4I5KA

Pp2a pr70 holoenzyme model3_dica_rcsb.pdb bppnat5_extend.mtz
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
272
structure length
266
Chain Sequence
NHHDDASKFICLLAKPNCSSLEQEDFIPLLQDVVDTHPGLTFLKDAPEFHSRYITTVIQRIFYTVNRSWSGKITSTEIRKSNFLQTLALLEEEEDINQITDYFSYEHFYVIYCKFWELDTDHDLYISQADLSRYNDQASSSRIIERIFSGAVTKEGRMSYADFVWFLISEEDKRNPTSIEYWFRCMDVDGDGVLSMYELEYFYEEQCERMEAMGIEPLPFHDLLCQMLDLVKPAVDGKITLRDLKRCRMAHIFYDTFFNLEKYLDH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein phosphatase 2A regulatory subunit B
publication title Structure of the Ca(2+)-dependent PP2A heterotrimer and insights into Cdc6 dephosphorylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 98
structure length 266
sequence length 272
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
A PF17958 EF-hand_13 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4i5kA02
1.10.238.220 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Recoverin; domain 1 4i5kA01
1GJYA 2M1UA 1H8BA 2LUXA 3FWBA 1BF5A 5KU1A 1Y0VH 4AQIA 1UHHA 1MHOA 1D1OA 2L50A 1YUUA 2LLUA 1IJ6A 2FCDA 1K95A 2LVKA 1QIVA 3RM1A 2OS8B 3RLZA 1IH0A 4DCKA 3OX5A 2OTGC 1NCYA 4PE1A 3CGAA 1RFJA 1FI5A 4F0ZB 2Q4UA 2PMYA 4YI8A 1QLSA 2SASA 3KPXA 4ORAB 1JFKA 2M97A 1AJ5A 2BBMA 2KFFA 2LP2A 4PE7A 1CFPA 3PATA 3ZNIA 3MSEB 1S26D 3BUNB 1DGVA 1SPYA 2ZN8A 4NDCA 2WCFA 1M63B 2H61A 3D0YB 1K8UA 1ZACA 2KQ6A 1EG3A 1BODA 3WHUB 1R6PA 2JT0A 1F4OA 2LVVA 1FI6A 1S5GY 3NSLA 3TZ1A 1F4QA 1OZSA 1YR5A 2E6WA 2M29A 2MRDA 3I5FC 5CSIA 2M1KB 2ZNDA 4I5LB 4M2PA 3GK2A 1JUOA 5AXIA 3LLEA 2WC8A 2KDHA 1UP5A 1TNXA 4JPZB 5J3XA 3I5IB 3IF7A 3SIBA 2F33A 2JNFA 1KQMB 2LC5A 2BE4A 4JQ0D 1YVLA 2MAZA 1AK8A 1MXLC 1TCOB 1KK7Y 1ZFSA 1BR4B 4MRYA 2BKIB 3VROA 1ZMZA 1NYAA 4NQGA 3PFVA 3DVEA 1SBJA 4ETOA 1G4YR 3OX6A 2LLTA 2JTZA 1SCMC 3O6BA 3LCPC 1LVCD 1A2XA 2OTGB 1RECA 2PASA 3DD4A 2Y5IA 4GPLB 4ZCVA 1B4CA 3LK1A 1DMOA 1RK9A 1J55A 2NZ0A 3AAJA 4M2QA 1ZUZA 3VRPA 1B8CA 2L51A 1S6CA 2PALA 3IQQA 1K94A 1TRFA 1XFUO 2LAPA 1LA0A 2F2PA 2LUCA 2D8NA 4PE0A 3KEVA 4CIDA 2AMIA 4TNCA 3F45A 1SMGA 5DKRA 3DF0A 3CZTX 1CNPA 1UURA 1S1EA 3GK4X 3KF9A 3I5FB 3SJSA 1KSMA 1W7JB 4QJ4B 1DJXA 1SCVA 2JT3A 2KI6C 4C0KA 1ZOTB 1MR8A 2CBLA 2Y1NA 2MLEC 5F6TA 4P5OE 2LNKA 4DIRA 3NXAA 1N65A 5ER5A 2BE6A 2R2IA 3OB1B 2KAYA 2MHHA 3WHTB 1NWDA 2H61C 3A8RA 1B8RA 1SCMB 5G08A 1CFFA 1NUBA 1L2OC 1N0YA 1WRZA 4HRHA 3SG6A 1OOJA 1XVJA 2QPTA 1RTP1 1SL7A 1LKJA 1YTZC 2HQWA 4FQOA 1LA3A 3VRQA 1F71A 2KAVA 1MUXA 2F3YA 2ZNEA 2M9GA 2GV5A 3CTNA 4C0JA 1OE9B 3O2PA 2B1UA 5HKZA 1JC2A 1C07A 1MXEA 3C1VA 1TN4A 1X02A 4NDDA 3NSIA 1BMOA 2KFGA 5TNCA 4PHMA 4QJ3B 1U5IB 2V53A 3M0WA 3ZWHA 1CDNA 4DRWA 5DKQA 1KSOA 1W7IB 1LXFC 2AAOA 3PALA 1XFZO 1CMGA 1BU3A 2LHIA 2NLNA 2M7LA 3SIAA 3TS5C 1KFXL 5B8IB 1NX0A 1YRUB 3NSOA 2WCEA 4I5NB 2PVBA 3I5GC 4OR9B 3EK4A 4YI9A 4UPGA 4OV2A 1J7RA 2L4IA 2G9BA 2NCOA 4YRUA 4GBAA 1F54A 3SG7A 1MF8B 4L9MA 5I8NA 4JWQA 2JPTA 2EC6C 2CT9A 1JSAA 1CDLA 1M31A 1XFYO 2CTNA 1UHIA 1WLZA 1L2OB 1FPWA 1NPQA 1YX7A 1PALA 4PALA 3BXKA 3EKJA 5GQQC 4CFQA 1J1DA 4YBHB 1K90D 1EJ3A 1RWYA 2GGMA 2KOTA 2M8UA 1YUSA 4N1FA 3WXAA 3VRNA 1NCZA 3DVJA 2O60A 2K61A 2HF5A 2ZFDA 4DUQA 2G2BA 1Y1UA 3TDUA 2AUCA 1WY9A 3IQOA 1XK4A 2LMTA 4GGNA 4XJKB 1LINA 1A75B 2MJWB 1AHRA 2L4HA 1SYMA 2O5GA 2IS9A 4IL1A 3AKAA 4GGFC 3OB2B 1M45A 1KCYA 3AKBA 1PSBA 1PULA 2L0PA 3WNXB 1XO5A 3TS5B 1Y1AA 2EGDA 2L5XB 1SL8A 4PHJA 3PN7C 1GQMA 1XFXO 4XYNA 1V1FA 3I5GB 2KAXA 2M7NA 1BT6A 2K7DA 2M49B 4GFTA 1SNLA 5D69A 5DKNA 1QLKA 5D7FA 3SG3A 1DF0B 2KYFA 4AOMA 4AQJA 3CR4X 1IGVA 1UHNA 1DVIA 1FW4A 5CSFA 2WCBA 2EC6B 4A4CA 4ORBB 4HREE 1YRTB 2LMVA 1IQ3A 4I5JA 5CSJA 2QACA 3BOWA 2P6BB 2Q91A 3QRXA 1S6IA 3CLNA 4D1EA 1VRKA 2BCAA 2JT8A 1NCXA 3OHMB 2PSRA 4PE4A 5CPVA 1H4BA 3FS7A 1AVSA 4NDBA 1AUIB 1JFJA 1AJ4A 3HCMA 1CMFA 2RGIA 1CTRA 2HQ8A 2JC2A 3H4SE 1EXRA 2KNEA 3BUOB 3TDIA 3VRRA 1HT9A 4GNKB 1R2UA 4WQ3A 3D10A 4OCIA 4MSPA 3FIAA 1NX2A 2JU0A 4OVNF 1QVIZ 4MZLA 1QTXA 1OMDA 1SRAA 3GOFA 1OMVA 1S36A 4MRXA 1GGWA 1SKTA 2L2EA 1KK8C 2PRUA 2EHBA 2SCPA 2DOQA 1ODBA 1CLLA 1KWOC 1NP8A 3PN7B 4WRIA 1CM1A 1S3PA 2K2FA 1YX8A 1QX7A 4MEWA 2K7CA 3AAKA 4N1GA 1DJYA 4HRGA 4P2YB 3GK1A 1UUSA 1QXPA 4FTGA 4GUKA 1TTXA 4C0LA 4ZCUA 3JVTC 1XK4C 1JF2A 2ZN9A 4U8DA 1J7OA 3VGOA 1PVAA 2FJUB 2KSPA 3BQ3A 2K0JA 2KI4C 5HKYA 1CFCA 1IG5A 2LMUA 4CFRA 1KFUS 2LE9B 5IBWA 3EK8A 2FCEA 1CDPA 1DJZA 1N2DA 1DJHA 2LP3A 4YGDB 3I5HC 1IQ5A 2LHLA 2I94A 2JZIA 2OPOA 3E3RA 5JOLA 1K2HA 1EG4A 1S5GZ 3EK7A 2CCMA 1UHKA 3KO0A 3TUYC 1SR6C 1BJFA 4YGAA 1K9PA 1QVIY 1PVBA 2K2AA 1V1GA 1A03A 2MA2A 2FOTA 4OKHA 1B8LA 1YVHA 2CNPA 2Y1MA 1JF0A 2JNXA 2LCPA 1PRWA 4MVFA 1U5IA 2LV7A 2KBMA 4Q04A 1FF1A 2NCPA 2F2OA 2WOSA 4YGCB 3CR5X 1KK8B 1RROA 4I5KA 1OSAA 1A29A 1KK7Z 1S6JA 1CM4A 2K7BA 3O4YA 2K7OA 1KFUL 1KWOB 2M0RA 1QX5B 1CLMA 3DVMA 5AFPA 1M46A 1YURA 1Q80A 1QV0A 2JXLA 2JRFA 1CKKA 1QJTA 2WORA 1OZOA 5CSNA 4ICBA 1XA5A 1PSRA 2VRGA 3CR2A 2I18A 3KHEA 1NSHA 5BPJA 2BECA 4YGBB 5AEQA 1BOCA 1TCFA 2GGZA 2I2RE 3PSRA 1J1EA 1PK0D 1SW8A 2BBNA 3JVTB 5HLOA 1CB1A 1EH2A 1G33A 1KQVA 1TIZA 1IRJA 2KI6D 2KI4B 5HYDA 1SK6D 1DJWA 1DGUA 4MLWA 2ZKMX 2ISDA 1F55A 1B47A 1BR1B 3D0YA 1A4PA 2L98A 1ALWA 2JQ6A 1TNQA 2LANA 3I5HB 4M2OA 2F3ZA 2NXQA 4WQ2A 4CLNA 3EVUA 5AERA 1Y1XA 1UWOA 3FWCA 1L7ZA 1CLBA 1K9KA 2MBXA 5KTYA 1CDMA 3SG5A 1OQPA 3TUYB 1DJIA 1SR6B 1QX2A 1DJGA 1QIWA 4ORCB 2BCBA 1B7TZ 3ICBA 1MQ1A 5JJGA 2JULA 2A4JA 4XJKA 2K8MB 4HSZA 1A75A 5HKWA 1XFWO 2KGBC 2LLSA 4PCWA 2BL0C 1DT7B 4BY5A 1WDCC 5I2LA 1EL4A 2COLB 1JWDA 1M39A 1ALVA 1Y6WA 3SG2A 3BOWB 3JTDC 4YGEB 3DF0B 1QATA 2JWWA 3CWGA 1AP4A 4PHKA 4R1EA 1K9UA 3LL8B 2JTTA 3NSKA 2CXJA 5I2QA 3EVRA 2ZRSA 1DTLA 3O78A 5K89A 4USLA 1DF0A 1FBVA 3DVKA 1J7PA 1NIWA 3PM8A 5PALA 1TOPA 1HQVA 1WRKA 2HPSA 2H2KA 2LM5A 2LVIA 1B9AA 4CPVA 1C7VA 2KBIA 2M3WA 4A4BA 2KGRA 4MBEA 1F8HA 3EVVA 3SG4A 1WRLA 4MZKA 4PHNA 2KFHA 2TN4A 2E30A 1NX1A 2JOJA 4DS7A 3K21A 1JBAA 2ZRTA 1NX3A 1E8AA 1YUTA 2BCXA 1CFDA 4GAOA 2Y4QA 1B7TY 2LVJA 3EKHA 1K93D 1BG1A 2KQYA 1TNWA 4BY4A 3HX4A 1MWNA 5I2OA 2OS8C 1QV1A 5AANA 2I7AA 2JXCA 1IJ5A 5KSZA 1XFVO 1K96A 1QASA 3OP0A 2BL0B 1WLMA 1WDCB 4GGFA 1J7QA 4E68A 1IWQA 2BKHB 1BLQA 3TDZA 1RJVA 3JTDB 1OMRA 2KHNA 2KYCA 3CS1A 4MN0A 1XYDA 1KFXS 3BUXB 2WNDA 4N5XA 3BUWB 2MLFC 4QJ5B 1IKUA 4PDZA 1C7WA 2F8PA 3BYAA 5ER4X 1UHJA 1GGZA 4MZJA 5FYXA 2HETA 3LK0A 1F70A 3I5IC 5HLVA 1G8IA 1KQMC 1TNPA 3PLFB 3BUMB 1SY9A 1B1GA 1SL9A 3A4UB 1QS7A
chains in the Genus database with same CATH superfamily
1GM0A 1GJYA 2M1UA 1H8BA 2LUXA 3FWBA 1BF5A 5KU1A 1Y0VH 4AQIA 3S0DA 1UHHA 1MHOA 1D1OA 2L50A 1YUUA 2LLUA 1IJ6A 2FCDA 1K95A 2LVKA 1QIVA 3RM1A 2OS8B 3RLZA 1IH0A 4DCKA 3OX5A 1OW4A 2OTGC 1NCYA 4PE1A 3CGAA 1RFJA 1FI5A 4F0ZB 2Q4UA 2PMYA 4YI8A 3O4XA 1QLSA 2SASA 3KPXA 4ORAB 1JFKA 2M97A 1AJ5A 2BBMA 2KFFA 2LP2A 3BJHA 3CZ0A 3D76A 4PE7A 3PATA 5DICA 3ZNIA 1CFPA 3MSEB 1S26D 3BUNB 1DGVA 1SPYA 2ZN8A 4NDCA 2WCFA 1M63B 2H61A 3D0YB 1K8UA 1ZACA 2KQ6A 1EG3A 1BODA 2JPOA 3WHUB 1R6PA 2JT0A 1F4OA 2LVVA 1FI6A 1S5GY 3NSLA 3TZ1A 3IVTA 1F4QA 1OZSA 1YR5A 2E6WA 2M29A 2MRDA 3I5FC 3L47A 5CSIA 2M1KB 2ZNDA 4I5LB 4M2PA 3GK2A 1JUOA 5AXIA 3LLEA 2WC8A 2KDHA 1UP5A 3D78A 1TNXA 4JPZB 5J3XA 3I5IB 1DEKA 3IF7A 2F33A 3OBVA 3SIBA 2JNFA 1KQMB 2LC5A 2BE4A 3B88A 4JQ0D 1YVLA 2MAZA 3DXLA 3R1VA 1AK8A 1MXLC 1TCOB 1KK7Y 1ZFSA 1BR4B 2BAPA 2BKIB 4MRYA 1ZMZA 3VROA 1NYAA 4NQGA 3PFVA 3DVEA 1SBJA 3S0AA 4ETOA 1G4YR 3OX6A 2LLTA 2JTZA 1SCMC 3S0GA 3FE6A 1C3YA 2YGUA 1QWVA 3O6BA 3OGNA 3LCPC 1LVCD 1A2XA 2OTGB 1Z2CB 1RECA 2PASA 3DD4A 2Y5IA 4GPLB 4ZCVA 1B4CA 3LK1A 1DMOA 1RK9A 1J55A 2NZ0A 3AAJA 4M2QA 1ZUZA 3VRPA 1B8CA 2L51A 1S6CA 2PALA 3IQQA 1K94A 1TRFA 1XFUO 2LAPA 1LA0A 2F2PA 2LUCA 2D8NA 4PE0A 3KEVA 4CIDA 2AMIA 4TNCA 3F45A 1SMGA 5DKRA 3DF0A 3CZTX 1CNPA 1UURA 1S1EA 3GK4X 3KF9A 3I5FB 3SJSA 1KSMA 1W7JB 4QJ4B 1DJXA 1SCVA 2JT3A 2KI6C 4C0KA 1ZOTB 1MR8A 2CBLA 2Y1NA 2MLEC 2WCJA 5F6TA 4P5OE 2LNKA 4DIRA 3NXAA 1N65A 5ER5A 2BE6A 2R2IA 3OB1B 2KAYA 2MHHA 3WHTB 1NWDA 2H61C 3A8RA 1B8RA 1SSEB 3K1EA 1SCMB 5G08A 1CFFA 1NUBA 1L2OC 1N0YA 1WRZA 4HRHA 3SG6A 1OOJA 2PQLA 1XVJA 2QPTA 1RTP1 1SL7A 1LKJA 1YTZC 2HQWA 4FQOA 1LA3A 3VRQA 1F71A 2KAVA 1MUXA 2F3YA 2ZNEA 2M9GA 2GV5A 3B7AA 3CTNA 4C0JA 1OE9B 3O2PA 2B1UA 5HKZA 1JC2A 1TWOA 1C07A 3SS4A 1MXEA 3C1VA 1TN4A 1X02A 4NDDA 3NSIA 1BMOA 2KFGA 5TNCA 4PHMA 4QJ3B 1U5IB 2FJYA 2V53A 3M0WA 3ZWHA 1CDNA 4DRWA 5DKQA 2QEBA 3R72A 1KSOA 1W7IB 1LXFC 2AAOA 3SS5A 3PALA 1XFZO 1CMGA 1BU3A 2LHIA 2NLNA 2M7LA 3SIAA 3TS5C 1KFXL 3Q8IA 5B8IB 1NX0A 1YRUB 3NSOA 2WCEA 3PJIA 3RZSA 4I5NB 2PVBA 3I5GC 4OR9B 1IIOA 3EK4A 4YI9A 3UO9A 4UPGA 4OV2A 1J7RA 2L4IA 2G9BA 3B6XA 2NCOA 4YRUA 4GBAA 1F54A 3SG7A 1MF8B 4L9MA 5I8NA 4JWQA 2JPTA 2L5YA 2EC6C 2CT9A 1JSAA 1CDLA 1M31A 1XFYO 2CTNA 1UHIA 1WLZA 1L2OB 3DY9A 1FPWA 1NPQA 1YX7A 1PALA 4PALA 1EH2A 3S0FA 3BXKA 3EKJA 5GQQC 4CFQA 1J1DA 4YBHB 1K90D 1EJ3A 1RWYA 2GGMA 2KOTA 2M8UA 1YUSA 3BFAA 4N1FA 3VRNA 1NCZA 3WXAA 3DVJA 2O60A 1DC1A 2K61A 2HF5A 2ZFDA 4DUQA 5D3OA 2G2BA 1Y1UA 3TDUA 2AUCA 4KYNA 3NGVA 4OZDA 1WY9A 3IQOA 1XK4A 2LMTA 4GGNA 4XJKB 1LINA 1A75B 2MJWB 1AHRA 2L4HA 1SYMA 2O5GA 2IS9A 4IL1A 4F7FA 3AKAA 4GGFC 3OB2B 1M45A 2KPHA 1KCYA 3AKBA 1PSBA 3S0BA 1ORGA 1PULA 2L0PA 3WNXB 1XO5A 3TS5B 1Y1AA 2EGDA 2L5XB 1SL8A 4PHJA 5EL2A 3PN7C 1GQMA 2L2CA 1XFXO 3FE8A 4XYNA 4JKTA 1V1FA 3I5GB 2KAXA 2M7NA 1BT6A 2K7DA 2M49B 4GFTA 1SNLA 5D69A 5DKNA 1QLKA 3DZTA 5D7FA 4INXA 1OOGA 3SG3A 1DF0B 2KYFA 4AOMA 4AQJA 3CR4X 1IGVA 1UHNA 1DVIA 1FW4A 5CSFA 2WCBA 2EC6B 4A4CA 4ORBB 4HREE 1YRTB 2LMVA 1IQ3A 4I5JA 3CZ1A 1TUZA 2QACA 5CSJA 3BOWA 2P6BB 2Q91A 3CABA 1S6IA 3QRXA 3CLNA 4D1EA 1VRKA 2BCAA 2JT8A 1NCXA 3OHMB 2PSRA 4PE4A 5CPVA 1H4BA 3FS7A 1LS8A 3D77A 1AVSA 4NDBA 1AUIB 1JFJA 1AJ4A 3HCMA 1CMFA 2RGIA 1CTRA 2HQ8A 2JC2A 3H4SE 1EXRA 2KNEA 3BUOB 3TDIA 3VRRA 1HT9A 4GNKB 1R2UA 4WQ3A 3D10A 5JJGA 3L4AA 4OCIA 1Z4HA 4MSPA 3FIAA 1NX2A 2JU0A 4OVNF 1QVIZ 4MZLA 1QTXA 1OMDA 1SRAA 3GOFA 3D75A 3QMEA 1OMVA 1S36A 4MRXA 3BFHA 1SKTA 1GGWA 2L2EA 1KK8C 2PRUA 2EHBA 2SCPA 2DOQA 1ODBA 1OOIX 1CLLA 1KWOC 1NP8A 3PN7B 4WRIA 1CM1A 1S3PA 2K2FA 1YX8A 1QX7A 4MEWA 2K7CA 2QEOA 3AAKA 4N1GA 3VB1A 1DJYA 4HRGA 4P2YB 3GK1A 1UUSA 1QXPA 2GTEA 4FTGA 1TTXA 4GUKA 4ZCUA 4C0LA 3JVTC 1XK4C 1JF2A 2ZN9A 4U8DA 1J7OA 3VGOA 1PVAA 2FJUB 2KSPA 3BQ3A 2K0JA 2KI4C 3S0EA 5HKYA 1CFCA 1IG5A 2LMUA 4CFRA 1KFUS 2LE9B 5IBWA 3EK8A 2FCEA 1CDPA 1DJZA 1N2DA 1DJHA 3CDNA 2LP3A 2WCMA 3I5HC 4YGDB 1IQ5A 2KLDA 2I94A 2JZIA 2LHLA 5HL1A 2OPOA 3E3RA 5JOLA 3B87A 1K2HA 1EG4A 1S5GZ 3D74A 3EK7A 2CCMA 1UHKA 3KO0A 3R1PA 3TUYC 1SR6C 1BJFA 4YGAA 1K9PA 1QVIY 1PVBA 2K2AA 2PYQA 1V1GA 3R1OA 1A03A 2MA2A 2FOTA 4OKHA 3FE9A 1B8LA 1YVHA 2CNPA 2Y1MA 1JF0A 2JNXA 2WCHA 2LCPA 4FQTA 5FI2A 1PRWA 3CZ2A 4MVFA 3CYZA 1U5IA 2LV7A 2KBMA 4Q04A 1FF1A 2NCPA 2F2OA 2WOSA 4YGCB 3CR5X 1KK8B 1RROA 4I5KA 1OSAA 1A29A 1KK7Z 1S6JA 1CM4A 2K7BA 3O4YA 2K7OA 1KFUL 1KWOB 2M0RA 1QX5B 1CLMA 3DVMA 5AFPA 1M46A 1YURA 1Q80A 1QV0A 2JXLA 2JRFA 1CKKA 1QJTA 2WORA 1OZOA 5CSNA 4ICBA 1XA5A 1PSRA 2VRGA 3CR2A 2I18A 3KHEA 1NSHA 5BPJA 2BECA 4YGBB 5AEQA 2QEHA 3BFBA 1BOCA 1TCFA 2GGZA 2I2RE 3PM2A 1J1EA 1PK0D 1SW8A 2BBNA 3JVTB 3PSRA 5HLOA 1CB1A 1G33A 1KQVA 1TIZA 1IRJA 2KI6D 2KI4B 5HYDA 1SK6D 1DJWA 1DGUA 3L4LA 4MLWA 2ZKMX 2ISDA 1F55A 1B47A 1BR1B 3D0YA 1A4PA 2L98A 1ALWA 3UNWA 2JQ6A 1TNQA 2LANA 3I5HB 4M2OA 2F3ZA 2NXQA 4WQ2A 4CLNA 3EVUA 5AERA 1Y1XA 1UWOA 3FWCA 1L7ZA 1CLBA 1K9KA 2MBXA 5KTYA 1CDMA 3SG5A 1OQPA 2WC5A 1DJIA 1SR6B 3TUYB 1QX2A 1DJGA 1QIWA 4ORCB 2BCBA 1B7TZ 2K60A 3ICBA 1MQ1A 1DQEA 1XFRA 2A4JA 2JULA 2K8MB 4XJKA 4HSZA 1A75A 5FI6A 1XFWO 2KGBC 2LLSA 4PCWA 4PT1A 5HKWA 2BL0C 1DT7B 4BY5A 1WDCC 5I2LA 1EL4A 1T14A 2COLB 1JWDA 1M39A 1ALVA 3EG5B 1Y6WA 2QDIA 3SG2A 3BOWB 3JTDC 4YGEB 5I94A 3DF0B 1QATA 2JWWA 3CWGA 3NHTA 1AP4A 2ERBA 4PHKA 4R1EA 1K9UA 1C3ZA 2WC6A 2KLEA 3LL8B 2JTTA 3D73A 3NSKA 2CXJA 5I2QA 3EVRA 2P70A 2ZRSA 1DTLA 3O78A 3DYEA 1W9ZA 5K89A 4USLA 2WCKA 1DF0A 1FBVA 3DVKA 1J7PA 1NIWA 3PM8A 5PALA 1TOPA 1HQVA 1WRKA 2HPSA 2H2KA 2LM5A 2LVIA 1B9AA 4CPVA 1C7VA 2KBIA 2M3WA 4A4BA 2KGRA 4MBEA 3N7HA 1P28A 1F8HA 3EVVA 3SG4A 1WRLA 4MZKA 4PHNA 2KFHA 2TN4A 2E30A 1NX1A 2JOJA 4DS7A 3K21A 1JBAA 2ZRTA 1NX3A 4INWA 1E8AA 1YUTA 2BCXA 1CFDA 4GAOA 2Y4QA 1B7TY 2LVJA 3EKHA 1K93D 1BG1A 1DELA 2KQYA 1TNWA 2P71A 3HX4A 1MWNA 4BY4A 5I2OA 2OS8C 2H8VA 1QV1A 5FI7A 5AANA 2I7AA 2JXCA 3NHIA 1IJ5A 5KSZA 1XFVO 1K96A 1QASA 2QEVA 3OP0A 3V2LA 2BL0B 1WLMA 1WDCB 4GGFA 1J7QA 4E68A 1IWQA 2BKHB 1BLQA 1TUJA 1RJVA 3TDZA 3JTDB 1OMRA 2KHNA 2WCLA 2KYCA 3CS1A 4MN0A 1XYDA 1KFXS 3BUXB 2WNDA 4N5XA 3BUWB 2MLFC 4QJ5B 1IKUA 4IJ7A 2BNXA 4PDZA 1C7WA 2F8PA 3BYAA 5ER4X 1UHJA 1GGZA 4MZJA 5FYXA 2HETA 4JD9A 3LK0A 1OOFA 3SS3A 3I5IC 5HLVA 1F70A 1G8IA 1KQMC 1TNPA 3B86A 3BUMB 3PLFB 1OOHA 1SY9A 1B1GA 1SL9A 3A4UB 1QS7A
chains in the Genus database with same CATH topology
1GJYA 2M1UA 1H8BA 2LUXA 3FWBA 1BF5A 5KU1A 1Y0VH 4AQIA 1UHHA 1MHOA 1D1OA 2L50A 1YUUA 2LLUA 1IJ6A 2FCDA 1K95A 2LVKA 1QIVA 3RM1A 2OS8B 3RLZA 1IH0A 4DCKA 3OX5A 2OTGC 1NCYA 4PE1A 3CGAA 1RFJA 1FI5A 4F0ZB 2Q4UA 2PMYA 4YI8A 3O4XA 1QLSA 2SASA 3KPXA 4ORAB 1JFKA 2M97A 1AJ5A 2BBMA 2KFFA 2LP2A 4PE7A 1CFPA 3PATA 3ZNIA 3MSEB 1S26D 3BUNB 1DGVA 1SPYA 2ZN8A 4NDCA 2WCFA 1M63B 2H61A 3D0YB 1K8UA 1ZACA 2KQ6A 1EG3A 1BODA 3WHUB 1R6PA 2JT0A 1F4OA 2LVVA 1FI6A 1S5GY 3NSLA 3TZ1A 3IVTA 1F4QA 1OZSA 1YR5A 2E6WA 2M29A 2MRDA 3I5FC 5CSIA 2M1KB 2ZNDA 4I5LB 4M2PA 3GK2A 1JUOA 5AXIA 3LLEA 2WC8A 2KDHA 1UP5A 1TNXA 4JPZB 5J3XA 3I5IB 3IF7A 3SIBA 2F33A 1DEKA 3OBVA 2JNFA 1KQMB 2LC5A 2BE4A 4JQ0D 1YVLA 2MAZA 1AK8A 1MXLC 1TCOB 1KK7Y 1ZFSA 1BR4B 4MRYA 2BKIB 3VROA 1ZMZA 2BAPA 1NYAA 4NQGA 3PFVA 3DVEA 1SBJA 4ETOA 1G4YR 3OX6A 2LLTA 2JTZA 1SCMC 2YGUA 3O6BA 3LCPC 1LVCD 1A2XA 2OTGB 1Z2CB 1RECA 2PASA 3DD4A 2Y5IA 4GPLB 4ZCVA 1B4CA 3LK1A 1DMOA 1RK9A 1J55A 2NZ0A 3AAJA 4M2QA 1ZUZA 3VRPA 1B8CA 2L51A 1S6CA 2PALA 3IQQA 1K94A 1TRFA 1XFUO 2LAPA 1LA0A 2F2PA 2LUCA 2D8NA 4PE0A 3KEVA 4CIDA 2AMIA 4TNCA 3F45A 1SMGA 5DKRA 3DF0A 3CZTX 1CNPA 1UURA 1S1EA 3GK4X 3KF9A 3I5FB 3SJSA 1KSMA 1W7JB 4QJ4B 1DJXA 1SCVA 2JT3A 2KI6C 4C0KA 1ZOTB 1MR8A 2CBLA 2Y1NA 2MLEC 5F6TA 4P5OE 2LNKA 4DIRA 3NXAA 1N65A 5ER5A 2BE6A 2R2IA 3OB1B 2KAYA 2MHHA 3WHTB 1NWDA 2H61C 3A8RA 1B8RA 1SCMB 5G08A 1CFFA 1NUBA 1L2OC 1N0YA 1WRZA 4HRHA 3SG6A 1OOJA 1XVJA 2QPTA 1RTP1 1SL7A 1LKJA 1YTZC 2HQWA 4FQOA 1LA3A 3VRQA 1F71A 2KAVA 1MUXA 2F3YA 2ZNEA 2M9GA 2GV5A 3CTNA 4C0JA 1OE9B 3O2PA 2B1UA 5HKZA 1JC2A 1C07A 3SS4A 1MXEA 3C1VA 1TN4A 1X02A 4NDDA 3NSIA 1BMOA 2KFGA 5TNCA 4PHMA 4QJ3B 1U5IB 2V53A 3M0WA 3ZWHA 1CDNA 4DRWA 5DKQA 1KSOA 1W7IB 1LXFC 2AAOA 3SS5A 3PALA 1XFZO 1CMGA 1BU3A 2LHIA 2NLNA 2M7LA 3SIAA 3TS5C 1KFXL 5B8IB 1NX0A 1YRUB 3NSOA 2WCEA 4I5NB 2PVBA 3I5GC 4OR9B 3EK4A 4YI9A 3UO9A 4UPGA 4OV2A 1J7RA 2L4IA 2G9BA 2NCOA 4YRUA 4GBAA 1F54A 3SG7A 1MF8B 4L9MA 5I8NA 4JWQA 2JPTA 2L5YA 2EC6C 2CT9A 1JSAA 1CDLA 1M31A 1XFYO 2CTNA 1UHIA 1WLZA 1L2OB 1FPWA 1NPQA 1YX7A 1PALA 4PALA 3BXKA 3EKJA 5GQQC 4CFQA 1J1DA 4YBHB 1K90D 1EJ3A 1RWYA 2GGMA 2KOTA 2M8UA 1YUSA 4N1FA 3WXAA 3VRNA 1NCZA 3DVJA 2O60A 1DC1A 2K61A 2HF5A 2ZFDA 4DUQA 5D3OA 2G2BA 1Y1UA 3TDUA 2AUCA 4KYNA 1WY9A 3IQOA 1XK4A 2LMTA 4GGNA 4XJKB 1LINA 1A75B 2MJWB 1AHRA 2L4HA 1SYMA 2O5GA 2IS9A 4IL1A 3AKAA 4GGFC 3OB2B 1M45A 1KCYA 3AKBA 1PSBA 1PULA 2L0PA 3WNXB 1XO5A 3TS5B 1Y1AA 2EGDA 2L5XB 1SL8A 4PHJA 3PN7C 1GQMA 1XFXO 4XYNA 4JKTA 1V1FA 3I5GB 2KAXA 2M7NA 1BT6A 2K7DA 2M49B 4GFTA 1SNLA 5D69A 5DKNA 1QLKA 3PM2A 5D7FA 3SG3A 1DF0B 2KYFA 4AOMA 4AQJA 3CR4X 1IGVA 1UHNA 1DVIA 1FW4A 5CSFA 2WCBA 2EC6B 4A4CA 4ORBB 4HREE 1YRTB 2LMVA 1IQ3A 4I5JA 5CSJA 2QACA 3BOWA 2P6BB 2Q91A 3QRXA 1S6IA 3CLNA 4D1EA 1VRKA 2BCAA 2JT8A 1NCXA 3OHMB 2PSRA 4PE4A 5CPVA 1H4BA 3FS7A 1AVSA 4NDBA 1AUIB 1JFJA 1AJ4A 3HCMA 1CMFA 2RGIA 1CTRA 2HQ8A 2JC2A 3H4SE 1EXRA 2KNEA 3BUOB 3TDIA 3VRRA 1HT9A 4GNKB 1R2UA 4WQ3A 3D10A 4OCIA 1Z4HA 4MSPA 3FIAA 1NX2A 2JU0A 4OVNF 1QVIZ 4MZLA 1QTXA 1OMDA 1SRAA 3GOFA 1OMVA 1S36A 4MRXA 1GGWA 1SKTA 2L2EA 1KK8C 2PRUA 2EHBA 2SCPA 2DOQA 1ODBA 1CLLA 1KWOC 1NP8A 3PN7B 4WRIA 1CM1A 1S3PA 2K2FA 1YX8A 1QX7A 4MEWA 2K7CA 3AAKA 4N1GA 1DJYA 4HRGA 4P2YB 3GK1A 1UUSA 1QXPA 4FTGA 4GUKA 1TTXA 4C0LA 4ZCUA 3JVTC 1XK4C 1JF2A 2ZN9A 4U8DA 1J7OA 3VGOA 1PVAA 2FJUB 2KSPA 3BQ3A 2K0JA 2KI4C 5HKYA 1CFCA 1IG5A 2LMUA 4CFRA 1KFUS 2LE9B 5IBWA 3EK8A 2FCEA 1CDPA 1DJZA 1N2DA 1DJHA 2LP3A 4YGDB 3I5HC 1IQ5A 2LHLA 2I94A 2JZIA 2KLDA 5HL1A 2OPOA 3E3RA 5JOLA 1K2HA 1EG4A 1S5GZ 3EK7A 2CCMA 1UHKA 3KO0A 3TUYC 1SR6C 1BJFA 4YGAA 1K9PA 1QVIY 1PVBA 2K2AA 1V1GA 1A03A 2MA2A 2FOTA 4OKHA 1B8LA 1YVHA 2CNPA 2Y1MA 1JF0A 2JNXA 2LCPA 5FI2A 1PRWA 4MVFA 1U5IA 2LV7A 2KBMA 4Q04A 1FF1A 2NCPA 2F2OA 2WOSA 4YGCB 3CR5X 1KK8B 1RROA 4I5KA 1OSAA 1A29A 1KK7Z 1S6JA 1CM4A 2K7BA 3O4YA 2K7OA 1KFUL 1KWOB 2M0RA 1QX5B 1CLMA 3DVMA 5AFPA 1M46A 1YURA 1Q80A 1QV0A 2JXLA 2JRFA 1CKKA 1QJTA 2WORA 1OZOA 5CSNA 4ICBA 1XA5A 1PSRA 2VRGA 3CR2A 2I18A 3KHEA 1NSHA 5BPJA 2BECA 4YGBB 5AEQA 1BOCA 1TCFA 2GGZA 2I2RE 3PSRA 1J1EA 1PK0D 1SW8A 2BBNA 3JVTB 5HLOA 1CB1A 1EH2A 1G33A 1KQVA 1TIZA 1IRJA 2KI6D 2KI4B 5HYDA 1SK6D 1DJWA 1DGUA 4MLWA 2ZKMX 2ISDA 1F55A 1B47A 1BR1B 3D0YA 1A4PA 2L98A 1ALWA 3UNWA 2JQ6A 1TNQA 2LANA 3I5HB 4M2OA 2F3ZA 2NXQA 4WQ2A 4CLNA 3EVUA 5AERA 1Y1XA 1UWOA 3FWCA 1L7ZA 1CLBA 1K9KA 2MBXA 5KTYA 1CDMA 3SG5A 1OQPA 3TUYB 1DJIA 1SR6B 1QX2A 1DJGA 1QIWA 4ORCB 2BCBA 1B7TZ 2K60A 3ICBA 1MQ1A 5JJGA 2JULA 2A4JA 4XJKA 2K8MB 5FI6A 4HSZA 1A75A 5HKWA 1XFWO 2KGBC 2LLSA 4PCWA 2BL0C 1DT7B 4BY5A 1WDCC 5I2LA 1EL4A 2COLB 1JWDA 1M39A 1ALVA 3EG5B 1Y6WA 3SG2A 3BOWB 3JTDC 4YGEB 5I94A 3DF0B 1QATA 2JWWA 3CWGA 1AP4A 4PHKA 4R1EA 1K9UA 2KLEA 3LL8B 2JTTA 3NSKA 2CXJA 5I2QA 3EVRA 2ZRSA 1DTLA 3O78A 5K89A 1W9ZA 4USLA 1DF0A 1FBVA 3DVKA 1J7PA 1NIWA 3PM8A 5PALA 1TOPA 1HQVA 1WRKA 2HPSA 2H2KA 2LM5A 2LVIA 1B9AA 4CPVA 1C7VA 2KBIA 2M3WA 4A4BA 2KGRA 4MBEA 1F8HA 3EVVA 3SG4A 1WRLA 4MZKA 4PHNA 2KFHA 2TN4A 2E30A 1NX1A 2JOJA 4DS7A 3K21A 1JBAA 2ZRTA 1NX3A 1E8AA 1YUTA 2BCXA 1CFDA 4GAOA 2Y4QA 1B7TY 2LVJA 3EKHA 1K93D 1BG1A 1DELA 2KQYA 1TNWA 4BY4A 3HX4A 1MWNA 5I2OA 2OS8C 1QV1A 5FI7A 5AANA 2I7AA 2JXCA 1IJ5A 5KSZA 1XFVO 1K96A 1QASA 3OP0A 2BL0B 1WLMA 1WDCB 4GGFA 1J7QA 4E68A 1IWQA 2BKHB 1BLQA 3TDZA 1RJVA 3JTDB 1OMRA 2KHNA 2KYCA 3CS1A 4MN0A 1XYDA 1KFXS 3BUXB 2WNDA 4N5XA 3BUWB 2MLFC 4QJ5B 1IKUA 4IJ7A 2BNXA 4PDZA 1C7WA 2F8PA 3BYAA 5ER4X 1UHJA 1GGZA 4MZJA 5FYXA 2HETA 3LK0A 1F70A 3I5IC 5HLVA 3SS3A 1G8IA 1KQMC 1TNPA 3PLFB 3BUMB 1SY9A 1B1GA 1SL9A 3A4UB 1QS7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GJY A;  2M1U A;  1H8B A;  2LUX A;  3FWB A;  1BF5 A;  5KU1 A;  1Y0V H;  4AQI A;  1UHH A;  1MHO A;  1D1O A;  2L50 A;  1YUU A;  2LLU A;  1IJ6 A;  2FCD A;  1K95 A;  2LVK A;  1QIV A;  3RM1 A;  2OS8 B;  3RLZ A;  1IH0 A;  4DCK A;  3OX5 A;  2OTG C;  1NCY A;  4PE1 A;  3CGA A;  1RFJ A;  1FI5 A;  4F0Z B;  2Q4U A;  2PMY A;  4YI8 A;  1QLS A;  2SAS A;  3KPX A;  4ORA B;  1JFK A;  2M97 A;  1AJ5 A;  2BBM A;  2KFF A;  2LP2 A;  4PE7 A;  1CFP A;  3PAT A;  3ZNI A;  3MSE B;  1S26 D;  3BUN B;  1DGV A;  1SPY A;  2ZN8 A;  4NDC A;  2WCF A;  1M63 B;  2H61 A;  3D0Y B;  1K8U A;  1ZAC A;  2KQ6 A;  1EG3 A;  1BOD A;  3WHU B;  1R6P A;  2JT0 A;  1F4O A;  2LVV A;  1FI6 A;  1S5G Y;  3NSL A;  3TZ1 A;  1F4Q A;  1OZS A;  1YR5 A;  2E6W A;  2M29 A;  2MRD A;  3I5F C;  5CSI A;  2M1K B;  2ZND A;  4I5L B;  4M2P A;  3GK2 A;  1JUO A;  5AXI A;  3LLE A;  2WC8 A;  2KDH A;  1UP5 A;  1TNX A;  4JPZ B;  5J3X A;  3I5I B;  3IF7 A;  3SIB A;  2F33 A;  2JNF A;  1KQM B;  2LC5 A;  2BE4 A;  4JQ0 D;  1YVL A;  2MAZ A;  1AK8 A;  1MXL C;  1TCO B;  1KK7 Y;  1ZFS A;  1BR4 B;  4MRY A;  2BKI B;  3VRO A;  1ZMZ A;  1NYA A;  4NQG A;  3PFV A;  3DVE A;  1SBJ A;  4ETO A;  1G4Y R;  3OX6 A;  2LLT A;  2JTZ A;  1SCM C;  3O6B A;  3LCP C;  1LVC D;  1A2X A;  2OTG B;  1REC A;  2PAS A;  3DD4 A;  2Y5I A;  4GPL B;  4ZCV A;  1B4C A;  3LK1 A;  1DMO A;  1RK9 A;  1J55 A;  2NZ0 A;  3AAJ A;  4M2Q A;  1ZUZ A;  3VRP A;  1B8C A;  2L51 A;  1S6C A;  2PAL A;  3IQQ A;  1K94 A;  1TRF A;  1XFU O;  2LAP A;  1LA0 A;  2F2P A;  2LUC A;  2D8N A;  4PE0 A;  3KEV A;  4CID A;  2AMI A;  4TNC A;  3F45 A;  1SMG A;  5DKR A;  3DF0 A;  3CZT X;  1CNP A;  1UUR A;  1S1E A;  3GK4 X;  3KF9 A;  3I5F B;  3SJS A;  1KSM A;  1W7J B;  4QJ4 B;  1DJX A;  1SCV A;  2JT3 A;  2KI6 C;  4C0K A;  1ZOT B;  1MR8 A;  2CBL A;  2Y1N A;  2MLE C;  5F6T A;  4P5O E;  2LNK A;  4DIR A;  3NXA A;  1N65 A;  5ER5 A;  2BE6 A;  2R2I A;  3OB1 B;  2KAY A;  2MHH A;  3WHT B;  1NWD A;  2H61 C;  3A8R A;  1B8R A;  1SCM B;  5G08 A;  1CFF A;  1NUB A;  1L2O C;  1N0Y A;  1WRZ A;  4HRH A;  3SG6 A;  1OOJ A;  1XVJ A;  2QPT A;  1RTP 1;  1SL7 A;  1LKJ A;  1YTZ C;  2HQW A;  4FQO A;  1LA3 A;  3VRQ A;  1F71 A;  2KAV A;  1MUX A;  2F3Y A;  2ZNE A;  2M9G A;  2GV5 A;  3CTN A;  4C0J A;  1OE9 B;  3O2P A;  2B1U A;  5HKZ A;  1JC2 A;  1C07 A;  1MXE A;  3C1V A;  1TN4 A;  1X02 A;  4NDD A;  3NSI A;  1BMO A;  2KFG A;  5TNC A;  4PHM A;  4QJ3 B;  1U5I B;  2V53 A;  3M0W A;  3ZWH A;  1CDN A;  4DRW A;  5DKQ A;  1KSO A;  1W7I B;  1LXF C;  2AAO A;  3PAL A;  1XFZ O;  1CMG A;  1BU3 A;  2LHI A;  2NLN A;  2M7L A;  3SIA A;  3TS5 C;  1KFX L;  5B8I B;  1NX0 A;  1YRU B;  3NSO A;  2WCE A;  4I5N B;  2PVB A;  3I5G C;  4OR9 B;  3EK4 A;  4YI9 A;  4UPG A;  4OV2 A;  1J7R A;  2L4I A;  2G9B A;  2NCO A;  4YRU A;  4GBA A;  1F54 A;  3SG7 A;  1MF8 B;  4L9M A;  5I8N A;  4JWQ A;  2JPT A;  2EC6 C;  2CT9 A;  1JSA A;  1CDL A;  1M31 A;  1XFY O;  2CTN A;  1UHI A;  1WLZ A;  1L2O B;  1FPW A;  1NPQ A;  1YX7 A;  1PAL A;  4PAL A;  3BXK A;  3EKJ A;  5GQQ C;  4CFQ A;  1J1D A;  4YBH B;  1K90 D;  1EJ3 A;  1RWY A;  2GGM A;  2KOT A;  2M8U A;  1YUS A;  4N1F A;  3WXA A;  3VRN A;  1NCZ A;  3DVJ A;  2O60 A;  2K61 A;  2HF5 A;  2ZFD A;  4DUQ A;  2G2B A;  1Y1U A;  3TDU A;  2AUC A;  1WY9 A;  3IQO A;  1XK4 A;  2LMT A;  4GGN A;  4XJK B;  1LIN A;  1A75 B;  2MJW B;  1AHR A;  2L4H A;  1SYM A;  2O5G A;  2IS9 A;  4IL1 A;  3AKA A;  4GGF C;  3OB2 B;  1M45 A;  1KCY A;  3AKB A;  1PSB A;  1PUL A;  2L0P A;  3WNX B;  1XO5 A;  3TS5 B;  1Y1A A;  2EGD A;  2L5X B;  1SL8 A;  4PHJ A;  3PN7 C;  1GQM A;  1XFX O;  4XYN A;  1V1F A;  3I5G B;  2KAX A;  2M7N A;  1BT6 A;  2K7D A;  2M49 B;  4GFT A;  1SNL A;  5D69 A;  5DKN A;  1QLK A;  5D7F A;  3SG3 A;  1DF0 B;  2KYF A;  4AOM A;  4AQJ A;  3CR4 X;  1IGV A;  1UHN A;  1DVI A;  1FW4 A;  5CSF A;  2WCB A;  2EC6 B;  4A4C A;  4ORB B;  4HRE E;  1YRT B;  2LMV A;  1IQ3 A;  4I5J A;  5CSJ A;  2QAC A;  3BOW A;  2P6B B;  2Q91 A;  3QRX A;  1S6I A;  3CLN A;  4D1E A;  1VRK A;  2BCA A;  2JT8 A;  1NCX A;  3OHM B;  2PSR A;  4PE4 A;  5CPV A;  1H4B A;  3FS7 A;  1AVS A;  4NDB A;  1AUI B;  1JFJ A;  1AJ4 A;  3HCM A;  1CMF A;  2RGI A;  1CTR A;  2HQ8 A;  2JC2 A;  3H4S E;  1EXR A;  2KNE A;  3BUO B;  3TDI A;  3VRR A;  1HT9 A;  4GNK B;  1R2U A;  4WQ3 A;  3D10 A;  4OCI A;  4MSP A;  3FIA A;  1NX2 A;  2JU0 A;  4OVN F;  1QVI Z;  4MZL A;  1QTX A;  1OMD A;  1SRA A;  3GOF A;  1OMV A;  1S36 A;  4MRX A;  1GGW A;  1SKT A;  2L2E A;  1KK8 C;  2PRU A;  2EHB A;  2SCP A;  2DOQ A;  1ODB A;  1CLL A;  1KWO C;  1NP8 A;  3PN7 B;  4WRI A;  1CM1 A;  1S3P A;  2K2F A;  1YX8 A;  1QX7 A;  4MEW A;  2K7C A;  3AAK A;  4N1G A;  1DJY A;  4HRG A;  4P2Y B;  3GK1 A;  1UUS A;  1QXP A;  4FTG A;  4GUK A;  1TTX A;  4C0L A;  4ZCU A;  3JVT C;  1XK4 C;  1JF2 A;  2ZN9 A;  4U8D A;  1J7O A;  3VGO A;  1PVA A;  2FJU B;  2KSP A;  3BQ3 A;  2K0J A;  2KI4 C;  5HKY A;  1CFC A;  1IG5 A;  2LMU A;  4CFR A;  1KFU S;  2LE9 B;  5IBW A;  3EK8 A;  2FCE A;  1CDP A;  1DJZ A;  1N2D A;  1DJH A;  2LP3 A;  4YGD B;  3I5H C;  1IQ5 A;  2LHL A;  2I94 A;  2JZI A;  2OPO A;  3E3R A;  5JOL A;  1K2H A;  1EG4 A;  1S5G Z;  3EK7 A;  2CCM A;  1UHK A;  3KO0 A;  3TUY C;  1SR6 C;  1BJF A;  4YGA A;  1K9P A;  1QVI Y;  1PVB A;  2K2A A;  1V1G A;  1A03 A;  2MA2 A;  2FOT A;  4OKH A;  1B8L A;  1YVH A;  2CNP A;  2Y1M A;  1JF0 A;  2JNX A;  2LCP A;  1PRW A;  4MVF A;  1U5I A;  2LV7 A;  2KBM A;  4Q04 A;  1FF1 A;  2NCP A;  2F2O A;  2WOS A;  4YGC B;  3CR5 X;  1KK8 B;  1RRO A;  4I5K A;  1OSA A;  1A29 A;  1KK7 Z;  1S6J A;  1CM4 A;  2K7B A;  3O4Y A;  2K7O A;  1KFU L;  1KWO B;  2M0R A;  1QX5 B;  1CLM A;  3DVM A;  5AFP A;  1M46 A;  1YUR A;  1Q80 A;  1QV0 A;  2JXL A;  2JRF A;  1CKK A;  1QJT A;  2WOR A;  1OZO A;  5CSN A;  4ICB A;  1XA5 A;  1PSR A;  2VRG A;  3CR2 A;  2I18 A;  3KHE A;  1NSH A;  5BPJ A;  2BEC A;  4YGB B;  5AEQ A;  1BOC A;  1TCF A;  2GGZ A;  2I2R E;  3PSR A;  1J1E A;  1PK0 D;  1SW8 A;  2BBN A;  3JVT B;  5HLO A;  1CB1 A;  1EH2 A;  1G33 A;  1KQV A;  1TIZ A;  1IRJ A;  2KI6 D;  2KI4 B;  5HYD A;  1SK6 D;  1DJW A;  1DGU A;  4MLW A;  2ZKM X;  2ISD A;  1F55 A;  1B47 A;  1BR1 B;  3D0Y A;  1A4P A;  2L98 A;  1ALW A;  2JQ6 A;  1TNQ A;  2LAN A;  3I5H B;  4M2O A;  2F3Z A;  2NXQ A;  4WQ2 A;  4CLN A;  3EVU A;  5AER A;  1Y1X A;  1UWO A;  3FWC A;  1L7Z A;  1CLB A;  1K9K A;  2MBX A;  5KTY A;  1CDM A;  3SG5 A;  1OQP A;  3TUY B;  1DJI A;  1SR6 B;  1QX2 A;  1DJG A;  1QIW A;  4ORC B;  2BCB A;  1B7T Z;  3ICB A;  1MQ1 A;  5JJG A;  2JUL A;  2A4J A;  4XJK A;  2K8M B;  4HSZ A;  1A75 A;  5HKW A;  1XFW O;  2KGB C;  2LLS A;  4PCW A;  2BL0 C;  1DT7 B;  4BY5 A;  1WDC C;  5I2L A;  1EL4 A;  2COL B;  1JWD A;  1M39 A;  1ALV A;  1Y6W A;  3SG2 A;  3BOW B;  3JTD C;  4YGE B;  3DF0 B;  1QAT A;  2JWW A;  3CWG A;  1AP4 A;  4PHK A;  4R1E A;  1K9U A;  3LL8 B;  2JTT A;  3NSK A;  2CXJ A;  5I2Q A;  3EVR A;  2ZRS A;  1DTL A;  3O78 A;  5K89 A;  4USL A;  1DF0 A;  1FBV A;  3DVK A;  1J7P A;  1NIW A;  3PM8 A;  5PAL A;  1TOP A;  1HQV A;  1WRK A;  2HPS A;  2H2K A;  2LM5 A;  2LVI A;  1B9A A;  4CPV A;  1C7V A;  2KBI A;  2M3W A;  4A4B A;  2KGR A;  4MBE A;  1F8H A;  3EVV A;  3SG4 A;  1WRL A;  4MZK A;  4PHN A;  2KFH A;  2TN4 A;  2E30 A;  1NX1 A;  2JOJ A;  4DS7 A;  3K21 A;  1JBA A;  2ZRT A;  1NX3 A;  1E8A A;  1YUT A;  2BCX A;  1CFD A;  4GAO A;  2Y4Q A;  1B7T Y;  2LVJ A;  3EKH A;  1K93 D;  1BG1 A;  2KQY A;  1TNW A;  4BY4 A;  3HX4 A;  1MWN A;  5I2O A;  2OS8 C;  1QV1 A;  5AAN A;  2I7A A;  2JXC A;  1IJ5 A;  5KSZ A;  1XFV O;  1K96 A;  1QAS A;  3OP0 A;  2BL0 B;  1WLM A;  1WDC B;  4GGF A;  1J7Q A;  4E68 A;  1IWQ A;  2BKH B;  1BLQ A;  3TDZ A;  1RJV A;  3JTD B;  1OMR A;  2KHN A;  2KYC A;  3CS1 A;  4MN0 A;  1XYD A;  1KFX S;  3BUX B;  2WND A;  4N5X A;  3BUW B;  2MLF C;  4QJ5 B;  1IKU A;  4PDZ A;  1C7W A;  2F8P A;  3BYA A;  5ER4 X;  1UHJ A;  1GGZ A;  4MZJ A;  5FYX A;  2HET A;  3LK0 A;  1F70 A;  3I5I C;  5HLV A;  1G8I A;  1KQM C;  1TNP A;  3PLF B;  3BUM B;  1SY9 A;  1B1G A;  1SL9 A;  3A4U B;  1QS7 A; 
#chains in the Genus database with same CATH topology
 1GM0 A;  1GJY A;  2M1U A;  1H8B A;  2LUX A;  3FWB A;  1BF5 A;  5KU1 A;  1Y0V H;  4AQI A;  3S0D A;  1UHH A;  1MHO A;  1D1O A;  2L50 A;  1YUU A;  2LLU A;  1IJ6 A;  2FCD A;  1K95 A;  2LVK A;  1QIV A;  3RM1 A;  2OS8 B;  3RLZ A;  1IH0 A;  4DCK A;  3OX5 A;  1OW4 A;  2OTG C;  1NCY A;  4PE1 A;  3CGA A;  1RFJ A;  1FI5 A;  4F0Z B;  2Q4U A;  2PMY A;  4YI8 A;  3O4X A;  1QLS A;  2SAS A;  3KPX A;  4ORA B;  1JFK A;  2M97 A;  1AJ5 A;  2BBM A;  2KFF A;  2LP2 A;  3BJH A;  3CZ0 A;  3D76 A;  4PE7 A;  3PAT A;  5DIC A;  3ZNI A;  1CFP A;  3MSE B;  1S26 D;  3BUN B;  1DGV A;  1SPY A;  2ZN8 A;  4NDC A;  2WCF A;  1M63 B;  2H61 A;  3D0Y B;  1K8U A;  1ZAC A;  2KQ6 A;  1EG3 A;  1BOD A;  2JPO A;  3WHU B;  1R6P A;  2JT0 A;  1F4O A;  2LVV A;  1FI6 A;  1S5G Y;  3NSL A;  3TZ1 A;  3IVT A;  1F4Q A;  1OZS A;  1YR5 A;  2E6W A;  2M29 A;  2MRD A;  3I5F C;  3L47 A;  5CSI A;  2M1K B;  2ZND A;  4I5L B;  4M2P A;  3GK2 A;  1JUO A;  5AXI A;  3LLE A;  2WC8 A;  2KDH A;  1UP5 A;  3D78 A;  1TNX A;  4JPZ B;  5J3X A;  3I5I B;  1DEK A;  3IF7 A;  2F33 A;  3OBV A;  3SIB A;  2JNF A;  1KQM B;  2LC5 A;  2BE4 A;  3B88 A;  4JQ0 D;  1YVL A;  2MAZ A;  3DXL A;  3R1V A;  1AK8 A;  1MXL C;  1TCO B;  1KK7 Y;  1ZFS A;  1BR4 B;  2BAP A;  2BKI B;  4MRY A;  1ZMZ A;  3VRO A;  1NYA A;  4NQG A;  3PFV A;  3DVE A;  1SBJ A;  3S0A A;  4ETO A;  1G4Y R;  3OX6 A;  2LLT A;  2JTZ A;  1SCM C;  3S0G A;  3FE6 A;  1C3Y A;  2YGU A;  1QWV A;  3O6B A;  3OGN A;  3LCP C;  1LVC D;  1A2X A;  2OTG B;  1Z2C B;  1REC A;  2PAS A;  3DD4 A;  2Y5I A;  4GPL B;  4ZCV A;  1B4C A;  3LK1 A;  1DMO A;  1RK9 A;  1J55 A;  2NZ0 A;  3AAJ A;  4M2Q A;  1ZUZ A;  3VRP A;  1B8C A;  2L51 A;  1S6C A;  2PAL A;  3IQQ A;  1K94 A;  1TRF A;  1XFU O;  2LAP A;  1LA0 A;  2F2P A;  2LUC A;  2D8N A;  4PE0 A;  3KEV A;  4CID A;  2AMI A;  4TNC A;  3F45 A;  1SMG A;  5DKR A;  3DF0 A;  3CZT X;  1CNP A;  1UUR A;  1S1E A;  3GK4 X;  3KF9 A;  3I5F B;  3SJS A;  1KSM A;  1W7J B;  4QJ4 B;  1DJX A;  1SCV A;  2JT3 A;  2KI6 C;  4C0K A;  1ZOT B;  1MR8 A;  2CBL A;  2Y1N A;  2MLE C;  2WCJ A;  5F6T A;  4P5O E;  2LNK A;  4DIR A;  3NXA A;  1N65 A;  5ER5 A;  2BE6 A;  2R2I A;  3OB1 B;  2KAY A;  2MHH A;  3WHT B;  1NWD A;  2H61 C;  3A8R A;  1B8R A;  1SSE B;  3K1E A;  1SCM B;  5G08 A;  1CFF A;  1NUB A;  1L2O C;  1N0Y A;  1WRZ A;  4HRH A;  3SG6 A;  1OOJ A;  2PQL A;  1XVJ A;  2QPT A;  1RTP 1;  1SL7 A;  1LKJ A;  1YTZ C;  2HQW A;  4FQO A;  1LA3 A;  3VRQ A;  1F71 A;  2KAV A;  1MUX A;  2F3Y A;  2ZNE A;  2M9G A;  2GV5 A;  3B7A A;  3CTN A;  4C0J A;  1OE9 B;  3O2P A;  2B1U A;  5HKZ A;  1JC2 A;  1TWO A;  1C07 A;  3SS4 A;  1MXE A;  3C1V A;  1TN4 A;  1X02 A;  4NDD A;  3NSI A;  1BMO A;  2KFG A;  5TNC A;  4PHM A;  4QJ3 B;  1U5I B;  2FJY A;  2V53 A;  3M0W A;  3ZWH A;  1CDN A;  4DRW A;  5DKQ A;  2QEB A;  3R72 A;  1KSO A;  1W7I B;  1LXF C;  2AAO A;  3SS5 A;  3PAL A;  1XFZ O;  1CMG A;  1BU3 A;  2LHI A;  2NLN A;  2M7L A;  3SIA A;  3TS5 C;  1KFX L;  3Q8I A;  5B8I B;  1NX0 A;  1YRU B;  3NSO A;  2WCE A;  3PJI A;  3RZS A;  4I5N B;  2PVB A;  3I5G C;  4OR9 B;  1IIO A;  3EK4 A;  4YI9 A;  3UO9 A;  4UPG A;  4OV2 A;  1J7R A;  2L4I A;  2G9B A;  3B6X A;  2NCO A;  4YRU A;  4GBA A;  1F54 A;  3SG7 A;  1MF8 B;  4L9M A;  5I8N A;  4JWQ A;  2JPT A;  2L5Y A;  2EC6 C;  2CT9 A;  1JSA A;  1CDL A;  1M31 A;  1XFY O;  2CTN A;  1UHI A;  1WLZ A;  1L2O B;  3DY9 A;  1FPW A;  1NPQ A;  1YX7 A;  1PAL A;  4PAL A;  1EH2 A;  3S0F A;  3BXK A;  3EKJ A;  5GQQ C;  4CFQ A;  1J1D A;  4YBH B;  1K90 D;  1EJ3 A;  1RWY A;  2GGM A;  2KOT A;  2M8U A;  1YUS A;  3BFA A;  4N1F A;  3VRN A;  1NCZ A;  3WXA A;  3DVJ A;  2O60 A;  1DC1 A;  2K61 A;  2HF5 A;  2ZFD A;  4DUQ A;  5D3O A;  2G2B A;  1Y1U A;  3TDU A;  2AUC A;  4KYN A;  3NGV A;  4OZD A;  1WY9 A;  3IQO A;  1XK4 A;  2LMT A;  4GGN A;  4XJK B;  1LIN A;  1A75 B;  2MJW B;  1AHR A;  2L4H A;  1SYM A;  2O5G A;  2IS9 A;  4IL1 A;  4F7F A;  3AKA A;  4GGF C;  3OB2 B;  1M45 A;  2KPH A;  1KCY A;  3AKB A;  1PSB A;  3S0B A;  1ORG A;  1PUL A;  2L0P A;  3WNX B;  1XO5 A;  3TS5 B;  1Y1A A;  2EGD A;  2L5X B;  1SL8 A;  4PHJ A;  5EL2 A;  3PN7 C;  1GQM A;  2L2C A;  1XFX O;  3FE8 A;  4XYN A;  4JKT A;  1V1F A;  3I5G B;  2KAX A;  2M7N A;  1BT6 A;  2K7D A;  2M49 B;  4GFT A;  1SNL A;  5D69 A;  5DKN A;  1QLK A;  3DZT A;  5D7F A;  4INX A;  1OOG A;  3SG3 A;  1DF0 B;  2KYF A;  4AOM A;  4AQJ A;  3CR4 X;  1IGV A;  1UHN A;  1DVI A;  1FW4 A;  5CSF A;  2WCB A;  2EC6 B;  4A4C A;  4ORB B;  4HRE E;  1YRT B;  2LMV A;  1IQ3 A;  4I5J A;  3CZ1 A;  1TUZ A;  2QAC A;  5CSJ A;  3BOW A;  2P6B B;  2Q91 A;  3CAB A;  1S6I A;  3QRX A;  3CLN A;  4D1E A;  1VRK A;  2BCA A;  2JT8 A;  1NCX A;  3OHM B;  2PSR A;  4PE4 A;  5CPV A;  1H4B A;  3FS7 A;  1LS8 A;  3D77 A;  1AVS A;  4NDB A;  1AUI B;  1JFJ A;  1AJ4 A;  3HCM A;  1CMF A;  2RGI A;  1CTR A;  2HQ8 A;  2JC2 A;  3H4S E;  1EXR A;  2KNE A;  3BUO B;  3TDI A;  3VRR A;  1HT9 A;  4GNK B;  1R2U A;  4WQ3 A;  3D10 A;  5JJG A;  3L4A A;  4OCI A;  1Z4H A;  4MSP A;  3FIA A;  1NX2 A;  2JU0 A;  4OVN F;  1QVI Z;  4MZL A;  1QTX A;  1OMD A;  1SRA A;  3GOF A;  3D75 A;  3QME A;  1OMV A;  1S36 A;  4MRX A;  3BFH A;  1SKT A;  1GGW A;  2L2E A;  1KK8 C;  2PRU A;  2EHB A;  2SCP A;  2DOQ A;  1ODB A;  1OOI X;  1CLL A;  1KWO C;  1NP8 A;  3PN7 B;  4WRI A;  1CM1 A;  1S3P A;  2K2F A;  1YX8 A;  1QX7 A;  4MEW A;  2K7C A;  2QEO A;  3AAK A;  4N1G A;  3VB1 A;  1DJY A;  4HRG A;  4P2Y B;  3GK1 A;  1UUS A;  1QXP A;  2GTE A;  4FTG A;  1TTX A;  4GUK A;  4ZCU A;  4C0L A;  3JVT C;  1XK4 C;  1JF2 A;  2ZN9 A;  4U8D A;  1J7O A;  3VGO A;  1PVA A;  2FJU B;  2KSP A;  3BQ3 A;  2K0J A;  2KI4 C;  3S0E A;  5HKY A;  1CFC A;  1IG5 A;  2LMU A;  4CFR A;  1KFU S;  2LE9 B;  5IBW A;  3EK8 A;  2FCE A;  1CDP A;  1DJZ A;  1N2D A;  1DJH A;  3CDN A;  2LP3 A;  2WCM A;  3I5H C;  4YGD B;  1IQ5 A;  2KLD A;  2I94 A;  2JZI A;  2LHL A;  5HL1 A;  2OPO A;  3E3R A;  5JOL A;  3B87 A;  1K2H A;  1EG4 A;  1S5G Z;  3D74 A;  3EK7 A;  2CCM A;  1UHK A;  3KO0 A;  3R1P A;  3TUY C;  1SR6 C;  1BJF A;  4YGA A;  1K9P A;  1QVI Y;  1PVB A;  2K2A A;  2PYQ A;  1V1G A;  3R1O A;  1A03 A;  2MA2 A;  2FOT A;  4OKH A;  3FE9 A;  1B8L A;  1YVH A;  2CNP A;  2Y1M A;  1JF0 A;  2JNX A;  2WCH A;  2LCP A;  4FQT A;  5FI2 A;  1PRW A;  3CZ2 A;  4MVF A;  3CYZ A;  1U5I A;  2LV7 A;  2KBM A;  4Q04 A;  1FF1 A;  2NCP A;  2F2O A;  2WOS A;  4YGC B;  3CR5 X;  1KK8 B;  1RRO A;  4I5K A;  1OSA A;  1A29 A;  1KK7 Z;  1S6J A;  1CM4 A;  2K7B A;  3O4Y A;  2K7O A;  1KFU L;  1KWO B;  2M0R A;  1QX5 B;  1CLM A;  3DVM A;  5AFP A;  1M46 A;  1YUR A;  1Q80 A;  1QV0 A;  2JXL A;  2JRF A;  1CKK A;  1QJT A;  2WOR A;  1OZO A;  5CSN A;  4ICB A;  1XA5 A;  1PSR A;  2VRG A;  3CR2 A;  2I18 A;  3KHE A;  1NSH A;  5BPJ A;  2BEC A;  4YGB B;  5AEQ A;  2QEH A;  3BFB A;  1BOC A;  1TCF A;  2GGZ A;  2I2R E;  3PM2 A;  1J1E A;  1PK0 D;  1SW8 A;  2BBN A;  3JVT B;  3PSR A;  5HLO A;  1CB1 A;  1G33 A;  1KQV A;  1TIZ A;  1IRJ A;  2KI6 D;  2KI4 B;  5HYD A;  1SK6 D;  1DJW A;  1DGU A;  3L4L A;  4MLW A;  2ZKM X;  2ISD A;  1F55 A;  1B47 A;  1BR1 B;  3D0Y A;  1A4P A;  2L98 A;  1ALW A;  3UNW A;  2JQ6 A;  1TNQ A;  2LAN A;  3I5H B;  4M2O A;  2F3Z A;  2NXQ A;  4WQ2 A;  4CLN A;  3EVU A;  5AER A;  1Y1X A;  1UWO A;  3FWC A;  1L7Z A;  1CLB A;  1K9K A;  2MBX A;  5KTY A;  1CDM A;  3SG5 A;  1OQP A;  2WC5 A;  1DJI A;  1SR6 B;  3TUY B;  1QX2 A;  1DJG A;  1QIW A;  4ORC B;  2BCB A;  1B7T Z;  2K60 A;  3ICB A;  1MQ1 A;  1DQE A;  1XFR A;  2A4J A;  2JUL A;  2K8M B;  4XJK A;  4HSZ A;  1A75 A;  5FI6 A;  1XFW O;  2KGB C;  2LLS A;  4PCW A;  4PT1 A;  5HKW A;  2BL0 C;  1DT7 B;  4BY5 A;  1WDC C;  5I2L A;  1EL4 A;  1T14 A;  2COL B;  1JWD A;  1M39 A;  1ALV A;  3EG5 B;  1Y6W A;  2QDI A;  3SG2 A;  3BOW B;  3JTD C;  4YGE B;  5I94 A;  3DF0 B;  1QAT A;  2JWW A;  3CWG A;  3NHT A;  1AP4 A;  2ERB A;  4PHK A;  4R1E A;  1K9U A;  1C3Z A;  2WC6 A;  2KLE A;  3LL8 B;  2JTT A;  3D73 A;  3NSK A;  2CXJ A;  5I2Q A;  3EVR A;  2P70 A;  2ZRS A;  1DTL A;  3O78 A;  3DYE A;  1W9Z A;  5K89 A;  4USL A;  2WCK A;  1DF0 A;  1FBV A;  3DVK A;  1J7P A;  1NIW A;  3PM8 A;  5PAL A;  1TOP A;  1HQV A;  1WRK A;  2HPS A;  2H2K A;  2LM5 A;  2LVI A;  1B9A A;  4CPV A;  1C7V A;  2KBI A;  2M3W A;  4A4B A;  2KGR A;  4MBE A;  3N7H A;  1P28 A;  1F8H A;  3EVV A;  3SG4 A;  1WRL A;  4MZK A;  4PHN A;  2KFH A;  2TN4 A;  2E30 A;  1NX1 A;  2JOJ A;  4DS7 A;  3K21 A;  1JBA A;  2ZRT A;  1NX3 A;  4INW A;  1E8A A;  1YUT A;  2BCX A;  1CFD A;  4GAO A;  2Y4Q A;  1B7T Y;  2LVJ A;  3EKH A;  1K93 D;  1BG1 A;  1DEL A;  2KQY A;  1TNW A;  2P71 A;  3HX4 A;  1MWN A;  4BY4 A;  5I2O A;  2OS8 C;  2H8V A;  1QV1 A;  5FI7 A;  5AAN A;  2I7A A;  2JXC A;  3NHI A;  1IJ5 A;  5KSZ A;  1XFV O;  1K96 A;  1QAS A;  2QEV A;  3OP0 A;  3V2L A;  2BL0 B;  1WLM A;  1WDC B;  4GGF A;  1J7Q A;  4E68 A;  1IWQ A;  2BKH B;  1BLQ A;  1TUJ A;  1RJV A;  3TDZ A;  3JTD B;  1OMR A;  2KHN A;  2WCL A;  2KYC A;  3CS1 A;  4MN0 A;  1XYD A;  1KFX S;  3BUX B;  2WND A;  4N5X A;  3BUW B;  2MLF C;  4QJ5 B;  1IKU A;  4IJ7 A;  2BNX A;  4PDZ A;  1C7W A;  2F8P A;  3BYA A;  5ER4 X;  1UHJ A;  1GGZ A;  4MZJ A;  5FYX A;  2HET A;  4JD9 A;  3LK0 A;  1OOF A;  3SS3 A;  3I5I C;  5HLV A;  1F70 A;  1G8I A;  1KQM C;  1TNP A;  3B86 A;  3BUM B;  3PLF B;  1OOH A;  1SY9 A;  1B1G A;  1SL9 A;  3A4U B;  1QS7 A; 
#chains in the Genus database with same CATH homology
 1GJY A;  2M1U A;  1H8B A;  2LUX A;  3FWB A;  1BF5 A;  5KU1 A;  1Y0V H;  4AQI A;  1UHH A;  1MHO A;  1D1O A;  2L50 A;  1YUU A;  2LLU A;  1IJ6 A;  2FCD A;  1K95 A;  2LVK A;  1QIV A;  3RM1 A;  2OS8 B;  3RLZ A;  1IH0 A;  4DCK A;  3OX5 A;  2OTG C;  1NCY A;  4PE1 A;  3CGA A;  1RFJ A;  1FI5 A;  4F0Z B;  2Q4U A;  2PMY A;  4YI8 A;  3O4X A;  1QLS A;  2SAS A;  3KPX A;  4ORA B;  1JFK A;  2M97 A;  1AJ5 A;  2BBM A;  2KFF A;  2LP2 A;  4PE7 A;  1CFP A;  3PAT A;  3ZNI A;  3MSE B;  1S26 D;  3BUN B;  1DGV A;  1SPY A;  2ZN8 A;  4NDC A;  2WCF A;  1M63 B;  2H61 A;  3D0Y B;  1K8U A;  1ZAC A;  2KQ6 A;  1EG3 A;  1BOD A;  3WHU B;  1R6P A;  2JT0 A;  1F4O A;  2LVV A;  1FI6 A;  1S5G Y;  3NSL A;  3TZ1 A;  3IVT A;  1F4Q A;  1OZS A;  1YR5 A;  2E6W A;  2M29 A;  2MRD A;  3I5F C;  5CSI A;  2M1K B;  2ZND A;  4I5L B;  4M2P A;  3GK2 A;  1JUO A;  5AXI A;  3LLE A;  2WC8 A;  2KDH A;  1UP5 A;  1TNX A;  4JPZ B;  5J3X A;  3I5I B;  3IF7 A;  3SIB A;  2F33 A;  1DEK A;  3OBV A;  2JNF A;  1KQM B;  2LC5 A;  2BE4 A;  4JQ0 D;  1YVL A;  2MAZ A;  1AK8 A;  1MXL C;  1TCO B;  1KK7 Y;  1ZFS A;  1BR4 B;  4MRY A;  2BKI B;  3VRO A;  1ZMZ A;  2BAP A;  1NYA A;  4NQG A;  3PFV A;  3DVE A;  1SBJ A;  4ETO A;  1G4Y R;  3OX6 A;  2LLT A;  2JTZ A;  1SCM C;  2YGU A;  3O6B A;  3LCP C;  1LVC D;  1A2X A;  2OTG B;  1Z2C B;  1REC A;  2PAS A;  3DD4 A;  2Y5I A;  4GPL B;  4ZCV A;  1B4C A;  3LK1 A;  1DMO A;  1RK9 A;  1J55 A;  2NZ0 A;  3AAJ A;  4M2Q A;  1ZUZ A;  3VRP A;  1B8C A;  2L51 A;  1S6C A;  2PAL A;  3IQQ A;  1K94 A;  1TRF A;  1XFU O;  2LAP A;  1LA0 A;  2F2P A;  2LUC A;  2D8N A;  4PE0 A;  3KEV A;  4CID A;  2AMI A;  4TNC A;  3F45 A;  1SMG A;  5DKR A;  3DF0 A;  3CZT X;  1CNP A;  1UUR A;  1S1E A;  3GK4 X;  3KF9 A;  3I5F B;  3SJS A;  1KSM A;  1W7J B;  4QJ4 B;  1DJX A;  1SCV A;  2JT3 A;  2KI6 C;  4C0K A;  1ZOT B;  1MR8 A;  2CBL A;  2Y1N A;  2MLE C;  5F6T A;  4P5O E;  2LNK A;  4DIR A;  3NXA A;  1N65 A;  5ER5 A;  2BE6 A;  2R2I A;  3OB1 B;  2KAY A;  2MHH A;  3WHT B;  1NWD A;  2H61 C;  3A8R A;  1B8R A;  1SCM B;  5G08 A;  1CFF A;  1NUB A;  1L2O C;  1N0Y A;  1WRZ A;  4HRH A;  3SG6 A;  1OOJ A;  1XVJ A;  2QPT A;  1RTP 1;  1SL7 A;  1LKJ A;  1YTZ C;  2HQW A;  4FQO A;  1LA3 A;  3VRQ A;  1F71 A;  2KAV A;  1MUX A;  2F3Y A;  2ZNE A;  2M9G A;  2GV5 A;  3CTN A;  4C0J A;  1OE9 B;  3O2P A;  2B1U A;  5HKZ A;  1JC2 A;  1C07 A;  3SS4 A;  1MXE A;  3C1V A;  1TN4 A;  1X02 A;  4NDD A;  3NSI A;  1BMO A;  2KFG A;  5TNC A;  4PHM A;  4QJ3 B;  1U5I B;  2V53 A;  3M0W A;  3ZWH A;  1CDN A;  4DRW A;  5DKQ A;  1KSO A;  1W7I B;  1LXF C;  2AAO A;  3SS5 A;  3PAL A;  1XFZ O;  1CMG A;  1BU3 A;  2LHI A;  2NLN A;  2M7L A;  3SIA A;  3TS5 C;  1KFX L;  5B8I B;  1NX0 A;  1YRU B;  3NSO A;  2WCE A;  4I5N B;  2PVB A;  3I5G C;  4OR9 B;  3EK4 A;  4YI9 A;  3UO9 A;  4UPG A;  4OV2 A;  1J7R A;  2L4I A;  2G9B A;  2NCO A;  4YRU A;  4GBA A;  1F54 A;  3SG7 A;  1MF8 B;  4L9M A;  5I8N A;  4JWQ A;  2JPT A;  2L5Y A;  2EC6 C;  2CT9 A;  1JSA A;  1CDL A;  1M31 A;  1XFY O;  2CTN A;  1UHI A;  1WLZ A;  1L2O B;  1FPW A;  1NPQ A;  1YX7 A;  1PAL A;  4PAL A;  3BXK A;  3EKJ A;  5GQQ C;  4CFQ A;  1J1D A;  4YBH B;  1K90 D;  1EJ3 A;  1RWY A;  2GGM A;  2KOT A;  2M8U A;  1YUS A;  4N1F A;  3WXA A;  3VRN A;  1NCZ A;  3DVJ A;  2O60 A;  1DC1 A;  2K61 A;  2HF5 A;  2ZFD A;  4DUQ A;  5D3O A;  2G2B A;  1Y1U A;  3TDU A;  2AUC A;  4KYN A;  1WY9 A;  3IQO A;  1XK4 A;  2LMT A;  4GGN A;  4XJK B;  1LIN A;  1A75 B;  2MJW B;  1AHR A;  2L4H A;  1SYM A;  2O5G A;  2IS9 A;  4IL1 A;  3AKA A;  4GGF C;  3OB2 B;  1M45 A;  1KCY A;  3AKB A;  1PSB A;  1PUL A;  2L0P A;  3WNX B;  1XO5 A;  3TS5 B;  1Y1A A;  2EGD A;  2L5X B;  1SL8 A;  4PHJ A;  3PN7 C;  1GQM A;  1XFX O;  4XYN A;  4JKT A;  1V1F A;  3I5G B;  2KAX A;  2M7N A;  1BT6 A;  2K7D A;  2M49 B;  4GFT A;  1SNL A;  5D69 A;  5DKN A;  1QLK A;  3PM2 A;  5D7F A;  3SG3 A;  1DF0 B;  2KYF A;  4AOM A;  4AQJ A;  3CR4 X;  1IGV A;  1UHN A;  1DVI A;  1FW4 A;  5CSF A;  2WCB A;  2EC6 B;  4A4C A;  4ORB B;  4HRE E;  1YRT B;  2LMV A;  1IQ3 A;  4I5J A;  5CSJ A;  2QAC A;  3BOW A;  2P6B B;  2Q91 A;  3QRX A;  1S6I A;  3CLN A;  4D1E A;  1VRK A;  2BCA A;  2JT8 A;  1NCX A;  3OHM B;  2PSR A;  4PE4 A;  5CPV A;  1H4B A;  3FS7 A;  1AVS A;  4NDB A;  1AUI B;  1JFJ A;  1AJ4 A;  3HCM A;  1CMF A;  2RGI A;  1CTR A;  2HQ8 A;  2JC2 A;  3H4S E;  1EXR A;  2KNE A;  3BUO B;  3TDI A;  3VRR A;  1HT9 A;  4GNK B;  1R2U A;  4WQ3 A;  3D10 A;  4OCI A;  1Z4H A;  4MSP A;  3FIA A;  1NX2 A;  2JU0 A;  4OVN F;  1QVI Z;  4MZL A;  1QTX A;  1OMD A;  1SRA A;  3GOF A;  1OMV A;  1S36 A;  4MRX A;  1GGW A;  1SKT A;  2L2E A;  1KK8 C;  2PRU A;  2EHB A;  2SCP A;  2DOQ A;  1ODB A;  1CLL A;  1KWO C;  1NP8 A;  3PN7 B;  4WRI A;  1CM1 A;  1S3P A;  2K2F A;  1YX8 A;  1QX7 A;  4MEW A;  2K7C A;  3AAK A;  4N1G A;  1DJY A;  4HRG A;  4P2Y B;  3GK1 A;  1UUS A;  1QXP A;  4FTG A;  4GUK A;  1TTX A;  4C0L A;  4ZCU A;  3JVT C;  1XK4 C;  1JF2 A;  2ZN9 A;  4U8D A;  1J7O A;  3VGO A;  1PVA A;  2FJU B;  2KSP A;  3BQ3 A;  2K0J A;  2KI4 C;  5HKY A;  1CFC A;  1IG5 A;  2LMU A;  4CFR A;  1KFU S;  2LE9 B;  5IBW A;  3EK8 A;  2FCE A;  1CDP A;  1DJZ A;  1N2D A;  1DJH A;  2LP3 A;  4YGD B;  3I5H C;  1IQ5 A;  2LHL A;  2I94 A;  2JZI A;  2KLD A;  5HL1 A;  2OPO A;  3E3R A;  5JOL A;  1K2H A;  1EG4 A;  1S5G Z;  3EK7 A;  2CCM A;  1UHK A;  3KO0 A;  3TUY C;  1SR6 C;  1BJF A;  4YGA A;  1K9P A;  1QVI Y;  1PVB A;  2K2A A;  1V1G A;  1A03 A;  2MA2 A;  2FOT A;  4OKH A;  1B8L A;  1YVH A;  2CNP A;  2Y1M A;  1JF0 A;  2JNX A;  2LCP A;  5FI2 A;  1PRW A;  4MVF A;  1U5I A;  2LV7 A;  2KBM A;  4Q04 A;  1FF1 A;  2NCP A;  2F2O A;  2WOS A;  4YGC B;  3CR5 X;  1KK8 B;  1RRO A;  4I5K A;  1OSA A;  1A29 A;  1KK7 Z;  1S6J A;  1CM4 A;  2K7B A;  3O4Y A;  2K7O A;  1KFU L;  1KWO B;  2M0R A;  1QX5 B;  1CLM A;  3DVM A;  5AFP A;  1M46 A;  1YUR A;  1Q80 A;  1QV0 A;  2JXL A;  2JRF A;  1CKK A;  1QJT A;  2WOR A;  1OZO A;  5CSN A;  4ICB A;  1XA5 A;  1PSR A;  2VRG A;  3CR2 A;  2I18 A;  3KHE A;  1NSH A;  5BPJ A;  2BEC A;  4YGB B;  5AEQ A;  1BOC A;  1TCF A;  2GGZ A;  2I2R E;  3PSR A;  1J1E A;  1PK0 D;  1SW8 A;  2BBN A;  3JVT B;  5HLO A;  1CB1 A;  1EH2 A;  1G33 A;  1KQV A;  1TIZ A;  1IRJ A;  2KI6 D;  2KI4 B;  5HYD A;  1SK6 D;  1DJW A;  1DGU A;  4MLW A;  2ZKM X;  2ISD A;  1F55 A;  1B47 A;  1BR1 B;  3D0Y A;  1A4P A;  2L98 A;  1ALW A;  3UNW A;  2JQ6 A;  1TNQ A;  2LAN A;  3I5H B;  4M2O A;  2F3Z A;  2NXQ A;  4WQ2 A;  4CLN A;  3EVU A;  5AER A;  1Y1X A;  1UWO A;  3FWC A;  1L7Z A;  1CLB A;  1K9K A;  2MBX A;  5KTY A;  1CDM A;  3SG5 A;  1OQP A;  3TUY B;  1DJI A;  1SR6 B;  1QX2 A;  1DJG A;  1QIW A;  4ORC B;  2BCB A;  1B7T Z;  2K60 A;  3ICB A;  1MQ1 A;  5JJG A;  2JUL A;  2A4J A;  4XJK A;  2K8M B;  5FI6 A;  4HSZ A;  1A75 A;  5HKW A;  1XFW O;  2KGB C;  2LLS A;  4PCW A;  2BL0 C;  1DT7 B;  4BY5 A;  1WDC C;  5I2L A;  1EL4 A;  2COL B;  1JWD A;  1M39 A;  1ALV A;  3EG5 B;  1Y6W A;  3SG2 A;  3BOW B;  3JTD C;  4YGE B;  5I94 A;  3DF0 B;  1QAT A;  2JWW A;  3CWG A;  1AP4 A;  4PHK A;  4R1E A;  1K9U A;  2KLE A;  3LL8 B;  2JTT A;  3NSK A;  2CXJ A;  5I2Q A;  3EVR A;  2ZRS A;  1DTL A;  3O78 A;  5K89 A;  1W9Z A;  4USL A;  1DF0 A;  1FBV A;  3DVK A;  1J7P A;  1NIW A;  3PM8 A;  5PAL A;  1TOP A;  1HQV A;  1WRK A;  2HPS A;  2H2K A;  2LM5 A;  2LVI A;  1B9A A;  4CPV A;  1C7V A;  2KBI A;  2M3W A;  4A4B A;  2KGR A;  4MBE A;  1F8H A;  3EVV A;  3SG4 A;  1WRL A;  4MZK A;  4PHN A;  2KFH A;  2TN4 A;  2E30 A;  1NX1 A;  2JOJ A;  4DS7 A;  3K21 A;  1JBA A;  2ZRT A;  1NX3 A;  1E8A A;  1YUT A;  2BCX A;  1CFD A;  4GAO A;  2Y4Q A;  1B7T Y;  2LVJ A;  3EKH A;  1K93 D;  1BG1 A;  1DEL A;  2KQY A;  1TNW A;  4BY4 A;  3HX4 A;  1MWN A;  5I2O A;  2OS8 C;  1QV1 A;  5FI7 A;  5AAN A;  2I7A A;  2JXC A;  1IJ5 A;  5KSZ A;  1XFV O;  1K96 A;  1QAS A;  3OP0 A;  2BL0 B;  1WLM A;  1WDC B;  4GGF A;  1J7Q A;  4E68 A;  1IWQ A;  2BKH B;  1BLQ A;  3TDZ A;  1RJV A;  3JTD B;  1OMR A;  2KHN A;  2KYC A;  3CS1 A;  4MN0 A;  1XYD A;  1KFX S;  3BUX B;  2WND A;  4N5X A;  3BUW B;  2MLF C;  4QJ5 B;  1IKU A;  4IJ7 A;  2BNX A;  4PDZ A;  1C7W A;  2F8P A;  3BYA A;  5ER4 X;  1UHJ A;  1GGZ A;  4MZJ A;  5FYX A;  2HET A;  3LK0 A;  1F70 A;  3I5I C;  5HLV A;  3SS3 A;  1G8I A;  1KQM C;  1TNP A;  3PLF B;  3BUM B;  1SY9 A;  1B1G A;  1SL9 A;  3A4U B;  1QS7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...