KSPA 2JXLA 2PYQA 1NCYA 2ZNEA 4PALA 1XFXO 1NX3A 2DOQA 3E3RA 2L0PA 1R6PA 4F0ZB 1XFRA 1CDMA 4OCIA 1VRKA 3RLZA 1JBAA 4AQJA 1QX2A 1UURA 2BE6A 1K9KA 1Q80A 2MLEC 1G33A 1B8RA 3B88A 2K2FA 3JTDC 1AP4A 3FS7A 3SG3A 1SMGA 5K89A 1ODBA 1PVBA 2I18A 1RROA 2BCAA 2F33A 1SL7A 2BKHB 2ZN9A 1DJWA 3A8RA 2SCPA 1ZACA 3NSOA 3CZ2A 1KQVA 4IJ7A 1AUIB 1KQMC 4PE1A 1OSAA 1EJ3A 2NXQA 4PDZA 1EG4A 4HSZA 3WHUB 1TRFA 2EGDA 1W7IB 2BL0B 3WNXB 2JPOA 5DKQA 1OW4A 3L4AA 5D7FA 5I94A 3O4XA 2WNDA 4N1FA 1F54A 5BPJA 1JFKA 1K94A 2PQLA 1WDCC 3DYEA 2WCLA 1RWYA 2BL0C 2PSRA 1ORGA 2PRUA 3VB1A 1K95A 2BNXA 1UUSA 2LVVA 1R2UA 2LM5A 2QEOA 4OV2A 1KCYA 1DQEA 3V2LA 3EVRA 2LVKA 2KGBC 1DGUA 1AHRA 1KWOB 3QRXA 3R72A 2R2IA 1JF0A 4YRUA 4R1EA 1IQ5A 1CB1A 3BUWB 4M2PA 1SCVA 1SNLA 3EKJA 3ZNIA 2QEBA 4C0LA 4A4BA 2OS8C 2F8PA 1BG1A 1N0YA 2L98A 1NCXA 1SBJA 1TCOB 2CBLA 2GTEA 3I5IC 4JPZB 1QVIZ 5ER5A 3TDIA 4CLNA 1DT7B 1N65A 5CSFA 5TNCA 1L2OB 3BUMB 3SS3A 1MWNA 1SL8A 2ZRTA 4DUQA 1BLQA 2M1KB 1PK0D 5FI6A 2KQYA 2LMTA 2LMVA 4QJ4B 1C7WA 3PALA 2LP3A 5B8IB 1YVHA 2LVIA 2HETA 3BYAA 3FE6A 2MHHA 1MXEA 4NDDA 4ORAB 1XK4A 2QPTA 2Y1NA 1B8LA 2KDHA 1EXRA 2MLFC 2PVBA 1FI5A 2HF5A 2H8VA 1RJVA 4USLA 3DVEA 1A75A 3BXKA 3D77A 3LK0A 3OX5A 2JNXA 4FTGA 3BFBA 2OPOA 2WCKA 3TDZA 2WC6A 1GGWA 2FJYA 2K2AA 1A2XA 1DTLA 5HYDA 2MJWB 2JPTA 1K9PA 2H61C 1XFUO 1G8IA 2JULA 2IS9A 3CWGA 3EVUA 3IVTA 1ZOTB 2WC8A 1KFUS 1QLKA 1TOPA 3PN7C 1GM0A 1UP5A 1OQPA 3DVKA 1J7RA 2KBMA 4CFQA 2ERBA 1B8CA 2K0JA 4CIDA 2HQWA 1F8HA 1ZUZA 1SRAA 2L50A 3CR2A 5JJGA 2K7CA 3SG4A 2Q91A 2JTTA 1M46A 3OP0A 1KK7Y 2WCBA 1QV0A 1QIVA 1BR4B 2L2EA 1EH2A 1XK4C 1A75B 2QEHA 1CFFA 2K60A 1KK7Z 1S6JA 2JC2A 1KSMA 3LLEA 4OR9B 1OE9B 1NWDA 4I5JA 2KBIA 1B1GA 5IBWA 3ICBA 4YGBB 1KFUL 1WLMA 4PHMA 4MZJA 2BBMA 2FCDA 2I2RE 3AAKA 2HQ8A 3R1VA 1H8BA 1UHHA 2KLDA 5G08A 2L4IA 3NGVA 1TIZA 1K90D 3I5GB 1QXPA 5HKZA 1S6CA 2KOTA 3GOFA 1B7TZ 1U5IA 1CLBA 1NX2A 2FOTA 2MBXA 2HPSA 4INWA 1F70A 3I5GC 3NSKA 1UHKA 4P5OE 3DD4A 1Y1XA 3D75A 1MUXA 2KYFA 4WQ2A 3DVMA 1IKUA 4DRWA 1JSAA 5CSJA 4FQTA 1WLZA 3D78A 3JTDB 1NUBA 3DXLA 2GV5A 2M7NA 2ZN8A 1BR1B 3CGAA 2E30A 1WRKA 1WRZA 3AAJA 4XYNA 2PMYA 5CPVA 2OTGC 1KQMB 4PHJA 3PLFB 2ZFDA 2CT9A 1DF0A 1LKJA 2M29A 2MAZA 3VRPA 2LAPA 1S3PA 3CABA 1PULA 1CLMA 3NHIA 5DICA 2LE9B 1CTRA 1GJYA 1MF8B 3VRQA 1DELA 5HLOA 2FCEA 1U5IB 1SYMA 5KSZA 1YUTA 4HREE 3S0GA 1WDCB 2A4JA 1PSRA 2JU0A 3NSIA 3DZTA 3PFVA 1DJXA 1Y0VH 2B1UA 1XFZO 3HCMA 4M2QA 5I2OA 1DJGA 4D1EA 4YGAA 1JFJA 5FI2A 5KTYA 5CSNA 4ZCUA 1SK6D 3RZSA 3D0YA 1LA0A 1DF0B 1J1DA 1QJTA 3O2PA 4C0JA 3OB1B 3EKHA 1N2DA 1LINA 2BBNA 4ICBA 1D1OA 3SG2A 1M63B 3C1VA 2E6WA 2OS8B 4JQ0D 5D69A 1KFXS 2PALA 4ORBB 3I5IB 4JKTA 5PALA 4DCKA 2QACA 1Y1UA 3BOWA 3H4SE 1PALA 1CMFA 3DY9A 4PE7A 4FQOA 4GNKB 1QVIY 2H61A 2ZRSA 2EHBA 3KPXA 1JF2A 3R1PA 5DKRA 4ZCVA 1P28A 1RFJA 2AUCA 4PHKA 3GK4X 4YI9A 2BE4A 2AMIA 1V1FA 1PRWA 2NZ0A 1K2HA 1KK8C 1XFWO 1CNPA 3KHEA 2KGRA 3OX6A 2CTNA 2K61A 2LANA 3HX4A 3D0YB 2Q4UA 3FE8A 1DVIA 3K1EA 4BY5A 1PVAA 1F71A 1NPQA 3PATA 1AK8A 1JUOA 1KFXL 2JT3A 3CZ0A 3SIAA 5AFPA 2JWWA 3FWBA 1YX7A 3EG5B 4GBAA 1QWVA 1UHIA 4GPLB 4QJ5B 1QX5B 2MRDA 3CR5X 4HRGA 4OKHA 1AJ5A 1TNXA 1C3ZA 2WCEA 4HRHA 1FF1A 5I2LA 1S26D 1A4PA 1OOHA 1CM4A 3BOWB 3SS4A 1KSOA 3WXAA 1F4OA 1SR6B 3GK2A 1QATA 2O60A 3S0BA 2LHLA 1Y6WA 3IQQA 1LXFC 5HL1A 2JZIA 2LNKA 1YUSA 1K93D 3O78A 2M1UA 2LHIA 1SKTA 3PN7B 1SR6C 3L4LA 1X02A 2KQ6A 3VRNA 1CDNA 1BOCA 3CR4X 1ALWA 3I5HC 4YGDB 1J7PA 2JOJA 2F3YA 4MRYA 3RM1A 1QTXA 3FWCA 4OZDA 2QEVA 1LVCD 1CDPA 4YI8A 2NLNA 4F7FA 1F55A 2LP2A 4IL1A 4YGEB 3BUNB 3NXAA 1CLLA 4DS7A 4YGCB 2NCOA 2P6BB 3S0DA 1G4YR 5D3OA 4MRXA 1TNWA 3D10A 4WQ3A 1YRTB 4GGFA 3IF7A 2F2PA 3UO9A 3BQ3A 1OOGA 3OB2B 2WCMA 3CZTX 3S0FA 3FE9A 1QX7A 3UNWA 1NYAA 2K7DA 5FYXA 1DJIA 2VRGA 1MHOA 1EG3A 4INXA 5AANA 1GGZA 3JVTC 2LUXA 1B7TY 1MQ1A 4JWQA 5F6TA 3VROA 4QJ3B 3FIAA 4YBHB 3TS5B 5HKWA 4M2OA 5DKNA 1QASA 5HKYA 3NSLA 1S36A 1OZOA 1TN4A 1IWQA 2K7BA 3ZWHA 3EK4A 1XYDA 3TS5C 4UPGA 2LC5A 2OTGB 3F45A 3N7HA 1NX0A 1DMOA 1UHNA 2ZKMX 1HT9A 4PE4A 2CCMA 5GQQC 3M0WA 2EC6B 1OZSA 1QLSA 5AERA 1IQ3A 2M8UA 1DJHA 5FI7A 3KEVA 2WCJA 1YURA 4GGFC 1CFDA 3B7AA 3O6BA 2M49B 2PASA 1TNPA 2I94A 4DIRA 3PJIA 4MVFA 2EC6C 2JTZA 4NDCA 3I5FC 3TUYC 2KPHA 1IIOA 1B9AA 4U8DA 3VGOA 4JD9A 2D8NA 2M97A 4NQGA 2K8MB 3SJSA 1IJ5A 1BJFA 2L5XB 2BECA 1SCMC 4GGNA 4PCWA 2COLB 2JRFA 3B86A 1FW4A 3SG6A 1S6IA 3R1OA 1OMDA 1WY9A 4KYNA 3QMEA 1UWOA 3BUXB 5EL2A 4GUKA 3S0EA 1GQMA 1YR5A 4MN0A 4E68A 3OHMB 2L2CA 1OOIX 1J1EA 1C3YA 3BFAA 1W9ZA 2F2OA 2KI6D 3PSRA 2NCPA 1NCZA 2V53A 3PM2A 4MZKA 2JQ6A 1OMRA 4ORCB 3B87A 2Y4QA 1Y1AA 1BU3A 1OOJA 2WORA 1JC2A 2GGMA 3PM8A 1CFPA 4MLWA 3CYZA 1A29A 5HLVA 1T14A
chains in the Genus database with same CATH topology
1M45A 1M39A 1IRJA 1TNQA 4AOMA 4ETOA 2K7OA 1L7ZA 2LLSA 2YGUA 1AVSA 1YUUA 1ZFSA 4Q04A 1XFVO 2KHNA 1CM1A 2BCXA 2L51A 3CTNA 1KK8B 1HQVA 2KI4B 4MSPA 1LA3A 2GGZA 1JWDA 1C7VA 3OBVA 4CPVA 1TTXA 3EK8A 3SG5A 4L9MA 1W7JB 3KF9A 2LMUA 5I2QA 1K8UA 1NP8A 2KI4C 4AQIA 1B4CA 2SASA 3TDUA 1J7OA 1Z2CB 1DJZA 4BY4A 4GAOA 4I5KA 1PSBA 1DJYA 2M0RA 2LV7A 1EL4A 2JNFA 1YVLA 4MZLA 4CFRA 3KO0A 1CKKA 2KFFA 3VRRA 1KWOC 3LL8B 1XA5A 2LLUA 2BKIB 1QS7A 3SIBA 5KU1A 1SPYA 1NSHA 1XO5A 1SL9A 1E8AA 1MR8A 2MA2A 2KAVA 3GK1A 1FBVA 1YTZC 3DF0A 2F3ZA 2KLEA 2M3WA 1FI6A 3I5HB 2L5YA 1ALVA 4PE0A 1MXLC 4I5LB 4TNCA 3K21A 1DGVA 3CLNA 3EK7A 1IG5A 3CS1A 2BCBA 2JT8A 2G2BA 1C07A 3SG7A 1BMOA 1L2OC 2RGIA 2CXJA 1RECA 5CSIA 2H2KA 1K9UA 2KFGA 3AKBA 4OVNF 2M9GA 2KI6C 1SW8A 1J7QA 4XJKA 3AKAA 2Y1MA 1F4QA 4P2YB 5I8NA 1BT6A 2LCPA 1FPWA 1RK9A 4MEWA 4PHNA 1SY9A 1DC1A 1OMVA 1CFCA 1UHJA 2M7LA 2CNPA 1V1GA 3DF0B 1IJ6A 1BF5A 1IGVA 2KFHA 4NDBA 1S1EA 1CDLA 1DEKA 1B47A 3JVTB 2KAXA 4N5XA 5ER4X 3WHTB 1IH0A 1XFYO 1XVJA 1ZMZA 4MBEA 2L4HA 2WCFA 3O4YA 4I5NB 2I7AA 3EVVA 1CMGA 2LUCA 2G9BA 2KAYA 2LVJA 3LK1A 4XJKB 2JXCA 1QIWA 3A4UB 1J55A 1WRLA 1BODA 1RTP1 1YRUB 3BUOB 2O5GA 3TZ1A 1YX8A 2WOSA 1K96A 1Z4HA 1H4BA 2ZNDA 5J3XA 2LLTA 4GFTA 4WRIA 2KNEA 5AXIA 3I5FB 3TUYB 2KYCA 2TN4A 3DVJA 3IQOA 4N1GA 4C0KA 1JFJA 2BAPA 2FJUB 1NIWA 1M31A 1S5GY 1TCFA 1QV1A 2Y5IA 3MSEB 4A4CA 1AJ4A 5AEQA 2JT0A 1SCMB 1A03A 3SS5A 1S5GZ 3LCPC 2AAOA 1NX1A 2ISDA 5JOLA 2KSPA 2JXLA 1NCYA 2ZNEA 4PALA 1XFXO 1NX3A 2DOQA 3E3RA 2L0PA 1R6PA 4F0ZB 1CDMA 4OCIA 1VRKA 3RLZA 1JBAA 4AQJA 1QX2A 1UURA 2BE6A 1K9KA 1Q80A 2MLEC 1G33A 1B8RA 2K2FA 3JTDC 1AP4A 3FS7A 3SG3A 1SMGA 5K89A 1ODBA 1PVBA 2I18A 1RROA 2BCAA 2F33A 1SL7A 2BKHB 2ZN9A 1DJWA 3A8RA 2SCPA 1ZACA 3NSOA 1KQVA 4IJ7A 1AUIB 1KQMC 4PE1A 1OSAA 1EJ3A 2NXQA 4PDZA 1EG4A 4HSZA 3WHUB 1TRFA 2EGDA 1W7IB 2BL0B 3WNXB 5DKQA 5D7FA 5I94A 3O4XA 2WNDA 4N1FA 1F54A 5BPJA 1JFKA 1K94A 1WDCC 1RWYA 2BL0C 2PSRA 2PRUA 1K95A 2BNXA 1UUSA 2LVVA 1R2UA 2LM5A 4OV2A 1KCYA 3EVRA 2LVKA 2KGBC 1DGUA 1AHRA 1KWOB 3QRXA 2R2IA 1JF0A 4YRUA 4R1EA 1IQ5A 1CB1A 3BUWB 4M2PA 1SCVA 1SNLA 3EKJA 3ZNIA 4C0LA 4A4BA 2OS8C 2F8PA 1BG1A 1N0YA 2L98A 1NCXA 1SBJA 1TCOB 2CBLA 3I5IC 4JPZB 5ER5A 1QVIZ 3TDIA 4CLNA 1DT7B 1N65A 5CSFA 5TNCA 1L2OB 3BUMB 4DUQA 1MWNA 1SL8A 2ZRTA 3SS3A 1BLQA 2M1KB 1PK0D 5FI6A 2KQYA 2LMTA 2LMVA 4QJ4B 1C7WA 3PALA 2LP3A 5B8IB 1YVHA 2LVIA 2HETA 3BYAA 2MHHA 1MXEA 4NDDA 4ORAB 1XK4A 2QPTA 2Y1NA 1B8LA 2KDHA 1EXRA 2MLFC 2PVBA 1FI5A 2HF5A 1RJVA 4USLA 3DVEA 1A75A 3BXKA 3OX5A 3LK0A 2JNXA 4FTGA 2OPOA 3TDZA 1GGWA 2K2AA 1A2XA 1DTLA 5HYDA 2MJWB 2JPTA 1K9PA 2H61C 1XFUO 1G8IA 2JULA 2IS9A 3CWGA 3EVUA 3IVTA 1ZOTB 2WC8A 1KFUS 1QLKA 1TOPA 3PN7C 1UP5A 1OQPA 3DVKA 1J7RA 2KBMA 4CFQA 1B8CA 2K0JA 4CIDA 2HQWA 1F8HA 1ZUZA 1SRAA 2L50A 3CR2A 5JJGA 2K7CA 3SG4A 2Q91A 2JTTA 1M46A 3OP0A 1KK7Y 2WCBA 1QV0A 1QIVA 1BR4B 2L2EA 1EH2A 1XK4C 1A75B 1CFFA 2K60A 1KK7Z 1S6JA 2JC2A 1KSMA 3LLEA 4OR9B 1OE9B 1NWDA 4I5JA 2KBIA 1B1GA 5IBWA 3ICBA 4YGBB 1KFUL 1WLMA 4PHMA 4MZJA 2BBMA 2FCDA 2I2RE 3AAKA 2HQ8A 1H8BA 1UHHA 2KLDA 5G08A 2L4IA 1TIZA 1K90D 3I5GB 1QXPA 5HKZA 1S6CA 2KOTA 3GOFA 1B7TZ 1U5IA 1CLBA 1NX2A 2FOTA 2MBXA 2HPSA 1F70A 3I5GC 3NSKA 1UHKA 4P5OE 3DD4A 1Y1XA 1MUXA 2KYFA 4WQ2A 3DVMA 1IKUA 4DRWA 1JSAA 5CSJA 1WLZA 3JTDB 1NUBA 2GV5A 2M7NA 2ZN8A 1BR1B 3CGAA 2E30A 1WRKA 1WRZA 3AAJA 4XYNA 2PMYA 5CPVA 2OTGC 1KQMB 4PHJA 3PLFB 2ZFDA 2CT9A 1DF0A 1LKJA 2M29A 2MAZA 3VRPA 2LAPA 1S3PA 1PULA 1CLMA 2LE9B 1CTRA 1GJYA 1MF8B 3VRQA 5HLOA 1DELA 2FCEA 1U5IB 1SYMA 5KSZA 1YUTA 4HREE 1WDCB 2A4JA 1PSRA 2JU0A 3NSIA 3PFVA 1DJXA 1Y0VH 2B1UA 1XFZO 3HCMA 4M2QA 5I2OA 1DJGA 4D1EA 4YGAA 5FI2A 5KTYA 5CSNA 4ZCUA 1SK6D 3D0YA 1LA0A 1DF0B 1J1DA 1QJTA 3O2PA 4C0JA 3OB1B 3EKHA 1N2DA 1LINA 2BBNA 4ICBA 1D1OA 3SG2A 1M63B 3C1VA 2E6WA 2OS8B 4JQ0D 5D69A 1KFXS 2PALA 4ORBB 3I5IB 4JKTA 5PALA 4DCKA 2QACA 1Y1UA 3BOWA 3H4SE 1PALA 1CMFA 4PE7A 4FQOA 4GNKB 1QVIY 2H61A 2ZRSA 2EHBA 3KPXA 1JF2A 5DKRA 4ZCVA 1RFJA 2AUCA 4PHKA 3GK4X 4YI9A 2BE4A 2AMIA 1V1FA 1PRWA 2NZ0A 1K2HA 1KK8C 1XFWO 1CNPA 3KHEA 2KGRA 3OX6A 2CTNA 2K61A 2LANA 3HX4A 3D0YB 2Q4UA 4BY5A 1DVIA 1F71A 1PVAA 1NPQA 3PATA 1AK8A 1JUOA 1KFXL 2JT3A 3SIAA 5AFPA 2JWWA 3FWBA 1YX7A 3EG5B 4GBAA 4GPLB 1UHIA 4QJ5B 1QX5B 2MRDA 3CR5X 4HRGA 4OKHA 1AJ5A 1TNXA 2WCEA 4HRHA 1FF1A 5I2LA 1S26D 1A4PA 3BOWB 1CM4A 3SS4A 1KSOA 3WXAA 1F4OA 1SR6B 3GK2A 1QATA 2O60A 2LHLA 1Y6WA 3IQQA 1LXFC 5HL1A 2JZIA 2LNKA 1YUSA 1K93D 3O78A 2M1UA 2LHIA 1SKTA 3PN7B 1SR6C 1BOCA 1X02A 2KQ6A 3VRNA 1CDNA 3CR4X 1ALWA 3I5HC 4YGDB 1J7PA 2JOJA 2F3YA 4MRYA 3RM1A 1QTXA 3FWCA 1LVCD 1CDPA 4YI8A 2NLNA 1F55A 2LP2A 4IL1A 4YGEB 3BUNB 3NXAA 1CLLA 4DS7A 4YGCB 2NCOA 2P6BB 1G4YR 5D3OA 4MRXA 1TNWA 3D10A 4WQ3A 1YRTB 4GGFA 3IF7A 2F2PA 3UO9A 3BQ3A 3OB2B 3CZTX 1QX7A 3UNWA 1NYAA 2K7DA 5FYXA 1DJIA 2VRGA 1MHOA 1EG3A 5AANA 1GGZA 3JVTC 2LUXA 1B7TY 1MQ1A 4JWQA 5F6TA 3VROA 4QJ3B 3FIAA 4YBHB 3TS5B 5HKWA 4M2OA 5DKNA 1QASA 5HKYA 3NSLA 1S36A 1OZOA 1TN4A 1IWQA 2K7BA 3ZWHA 3EK4A 1XYDA 3TS5C 4UPGA 2LC5A 2OTGB 3F45A 1NX0A 1DMOA 1UHNA 2ZKMX 1HT9A 4PE4A 2CCMA 5GQQC 3M0WA 2EC6B 1OZSA 1QLSA 5AERA 1IQ3A 2M8UA 1DJHA 5FI7A 3KEVA 1YURA 4GGFC 1CFDA 3O6BA 2M49B 2PASA 1TNPA 2I94A 4DIRA 4MVFA 2EC6C 2JTZA 4NDCA 3I5FC 3TUYC 1B9AA 4U8DA 3VGOA 4NQGA 2D8NA 2M97A 3SJSA 2K8MB 1IJ5A 1BJFA 2L5XB 2BECA 1SCMC 4GGNA 4PCWA 2COLB 2JRFA 1FW4A 3SG6A 1S6IA 1OMDA 1WY9A 4KYNA 1UWOA 3BUXB 4E68A 4GUKA 1GQMA 1YR5A 4MN0A 3OHMB 1J1EA 1W9ZA 2F2OA 2KI6D 3PSRA 2NCPA 1NCZA 2V53A 4MZKA 3PM2A 2JQ6A 1OMRA 4ORCB 2Y4QA 1Y1AA 1BU3A 1OOJA 2WORA 1JC2A 2GGMA 3PM8A 1CFPA 4MLWA 1A29A 5HLVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M45 A;  1M39 A;  1IRJ A;  1TNQ A;  4AOM A;  4ETO A;  2K7O A;  1L7Z A;  2LLS A;  1AVS A;  1YUU A;  1ZFS A;  4Q04 A;  1XFV O;  2KHN A;  1CM1 A;  2BCX A;  2L51 A;  3CTN A;  1KK8 B;  1HQV A;  2KI4 B;  4MSP A;  1LA3 A;  2GGZ A;  1JWD A;  1C7V A;  4CPV A;  1TTX A;  3EK8 A;  3SG5 A;  4L9M A;  1W7J B;  3KF9 A;  2LMU A;  5I2Q A;  1K8U A;  1NP8 A;  2KI4 C;  4AQI A;  1B4C A;  2SAS A;  3TDU A;  1J7O A;  1DJZ A;  4BY4 A;  4GAO A;  4I5K A;  1PSB A;  1DJY A;  2M0R A;  2LV7 A;  1EL4 A;  2JNF A;  1YVL A;  4MZL A;  4CFR A;  3KO0 A;  1CKK A;  2KFF A;  3VRR A;  1KWO C;  3LL8 B;  1XA5 A;  2LLU A;  2BKI B;  1QS7 A;  3SIB A;  5KU1 A;  1SPY A;  1NSH A;  1XO5 A;  1SL9 A;  1E8A A;  1MR8 A;  2MA2 A;  2KAV A;  3GK1 A;  1FBV A;  1YTZ C;  3DF0 A;  2F3Z A;  2M3W A;  1FI6 A;  3I5H B;  1ALV A;  4PE0 A;  1MXL C;  4I5L B;  4TNC A;  3K21 A;  1DGV A;  3CLN A;  3EK7 A;  1IG5 A;  3CS1 A;  2BCB A;  2JT8 A;  2G2B A;  1C07 A;  3SG7 A;  1BMO A;  1L2O C;  2RGI A;  2CXJ A;  1REC A;  5CSI A;  2H2K A;  1K9U A;  2KFG A;  3AKB A;  4OVN F;  2M9G A;  2KI6 C;  1SW8 A;  1J7Q A;  4XJK A;  3AKA A;  2Y1M A;  1F4Q A;  4P2Y B;  5I8N A;  1BT6 A;  2LCP A;  1FPW A;  1RK9 A;  4MEW A;  4PHN A;  1SY9 A;  1OMV A;  1CFC A;  1UHJ A;  2M7L A;  2CNP A;  1V1G A;  3DF0 B;  1IJ6 A;  1BF5 A;  1IGV A;  2KFH A;  4NDB A;  1S1E A;  1CDL A;  1B47 A;  3JVT B;  2KAX A;  4N5X A;  5ER4 X;  3WHT B;  1IH0 A;  1XFY O;  1XVJ A;  1ZMZ A;  4MBE A;  2L4H A;  2WCF A;  3O4Y A;  4I5N B;  2I7A A;  3EVV A;  1CMG A;  2LUC A;  2G9B A;  2KAY A;  2LVJ A;  3LK1 A;  4XJK B;  2JXC A;  1QIW A;  3A4U B;  1J55 A;  1WRL A;  1BOD A;  1RTP 1;  1YRU B;  3BUO B;  2O5G A;  3TZ1 A;  1YX8 A;  2WOS A;  1K96 A;  1H4B A;  2ZND A;  5J3X A;  2LLT A;  4GFT A;  4WRI A;  2KNE A;  5AXI A;  3I5F B;  3TUY B;  2KYC A;  2TN4 A;  3DVJ A;  3IQO A;  4N1G A;  4C0K A;  1JFJ A;  2FJU B;  1NIW A;  1M31 A;  1S5G Y;  1TCF A;  1QV1 A;  2Y5I A;  3MSE B;  4A4C A;  1AJ4 A;  5AEQ A;  2JT0 A;  1SCM B;  1A03 A;  1S5G Z;  3LCP C;  2AAO A;  1NX1 A;  2ISD A;  5JOL A;  2KSP A;  2JXL A;  1NCY A;  2ZNE A;  4PAL A;  1XFX O;  1NX3 A;  2DOQ A;  3E3R A;  2L0P A;  1R6P A;  4F0Z B;  1CDM A;  4OCI A;  1VRK A;  3RLZ A;  1JBA A;  4AQJ A;  1QX2 A;  1UUR A;  2BE6 A;  1K9K A;  1Q80 A;  2MLE C;  1G33 A;  1B8R A;  2K2F A;  3JTD C;  1AP4 A;  3FS7 A;  3SG3 A;  1SMG A;  5K89 A;  1ODB A;  1PVB A;  2I18 A;  1RRO A;  2BCA A;  2F33 A;  1SL7 A;  2BKH B;  2ZN9 A;  1DJW A;  3A8R A;  2SCP A;  1ZAC A;  3NSO A;  1KQV A;  1AUI B;  1KQM C;  4PE1 A;  1OSA A;  1EJ3 A;  2NXQ A;  4PDZ A;  1EG4 A;  4HSZ A;  3WHU B;  1TRF A;  2EGD A;  1W7I B;  2BL0 B;  3WNX B;  5DKQ A;  5D7F A;  2WND A;  4N1F A;  1F54 A;  5BPJ A;  1JFK A;  1K94 A;  1WDC C;  1RWY A;  2BL0 C;  2PSR A;  2PRU A;  1K95 A;  1UUS A;  2LVV A;  1R2U A;  2LM5 A;  4OV2 A;  1KCY A;  3EVR A;  2LVK A;  2KGB C;  1DGU A;  1AHR A;  1KWO B;  3QRX A;  2R2I A;  1JF0 A;  4YRU A;  4R1E A;  1IQ5 A;  1CB1 A;  3BUW B;  4M2P A;  1SCV A;  1SNL A;  3EKJ A;  3ZNI A;  4C0L A;  4A4B A;  2OS8 C;  2F8P A;  1BG1 A;  1N0Y A;  2L98 A;  1NCX A;  1SBJ A;  1TCO B;  2CBL A;  3I5I C;  4JPZ B;  5ER5 A;  1QVI Z;  3TDI A;  4CLN A;  1DT7 B;  1N65 A;  5CSF A;  5TNC A;  1L2O B;  3BUM B;  4DUQ A;  1MWN A;  1SL8 A;  2ZRT A;  1BLQ A;  2M1K B;  1PK0 D;  2KQY A;  2LMT A;  2LMV A;  4QJ4 B;  1C7W A;  3PAL A;  2LP3 A;  5B8I B;  1YVH A;  2LVI A;  2HET A;  3BYA A;  2MHH A;  1MXE A;  4NDD A;  4ORA B;  1XK4 A;  2QPT A;  2Y1N A;  1B8L A;  2KDH A;  1EXR A;  2MLF C;  2PVB A;  1FI5 A;  2HF5 A;  1RJV A;  4USL A;  3DVE A;  1A75 A;  3BXK A;  3OX5 A;  3LK0 A;  2JNX A;  4FTG A;  2OPO A;  3TDZ A;  1GGW A;  2K2A A;  1A2X A;  1DTL A;  5HYD A;  2MJW B;  2JPT A;  1K9P A;  2H61 C;  1XFU O;  1G8I A;  2JUL A;  2IS9 A;  3CWG A;  3EVU A;  1ZOT B;  2WC8 A;  1KFU S;  1QLK A;  1TOP A;  3PN7 C;  1UP5 A;  1OQP A;  3DVK A;  1J7R A;  2KBM A;  4CFQ A;  1B8C A;  2K0J A;  4CID A;  2HQW A;  1F8H A;  1ZUZ A;  1SRA A;  2L50 A;  3CR2 A;  5JJG A;  2K7C A;  3SG4 A;  2Q91 A;  2JTT A;  1M46 A;  3OP0 A;  1KK7 Y;  2WCB A;  1QV0 A;  1QIV A;  1BR4 B;  2L2E A;  1EH2 A;  1XK4 C;  1A75 B;  1CFF A;  1KK7 Z;  1S6J A;  2JC2 A;  1KSM A;  3LLE A;  4OR9 B;  1OE9 B;  1NWD A;  4I5J A;  2KBI A;  1B1G A;  5IBW A;  3ICB A;  4YGB B;  1KFU L;  1WLM A;  4PHM A;  4MZJ A;  2BBM A;  2FCD A;  2I2R E;  3AAK A;  2HQ8 A;  1H8B A;  1UHH A;  5G08 A;  2L4I A;  1TIZ A;  1K90 D;  3I5G B;  1QXP A;  5HKZ A;  1S6C A;  2KOT A;  3GOF A;  1B7T Z;  1U5I A;  1CLB A;  1NX2 A;  2FOT A;  2MBX A;  2HPS A;  1F70 A;  3I5G C;  3NSK A;  1UHK A;  4P5O E;  3DD4 A;  1Y1X A;  1MUX A;  2KYF A;  4WQ2 A;  3DVM A;  1IKU A;  4DRW A;  1JSA A;  5CSJ A;  1WLZ A;  3JTD B;  1NUB A;  2GV5 A;  2M7N A;  2ZN8 A;  1BR1 B;  3CGA A;  2E30 A;  1WRK A;  1WRZ A;  3AAJ A;  4XYN A;  2PMY A;  5CPV A;  2OTG C;  1KQM B;  4PHJ A;  3PLF B;  2ZFD A;  2CT9 A;  1DF0 A;  1LKJ A;  2M29 A;  2MAZ A;  3VRP A;  2LAP A;  1S3P A;  1PUL A;  1CLM A;  2LE9 B;  1CTR A;  1GJY A;  1MF8 B;  3VRQ A;  5HLO A;  2FCE A;  1U5I B;  1SYM A;  5KSZ A;  1YUT A;  4HRE E;  1WDC B;  2A4J A;  1PSR A;  2JU0 A;  3NSI A;  3PFV A;  1DJX A;  1Y0V H;  2B1U A;  1XFZ O;  3HCM A;  4M2Q A;  5I2O A;  1DJG A;  4D1E A;  4YGA A;  5KTY A;  5CSN A;  4ZCU A;  1SK6 D;  3D0Y A;  1LA0 A;  1DF0 B;  1J1D A;  1QJT A;  3O2P A;  4C0J A;  3OB1 B;  3EKH A;  1N2D A;  1LIN A;  2BBN A;  4ICB A;  1D1O A;  3SG2 A;  1M63 B;  3C1V A;  2E6W A;  2OS8 B;  4JQ0 D;  5D69 A;  1KFX S;  2PAL A;  4ORB B;  3I5I B;  5PAL A;  4DCK A;  2QAC A;  1Y1U A;  3BOW A;  3H4S E;  1PAL A;  1CMF A;  4PE7 A;  4FQO A;  4GNK B;  1QVI Y;  2H61 A;  2ZRS A;  2EHB A;  3KPX A;  1JF2 A;  5DKR A;  4ZCV A;  1RFJ A;  2AUC A;  4PHK A;  3GK4 X;  4YI9 A;  2BE4 A;  2AMI A;  1V1F A;  1PRW A;  2NZ0 A;  1K2H A;  1KK8 C;  1XFW O;  1CNP A;  3KHE A;  2KGR A;  3OX6 A;  2CTN A;  2K61 A;  2LAN A;  3HX4 A;  3D0Y B;  2Q4U A;  4BY5 A;  1DVI A;  1F71 A;  1PVA A;  1NPQ A;  3PAT A;  1AK8 A;  1JUO A;  1KFX L;  2JT3 A;  3SIA A;  5AFP A;  2JWW A;  3FWB A;  1YX7 A;  4GBA A;  4GPL B;  1UHI A;  4QJ5 B;  1QX5 B;  2MRD A;  3CR5 X;  4HRG A;  4OKH A;  1AJ5 A;  1TNX A;  2WCE A;  4HRH A;  1FF1 A;  5I2L A;  1S26 D;  1A4P A;  3BOW B;  1CM4 A;  1KSO A;  3WXA A;  1F4O A;  1SR6 B;  3GK2 A;  1QAT A;  2O60 A;  2LHL A;  1Y6W A;  3IQQ A;  1LXF C;  2JZI A;  2LNK A;  1YUS A;  1K93 D;  3O78 A;  2M1U A;  2LHI A;  1SKT A;  3PN7 B;  1SR6 C;  1BOC A;  1X02 A;  2KQ6 A;  3VRN A;  1CDN A;  3CR4 X;  1ALW A;  3I5H C;  4YGD B;  1J7P A;  2JOJ A;  2F3Y A;  4MRY A;  3RM1 A;  1QTX A;  3FWC A;  1LVC D;  1CDP A;  4YI8 A;  2NLN A;  1F55 A;  2LP2 A;  4IL1 A;  4YGE B;  3BUN B;  3NXA A;  1CLL A;  4DS7 A;  4YGC B;  2NCO A;  2P6B B;  1G4Y R;  4MRX A;  1TNW A;  3D10 A;  4WQ3 A;  1YRT B;  4GGF A;  3IF7 A;  2F2P A;  3BQ3 A;  3OB2 B;  3CZT X;  1QX7 A;  1NYA A;  2K7D A;  5FYX A;  1DJI A;  2VRG A;  1MHO A;  1EG3 A;  5AAN A;  1GGZ A;  3JVT C;  2LUX A;  1B7T Y;  1MQ1 A;  4JWQ A;  5F6T A;  3VRO A;  4QJ3 B;  3FIA A;  4YBH B;  3TS5 B;  5HKW A;  4M2O A;  5DKN A;  1QAS A;  5HKY A;  3NSL A;  1S36 A;  1OZO A;  1TN4 A;  1IWQ A;  2K7B A;  3ZWH A;  3EK4 A;  1XYD A;  3TS5 C;  4UPG A;  2LC5 A;  2OTG B;  3F45 A;  1NX0 A;  1DMO A;  1UHN A;  2ZKM X;  1HT9 A;  4PE4 A;  2CCM A;  5GQQ C;  3M0W A;  2EC6 B;  1OZS A;  1QLS A;  5AER A;  1IQ3 A;  2M8U A;  1DJH A;  3KEV A;  1YUR A;  4GGF C;  1CFD A;  3O6B A;  2M49 B;  2PAS A;  1TNP A;  2I94 A;  4DIR A;  4MVF A;  2EC6 C;  2JTZ A;  4NDC A;  3I5F C;  3TUY C;  1B9A A;  4U8D A;  3VGO A;  4NQG A;  2D8N A;  2M97 A;  3SJS A;  2K8M B;  1IJ5 A;  1BJF A;  2L5X B;  2BEC A;  1SCM C;  4GGN A;  4PCW A;  2COL B;  2JRF A;  1FW4 A;  3SG6 A;  1S6I A;  1OMD A;  1WY9 A;  1UWO A;  3BUX B;  4E68 A;  4GUK A;  1GQM A;  1YR5 A;  4MN0 A;  3OHM B;  1J1E A;  2F2O A;  2KI6 D;  3PSR A;  2NCP A;  1NCZ A;  2V53 A;  4MZK A;  2JQ6 A;  1OMR A;  4ORC B;  2Y4Q A;  1Y1A A;  1BU3 A;  1OOJ A;  2WOR A;  1JC2 A;  2GGM A;  3PM8 A;  1CFP A;  4MLW A;  1A29 A;  5HLV A; 
#chains in the Genus database with same CATH topology
 1M45 A;  1M39 A;  1IRJ A;  1TNQ A;  4AOM A;  4ETO A;  2K7O A;  4PT1 A;  1L7Z A;  2LLS A;  2YGU A;  1AVS A;  1YUU A;  1ZFS A;  4Q04 A;  1XFV O;  2KHN A;  1CM1 A;  2BCX A;  2L51 A;  3CTN A;  1KK8 B;  1HQV A;  2KI4 B;  4MSP A;  1LA3 A;  2GGZ A;  1JWD A;  1C7V A;  3OBV A;  4CPV A;  1TTX A;  3EK8 A;  3SG5 A;  4L9M A;  1W7J B;  3KF9 A;  2LMU A;  5I2Q A;  1K8U A;  1NP8 A;  2KI4 C;  4AQI A;  2WC5 A;  1B4C A;  2SAS A;  3TDU A;  1J7O A;  1Z2C B;  1DJZ A;  4BY4 A;  4GAO A;  4I5K A;  1PSB A;  1DJY A;  2M0R A;  2LV7 A;  3L47 A;  1EL4 A;  2JNF A;  1YVL A;  4MZL A;  4CFR A;  3KO0 A;  1CKK A;  2KFF A;  3VRR A;  1KWO C;  3LL8 B;  1XA5 A;  2LLU A;  2BKI B;  1QS7 A;  3SIB A;  5KU1 A;  1SPY A;  3CDN A;  1NSH A;  1XO5 A;  1SL9 A;  1E8A A;  1MR8 A;  2MA2 A;  2KAV A;  3GK1 A;  1FBV A;  1YTZ C;  3DF0 A;  2F3Z A;  2KLE A;  3D76 A;  1OOF A;  2P71 A;  2M3W A;  1FI6 A;  2L5Y A;  3I5H B;  1ALV A;  4PE0 A;  1MXL C;  4I5L B;  4TNC A;  3K21 A;  1DGV A;  3CLN A;  3EK7 A;  3S0A A;  1IG5 A;  3CS1 A;  2BCB A;  1LS8 A;  2JT8 A;  2G2B A;  1C07 A;  3SG7 A;  1BMO A;  1L2O C;  2RGI A;  2CXJ A;  1REC A;  5CSI A;  2H2K A;  1K9U A;  2KFG A;  3AKB A;  4OVN F;  2M9G A;  2KI6 C;  1SW8 A;  2QDI A;  1J7Q A;  4XJK A;  1TWO A;  3AKA A;  2Y1M A;  3CZ1 A;  1F4Q A;  4P2Y B;  3BFH A;  5I8N A;  1BT6 A;  3NHT A;  2LCP A;  1FPW A;  1RK9 A;  1TUJ A;  4MEW A;  1SY9 A;  4PHN A;  1DC1 A;  1OMV A;  3Q8I A;  1UHJ A;  2M7L A;  2CNP A;  1CFC A;  1V1G A;  3DF0 B;  1IJ6 A;  1BF5 A;  1IGV A;  2KFH A;  4NDB A;  1S1E A;  1CDL A;  1DEK A;  1B47 A;  3JVT B;  2KAX A;  3D73 A;  4N5X A;  5ER4 X;  3WHT B;  1IH0 A;  1XFY O;  1XVJ A;  1ZMZ A;  4MBE A;  2L4H A;  2WCF A;  3O4Y A;  4I5N B;  2I7A A;  3EVV A;  1CMG A;  2LUC A;  2G9B A;  2KAY A;  2LVJ A;  3LK1 A;  4XJK B;  2JXC A;  1QIW A;  3A4U B;  1J55 A;  1WRL A;  1BOD A;  1RTP 1;  1YRU B;  3BUO B;  2O5G A;  3TZ1 A;  1YX8 A;  2WOS A;  1K96 A;  1Z4H A;  3D74 A;  2ZND A;  5J3X A;  1H4B A;  2LLT A;  3B6X A;  4GFT A;  4WRI A;  2KNE A;  5AXI A;  3I5F B;  1SSE B;  2BAP A;  2KYC A;  2TN4 A;  3DVJ A;  3IQO A;  4N1G A;  3TUY B;  4C0K A;  2FJU B;  1NIW A;  1M31 A;  2WCH A;  1S5G Y;  1TCF A;  1QV1 A;  2Y5I A;  3MSE B;  4A4C A;  1AJ4 A;  1TUZ A;  2JT0 A;  2P70 A;  5AEQ A;  1SCM B;  3BJH A;  3SS5 A;  3OGN A;  1A03 A;  1S5G Z;  3LCP C;  2AAO A;  1NX1 A;  2ISD A;  5JOL A;  2KSP A;  2JXL A;  2PYQ A;  1NCY A;  2ZNE A;  4PAL A;  1XFX O;  1NX3 A;  2DOQ A;  3E3R A;  2L0P A;  1R6P A;  4F0Z B;  1XFR A;  1CDM A;  4OCI A;  1VRK A;  3RLZ A;  1JBA A;  4AQJ A;  1QX2 A;  1UUR A;  2BE6 A;  1K9K A;  1Q80 A;  2MLE C;  1G33 A;  1B8R A;  3B88 A;  2K2F A;  3JTD C;  1AP4 A;  3FS7 A;  3SG3 A;  1SMG A;  5K89 A;  1ODB A;  1PVB A;  2I18 A;  1RRO A;  2BCA A;  2F33 A;  1SL7 A;  2BKH B;  2ZN9 A;  1DJW A;  3A8R A;  2SCP A;  1ZAC A;  3NSO A;  3CZ2 A;  1KQV A;  4IJ7 A;  1AUI B;  1KQM C;  4PE1 A;  1OSA A;  1EJ3 A;  2NXQ A;  4PDZ A;  1EG4 A;  4HSZ A;  3WHU B;  1TRF A;  2EGD A;  1W7I B;  2BL0 B;  3WNX B;  2JPO A;  5DKQ A;  1OW4 A;  3L4A A;  5D7F A;  5I94 A;  3O4X A;  2WND A;  4N1F A;  1F54 A;  5BPJ A;  1JFK A;  1K94 A;  2PQL A;  1WDC C;  3DYE A;  2WCL A;  1RWY A;  2BL0 C;  2PSR A;  1ORG A;  2PRU A;  3VB1 A;  1K95 A;  2BNX A;  1UUS A;  2LVV A;  1R2U A;  2LM5 A;  2QEO A;  4OV2 A;  1KCY A;  1DQE A;  3V2L A;  3EVR A;  2LVK A;  2KGB C;  1DGU A;  1AHR A;  1KWO B;  3QRX A;  3R72 A;  2R2I A;  1JF0 A;  4YRU A;  4R1E A;  1IQ5 A;  1CB1 A;  3BUW B;  4M2P A;  1SCV A;  1SNL A;  3EKJ A;  3ZNI A;  2QEB A;  4C0L A;  4A4B A;  2OS8 C;  2F8P A;  1BG1 A;  1N0Y A;  2L98 A;  1NCX A;  1SBJ A;  1TCO B;  2CBL A;  2GTE A;  3I5I C;  4JPZ B;  1QVI Z;  5ER5 A;  3TDI A;  4CLN A;  1DT7 B;  1N65 A;  5CSF A;  5TNC A;  1L2O B;  3BUM B;  3SS3 A;  1MWN A;  1SL8 A;  2ZRT A;  4DUQ A;  1BLQ A;  2M1K B;  1PK0 D;  5FI6 A;  2KQY A;  2LMT A;  2LMV A;  4QJ4 B;  1C7W A;  3PAL A;  2LP3 A;  5B8I B;  1YVH A;  2LVI A;  2HET A;  3BYA A;  3FE6 A;  2MHH A;  1MXE A;  4NDD A;  4ORA B;  1XK4 A;  2QPT A;  2Y1N A;  1B8L A;  2KDH A;  1EXR A;  2MLF C;  2PVB A;  1FI5 A;  2HF5 A;  2H8V A;  1RJV A;  4USL A;  3DVE A;  1A75 A;  3BXK A;  3D77 A;  3LK0 A;  3OX5 A;  2JNX A;  4FTG A;  3BFB A;  2OPO A;  2WCK A;  3TDZ A;  2WC6 A;  1GGW A;  2FJY A;  2K2A A;  1A2X A;  1DTL A;  5HYD A;  2MJW B;  2JPT A;  1K9P A;  2H61 C;  1XFU O;  1G8I A;  2JUL A;  2IS9 A;  3CWG A;  3EVU A;  3IVT A;  1ZOT B;  2WC8 A;  1KFU S;  1QLK A;  1TOP A;  3PN7 C;  1GM0 A;  1UP5 A;  1OQP A;  3DVK A;  1J7R A;  2KBM A;  4CFQ A;  2ERB A;  1B8C A;  2K0J A;  4CID A;  2HQW A;  1F8H A;  1ZUZ A;  1SRA A;  2L50 A;  3CR2 A;  5JJG A;  2K7C A;  3SG4 A;  2Q91 A;  2JTT A;  1M46 A;  3OP0 A;  1KK7 Y;  2WCB A;  1QV0 A;  1QIV A;  1BR4 B;  2L2E A;  1EH2 A;  1XK4 C;  1A75 B;  2QEH A;  1CFF A;  2K60 A;  1KK7 Z;  1S6J A;  2JC2 A;  1KSM A;  3LLE A;  4OR9 B;  1OE9 B;  1NWD A;  4I5J A;  2KBI A;  1B1G A;  5IBW A;  3ICB A;  4YGB B;  1KFU L;  1WLM A;  4PHM A;  4MZJ A;  2BBM A;  2FCD A;  2I2R E;  3AAK A;  2HQ8 A;  3R1V A;  1H8B A;  1UHH A;  2KLD A;  5G08 A;  2L4I A;  3NGV A;  1TIZ A;  1K90 D;  3I5G B;  1QXP A;  5HKZ A;  1S6C A;  2KOT A;  3GOF A;  1B7T Z;  1U5I A;  1CLB A;  1NX2 A;  2FOT A;  2MBX A;  2HPS A;  4INW A;  1F70 A;  3I5G C;  3NSK A;  1UHK A;  4P5O E;  3DD4 A;  1Y1X A;  3D75 A;  1MUX A;  2KYF A;  4WQ2 A;  3DVM A;  1IKU A;  4DRW A;  1JSA A;  5CSJ A;  4FQT A;  1WLZ A;  3D78 A;  3JTD B;  1NUB A;  3DXL A;  2GV5 A;  2M7N A;  2ZN8 A;  1BR1 B;  3CGA A;  2E30 A;  1WRK A;  1WRZ A;  3AAJ A;  4XYN A;  2PMY A;  5CPV A;  2OTG C;  1KQM B;  4PHJ A;  3PLF B;  2ZFD A;  2CT9 A;  1DF0 A;  1LKJ A;  2M29 A;  2MAZ A;  3VRP A;  2LAP A;  1S3P A;  3CAB A;  1PUL A;  1CLM A;  3NHI A;  5DIC A;  2LE9 B;  1CTR A;  1GJY A;  1MF8 B;  3VRQ A;  1DEL A;  5HLO A;  2FCE A;  1U5I B;  1SYM A;  5KSZ A;  1YUT A;  4HRE E;  3S0G A;  1WDC B;  2A4J A;  1PSR A;  2JU0 A;  3NSI A;  3DZT A;  3PFV A;  1DJX A;  1Y0V H;  2B1U A;  1XFZ O;  3HCM A;  4M2Q A;  5I2O A;  1DJG A;  4D1E A;  4YGA A;  1JFJ A;  5FI2 A;  5KTY A;  5CSN A;  4ZCU A;  1SK6 D;  3RZS A;  3D0Y A;  1LA0 A;  1DF0 B;  1J1D A;  1QJT A;  3O2P A;  4C0J A;  3OB1 B;  3EKH A;  1N2D A;  1LIN A;  2BBN A;  4ICB A;  1D1O A;  3SG2 A;  1M63 B;  3C1V A;  2E6W A;  2OS8 B;  4JQ0 D;  5D69 A;  1KFX S;  2PAL A;  4ORB B;  3I5I B;  4JKT A;  5PAL A;  4DCK A;  2QAC A;  1Y1U A;  3BOW A;  3H4S E;  1PAL A;  1CMF A;  3DY9 A;  4PE7 A;  4FQO A;  4GNK B;  1QVI Y;  2H61 A;  2ZRS A;  2EHB A;  3KPX A;  1JF2 A;  3R1P A;  5DKR A;  4ZCV A;  1P28 A;  1RFJ A;  2AUC A;  4PHK A;  3GK4 X;  4YI9 A;  2BE4 A;  2AMI A;  1V1F A;  1PRW A;  2NZ0 A;  1K2H A;  1KK8 C;  1XFW O;  1CNP A;  3KHE A;  2KGR A;  3OX6 A;  2CTN A;  2K61 A;  2LAN A;  3HX4 A;  3D0Y B;  2Q4U A;  3FE8 A;  1DVI A;  3K1E A;  4BY5 A;  1PVA A;  1F71 A;  1NPQ A;  3PAT A;  1AK8 A;  1JUO A;  1KFX L;  2JT3 A;  3CZ0 A;  3SIA A;  5AFP A;  2JWW A;  3FWB A;  1YX7 A;  3EG5 B;  4GBA A;  1QWV A;  1UHI A;  4GPL B;  4QJ5 B;  1QX5 B;  2MRD A;  3CR5 X;  4HRG A;  4OKH A;  1AJ5 A;  1TNX A;  1C3Z A;  2WCE A;  4HRH A;  1FF1 A;  5I2L A;  1S26 D;  1A4P A;  1OOH A;  1CM4 A;  3BOW B;  3SS4 A;  1KSO A;  3WXA A;  1F4O A;  1SR6 B;  3GK2 A;  1QAT A;  2O60 A;  3S0B A;  2LHL A;  1Y6W A;  3IQQ A;  1LXF C;  5HL1 A;  2JZI A;  2LNK A;  1YUS A;  1K93 D;  3O78 A;  2M1U A;  2LHI A;  1SKT A;  3PN7 B;  1SR6 C;  3L4L A;  1X02 A;  2KQ6 A;  3VRN A;  1CDN A;  1BOC A;  3CR4 X;  1ALW A;  3I5H C;  4YGD B;  1J7P A;  2JOJ A;  2F3Y A;  4MRY A;  3RM1 A;  1QTX A;  3FWC A;  4OZD A;  2QEV A;  1LVC D;  1CDP A;  4YI8 A;  2NLN A;  4F7F A;  1F55 A;  2LP2 A;  4IL1 A;  4YGE B;  3BUN B;  3NXA A;  1CLL A;  4DS7 A;  4YGC B;  2NCO A;  2P6B B;  3S0D A;  1G4Y R;  5D3O A;  4MRX A;  1TNW A;  3D10 A;  4WQ3 A;  1YRT B;  4GGF A;  3IF7 A;  2F2P A;  3UO9 A;  3BQ3 A;  1OOG A;  3OB2 B;  2WCM A;  3CZT X;  3S0F A;  3FE9 A;  1QX7 A;  3UNW A;  1NYA A;  2K7D A;  5FYX A;  1DJI A;  2VRG A;  1MHO A;  1EG3 A;  4INX A;  5AAN A;  1GGZ A;  3JVT C;  2LUX A;  1B7T Y;  1MQ1 A;  4JWQ A;  5F6T A;  3VRO A;  4QJ3 B;  3FIA A;  4YBH B;  3TS5 B;  5HKW A;  4M2O A;  5DKN A;  1QAS A;  5HKY A;  3NSL A;  1S36 A;  1OZO A;  1TN4 A;  1IWQ A;  2K7B A;  3ZWH A;  3EK4 A;  1XYD A;  3TS5 C;  4UPG A;  2LC5 A;  2OTG B;  3F45 A;  3N7H A;  1NX0 A;  1DMO A;  1UHN A;  2ZKM X;  1HT9 A;  4PE4 A;  2CCM A;  5GQQ C;  3M0W A;  2EC6 B;  1OZS A;  1QLS A;  5AER A;  1IQ3 A;  2M8U A;  1DJH A;  5FI7 A;  3KEV A;  2WCJ A;  1YUR A;  4GGF C;  1CFD A;  3B7A A;  3O6B A;  2M49 B;  2PAS A;  1TNP A;  2I94 A;  4DIR A;  3PJI A;  4MVF A;  2EC6 C;  2JTZ A;  4NDC A;  3I5F C;  3TUY C;  2KPH A;  1IIO A;  1B9A A;  4U8D A;  3VGO A;  4JD9 A;  2D8N A;  2M97 A;  4NQG A;  2K8M B;  3SJS A;  1IJ5 A;  1BJF A;  2L5X B;  2BEC A;  1SCM C;  4GGN A;  4PCW A;  2COL B;  2JRF A;  3B86 A;  1FW4 A;  3SG6 A;  1S6I A;  3R1O A;  1OMD A;  1WY9 A;  4KYN A;  3QME A;  1UWO A;  3BUX B;  5EL2 A;  4GUK A;  3S0E A;  1GQM A;  1YR5 A;  4MN0 A;  4E68 A;  3OHM B;  2L2C A;  1OOI X;  1J1E A;  1C3Y A;  3BFA A;  1W9Z A;  2F2O A;  2KI6 D;  3PSR A;  2NCP A;  1NCZ A;  2V53 A;  3PM2 A;  4MZK A;  2JQ6 A;  1OMR A;  4ORC B;  3B87 A;  2Y4Q A;  1Y1A A;  1BU3 A;  1OOJ A;  2WOR A;  1JC2 A;  2GGM A;  3PM8 A;  1CFP A;  4MLW A;  3CYZ A;  1A29 A;  5HLV A;  1T14 A; 
#chains in the Genus database with same CATH homology
 1M45 A;  1M39 A;  1IRJ A;  1TNQ A;  4AOM A;  4ETO A;  2K7O A;  1L7Z A;  2LLS A;  2YGU A;  1AVS A;  1YUU A;  1ZFS A;  4Q04 A;  1XFV O;  2KHN A;  1CM1 A;  2BCX A;  2L51 A;  3CTN A;  1KK8 B;  1HQV A;  2KI4 B;  4MSP A;  1LA3 A;  2GGZ A;  1JWD A;  1C7V A;  3OBV A;  4CPV A;  1TTX A;  3EK8 A;  3SG5 A;  4L9M A;  1W7J B;  3KF9 A;  2LMU A;  5I2Q A;  1K8U A;  1NP8 A;  2KI4 C;  4AQI A;  1B4C A;  2SAS A;  3TDU A;  1J7O A;  1Z2C B;  1DJZ A;  4BY4 A;  4GAO A;  4I5K A;  1PSB A;  1DJY A;  2M0R A;  2LV7 A;  1EL4 A;  2JNF A;  1YVL A;  4MZL A;  4CFR A;  3KO0 A;  1CKK A;  2KFF A;  3VRR A;  1KWO C;  3LL8 B;  1XA5 A;  2LLU A;  2BKI B;  1QS7 A;  3SIB A;  5KU1 A;  1SPY A;  1NSH A;  1XO5 A;  1SL9 A;  1E8A A;  1MR8 A;  2MA2 A;  2KAV A;  3GK1 A;  1FBV A;  1YTZ C;  3DF0 A;  2F3Z A;  2KLE A;  2M3W A;  1FI6 A;  3I5H B;  2L5Y A;  1ALV A;  4PE0 A;  1MXL C;  4I5L B;  4TNC A;  3K21 A;  1DGV A;  3CLN A;  3EK7 A;  1IG5 A;  3CS1 A;  2BCB A;  2JT8 A;  2G2B A;  1C07 A;  3SG7 A;  1BMO A;  1L2O C;  2RGI A;  2CXJ A;  1REC A;  5CSI A;  2H2K A;  1K9U A;  2KFG A;  3AKB A;  4OVN F;  2M9G A;  2KI6 C;  1SW8 A;  1J7Q A;  4XJK A;  3AKA A;  2Y1M A;  1F4Q A;  4P2Y B;  5I8N A;  1BT6 A;  2LCP A;  1FPW A;  1RK9 A;  4MEW A;  4PHN A;  1SY9 A;  1DC1 A;  1OMV A;  1CFC A;  1UHJ A;  2M7L A;  2CNP A;  1V1G A;  3DF0 B;  1IJ6 A;  1BF5 A;  1IGV A;  2KFH A;  4NDB A;  1S1E A;  1CDL A;  1DEK A;  1B47 A;  3JVT B;  2KAX A;  4N5X A;  5ER4 X;  3WHT B;  1IH0 A;  1XFY O;  1XVJ A;  1ZMZ A;  4MBE A;  2L4H A;  2WCF A;  3O4Y A;  4I5N B;  2I7A A;  3EVV A;  1CMG A;  2LUC A;  2G9B A;  2KAY A;  2LVJ A;  3LK1 A;  4XJK B;  2JXC A;  1QIW A;  3A4U B;  1J55 A;  1WRL A;  1BOD A;  1RTP 1;  1YRU B;  3BUO B;  2O5G A;  3TZ1 A;  1YX8 A;  2WOS A;  1K96 A;  1Z4H A;  1H4B A;  2ZND A;  5J3X A;  2LLT A;  4GFT A;  4WRI A;  2KNE A;  5AXI A;  3I5F B;  3TUY B;  2KYC A;  2TN4 A;  3DVJ A;  3IQO A;  4N1G A;  4C0K A;  1JFJ A;  2BAP A;  2FJU B;  1NIW A;  1M31 A;  1S5G Y;  1TCF A;  1QV1 A;  2Y5I A;  3MSE B;  4A4C A;  1AJ4 A;  5AEQ A;  2JT0 A;  1SCM B;  1A03 A;  3SS5 A;  1S5G Z;  3LCP C;  2AAO A;  1NX1 A;  2ISD A;  5JOL A;  2KSP A;  2JXL A;  1NCY A;  2ZNE A;  4PAL A;  1XFX O;  1NX3 A;  2DOQ A;  3E3R A;  2L0P A;  1R6P A;  4F0Z B;  1CDM A;  4OCI A;  1VRK A;  3RLZ A;  1JBA A;  4AQJ A;  1QX2 A;  1UUR A;  2BE6 A;  1K9K A;  1Q80 A;  2MLE C;  1G33 A;  1B8R A;  2K2F A;  3JTD C;  1AP4 A;  3FS7 A;  3SG3 A;  1SMG A;  5K89 A;  1ODB A;  1PVB A;  2I18 A;  1RRO A;  2BCA A;  2F33 A;  1SL7 A;  2BKH B;  2ZN9 A;  1DJW A;  3A8R A;  2SCP A;  1ZAC A;  3NSO A;  1KQV A;  4IJ7 A;  1AUI B;  1KQM C;  4PE1 A;  1OSA A;  1EJ3 A;  2NXQ A;  4PDZ A;  1EG4 A;  4HSZ A;  3WHU B;  1TRF A;  2EGD A;  1W7I B;  2BL0 B;  3WNX B;  5DKQ A;  5D7F A;  5I94 A;  3O4X A;  2WND A;  4N1F A;  1F54 A;  5BPJ A;  1JFK A;  1K94 A;  1WDC C;  1RWY A;  2BL0 C;  2PSR A;  2PRU A;  1K95 A;  2BNX A;  1UUS A;  2LVV A;  1R2U A;  2LM5 A;  4OV2 A;  1KCY A;  3EVR A;  2LVK A;  2KGB C;  1DGU A;  1AHR A;  1KWO B;  3QRX A;  2R2I A;  1JF0 A;  4YRU A;  4R1E A;  1IQ5 A;  1CB1 A;  3BUW B;  4M2P A;  1SCV A;  1SNL A;  3EKJ A;  3ZNI A;  4C0L A;  4A4B A;  2OS8 C;  2F8P A;  1BG1 A;  1N0Y A;  2L98 A;  1NCX A;  1SBJ A;  1TCO B;  2CBL A;  3I5I C;  4JPZ B;  5ER5 A;  1QVI Z;  3TDI A;  4CLN A;  1DT7 B;  1N65 A;  5CSF A;  5TNC A;  1L2O B;  3BUM B;  4DUQ A;  1MWN A;  1SL8 A;  2ZRT A;  3SS3 A;  1BLQ A;  2M1K B;  1PK0 D;  5FI6 A;  2KQY A;  2LMT A;  2LMV A;  4QJ4 B;  1C7W A;  3PAL A;  2LP3 A;  5B8I B;  1YVH A;  2LVI A;  2HET A;  3BYA A;  2MHH A;  1MXE A;  4NDD A;  4ORA B;  1XK4 A;  2QPT A;  2Y1N A;  1B8L A;  2KDH A;  1EXR A;  2MLF C;  2PVB A;  1FI5 A;  2HF5 A;  1RJV A;  4USL A;  3DVE A;  1A75 A;  3BXK A;  3OX5 A;  3LK0 A;  2JNX A;  4FTG A;  2OPO A;  3TDZ A;  1GGW A;  2K2A A;  1A2X A;  1DTL A;  5HYD A;  2MJW B;  2JPT A;  1K9P A;  2H61 C;  1XFU O;  1G8I A;  2JUL A;  2IS9 A;  3CWG A;  3EVU A;  3IVT A;  1ZOT B;  2WC8 A;  1KFU S;  1QLK A;  1TOP A;  3PN7 C;  1UP5 A;  1OQP A;  3DVK A;  1J7R A;  2KBM A;  4CFQ A;  1B8C A;  2K0J A;  4CID A;  2HQW A;  1F8H A;  1ZUZ A;  1SRA A;  2L50 A;  3CR2 A;  5JJG A;  2K7C A;  3SG4 A;  2Q91 A;  2JTT A;  1M46 A;  3OP0 A;  1KK7 Y;  2WCB A;  1QV0 A;  1QIV A;  1BR4 B;  2L2E A;  1EH2 A;  1XK4 C;  1A75 B;  1CFF A;  2K60 A;  1KK7 Z;  1S6J A;  2JC2 A;  1KSM A;  3LLE A;  4OR9 B;  1OE9 B;  1NWD A;  4I5J A;  2KBI A;  1B1G A;  5IBW A;  3ICB A;  4YGB B;  1KFU L;  1WLM A;  4PHM A;  4MZJ A;  2BBM A;  2FCD A;  2I2R E;  3AAK A;  2HQ8 A;  1H8B A;  1UHH A;  2KLD A;  5G08 A;  2L4I A;  1TIZ A;  1K90 D;  3I5G B;  1QXP A;  5HKZ A;  1S6C A;  2KOT A;  3GOF A;  1B7T Z;  1U5I A;  1CLB A;  1NX2 A;  2FOT A;  2MBX A;  2HPS A;  1F70 A;  3I5G C;  3NSK A;  1UHK A;  4P5O E;  3DD4 A;  1Y1X A;  1MUX A;  2KYF A;  4WQ2 A;  3DVM A;  1IKU A;  4DRW A;  1JSA A;  5CSJ A;  1WLZ A;  3JTD B;  1NUB A;  2GV5 A;  2M7N A;  2ZN8 A;  1BR1 B;  3CGA A;  2E30 A;  1WRK A;  1WRZ A;  3AAJ A;  4XYN A;  2PMY A;  5CPV A;  2OTG C;  1KQM B;  4PHJ A;  3PLF B;  2ZFD A;  2CT9 A;  1DF0 A;  1LKJ A;  2M29 A;  2MAZ A;  3VRP A;  2LAP A;  1S3P A;  1PUL A;  1CLM A;  2LE9 B;  1CTR A;  1GJY A;  1MF8 B;  3VRQ A;  5HLO A;  1DEL A;  2FCE A;  1U5I B;  1SYM A;  5KSZ A;  1YUT A;  4HRE E;  1WDC B;  2A4J A;  1PSR A;  2JU0 A;  3NSI A;  3PFV A;  1DJX A;  1Y0V H;  2B1U A;  1XFZ O;  3HCM A;  4M2Q A;  5I2O A;  1DJG A;  4D1E A;  4YGA A;  5FI2 A;  5KTY A;  5CSN A;  4ZCU A;  1SK6 D;  3D0Y A;  1LA0 A;  1DF0 B;  1J1D A;  1QJT A;  3O2P A;  4C0J A;  3OB1 B;  3EKH A;  1N2D A;  1LIN A;  2BBN A;  4ICB A;  1D1O A;  3SG2 A;  1M63 B;  3C1V A;  2E6W A;  2OS8 B;  4JQ0 D;  5D69 A;  1KFX S;  2PAL A;  4ORB B;  3I5I B;  4JKT A;  5PAL A;  4DCK A;  2QAC A;  1Y1U A;  3BOW A;  3H4S E;  1PAL A;  1CMF A;  4PE7 A;  4FQO A;  4GNK B;  1QVI Y;  2H61 A;  2ZRS A;  2EHB A;  3KPX A;  1JF2 A;  5DKR A;  4ZCV A;  1RFJ A;  2AUC A;  4PHK A;  3GK4 X;  4YI9 A;  2BE4 A;  2AMI A;  1V1F A;  1PRW A;  2NZ0 A;  1K2H A;  1KK8 C;  1XFW O;  1CNP A;  3KHE A;  2KGR A;  3OX6 A;  2CTN A;  2K61 A;  2LAN A;  3HX4 A;  3D0Y B;  2Q4U A;  4BY5 A;  1DVI A;  1F71 A;  1PVA A;  1NPQ A;  3PAT A;  1AK8 A;  1JUO A;  1KFX L;  2JT3 A;  3SIA A;  5AFP A;  2JWW A;  3FWB A;  1YX7 A;  3EG5 B;  4GBA A;  4GPL B;  1UHI A;  4QJ5 B;  1QX5 B;  2MRD A;  3CR5 X;  4HRG A;  4OKH A;  1AJ5 A;  1TNX A;  2WCE A;  4HRH A;  1FF1 A;  5I2L A;  1S26 D;  1A4P A;  3BOW B;  1CM4 A;  3SS4 A;  1KSO A;  3WXA A;  1F4O A;  1SR6 B;  3GK2 A;  1QAT A;  2O60 A;  2LHL A;  1Y6W A;  3IQQ A;  1LXF C;  5HL1 A;  2JZI A;  2LNK A;  1YUS A;  1K93 D;  3O78 A;  2M1U A;  2LHI A;  1SKT A;  3PN7 B;  1SR6 C;  1BOC A;  1X02 A;  2KQ6 A;  3VRN A;  1CDN A;  3CR4 X;  1ALW A;  3I5H C;  4YGD B;  1J7P A;  2JOJ A;  2F3Y A;  4MRY A;  3RM1 A;  1QTX A;  3FWC A;  1LVC D;  1CDP A;  4YI8 A;  2NLN A;  1F55 A;  2LP2 A;  4IL1 A;  4YGE B;  3BUN B;  3NXA A;  1CLL A;  4DS7 A;  4YGC B;  2NCO A;  2P6B B;  1G4Y R;  5D3O A;  4MRX A;  1TNW A;  3D10 A;  4WQ3 A;  1YRT B;  4GGF A;  3IF7 A;  2F2P A;  3UO9 A;  3BQ3 A;  3OB2 B;  3CZT X;  1QX7 A;  3UNW A;  1NYA A;  2K7D A;  5FYX A;  1DJI A;  2VRG A;  1MHO A;  1EG3 A;  5AAN A;  1GGZ A;  3JVT C;  2LUX A;  1B7T Y;  1MQ1 A;  4JWQ A;  5F6T A;  3VRO A;  4QJ3 B;  3FIA A;  4YBH B;  3TS5 B;  5HKW A;  4M2O A;  5DKN A;  1QAS A;  5HKY A;  3NSL A;  1S36 A;  1OZO A;  1TN4 A;  1IWQ A;  2K7B A;  3ZWH A;  3EK4 A;  1XYD A;  3TS5 C;  4UPG A;  2LC5 A;  2OTG B;  3F45 A;  1NX0 A;  1DMO A;  1UHN A;  2ZKM X;  1HT9 A;  4PE4 A;  2CCM A;  5GQQ C;  3M0W A;  2EC6 B;  1OZS A;  1QLS A;  5AER A;  1IQ3 A;  2M8U A;  1DJH A;  5FI7 A;  3KEV A;  1YUR A;  4GGF C;  1CFD A;  3O6B A;  2M49 B;  2PAS A;  1TNP A;  2I94 A;  4DIR A;  4MVF A;  2EC6 C;  2JTZ A;  4NDC A;  3I5F C;  3TUY C;  1B9A A;  4U8D A;  3VGO A;  4NQG A;  2D8N A;  2M97 A;  3SJS A;  2K8M B;  1IJ5 A;  1BJF A;  2L5X B;  2BEC A;  1SCM C;  4GGN A;  4PCW A;  2COL B;  2JRF A;  1FW4 A;  3SG6 A;  1S6I A;  1OMD A;  1WY9 A;  4KYN A;  1UWO A;  3BUX B;  4E68 A;  4GUK A;  1GQM A;  1YR5 A;  4MN0 A;  3OHM B;  1J1E A;  1W9Z A;  2F2O A;  2KI6 D;  3PSR A;  2NCP A;  1NCZ A;  2V53 A;  4MZK A;  3PM2 A;  2JQ6 A;  1OMR A;  4ORC B;  2Y4Q A;  1Y1A A;  1BU3 A;  1OOJ A;  2WOR A;  1JC2 A;  2GGM A;  3PM8 A;  1CFP A;  4MLW A;  1A29 A;  5HLV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...