1C7WA

Nmr solution structure of the calcium-bound c-terminal domain (w81-s161) of calcium vector protein from amphioxus
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
68
structure length
68
Chain Sequence
EEEILRAFKVFDANGDGVIDFDEFKFIMQKVGEEPLTDAEVEEAMKEADEDGNGVIDIPEFMDLIKKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal binding protein
molecule keywords CALCIUM VECTOR PROTEIN
publication title Sequential calcium binding to the regulatory domain of calcium vector protein reveals functional asymmetry and a novel mode of structural rearrangement.
pubmed doi rcsb
source organism Branchiostoma lanceolatum
total genus 17
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2000-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1c7wA00
1TCOB 1XK4C 3OB1B 4GUKA 1F70A 2L2EA 3BYAA 5DKRA 3DD4A 1XFVO 2QPTA 1CKKA 1N2DA 1DJWA 1UHKA 2JXLA 2WORA 1JFKA 1KFUS 4M2QA 4M2OA 2M29A 3TDUA 1SCMC 2KDHA 1KSMA 4NQGA 2D8NA 2TN4A 3LCPC 2F2OA 2RGIA 4OVNF 3LK1A 2BCBA 5I8NA 2KGBC 2F3ZA 1CMFA 2HF5A 1FI5A 2K0JA 2CNPA 4CFQA 1ZFSA 5DKQA 2BKHB 2GGMA 4QJ5B 1NUBA 4JWQA 1QIWA 4DS7A 4CLNA 1K2HA 4MLWA 1NPQA 3CTNA 1L2OB 4HSZA 3IQOA 1WLZA 1ALWA 4BY4A 2M97A 1YTZC 1IRJA 3BQ3A 4MVFA 1UHHA 2AMIA 2KI4B 2Y4QA 1A2XA 2CXJA 2LAPA 4HRHA 3BUOB 1KSOA 1IQ5A 3WNXB 2JTTA 3C1VA 1TNXA 3SIBA 4D1EA 3JVTB 4N1GA 1AP4A 1AVSA 3OX5A 3OB2B 2H2KA 2Y1NA 1GGZA 1TN4A 1XFWO 2MAZA 3FIAA 1OMVA 1MR8A 3DVJA 1XO5A 5I2QA 1K96A 4MRXA 2M7LA 1Y1XA 4JQ0D 3SG5A 2MA2A 3AKAA 2O60A 4GAOA 4XJKA 1BJFA 4ORBB 4PCWA 1QX5B 2HPSA 1J7RA 2CBLA 3NSLA 1F4QA 1YVLA 2L98A 4XJKB 2BE6A 2EGDA 2BL0C 1F54A 1TOPA 5PALA 1YUUA 4I5JA 2KI6D 2M3WA 5JJGA 3BXKA 3PALA 3TDIA 2MLFC 2WNDA 3IQQA 1CDPA 1PSBA 4IL1A 1LA3A 4GGNA 5AERA 1S6JA 1XFZO 1DVIA 1NP8A 2M9GA 2QACA 4MN0A 1S3PA 1KFXL 2BCAA 1QS7A 1A03A 1KK7Y 1QV1A 1DT7B 2K7OA 2F2PA 1SK6D 1M31A 4PE7A 1OZSA 4HREE 1OMDA 4XYNA 2SASA 1DJXA 3E3RA 1D1OA 2L4HA 3NSOA 1H8BA 4BY5A 2I94A 1BR1B 1CNPA 1A75A 1AUIB 1NX2A 4YBHB 1QX7A 1AJ5A 1NCZA 2JT0A 3PSRA 4PDZA 1DJHA 1KK7Z 2JNFA 1A75B 2KOTA 4A4CA 1CFDA 4M2PA 1CDMA 1Y1UA 1QTXA 2JT8A 3A8RA 1DF0A 1MF8B 2KHNA 2I7AA 3AKBA 2L51A 4E68A 2Y5IA 1SL8A 5CSFA 2BL0B 1DF0B 2KI4C 3SG7A 3I5GB 4DIRA 2FJUB 1ZOTB 1B7TY 1K95A 2BBNA 2NXQA 3JVTC 1OZOA 1OMRA 2KAVA 1ALVA 2CCMA 3VRQA 1XFXO 2WCEA 5KTYA 3WHUB 2MHHA 2NZ0A 1J55A 1HT9A 2LHIA 1JBAA 1PK0D 4CPVA 1YR5A 2KNEA 1PULA 1GQMA 1YUSA 3BUNB 3SIAA 5ER4X 2ZRTA 3DF0A 1RWYA 4AQJA 1B7TZ 1RTP1 1TTXA 1DJIA 4YGAA 2A4JA 1QV0A 3DF0B 1BLQA 1DJYA 2LC5A 4I5KA 1QX2A 2M0RA 2BKIB 4YI8A 3TS5B 1IQ3A 2AUCA 2JT3A 2JC2A 2LE9B 4WQ3A 5KSZA 2LUXA 2LLSA 2OPOA 4FQOA 4MSPA 4OKHA 1SYMA 4AOMA 1AK8A 1FBVA 5TNCA 3QRXA 1QIVA 3CR5X 1JUOA 4DUQA 1B8RA 2EHBA 1EG4A 1F71A 1KQVA 1RJVA 4PE1A 4PALA 2JPTA 2Q4UA 1SW8A 3OHMB 1U5IA 2GGZA 1CLBA 1SMGA 3EK8A 3SG3A 1MXEA 2ZNEA 1NCXA 5ER5A 1U5IB 1IJ5A 2JQ6A 5CSJA 4C0LA 2E30A 2KFFA 3NSIA 4OV2A 2LMTA 3GK1A 4GPLB 5GQQC 3BUXB 1NIWA 1BODA 3KEVA 1R6PA 1SR6B 2CT9A 2LLTA 4L9MA 4R1EA 3KHEA 1PVAA 1RK9A 4OR9B 3LLEA 2EC6B 1JF0A 3WHTB 1BOCA 1M46A 1W7JB 1VRKA 2K2AA 1JSAA 3DVMA 4PHKA 4PHMA 1LA0A 1FF1A 4U8DA 3I5HC 3I5IC 1UP5A 3EKHA 4P5OE 4CFRA 1UHNA 3O4YA 1ZACA 2ZN8A 4MZJA 1SY9A 3A4UB 3GK2A 1L7ZA 5FYXA 4DCKA 1MQ1A 2KFGA 1XA5A 4QJ4B 4PHJA 3I5GC 2KAXA 1SRAA 3M0WA 2PSRA 1Y1AA 5BPJA 1J7QA 1TNWA 2KFHA 3CR2A 1FI6A 1RFJA 3DVEA 3DVKA 2MBXA 5I2OA 2FCEA 1CMGA 1CM4A 1S36A 4ZCUA 1GGWA 1HQVA 4GBAA 1H4BA 1K9PA 1QVIY 4MBEA 1KK8B 2KGRA 2L5XB 1MWNA 1FW4A 1WLMA 1B47A 3CZTX 4QJ3B 2I2RE 1Y0VH 2ZFDA 1YVHA 4F0ZB 3VROA 1XVJA 2LLUA 5D69A 1YRUB 1KCYA 2LCPA 5I2LA 1IKUA 1PVBA 1NX3A 2NCOA 5CSIA 1YRTB 5D7FA 1SNLA 2WCBA 5DKNA 3VRRA 2OTGC 2L50A 2JWWA 3TS5C 1QVIZ 1CFCA 1CDLA 2LVKA 1WDCB 2ZRSA 1MHOA 1B8CA 1KQMC 1WY9A 1XYDA 3I5HB 2F8PA 3I5IB 2LV7A 4HRGA 1DGUA 1OQPA 2LVJA 2PVBA 1CLLA 1NX0A 2SCPA 1PALA 1OE9B 3O2PA 5AFPA 3EVVA 3KPXA 4CIDA 5B8IB 1IGVA 1DMOA 3OP0A 1KWOC 4AQIA 3H4SE 1S5GY 1YUTA 1SR6C 1DJZA 4MZLA 2JTZA 4GNKB 3KF9A 1QATA 1BF5A 3OX6A 2EC6C 1K94A 1CDNA 1QXPA 1N65A 4YRUA 1EG3A 4ETOA 5HKYA 4I5LB 4Q04A 2JU0A 2HETA 2KI6C 3D10A 2Q91A 3D0YA 3CR4X 3IF7A 2ISDA 2JOJA 1B9AA 2JRFA 1UHJA 1IWQA 3O6BA 3CS1A 1JFJA 1S5GZ 4FTGA 3D0YB 2B1UA 3AAKA 1RROA 1M39A 2F3YA 2LP3A 3KO0A 4GGFA 3PLFB 3ZNIA 1DGVA 1SL9A 5AANA 1SBJA 3LK0A 2OTGB 4ICBA 2GV5A 5CPVA 2ZNDA 1OOJA 3PN7B 1MXLC 1LINA 3BOWA 4NDDA 1JC2A 1G4YR 2LUCA 1KQMB 1XFYO 1YX7A 2HQWA 3BOWB 5HLOA 3I5FB 1LVCD 1IH0A 4PE4A 4P2YB 1KK8C 2LMVA 3SG4A 4ZCVA 5G08A 1B1GA 1QLSA 2BBMA 1Q80A 1SL7A 2KQYA 2M49B 3NXAA 3VRNA 2WC8A 4I5NB 1C7WA 4C0KA 3K21A 1KWOB 1BG1A 1ZMZA 2M1UA 1S6CA 3EVUA 3VGOA 1KFUL 2AAOA 1K8UA 1K90D 1UUSA 1Y6WA 2JULA 3PM8A 2CTNA 2BE4A 4N5XA 1UHIA 2OS8C 5K89A 1J1DA 1WRZA 3LL8B 1WDCC 3FS7A 1ODBA 1OSAA 4YI9A 1LXFC 1CLMA 5AEQA 1S26D 2KQ6A 1K9KA 3NSKA 1J1EA 2PASA 3SG2A 1G8IA 5HKZA 1BU3A 3CWGA 2COLB 2R2IA 2FOTA 4A4BA 3EK4A 4JPZB 2VRGA 2JNXA 1CB1A 1BMOA 2H61A 4NDCA 1TNQA 3CGAA 2Y1MA 1WRLA 2K7BA 5CSNA 1B8LA 1IJ6A 1NX1A 1C7VA 1B4CA 3JTDB 1PSRA 2KBIA 3EVRA 2JXCA 4PE0A 2P6BB 2KAYA 3SG6A 1CFPA 2K61A 1W7IB 2KYFA 2MLEC 3O78A 1X02A 3RM1A 1QJTA 1TRFA 1XK4A 3RLZA 1EH2A 1PRWA 1M63B 1RECA 1DJGA 1XFUO 1K9UA 2IS9A 4ORAB 1K93D 2HQ8A 1C07A 1A29A 2E6WA 2K2FA 2LHLA 2PMYA 2ZKMX 1LKJA 2M7NA 4UPGA 1GJYA 3TUYC 1KFXS 2LNKA 5AXIA 1NCYA 2KYCA 3F45A 4YGBB 2MJWB 2WCFA 3GOFA 4WRIA 2WOSA 2F33A 2O5GA 1QASA 1UWOA 2G9BA 1SCMB 2LP2A 3PATA 2LM5A 3TZ1A 3AAJA 2K7DA 5JOLA 4PHNA 2L4IA 3HCMA 1JWDA 2ZN9A 3BUMB 1R2UA 1NWDA 4WQ2A 1WRKA 1CTRA 4C0JA 1TIZA 3BUWB 2NLNA 1AHRA 4YGEB 2OS8B 4GGFC 3ICBA 1SKTA 3EK7A 3PN7C 2M8UA 1NYAA 1SPYA 1M45A 3CLNA 5F6TA 2FCDA 2PALA 4DRWA 1V1FA 3I5FC 2BECA 4MEWA 3VRPA 3FWCA 5KU1A 4ORCB 5IBWA 1J7PA 1F8HA 5J3XA 2NCPA 2LANA 1E8AA 4YGCB 5HLVA 1MUXA 2DOQA 3WXAA 1S1EA 2MRDA 3HX4A 1J7OA 1FPWA 1G33A 4GFTA 1F4OA 1DTLA 2K8MB 1CM1A 1EXRA 2PRUA 1JF2A 2M1KB 1IG5A 1ZUZA 1V1GA 3PFVA 1YX8A 1S6IA 1YURA 3SJSA 4OCIA 4YGDB 2LMUA 1UURA 2K7CA 1AJ4A 3TDZA 1F55A 2V53A 3TUYB 2I18A 3ZWHA 1L2OC 2LVIA 3MSEB 4MZKA 4NDBA 4USLA 3FWBA 1TCFA 4N1FA 5HYDA 1QLKA 1N0YA 1EJ3A 2KSPA 2LVVA 3JTDC 1BR4B 2H61C 2BCXA 3GK4X 5HKWA 3EKJA 2JZIA 1CFFA 1TNPA 2L0PA 1BT6A 4MRYA 4TNCA 2KBMA 1A4PA 1EL4A 1SCVA 2G2BA 1NSHA
chains in the Genus database with same CATH superfamily
1TCOB 1XK4C 2FJYA 3S0GA 3OB1B 2QEBA 4GUKA 1F70A 2L2EA 3NHTA 3BYAA 5DKRA 3DD4A 1XFVO 2QPTA 1CKKA 1N2DA 1DJWA 1UHKA 2JXLA 2WORA 1JFKA 1KFUS 3CZ1A 4M2QA 4M2OA 2M29A 3TDUA 1SCMC 2KDHA 1KSMA 4NQGA 2D8NA 2TN4A 3LCPC 2F2OA 2RGIA 4OVNF 3LK1A 2BCBA 3CYZA 5I8NA 2KGBC 2F3ZA 3BJHA 1CMFA 2HF5A 1FI5A 2K0JA 2CNPA 4CFQA 1ZFSA 5DKQA 2BKHB 2GGMA 4QJ5B 1OW4A 1NUBA 3BFBA 4JWQA 1QIWA 4DS7A 1XFRA 4CLNA 1K2HA 4MLWA 1NPQA 3CTNA 1L2OB 4HSZA 3IQOA 1WLZA 1ALWA 4BY4A 2M97A 1YTZC 1IRJA 3BQ3A 4MVFA 1UHHA 2AMIA 2KI4B 2Y4QA 1A2XA 2CXJA 2LAPA 4HRHA 3BUOB 1KSOA 1IQ5A 3WNXB 2JTTA 3C1VA 1TNXA 3SIBA 4D1EA 3JVTB 4N1GA 1AP4A 3CZ2A 1AVSA 3OX5A 3OB2B 3CDNA 2H2KA 2Y1NA 1GGZA 1TN4A 1XFWO 3L47A 3FE6A 2MAZA 3FIAA 1OMVA 1MR8A 3DVJA 1XO5A 5I2QA 1K96A 3B86A 4MRXA 2M7LA 1Y1XA 4JQ0D 3SG5A 2MA2A 3AKAA 2O60A 1OOFA 4GAOA 4XJKA 1BJFA 4ORBB 4PCWA 1QX5B 2HPSA 1J7RA 2CBLA 3NSLA 1F4QA 2L2CA 1YVLA 2L98A 4XJKB 2BE6A 2EGDA 2BL0C 3QMEA 1F54A 1TOPA 5PALA 1YUUA 4I5JA 2KI6D 2M3WA 2WCMA 4PT1A 2WC6A 5JJGA 3BXKA 3PALA 3TDIA 2MLFC 2WNDA 3V2LA 3IQQA 1CDPA 1PSBA 3S0DA 4IL1A 1LA3A 1T14A 3N7HA 4GGNA 5AERA 1S6JA 1XFZO 1DVIA 1NP8A 2M9GA 2QACA 4MN0A 1S3PA 1KFXL 2BCAA 1QS7A 1A03A 1KK7Y 1QV1A 3S0AA 1DT7B 2K7OA 2F2PA 1SK6D 1M31A 4PE7A 1OZSA 3B87A 4HREE 1OMDA 1LS8A 4XYNA 2SASA 2QDIA 1DJXA 3E3RA 3VB1A 1D1OA 2L4HA 3NSOA 1H8BA 5DICA 4BY5A 2I94A 1BR1B 1CNPA 1A75A 1AUIB 1NX2A 3BFAA 4YBHB 1QX7A 1AJ5A 1NCZA 2JT0A 3PSRA 4PDZA 1DJHA 1KK7Z 2JNFA 3R72A 1A75B 2KOTA 4A4CA 1CFDA 4M2PA 3UNWA 1CDMA 1Y1UA 1QTXA 2KLEA 2JT8A 3A8RA 1DF0A 1MF8B 2KHNA 2BNXA 1Z4HA 2I7AA 3AKBA 2L51A 1C3ZA 3D73A 3SS5A 4E68A 2Y5IA 1SL8A 5CSFA 2BL0B 1DF0B 2KI4C 3SG7A 3I5GB 4DIRA 3D78A 2FJUB 1ZOTB 3R1PA 1B7TY 1K95A 2BBNA 2NXQA 3JVTC 2KLDA 1OZOA 1OMRA 2KAVA 1ALVA 3D75A 2CCMA 3VRQA 1XFXO 2WCEA 5KTYA 3WHUB 2MHHA 2NZ0A 1J55A 1HT9A 2LHIA 1JBAA 1PK0D 4CPVA 1YR5A 3SS3A 2KNEA 1PULA 1GQMA 1YUSA 3BUNB 3SIAA 2PYQA 2P70A 5ER4X 2ZRTA 1TUJA 1RWYA 3DF0A 4AQJA 1B7TZ 1RTP1 1TTXA 1DJIA 4YGAA 2A4JA 1QV0A 3DF0B 2WCKA 1BLQA 1DJYA 2LC5A 4I5KA 1QX2A 2M0RA 2BKIB 1IIOA 4YI8A 3TS5B 1IQ3A 2AUCA 2JT3A 2JC2A 2LE9B 3D76A 4WQ3A 1OOHA 1ORGA 5KSZA 2LUXA 2LLSA 2OPOA 4FQOA 4MSPA 4OKHA 1SYMA 4AOMA 1AK8A 1FBVA 5TNCA 3QRXA 1QIVA 3CR5X 1JUOA 4DUQA 1B8RA 2EHBA 1EG4A 1F71A 1KQVA 1RJVA 4PE1A 4PALA 2JPTA 2Q4UA 1SW8A 3OHMB 1U5IA 2GGZA 1CLBA 1SMGA 3EK8A 3SG3A 1MXEA 2ZNEA 1NCXA 5ER5A 1U5IB 1IJ5A 2JQ6A 3DYEA 3Q8IA 2E30A 2KFFA 3NSIA 4OV2A 2LMTA 3GK1A 4GPLB 5GQQC 3BUXB 1NIWA 1BODA 3KEVA 1R6PA 1SR6B 2CT9A 2BAPA 2LLTA 4L9MA 4OZDA 4R1EA 3KHEA 1PVAA 1RK9A 4OR9B 3LLEA 1TWOA 2EC6B 1JF0A 3WHTB 1BOCA 1M46A 1W7JB 1VRKA 2K2AA 1JSAA 3DVMA 4PHKA 1DELA 4PHMA 1LA0A 1FF1A 4U8DA 3I5HC 3I5IC 1UP5A 3B7AA 3EKHA 4P5OE 4CFRA 1UHNA 3O4YA 1ZACA 2ZN8A 4MZJA 1SY9A 3NHIA 3A4UB 3GK2A 1L7ZA 5FYXA 4DCKA 1MQ1A 2KFGA 1XA5A 4QJ4B 4PHJA 2QEVA 3I5GC 2KAXA 1SRAA 3FE8A 3M0WA 4KYNA 2PSRA 1Y1AA 5BPJA 1J7QA 1TNWA 2KFHA 3CR2A 3SS4A 1P28A 3CZ0A 1FI6A 1RFJA 3DVEA 3DVKA 2MBXA 5I2OA 2FCEA 1CMGA 5I94A 1CM4A 1S36A 4ZCUA 1GGWA 3L4LA 1HQVA 2YGUA 4GBAA 1K9PA 4C0LA 1H4BA 1QVIY 4MBEA 1KK8B 2KGRA 2L5XB 1MWNA 1FW4A 1WLMA 1B47A 3CZTX 4QJ3B 2I2RE 1Y0VH 2ZFDA 3D74A 1YVHA 4F0ZB 3R1OA 3VROA 1XVJA 2LLUA 5D69A 1YRUB 1KCYA 2LCPA 5I2LA 1IKUA 1PVBA 1QWVA 1NX3A 2NCOA 2P71A 1YRTB 5CSIA 5D7FA 1SNLA 2WCBA 5DKNA 3VRRA 2OTGC 2L50A 2JWWA 1DQEA 3TS5C 1QVIZ 3OBVA 1CFCA 1CDLA 2LVKA 4INWA 2PQLA 1WDCB 4JKTA 2ZRSA 1MHOA 1B8CA 1KQMC 1WY9A 2H8VA 3B6XA 3EG5B 1XYDA 3I5HB 2ERBA 2F8PA 2LV7A 3BFHA 3I5IB 4HRGA 1DGUA 1OQPA 2LVJA 4F7FA 2PVBA 1CLLA 1NX0A 2QEOA 2SCPA 2WCHA 1PALA 1OE9B 3O2PA 5AFPA 3EVVA 2WC5A 3KPXA 4CIDA 5B8IB 1IGVA 1DMOA 3OP0A 1KWOC 3FE9A 3DZTA 1Z2CB 4AQIA 3H4SE 1S5GY 1YUTA 1SR6C 1DJZA 4MZLA 2JTZA 4GNKB 3KF9A 3S0EA 1QATA 4JD9A 1BF5A 3OX6A 2EC6C 1K94A 1CDNA 1QXPA 1N65A 4YRUA 1EG3A 4ETOA 5HKYA 4I5LB 4Q04A 2JU0A 2HETA 2KI6C 3D10A 2Q91A 3D0YA 3CR4X 3IF7A 2ISDA 2JOJA 1B9AA 2JRFA 1UHJA 1IWQA 3O6BA 3CABA 3CS1A 1JFJA 1S5GZ 3IVTA 4FTGA 3D0YB 5FI7A 2B1UA 3AAKA 1RROA 1M39A 2F3YA 2LP3A 3KO0A 4GGFA 3PLFB 3ZNIA 1DGVA 2JPOA 1SL9A 5AANA 1SBJA 2WCLA 3LK0A 2OTGB 4ICBA 2GV5A 5CPVA 2ZNDA 1OOJA 3PN7B 1MXLC 1LINA 3BOWA 3DY9A 4NDDA 3S0FA 1JC2A 1G4YR 2LUCA 1KQMB 1XFYO 1YX7A 2HQWA 2WCJA 3BOWB 5HLOA 3I5FB 1LVCD 1W9ZA 4PE4A 1IH0A 4P2YB 1KK8C 2LMVA 3SG4A 4ZCVA 5G08A 1B1GA 1QLSA 2BBMA 1Q80A 1SL7A 2KQYA 2M49B 3NXAA 3VRNA 2WC8A 4I5NB 1C7WA 4C0KA 3K21A 1KWOB 1BG1A 1ZMZA 2M1UA 1GM0A 1S6CA 3EVUA 3VGOA 1KFUL 2AAOA 1K8UA 1K90D 1UUSA 1Y6WA 2JULA 3PM8A 2CTNA 2BE4A 4N5XA 1UHIA 2OS8C 5K89A 1J1DA 1WRZA 3LL8B 1WDCC 3FS7A 1ODBA 3PJIA 1OSAA 4YI9A 1LXFC 5EL2A 1CLMA 5AEQA 1S26D 2KQ6A 2K60A 1DEKA 1K9KA 3NSKA 1J1EA 2PASA 3SG2A 1G8IA 4IJ7A 5HKZA 1BU3A 3CWGA 2COLB 2R2IA 2FOTA 3PM2A 3EK4A 4A4BA 4JPZB 2VRGA 2JNXA 1CB1A 1BMOA 2H61A 5HL1A 4NDCA 1TNQA 3CGAA 1TUZA 2Y1MA 1WRLA 2K7BA 5FI6A 2L5YA 5CSNA 1B8LA 5D3OA 1IJ6A 1NX1A 1C7VA 1B4CA 3JTDB 1PSRA 2KBIA 3EVRA 2JXCA 4PE0A 2P6BB 2KAYA 3SG6A 1CFPA 2K61A 3DXLA 1W7IB 2KYFA 2MLEC 3O78A 1X02A 3RM1A 1QJTA 1TRFA 1XK4A 3RLZA 1EH2A 1PRWA 1M63B 1RECA 1DJGA 1XFUO 1K9UA 2IS9A 3R1VA 4ORAB 1K93D 2HQ8A 1C07A 1A29A 2E6WA 2K2FA 4FQTA 2LHLA 2PMYA 2ZKMX 1LKJA 2M7NA 4UPGA 1GJYA 3TUYC 1KFXS 2LNKA 5AXIA 3UO9A 1NCYA 2KYCA 3F45A 4YGBB 2MJWB 2WCFA 3GOFA 4WRIA 2WOSA 2F33A 1DC1A 2O5GA 3O4XA 1QASA 1UWOA 2G9BA 1SCMB 2LP2A 3PATA 2LM5A 3OGNA 3AAJA 2K7DA 5JOLA 3TZ1A 4PHNA 2L4IA 3HCMA 1JWDA 5CSJA 2ZN9A 3BUMB 3L4AA 1R2UA 1NWDA 4WQ2A 1WRKA 1CTRA 1OOGA 1TIZA 4C0JA 3BUWB 2NLNA 1AHRA 4YGEB 2OS8B 4GGFC 3ICBA 3NGVA 1SKTA 3EK7A 3PN7C 2M8UA 3RZSA 1NYAA 1SPYA 1M45A 3CLNA 5F6TA 3D77A 2FCDA 2PALA 4DRWA 1V1FA 3I5FC 2BECA 4MEWA 3VRPA 3FWCA 5KU1A 4ORCB 5IBWA 1J7PA 1F8HA 5J3XA 2NCPA 2LANA 1E8AA 4YGCB 5HLVA 1MUXA 2DOQA 3WXAA 1S1EA 2MRDA 1SSEB 3HX4A 1J7OA 3S0BA 1FPWA 2QEHA 1G33A 4GFTA 1F4OA 1DTLA 2K8MB 4INXA 1CM1A 1EXRA 2PRUA 1JF2A 2M1KB 1IG5A 1ZUZA 1V1GA 3PFVA 1YX8A 1S6IA 1YURA 3SJSA 4OCIA 4YGDB 2LMUA 1UURA 2K7CA 1AJ4A 3TDZA 1F55A 2V53A 3TUYB 2I18A 3ZWHA 2KPHA 1L2OC 2LVIA 3MSEB 4MZKA 4NDBA 4USLA 3FWBA 1TCFA 4N1FA 5HYDA 3K1EA 3B88A 1QLKA 1N0YA 1EJ3A 2KSPA 2LVVA 3JTDC 5FI2A 1BR4B 2H61C 2BCXA 3GK4X 5HKWA 3EKJA 2JZIA 1C3YA 1CFFA 1TNPA 2GTEA 2L0PA 1BT6A 4MRYA 1OOIX 4TNCA 2KBMA 1A4PA 1EL4A 1SCVA 2G2BA 1NSHA
chains in the Genus database with same CATH topology
1TCOB 1XK4C 3OB1B 4GUKA 1F70A 2L2EA 3BYAA 5DKRA 3DD4A 1XFVO 2QPTA 1CKKA 1N2DA 1DJWA 1UHKA 2JXLA 2WORA 1JFKA 1KFUS 4M2QA 4M2OA 2M29A 3TDUA 1SCMC 2KDHA 1KSMA 4NQGA 2D8NA 2TN4A 3LCPC 2F2OA 2RGIA 4OVNF 3LK1A 2BCBA 5I8NA 2KGBC 2F3ZA 1CMFA 2HF5A 1FI5A 2K0JA 2CNPA 4CFQA 1ZFSA 5DKQA 2BKHB 2GGMA 4QJ5B 1NUBA 4JWQA 1QIWA 4DS7A 4CLNA 1K2HA 4MLWA 1NPQA 3CTNA 1L2OB 4HSZA 3IQOA 1WLZA 1ALWA 4BY4A 2M97A 1YTZC 1IRJA 3BQ3A 4MVFA 1UHHA 2AMIA 2KI4B 2Y4QA 1A2XA 2CXJA 2LAPA 4HRHA 3BUOB 1KSOA 1IQ5A 3WNXB 2JTTA 3C1VA 1TNXA 3SIBA 4D1EA 3JVTB 4N1GA 1AP4A 1AVSA 3OX5A 3OB2B 2H2KA 2Y1NA 1GGZA 1TN4A 1XFWO 2MAZA 3FIAA 1OMVA 1MR8A 3DVJA 1XO5A 5I2QA 1K96A 4MRXA 2M7LA 1Y1XA 4JQ0D 3SG5A 2MA2A 3AKAA 2O60A 4GAOA 4XJKA 1BJFA 4ORBB 4PCWA 1QX5B 2HPSA 1J7RA 2CBLA 3NSLA 1F4QA 1YVLA 2L98A 4XJKB 2BE6A 2EGDA 2BL0C 1F54A 1TOPA 5PALA 1YUUA 4I5JA 2KI6D 2M3WA 5JJGA 3BXKA 3PALA 3TDIA 2MLFC 2WNDA 3IQQA 1CDPA 1PSBA 4IL1A 1LA3A 4GGNA 5AERA 1S6JA 1XFZO 1DVIA 1NP8A 2M9GA 2QACA 4MN0A 1S3PA 1KFXL 2BCAA 1QS7A 1A03A 1KK7Y 1QV1A 1DT7B 2K7OA 2F2PA 1SK6D 1M31A 4PE7A 1OZSA 4HREE 1OMDA 4XYNA 2SASA 1DJXA 3E3RA 1D1OA 2L4HA 3NSOA 1H8BA 4BY5A 2I94A 1BR1B 1CNPA 1A75A 1AUIB 1NX2A 4YBHB 1QX7A 1AJ5A 1NCZA 2JT0A 3PSRA 4PDZA 1DJHA 1KK7Z 2JNFA 1A75B 2KOTA 4A4CA 1CFDA 4M2PA 1CDMA 1Y1UA 1QTXA 2JT8A 3A8RA 1DF0A 1MF8B 2KHNA 2I7AA 3AKBA 2L51A 4E68A 2Y5IA 1SL8A 5CSFA 2BL0B 1DF0B 2KI4C 3SG7A 3I5GB 4DIRA 2FJUB 1ZOTB 1B7TY 1K95A 2BBNA 2NXQA 3JVTC 1OZOA 1OMRA 2KAVA 1ALVA 2CCMA 3VRQA 1XFXO 2WCEA 5KTYA 3WHUB 2MHHA 2NZ0A 1J55A 1HT9A 2LHIA 1JBAA 1PK0D 4CPVA 1YR5A 2KNEA 1PULA 1GQMA 1YUSA 3BUNB 3SIAA 5ER4X 2ZRTA 3DF0A 1RWYA 4AQJA 1B7TZ 1RTP1 1TTXA 1DJIA 4YGAA 2A4JA 1QV0A 3DF0B 1BLQA 1DJYA 2LC5A 4I5KA 1QX2A 2M0RA 2BKIB 4YI8A 3TS5B 1IQ3A 2AUCA 2JT3A 2JC2A 2LE9B 4WQ3A 5KSZA 2LUXA 2LLSA 2OPOA 4FQOA 4MSPA 4OKHA 1SYMA 4AOMA 1AK8A 1FBVA 5TNCA 3QRXA 1QIVA 3CR5X 1JUOA 4DUQA 1B8RA 2EHBA 1EG4A 1F71A 1KQVA 1RJVA 4PE1A 4PALA 2JPTA 2Q4UA 1SW8A 3OHMB 1U5IA 2GGZA 1CLBA 1SMGA 3EK8A 3SG3A 1MXEA 2ZNEA 1NCXA 5ER5A 1U5IB 1IJ5A 2JQ6A 5CSJA 4C0LA 2E30A 2KFFA 3NSIA 4OV2A 2LMTA 3GK1A 4GPLB 5GQQC 3BUXB 1NIWA 1BODA 3KEVA 1R6PA 1SR6B 2CT9A 2LLTA 4L9MA 4R1EA 3KHEA 1PVAA 1RK9A 4OR9B 3LLEA 2EC6B 1JF0A 3WHTB 1BOCA 1M46A 1W7JB 1VRKA 2K2AA 1JSAA 3DVMA 4PHKA 4PHMA 1LA0A 1FF1A 4U8DA 3I5HC 3I5IC 1UP5A 3EKHA 4P5OE 4CFRA 1UHNA 3O4YA 1ZACA 2ZN8A 4MZJA 1SY9A 3A4UB 3GK2A 1L7ZA 5FYXA 4DCKA 1MQ1A 2KFGA 1XA5A 4QJ4B 4PHJA 3I5GC 2KAXA 1SRAA 3M0WA 2PSRA 1Y1AA 5BPJA 1J7QA 1TNWA 2KFHA 3CR2A 1FI6A 1RFJA 3DVEA 3DVKA 2MBXA 5I2OA 2FCEA 1CMGA 1CM4A 1S36A 4ZCUA 1GGWA 1HQVA 4GBAA 1H4BA 1K9PA 1QVIY 4MBEA 1KK8B 2KGRA 2L5XB 1MWNA 1FW4A 1WLMA 1B47A 3CZTX 4QJ3B 2I2RE 1Y0VH 2ZFDA 1YVHA 4F0ZB 3VROA 1XVJA 2LLUA 5D69A 1YRUB 1KCYA 2LCPA 5I2LA 1IKUA 1PVBA 1NX3A 2NCOA 5CSIA 1YRTB 5D7FA 1SNLA 2WCBA 5DKNA 3VRRA 2OTGC 2L50A 2JWWA 3TS5C 1QVIZ 1CFCA 1CDLA 2LVKA 1WDCB 2ZRSA 1MHOA 1B8CA 1KQMC 1WY9A 1XYDA 3I5HB 2F8PA 3I5IB 2LV7A 4HRGA 1DGUA 1OQPA 2LVJA 2PVBA 1CLLA 1NX0A 2SCPA 1PALA 1OE9B 3O2PA 5AFPA 3EVVA 3KPXA 4CIDA 5B8IB 1IGVA 1DMOA 3OP0A 1KWOC 4AQIA 3H4SE 1S5GY 1YUTA 1SR6C 1DJZA 4MZLA 2JTZA 4GNKB 3KF9A 1QATA 1BF5A 3OX6A 2EC6C 1K94A 1CDNA 1QXPA 1N65A 4YRUA 1EG3A 4ETOA 5HKYA 4I5LB 4Q04A 2JU0A 2HETA 2KI6C 3D10A 2Q91A 3D0YA 3CR4X 3IF7A 2ISDA 2JOJA 1B9AA 2JRFA 1UHJA 1IWQA 3O6BA 3CS1A 1JFJA 1S5GZ 4FTGA 3D0YB 2B1UA 3AAKA 1RROA 1M39A 2F3YA 2LP3A 3KO0A 4GGFA 3PLFB 3ZNIA 1DGVA 1SL9A 5AANA 1SBJA 3LK0A 2OTGB 4ICBA 2GV5A 5CPVA 2ZNDA 1OOJA 3PN7B 1MXLC 1LINA 3BOWA 4NDDA 1JC2A 1G4YR 2LUCA 1KQMB 1XFYO 1YX7A 2HQWA 3BOWB 5HLOA 3I5FB 1LVCD 1IH0A 4PE4A 4P2YB 1KK8C 2LMVA 3SG4A 4ZCVA 5G08A 1B1GA 1QLSA 2BBMA 1Q80A 1SL7A 2KQYA 2M49B 3NXAA 3VRNA 2WC8A 4I5NB 1C7WA 4C0KA 3K21A 1KWOB 1BG1A 1ZMZA 2M1UA 1S6CA 3EVUA 3VGOA 1KFUL 2AAOA 1K8UA 1K90D 1UUSA 1Y6WA 2JULA 3PM8A 2CTNA 2BE4A 4N5XA 1UHIA 2OS8C 5K89A 1J1DA 1WRZA 3LL8B 1WDCC 3FS7A 1ODBA 1OSAA 4YI9A 1LXFC 1CLMA 5AEQA 1S26D 2KQ6A 1K9KA 3NSKA 1J1EA 2PASA 3SG2A 1G8IA 5HKZA 1BU3A 3CWGA 2COLB 2R2IA 2FOTA 4A4BA 3EK4A 4JPZB 2VRGA 2JNXA 1CB1A 1BMOA 2H61A 4NDCA 1TNQA 3CGAA 2Y1MA 1WRLA 2K7BA 5CSNA 1B8LA 1IJ6A 1NX1A 1C7VA 1B4CA 3JTDB 1PSRA 2KBIA 3EVRA 2JXCA 4PE0A 2P6BB 2KAYA 3SG6A 1CFPA 2K61A 1W7IB 2KYFA 2MLEC 3O78A 1X02A 3RM1A 1QJTA 1TRFA 1XK4A 3RLZA 1EH2A 1PRWA 1M63B 1RECA 1DJGA 1XFUO 1K9UA 2IS9A 4ORAB 1K93D 2HQ8A 1C07A 1A29A 2E6WA 2K2FA 2LHLA 2PMYA 2ZKMX 1LKJA 2M7NA 4UPGA 1GJYA 3TUYC 1KFXS 2LNKA 5AXIA 1NCYA 2KYCA 3F45A 4YGBB 2MJWB 2WCFA 3GOFA 4WRIA 2WOSA 2F33A 2O5GA 1QASA 1UWOA 2G9BA 1SCMB 2LP2A 3PATA 2LM5A 3TZ1A 3AAJA 2K7DA 5JOLA 4PHNA 2L4IA 3HCMA 1JWDA 2ZN9A 3BUMB 1R2UA 1NWDA 4WQ2A 1WRKA 1CTRA 4C0JA 1TIZA 3BUWB 2NLNA 1AHRA 4YGEB 2OS8B 4GGFC 3ICBA 1SKTA 3EK7A 3PN7C 2M8UA 1NYAA 1SPYA 1M45A 3CLNA 5F6TA 2FCDA 2PALA 4DRWA 1V1FA 3I5FC 2BECA 4MEWA 3VRPA 3FWCA 5KU1A 4ORCB 5IBWA 1J7PA 1F8HA 5J3XA 2NCPA 2LANA 1E8AA 4YGCB 5HLVA 1MUXA 2DOQA 3WXAA 1S1EA 2MRDA 3HX4A 1J7OA 1FPWA 1G33A 4GFTA 1F4OA 1DTLA 2K8MB 1CM1A 1EXRA 2PRUA 1JF2A 2M1KB 1IG5A 1ZUZA 1V1GA 3PFVA 1YX8A 1S6IA 1YURA 3SJSA 4OCIA 4YGDB 2LMUA 1UURA 2K7CA 1AJ4A 3TDZA 1F55A 2V53A 3TUYB 2I18A 3ZWHA 1L2OC 2LVIA 3MSEB 4MZKA 4NDBA 4USLA 3FWBA 1TCFA 4N1FA 5HYDA 1QLKA 1N0YA 1EJ3A 2KSPA 2LVVA 3JTDC 1BR4B 2H61C 2BCXA 3GK4X 5HKWA 3EKJA 2JZIA 1CFFA 1TNPA 2L0PA 1BT6A 4MRYA 4TNCA 2KBMA 1A4PA 1EL4A 1SCVA 2G2BA 1NSHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TCO B;  1XK4 C;  3OB1 B;  4GUK A;  1F70 A;  2L2E A;  3BYA A;  5DKR A;  3DD4 A;  1XFV O;  2QPT A;  1CKK A;  1N2D A;  1DJW A;  1UHK A;  2JXL A;  2WOR A;  1JFK A;  1KFU S;  4M2Q A;  4M2O A;  2M29 A;  3TDU A;  1SCM C;  2KDH A;  1KSM A;  4NQG A;  2D8N A;  2TN4 A;  3LCP C;  2F2O A;  2RGI A;  4OVN F;  3LK1 A;  2BCB A;  5I8N A;  2KGB C;  2F3Z A;  1CMF A;  2HF5 A;  1FI5 A;  2K0J A;  2CNP A;  4CFQ A;  1ZFS A;  5DKQ A;  2BKH B;  2GGM A;  4QJ5 B;  1NUB A;  4JWQ A;  1QIW A;  4DS7 A;  4CLN A;  1K2H A;  4MLW A;  1NPQ A;  3CTN A;  1L2O B;  4HSZ A;  3IQO A;  1WLZ A;  1ALW A;  4BY4 A;  2M97 A;  1YTZ C;  1IRJ A;  3BQ3 A;  4MVF A;  1UHH A;  2AMI A;  2KI4 B;  2Y4Q A;  1A2X A;  2CXJ A;  2LAP A;  4HRH A;  3BUO B;  1KSO A;  1IQ5 A;  3WNX B;  2JTT A;  3C1V A;  1TNX A;  3SIB A;  4D1E A;  3JVT B;  4N1G A;  1AP4 A;  1AVS A;  3OX5 A;  3OB2 B;  2H2K A;  2Y1N A;  1GGZ A;  1TN4 A;  1XFW O;  2MAZ A;  3FIA A;  1OMV A;  1MR8 A;  3DVJ A;  1XO5 A;  5I2Q A;  1K96 A;  4MRX A;  2M7L A;  1Y1X A;  4JQ0 D;  3SG5 A;  2MA2 A;  3AKA A;  2O60 A;  4GAO A;  4XJK A;  1BJF A;  4ORB B;  4PCW A;  1QX5 B;  2HPS A;  1J7R A;  2CBL A;  3NSL A;  1F4Q A;  1YVL A;  2L98 A;  4XJK B;  2BE6 A;  2EGD A;  2BL0 C;  1F54 A;  1TOP A;  5PAL A;  1YUU A;  4I5J A;  2KI6 D;  2M3W A;  5JJG A;  3BXK A;  3PAL A;  3TDI A;  2MLF C;  2WND A;  3IQQ A;  1CDP A;  1PSB A;  4IL1 A;  1LA3 A;  4GGN A;  5AER A;  1S6J A;  1XFZ O;  1DVI A;  1NP8 A;  2M9G A;  2QAC A;  4MN0 A;  1S3P A;  1KFX L;  2BCA A;  1QS7 A;  1A03 A;  1KK7 Y;  1QV1 A;  1DT7 B;  2K7O A;  2F2P A;  1SK6 D;  1M31 A;  4PE7 A;  1OZS A;  4HRE E;  1OMD A;  4XYN A;  2SAS A;  1DJX A;  3E3R A;  1D1O A;  2L4H A;  3NSO A;  1H8B A;  4BY5 A;  2I94 A;  1BR1 B;  1CNP A;  1A75 A;  1AUI B;  1NX2 A;  4YBH B;  1QX7 A;  1AJ5 A;  1NCZ A;  2JT0 A;  3PSR A;  4PDZ A;  1DJH A;  1KK7 Z;  2JNF A;  1A75 B;  2KOT A;  4A4C A;  1CFD A;  4M2P A;  1CDM A;  1Y1U A;  1QTX A;  2JT8 A;  3A8R A;  1DF0 A;  1MF8 B;  2KHN A;  2I7A A;  3AKB A;  2L51 A;  4E68 A;  2Y5I A;  1SL8 A;  5CSF A;  2BL0 B;  1DF0 B;  2KI4 C;  3SG7 A;  3I5G B;  4DIR A;  2FJU B;  1ZOT B;  1B7T Y;  1K95 A;  2BBN A;  2NXQ A;  3JVT C;  1OZO A;  1OMR A;  2KAV A;  1ALV A;  2CCM A;  3VRQ A;  1XFX O;  2WCE A;  5KTY A;  3WHU B;  2MHH A;  2NZ0 A;  1J55 A;  1HT9 A;  2LHI A;  1JBA A;  1PK0 D;  4CPV A;  1YR5 A;  2KNE A;  1PUL A;  1GQM A;  1YUS A;  3BUN B;  3SIA A;  5ER4 X;  2ZRT A;  3DF0 A;  1RWY A;  4AQJ A;  1B7T Z;  1RTP 1;  1TTX A;  1DJI A;  4YGA A;  2A4J A;  1QV0 A;  3DF0 B;  1BLQ A;  1DJY A;  2LC5 A;  4I5K A;  1QX2 A;  2M0R A;  2BKI B;  4YI8 A;  3TS5 B;  1IQ3 A;  2AUC A;  2JT3 A;  2JC2 A;  2LE9 B;  4WQ3 A;  5KSZ A;  2LUX A;  2LLS A;  2OPO A;  4FQO A;  4MSP A;  4OKH A;  1SYM A;  4AOM A;  1AK8 A;  1FBV A;  5TNC A;  3QRX A;  1QIV A;  3CR5 X;  1JUO A;  4DUQ A;  1B8R A;  2EHB A;  1EG4 A;  1F71 A;  1KQV A;  1RJV A;  4PE1 A;  4PAL A;  2JPT A;  2Q4U A;  1SW8 A;  3OHM B;  1U5I A;  2GGZ A;  1CLB A;  1SMG A;  3EK8 A;  3SG3 A;  1MXE A;  2ZNE A;  1NCX A;  5ER5 A;  1U5I B;  1IJ5 A;  2JQ6 A;  5CSJ A;  4C0L A;  2E30 A;  2KFF A;  3NSI A;  4OV2 A;  2LMT A;  3GK1 A;  4GPL B;  5GQQ C;  3BUX B;  1NIW A;  1BOD A;  3KEV A;  1R6P A;  1SR6 B;  2CT9 A;  2LLT A;  4L9M A;  4R1E A;  3KHE A;  1PVA A;  1RK9 A;  4OR9 B;  3LLE A;  2EC6 B;  1JF0 A;  3WHT B;  1BOC A;  1M46 A;  1W7J B;  1VRK A;  2K2A A;  1JSA A;  3DVM A;  4PHK A;  4PHM A;  1LA0 A;  1FF1 A;  4U8D A;  3I5H C;  3I5I C;  1UP5 A;  3EKH A;  4P5O E;  4CFR A;  1UHN A;  3O4Y A;  1ZAC A;  2ZN8 A;  4MZJ A;  1SY9 A;  3A4U B;  3GK2 A;  1L7Z A;  5FYX A;  4DCK A;  1MQ1 A;  2KFG A;  1XA5 A;  4QJ4 B;  4PHJ A;  3I5G C;  2KAX A;  1SRA A;  3M0W A;  2PSR A;  1Y1A A;  5BPJ A;  1J7Q A;  1TNW A;  2KFH A;  3CR2 A;  1FI6 A;  1RFJ A;  3DVE A;  3DVK A;  2MBX A;  5I2O A;  2FCE A;  1CMG A;  1CM4 A;  1S36 A;  4ZCU A;  1GGW A;  1HQV A;  4GBA A;  1H4B A;  1K9P A;  1QVI Y;  4MBE A;  1KK8 B;  2KGR A;  2L5X B;  1MWN A;  1FW4 A;  1WLM A;  1B47 A;  3CZT X;  4QJ3 B;  2I2R E;  1Y0V H;  2ZFD A;  1YVH A;  4F0Z B;  3VRO A;  1XVJ A;  2LLU A;  5D69 A;  1YRU B;  1KCY A;  2LCP A;  5I2L A;  1IKU A;  1PVB A;  1NX3 A;  2NCO A;  5CSI A;  1YRT B;  5D7F A;  1SNL A;  2WCB A;  5DKN A;  3VRR A;  2OTG C;  2L50 A;  2JWW A;  3TS5 C;  1QVI Z;  1CFC A;  1CDL A;  2LVK A;  1WDC B;  2ZRS A;  1MHO A;  1B8C A;  1KQM C;  1WY9 A;  1XYD A;  3I5H B;  2F8P A;  3I5I B;  2LV7 A;  4HRG A;  1DGU A;  1OQP A;  2LVJ A;  2PVB A;  1CLL A;  1NX0 A;  2SCP A;  1PAL A;  1OE9 B;  3O2P A;  5AFP A;  3EVV A;  3KPX A;  4CID A;  5B8I B;  1IGV A;  1DMO A;  3OP0 A;  1KWO C;  4AQI A;  3H4S E;  1S5G Y;  1YUT A;  1SR6 C;  1DJZ A;  4MZL A;  2JTZ A;  4GNK B;  3KF9 A;  1QAT A;  1BF5 A;  3OX6 A;  2EC6 C;  1K94 A;  1CDN A;  1QXP A;  1N65 A;  4YRU A;  1EG3 A;  4ETO A;  5HKY A;  4I5L B;  4Q04 A;  2JU0 A;  2HET A;  2KI6 C;  3D10 A;  2Q91 A;  3D0Y A;  3CR4 X;  3IF7 A;  2ISD A;  2JOJ A;  1B9A A;  2JRF A;  1UHJ A;  1IWQ A;  3O6B A;  3CS1 A;  1JFJ A;  1S5G Z;  4FTG A;  3D0Y B;  2B1U A;  3AAK A;  1RRO A;  1M39 A;  2F3Y A;  2LP3 A;  3KO0 A;  4GGF A;  3PLF B;  3ZNI A;  1DGV A;  1SL9 A;  5AAN A;  1SBJ A;  3LK0 A;  2OTG B;  4ICB A;  2GV5 A;  5CPV A;  2ZND A;  1OOJ A;  3PN7 B;  1MXL C;  1LIN A;  3BOW A;  4NDD A;  1JC2 A;  1G4Y R;  2LUC A;  1KQM B;  1XFY O;  1YX7 A;  2HQW A;  3BOW B;  5HLO A;  3I5F B;  1LVC D;  1IH0 A;  4PE4 A;  4P2Y B;  1KK8 C;  2LMV A;  3SG4 A;  4ZCV A;  5G08 A;  1B1G A;  1QLS A;  2BBM A;  1Q80 A;  1SL7 A;  2KQY A;  2M49 B;  3NXA A;  3VRN A;  2WC8 A;  4I5N B;  1C7W A;  4C0K A;  3K21 A;  1KWO B;  1BG1 A;  1ZMZ A;  2M1U A;  1S6C A;  3EVU A;  3VGO A;  1KFU L;  2AAO A;  1K8U A;  1K90 D;  1UUS A;  1Y6W A;  2JUL A;  3PM8 A;  2CTN A;  2BE4 A;  4N5X A;  1UHI A;  2OS8 C;  5K89 A;  1J1D A;  1WRZ A;  3LL8 B;  1WDC C;  3FS7 A;  1ODB A;  1OSA A;  4YI9 A;  1LXF C;  1CLM A;  5AEQ A;  1S26 D;  2KQ6 A;  1K9K A;  3NSK A;  1J1E A;  2PAS A;  3SG2 A;  1G8I A;  5HKZ A;  1BU3 A;  3CWG A;  2COL B;  2R2I A;  2FOT A;  4A4B A;  3EK4 A;  4JPZ B;  2VRG A;  2JNX A;  1CB1 A;  1BMO A;  2H61 A;  4NDC A;  1TNQ A;  3CGA A;  2Y1M A;  1WRL A;  2K7B A;  5CSN A;  1B8L A;  1IJ6 A;  1NX1 A;  1C7V A;  1B4C A;  3JTD B;  1PSR A;  2KBI A;  3EVR A;  2JXC A;  4PE0 A;  2P6B B;  2KAY A;  3SG6 A;  1CFP A;  2K61 A;  1W7I B;  2KYF A;  2MLE C;  3O78 A;  1X02 A;  3RM1 A;  1QJT A;  1TRF A;  1XK4 A;  3RLZ A;  1EH2 A;  1PRW A;  1M63 B;  1REC A;  1DJG A;  1XFU O;  1K9U A;  2IS9 A;  4ORA B;  1K93 D;  2HQ8 A;  1C07 A;  1A29 A;  2E6W A;  2K2F A;  2LHL A;  2PMY A;  2ZKM X;  1LKJ A;  2M7N A;  4UPG A;  1GJY A;  3TUY C;  1KFX S;  2LNK A;  5AXI A;  1NCY A;  2KYC A;  3F45 A;  4YGB B;  2MJW B;  2WCF A;  3GOF A;  4WRI A;  2WOS A;  2F33 A;  2O5G A;  1QAS A;  1UWO A;  2G9B A;  1SCM B;  2LP2 A;  3PAT A;  2LM5 A;  3TZ1 A;  3AAJ A;  2K7D A;  5JOL A;  4PHN A;  2L4I A;  3HCM A;  1JWD A;  2ZN9 A;  3BUM B;  1R2U A;  1NWD A;  4WQ2 A;  1WRK A;  1CTR A;  4C0J A;  1TIZ A;  3BUW B;  2NLN A;  1AHR A;  4YGE B;  2OS8 B;  4GGF C;  3ICB A;  1SKT A;  3EK7 A;  3PN7 C;  2M8U A;  1NYA A;  1SPY A;  1M45 A;  3CLN A;  5F6T A;  2FCD A;  2PAL A;  4DRW A;  1V1F A;  3I5F C;  2BEC A;  4MEW A;  3VRP A;  3FWC A;  5KU1 A;  4ORC B;  5IBW A;  1J7P A;  1F8H A;  5J3X A;  2NCP A;  2LAN A;  1E8A A;  4YGC B;  5HLV A;  1MUX A;  2DOQ A;  3WXA A;  1S1E A;  2MRD A;  3HX4 A;  1J7O A;  1FPW A;  1G33 A;  4GFT A;  1F4O A;  1DTL A;  2K8M B;  1CM1 A;  1EXR A;  2PRU A;  1JF2 A;  2M1K B;  1IG5 A;  1ZUZ A;  1V1G A;  3PFV A;  1YX8 A;  1S6I A;  1YUR A;  3SJS A;  4OCI A;  4YGD B;  2LMU A;  1UUR A;  2K7C A;  1AJ4 A;  3TDZ A;  1F55 A;  2V53 A;  3TUY B;  2I18 A;  3ZWH A;  1L2O C;  2LVI A;  3MSE B;  4MZK A;  4NDB A;  4USL A;  3FWB A;  1TCF A;  4N1F A;  5HYD A;  1QLK A;  1N0Y A;  1EJ3 A;  2KSP A;  2LVV A;  3JTD C;  1BR4 B;  2H61 C;  2BCX A;  3GK4 X;  5HKW A;  3EKJ A;  2JZI A;  1CFF A;  1TNP A;  2L0P A;  1BT6 A;  4MRY A;  4TNC A;  2KBM A;  1A4P A;  1EL4 A;  1SCV A;  2G2B A;  1NSH A; 
#chains in the Genus database with same CATH topology
 1TCO B;  1XK4 C;  2FJY A;  3S0G A;  3OB1 B;  2QEB A;  4GUK A;  1F70 A;  2L2E A;  3NHT A;  3BYA A;  5DKR A;  3DD4 A;  1XFV O;  2QPT A;  1CKK A;  1N2D A;  1DJW A;  1UHK A;  2JXL A;  2WOR A;  1JFK A;  1KFU S;  3CZ1 A;  4M2Q A;  4M2O A;  2M29 A;  3TDU A;  1SCM C;  2KDH A;  1KSM A;  4NQG A;  2D8N A;  2TN4 A;  3LCP C;  2F2O A;  2RGI A;  4OVN F;  3LK1 A;  2BCB A;  3CYZ A;  5I8N A;  2KGB C;  2F3Z A;  3BJH A;  1CMF A;  2HF5 A;  1FI5 A;  2K0J A;  2CNP A;  4CFQ A;  1ZFS A;  5DKQ A;  2BKH B;  2GGM A;  4QJ5 B;  1OW4 A;  1NUB A;  3BFB A;  4JWQ A;  1QIW A;  4DS7 A;  1XFR A;  4CLN A;  1K2H A;  4MLW A;  1NPQ A;  3CTN A;  1L2O B;  4HSZ A;  3IQO A;  1WLZ A;  1ALW A;  4BY4 A;  2M97 A;  1YTZ C;  1IRJ A;  3BQ3 A;  4MVF A;  1UHH A;  2AMI A;  2KI4 B;  2Y4Q A;  1A2X A;  2CXJ A;  2LAP A;  4HRH A;  3BUO B;  1KSO A;  1IQ5 A;  3WNX B;  2JTT A;  3C1V A;  1TNX A;  3SIB A;  4D1E A;  3JVT B;  4N1G A;  1AP4 A;  3CZ2 A;  1AVS A;  3OX5 A;  3OB2 B;  3CDN A;  2H2K A;  2Y1N A;  1GGZ A;  1TN4 A;  1XFW O;  3L47 A;  3FE6 A;  2MAZ A;  3FIA A;  1OMV A;  1MR8 A;  3DVJ A;  1XO5 A;  5I2Q A;  1K96 A;  3B86 A;  4MRX A;  2M7L A;  1Y1X A;  4JQ0 D;  3SG5 A;  2MA2 A;  3AKA A;  2O60 A;  1OOF A;  4GAO A;  4XJK A;  1BJF A;  4ORB B;  4PCW A;  1QX5 B;  2HPS A;  1J7R A;  2CBL A;  3NSL A;  1F4Q A;  2L2C A;  1YVL A;  2L98 A;  4XJK B;  2BE6 A;  2EGD A;  2BL0 C;  3QME A;  1F54 A;  1TOP A;  5PAL A;  1YUU A;  4I5J A;  2KI6 D;  2M3W A;  2WCM A;  4PT1 A;  2WC6 A;  5JJG A;  3BXK A;  3PAL A;  3TDI A;  2MLF C;  2WND A;  3V2L A;  3IQQ A;  1CDP A;  1PSB A;  3S0D A;  4IL1 A;  1LA3 A;  1T14 A;  3N7H A;  4GGN A;  5AER A;  1S6J A;  1XFZ O;  1DVI A;  1NP8 A;  2M9G A;  2QAC A;  4MN0 A;  1S3P A;  1KFX L;  2BCA A;  1QS7 A;  1A03 A;  1KK7 Y;  1QV1 A;  3S0A A;  1DT7 B;  2K7O A;  2F2P A;  1SK6 D;  1M31 A;  4PE7 A;  1OZS A;  3B87 A;  4HRE E;  1OMD A;  1LS8 A;  4XYN A;  2SAS A;  2QDI A;  1DJX A;  3E3R A;  3VB1 A;  1D1O A;  2L4H A;  3NSO A;  1H8B A;  5DIC A;  4BY5 A;  2I94 A;  1BR1 B;  1CNP A;  1A75 A;  1AUI B;  1NX2 A;  3BFA A;  4YBH B;  1QX7 A;  1AJ5 A;  1NCZ A;  2JT0 A;  3PSR A;  4PDZ A;  1DJH A;  1KK7 Z;  2JNF A;  3R72 A;  1A75 B;  2KOT A;  4A4C A;  1CFD A;  4M2P A;  3UNW A;  1CDM A;  1Y1U A;  1QTX A;  2KLE A;  2JT8 A;  3A8R A;  1DF0 A;  1MF8 B;  2KHN A;  2BNX A;  1Z4H A;  2I7A A;  3AKB A;  2L51 A;  1C3Z A;  3D73 A;  3SS5 A;  4E68 A;  2Y5I A;  1SL8 A;  5CSF A;  2BL0 B;  1DF0 B;  2KI4 C;  3SG7 A;  3I5G B;  4DIR A;  3D78 A;  2FJU B;  1ZOT B;  3R1P A;  1B7T Y;  1K95 A;  2BBN A;  2NXQ A;  3JVT C;  2KLD A;  1OZO A;  1OMR A;  2KAV A;  1ALV A;  3D75 A;  2CCM A;  3VRQ A;  1XFX O;  2WCE A;  5KTY A;  3WHU B;  2MHH A;  2NZ0 A;  1J55 A;  1HT9 A;  2LHI A;  1JBA A;  1PK0 D;  4CPV A;  1YR5 A;  3SS3 A;  2KNE A;  1PUL A;  1GQM A;  1YUS A;  3BUN B;  3SIA A;  2PYQ A;  2P70 A;  5ER4 X;  2ZRT A;  1TUJ A;  1RWY A;  3DF0 A;  4AQJ A;  1B7T Z;  1RTP 1;  1TTX A;  1DJI A;  4YGA A;  2A4J A;  1QV0 A;  3DF0 B;  2WCK A;  1BLQ A;  1DJY A;  2LC5 A;  4I5K A;  1QX2 A;  2M0R A;  2BKI B;  1IIO A;  4YI8 A;  3TS5 B;  1IQ3 A;  2AUC A;  2JT3 A;  2JC2 A;  2LE9 B;  3D76 A;  4WQ3 A;  1OOH A;  1ORG A;  5KSZ A;  2LUX A;  2LLS A;  2OPO A;  4FQO A;  4MSP A;  4OKH A;  1SYM A;  4AOM A;  1AK8 A;  1FBV A;  5TNC A;  3QRX A;  1QIV A;  3CR5 X;  1JUO A;  4DUQ A;  1B8R A;  2EHB A;  1EG4 A;  1F71 A;  1KQV A;  1RJV A;  4PE1 A;  4PAL A;  2JPT A;  2Q4U A;  1SW8 A;  3OHM B;  1U5I A;  2GGZ A;  1CLB A;  1SMG A;  3EK8 A;  3SG3 A;  1MXE A;  2ZNE A;  1NCX A;  5ER5 A;  1U5I B;  1IJ5 A;  2JQ6 A;  3DYE A;  3Q8I A;  2E30 A;  2KFF A;  3NSI A;  4OV2 A;  2LMT A;  3GK1 A;  4GPL B;  5GQQ C;  3BUX B;  1NIW A;  1BOD A;  3KEV A;  1R6P A;  1SR6 B;  2CT9 A;  2BAP A;  2LLT A;  4L9M A;  4OZD A;  4R1E A;  3KHE A;  1PVA A;  1RK9 A;  4OR9 B;  3LLE A;  1TWO A;  2EC6 B;  1JF0 A;  3WHT B;  1BOC A;  1M46 A;  1W7J B;  1VRK A;  2K2A A;  1JSA A;  3DVM A;  4PHK A;  1DEL A;  4PHM A;  1LA0 A;  1FF1 A;  4U8D A;  3I5H C;  3I5I C;  1UP5 A;  3B7A A;  3EKH A;  4P5O E;  4CFR A;  1UHN A;  3O4Y A;  1ZAC A;  2ZN8 A;  4MZJ A;  1SY9 A;  3NHI A;  3A4U B;  3GK2 A;  1L7Z A;  5FYX A;  4DCK A;  1MQ1 A;  2KFG A;  1XA5 A;  4QJ4 B;  4PHJ A;  2QEV A;  3I5G C;  2KAX A;  1SRA A;  3FE8 A;  3M0W A;  4KYN A;  2PSR A;  1Y1A A;  5BPJ A;  1J7Q A;  1TNW A;  2KFH A;  3CR2 A;  3SS4 A;  1P28 A;  3CZ0 A;  1FI6 A;  1RFJ A;  3DVE A;  3DVK A;  2MBX A;  5I2O A;  2FCE A;  1CMG A;  5I94 A;  1CM4 A;  1S36 A;  4ZCU A;  1GGW A;  3L4L A;  1HQV A;  2YGU A;  4GBA A;  1K9P A;  4C0L A;  1H4B A;  1QVI Y;  4MBE A;  1KK8 B;  2KGR A;  2L5X B;  1MWN A;  1FW4 A;  1WLM A;  1B47 A;  3CZT X;  4QJ3 B;  2I2R E;  1Y0V H;  2ZFD A;  3D74 A;  1YVH A;  4F0Z B;  3R1O A;  3VRO A;  1XVJ A;  2LLU A;  5D69 A;  1YRU B;  1KCY A;  2LCP A;  5I2L A;  1IKU A;  1PVB A;  1QWV A;  1NX3 A;  2NCO A;  2P71 A;  1YRT B;  5CSI A;  5D7F A;  1SNL A;  2WCB A;  5DKN A;  3VRR A;  2OTG C;  2L50 A;  2JWW A;  1DQE A;  3TS5 C;  1QVI Z;  3OBV A;  1CFC A;  1CDL A;  2LVK A;  4INW A;  2PQL A;  1WDC B;  4JKT A;  2ZRS A;  1MHO A;  1B8C A;  1KQM C;  1WY9 A;  2H8V A;  3B6X A;  3EG5 B;  1XYD A;  3I5H B;  2ERB A;  2F8P A;  2LV7 A;  3BFH A;  3I5I B;  4HRG A;  1DGU A;  1OQP A;  2LVJ A;  4F7F A;  2PVB A;  1CLL A;  1NX0 A;  2QEO A;  2SCP A;  2WCH A;  1PAL A;  1OE9 B;  3O2P A;  5AFP A;  3EVV A;  2WC5 A;  3KPX A;  4CID A;  5B8I B;  1IGV A;  1DMO A;  3OP0 A;  1KWO C;  3FE9 A;  3DZT A;  1Z2C B;  4AQI A;  3H4S E;  1S5G Y;  1YUT A;  1SR6 C;  1DJZ A;  4MZL A;  2JTZ A;  4GNK B;  3KF9 A;  3S0E A;  1QAT A;  4JD9 A;  1BF5 A;  3OX6 A;  2EC6 C;  1K94 A;  1CDN A;  1QXP A;  1N65 A;  4YRU A;  1EG3 A;  4ETO A;  5HKY A;  4I5L B;  4Q04 A;  2JU0 A;  2HET A;  2KI6 C;  3D10 A;  2Q91 A;  3D0Y A;  3CR4 X;  3IF7 A;  2ISD A;  2JOJ A;  1B9A A;  2JRF A;  1UHJ A;  1IWQ A;  3O6B A;  3CAB A;  3CS1 A;  1JFJ A;  1S5G Z;  3IVT A;  4FTG A;  3D0Y B;  5FI7 A;  2B1U A;  3AAK A;  1RRO A;  1M39 A;  2F3Y A;  2LP3 A;  3KO0 A;  4GGF A;  3PLF B;  3ZNI A;  1DGV A;  2JPO A;  1SL9 A;  5AAN A;  1SBJ A;  2WCL A;  3LK0 A;  2OTG B;  4ICB A;  2GV5 A;  5CPV A;  2ZND A;  1OOJ A;  3PN7 B;  1MXL C;  1LIN A;  3BOW A;  3DY9 A;  4NDD A;  3S0F A;  1JC2 A;  1G4Y R;  2LUC A;  1KQM B;  1XFY O;  1YX7 A;  2HQW A;  2WCJ A;  3BOW B;  5HLO A;  3I5F B;  1LVC D;  1W9Z A;  4PE4 A;  1IH0 A;  4P2Y B;  1KK8 C;  2LMV A;  3SG4 A;  4ZCV A;  5G08 A;  1B1G A;  1QLS A;  2BBM A;  1Q80 A;  1SL7 A;  2KQY A;  2M49 B;  3NXA A;  3VRN A;  2WC8 A;  4I5N B;  1C7W A;  4C0K A;  3K21 A;  1KWO B;  1BG1 A;  1ZMZ A;  2M1U A;  1GM0 A;  1S6C A;  3EVU A;  3VGO A;  1KFU L;  2AAO A;  1K8U A;  1K90 D;  1UUS A;  1Y6W A;  2JUL A;  3PM8 A;  2CTN A;  2BE4 A;  4N5X A;  1UHI A;  2OS8 C;  5K89 A;  1J1D A;  1WRZ A;  3LL8 B;  1WDC C;  3FS7 A;  1ODB A;  3PJI A;  1OSA A;  4YI9 A;  1LXF C;  5EL2 A;  1CLM A;  5AEQ A;  1S26 D;  2KQ6 A;  2K60 A;  1DEK A;  1K9K A;  3NSK A;  1J1E A;  2PAS A;  3SG2 A;  1G8I A;  4IJ7 A;  5HKZ A;  1BU3 A;  3CWG A;  2COL B;  2R2I A;  2FOT A;  3PM2 A;  3EK4 A;  4A4B A;  4JPZ B;  2VRG A;  2JNX A;  1CB1 A;  1BMO A;  2H61 A;  5HL1 A;  4NDC A;  1TNQ A;  3CGA A;  1TUZ A;  2Y1M A;  1WRL A;  2K7B A;  5FI6 A;  2L5Y A;  5CSN A;  1B8L A;  5D3O A;  1IJ6 A;  1NX1 A;  1C7V A;  1B4C A;  3JTD B;  1PSR A;  2KBI A;  3EVR A;  2JXC A;  4PE0 A;  2P6B B;  2KAY A;  3SG6 A;  1CFP A;  2K61 A;  3DXL A;  1W7I B;  2KYF A;  2MLE C;  3O78 A;  1X02 A;  3RM1 A;  1QJT A;  1TRF A;  1XK4 A;  3RLZ A;  1EH2 A;  1PRW A;  1M63 B;  1REC A;  1DJG A;  1XFU O;  1K9U A;  2IS9 A;  3R1V A;  4ORA B;  1K93 D;  2HQ8 A;  1C07 A;  1A29 A;  2E6W A;  2K2F A;  4FQT A;  2LHL A;  2PMY A;  2ZKM X;  1LKJ A;  2M7N A;  4UPG A;  1GJY A;  3TUY C;  1KFX S;  2LNK A;  5AXI A;  3UO9 A;  1NCY A;  2KYC A;  3F45 A;  4YGB B;  2MJW B;  2WCF A;  3GOF A;  4WRI A;  2WOS A;  2F33 A;  1DC1 A;  2O5G A;  3O4X A;  1QAS A;  1UWO A;  2G9B A;  1SCM B;  2LP2 A;  3PAT A;  2LM5 A;  3OGN A;  3AAJ A;  2K7D A;  5JOL A;  3TZ1 A;  4PHN A;  2L4I A;  3HCM A;  1JWD A;  5CSJ A;  2ZN9 A;  3BUM B;  3L4A A;  1R2U A;  1NWD A;  4WQ2 A;  1WRK A;  1CTR A;  1OOG A;  1TIZ A;  4C0J A;  3BUW B;  2NLN A;  1AHR A;  4YGE B;  2OS8 B;  4GGF C;  3ICB A;  3NGV A;  1SKT A;  3EK7 A;  3PN7 C;  2M8U A;  3RZS A;  1NYA A;  1SPY A;  1M45 A;  3CLN A;  5F6T A;  3D77 A;  2FCD A;  2PAL A;  4DRW A;  1V1F A;  3I5F C;  2BEC A;  4MEW A;  3VRP A;  3FWC A;  5KU1 A;  4ORC B;  5IBW A;  1J7P A;  1F8H A;  5J3X A;  2NCP A;  2LAN A;  1E8A A;  4YGC B;  5HLV A;  1MUX A;  2DOQ A;  3WXA A;  1S1E A;  2MRD A;  1SSE B;  3HX4 A;  1J7O A;  3S0B A;  1FPW A;  2QEH A;  1G33 A;  4GFT A;  1F4O A;  1DTL A;  2K8M B;  4INX A;  1CM1 A;  1EXR A;  2PRU A;  1JF2 A;  2M1K B;  1IG5 A;  1ZUZ A;  1V1G A;  3PFV A;  1YX8 A;  1S6I A;  1YUR A;  3SJS A;  4OCI A;  4YGD B;  2LMU A;  1UUR A;  2K7C A;  1AJ4 A;  3TDZ A;  1F55 A;  2V53 A;  3TUY B;  2I18 A;  3ZWH A;  2KPH A;  1L2O C;  2LVI A;  3MSE B;  4MZK A;  4NDB A;  4USL A;  3FWB A;  1TCF A;  4N1F A;  5HYD A;  3K1E A;  3B88 A;  1QLK A;  1N0Y A;  1EJ3 A;  2KSP A;  2LVV A;  3JTD C;  5FI2 A;  1BR4 B;  2H61 C;  2BCX A;  3GK4 X;  5HKW A;  3EKJ A;  2JZI A;  1C3Y A;  1CFF A;  1TNP A;  2GTE A;  2L0P A;  1BT6 A;  4MRY A;  1OOI X;  4TNC A;  2KBM A;  1A4P A;  1EL4 A;  1SCV A;  2G2B A;  1NSH A; 
#chains in the Genus database with same CATH homology
 1TCO B;  1XK4 C;  3OB1 B;  4GUK A;  1F70 A;  2L2E A;  3BYA A;  5DKR A;  3DD4 A;  1XFV O;  2QPT A;  1CKK A;  1N2D A;  1DJW A;  1UHK A;  2JXL A;  2WOR A;  1JFK A;  1KFU S;  4M2Q A;  4M2O A;  2M29 A;  3TDU A;  1SCM C;  2KDH A;  1KSM A;  4NQG A;  2D8N A;  2TN4 A;  3LCP C;  2F2O A;  2RGI A;  4OVN F;  3LK1 A;  2BCB A;  5I8N A;  2KGB C;  2F3Z A;  1CMF A;  2HF5 A;  1FI5 A;  2K0J A;  2CNP A;  4CFQ A;  1ZFS A;  5DKQ A;  2BKH B;  2GGM A;  4QJ5 B;  1NUB A;  4JWQ A;  1QIW A;  4DS7 A;  4CLN A;  1K2H A;  4MLW A;  1NPQ A;  3CTN A;  1L2O B;  4HSZ A;  3IQO A;  1WLZ A;  1ALW A;  4BY4 A;  2M97 A;  1YTZ C;  1IRJ A;  3BQ3 A;  4MVF A;  1UHH A;  2AMI A;  2KI4 B;  2Y4Q A;  1A2X A;  2CXJ A;  2LAP A;  4HRH A;  3BUO B;  1KSO A;  1IQ5 A;  3WNX B;  2JTT A;  3C1V A;  1TNX A;  3SIB A;  4D1E A;  3JVT B;  4N1G A;  1AP4 A;  1AVS A;  3OX5 A;  3OB2 B;  2H2K A;  2Y1N A;  1GGZ A;  1TN4 A;  1XFW O;  2MAZ A;  3FIA A;  1OMV A;  1MR8 A;  3DVJ A;  1XO5 A;  5I2Q A;  1K96 A;  4MRX A;  2M7L A;  1Y1X A;  4JQ0 D;  3SG5 A;  2MA2 A;  3AKA A;  2O60 A;  4GAO A;  4XJK A;  1BJF A;  4ORB B;  4PCW A;  1QX5 B;  2HPS A;  1J7R A;  2CBL A;  3NSL A;  1F4Q A;  1YVL A;  2L98 A;  4XJK B;  2BE6 A;  2EGD A;  2BL0 C;  1F54 A;  1TOP A;  5PAL A;  1YUU A;  4I5J A;  2KI6 D;  2M3W A;  5JJG A;  3BXK A;  3PAL A;  3TDI A;  2MLF C;  2WND A;  3IQQ A;  1CDP A;  1PSB A;  4IL1 A;  1LA3 A;  4GGN A;  5AER A;  1S6J A;  1XFZ O;  1DVI A;  1NP8 A;  2M9G A;  2QAC A;  4MN0 A;  1S3P A;  1KFX L;  2BCA A;  1QS7 A;  1A03 A;  1KK7 Y;  1QV1 A;  1DT7 B;  2K7O A;  2F2P A;  1SK6 D;  1M31 A;  4PE7 A;  1OZS A;  4HRE E;  1OMD A;  4XYN A;  2SAS A;  1DJX A;  3E3R A;  1D1O A;  2L4H A;  3NSO A;  1H8B A;  4BY5 A;  2I94 A;  1BR1 B;  1CNP A;  1A75 A;  1AUI B;  1NX2 A;  4YBH B;  1QX7 A;  1AJ5 A;  1NCZ A;  2JT0 A;  3PSR A;  4PDZ A;  1DJH A;  1KK7 Z;  2JNF A;  1A75 B;  2KOT A;  4A4C A;  1CFD A;  4M2P A;  1CDM A;  1Y1U A;  1QTX A;  2JT8 A;  3A8R A;  1DF0 A;  1MF8 B;  2KHN A;  2I7A A;  3AKB A;  2L51 A;  4E68 A;  2Y5I A;  1SL8 A;  5CSF A;  2BL0 B;  1DF0 B;  2KI4 C;  3SG7 A;  3I5G B;  4DIR A;  2FJU B;  1ZOT B;  1B7T Y;  1K95 A;  2BBN A;  2NXQ A;  3JVT C;  1OZO A;  1OMR A;  2KAV A;  1ALV A;  2CCM A;  3VRQ A;  1XFX O;  2WCE A;  5KTY A;  3WHU B;  2MHH A;  2NZ0 A;  1J55 A;  1HT9 A;  2LHI A;  1JBA A;  1PK0 D;  4CPV A;  1YR5 A;  2KNE A;  1PUL A;  1GQM A;  1YUS A;  3BUN B;  3SIA A;  5ER4 X;  2ZRT A;  3DF0 A;  1RWY A;  4AQJ A;  1B7T Z;  1RTP 1;  1TTX A;  1DJI A;  4YGA A;  2A4J A;  1QV0 A;  3DF0 B;  1BLQ A;  1DJY A;  2LC5 A;  4I5K A;  1QX2 A;  2M0R A;  2BKI B;  4YI8 A;  3TS5 B;  1IQ3 A;  2AUC A;  2JT3 A;  2JC2 A;  2LE9 B;  4WQ3 A;  5KSZ A;  2LUX A;  2LLS A;  2OPO A;  4FQO A;  4MSP A;  4OKH A;  1SYM A;  4AOM A;  1AK8 A;  1FBV A;  5TNC A;  3QRX A;  1QIV A;  3CR5 X;  1JUO A;  4DUQ A;  1B8R A;  2EHB A;  1EG4 A;  1F71 A;  1KQV A;  1RJV A;  4PE1 A;  4PAL A;  2JPT A;  2Q4U A;  1SW8 A;  3OHM B;  1U5I A;  2GGZ A;  1CLB A;  1SMG A;  3EK8 A;  3SG3 A;  1MXE A;  2ZNE A;  1NCX A;  5ER5 A;  1U5I B;  1IJ5 A;  2JQ6 A;  5CSJ A;  4C0L A;  2E30 A;  2KFF A;  3NSI A;  4OV2 A;  2LMT A;  3GK1 A;  4GPL B;  5GQQ C;  3BUX B;  1NIW A;  1BOD A;  3KEV A;  1R6P A;  1SR6 B;  2CT9 A;  2LLT A;  4L9M A;  4R1E A;  3KHE A;  1PVA A;  1RK9 A;  4OR9 B;  3LLE A;  2EC6 B;  1JF0 A;  3WHT B;  1BOC A;  1M46 A;  1W7J B;  1VRK A;  2K2A A;  1JSA A;  3DVM A;  4PHK A;  4PHM A;  1LA0 A;  1FF1 A;  4U8D A;  3I5H C;  3I5I C;  1UP5 A;  3EKH A;  4P5O E;  4CFR A;  1UHN A;  3O4Y A;  1ZAC A;  2ZN8 A;  4MZJ A;  1SY9 A;  3A4U B;  3GK2 A;  1L7Z A;  5FYX A;  4DCK A;  1MQ1 A;  2KFG A;  1XA5 A;  4QJ4 B;  4PHJ A;  3I5G C;  2KAX A;  1SRA A;  3M0W A;  2PSR A;  1Y1A A;  5BPJ A;  1J7Q A;  1TNW A;  2KFH A;  3CR2 A;  1FI6 A;  1RFJ A;  3DVE A;  3DVK A;  2MBX A;  5I2O A;  2FCE A;  1CMG A;  1CM4 A;  1S36 A;  4ZCU A;  1GGW A;  1HQV A;  4GBA A;  1H4B A;  1K9P A;  1QVI Y;  4MBE A;  1KK8 B;  2KGR A;  2L5X B;  1MWN A;  1FW4 A;  1WLM A;  1B47 A;  3CZT X;  4QJ3 B;  2I2R E;  1Y0V H;  2ZFD A;  1YVH A;  4F0Z B;  3VRO A;  1XVJ A;  2LLU A;  5D69 A;  1YRU B;  1KCY A;  2LCP A;  5I2L A;  1IKU A;  1PVB A;  1NX3 A;  2NCO A;  5CSI A;  1YRT B;  5D7F A;  1SNL A;  2WCB A;  5DKN A;  3VRR A;  2OTG C;  2L50 A;  2JWW A;  3TS5 C;  1QVI Z;  1CFC A;  1CDL A;  2LVK A;  1WDC B;  2ZRS A;  1MHO A;  1B8C A;  1KQM C;  1WY9 A;  1XYD A;  3I5H B;  2F8P A;  3I5I B;  2LV7 A;  4HRG A;  1DGU A;  1OQP A;  2LVJ A;  2PVB A;  1CLL A;  1NX0 A;  2SCP A;  1PAL A;  1OE9 B;  3O2P A;  5AFP A;  3EVV A;  3KPX A;  4CID A;  5B8I B;  1IGV A;  1DMO A;  3OP0 A;  1KWO C;  4AQI A;  3H4S E;  1S5G Y;  1YUT A;  1SR6 C;  1DJZ A;  4MZL A;  2JTZ A;  4GNK B;  3KF9 A;  1QAT A;  1BF5 A;  3OX6 A;  2EC6 C;  1K94 A;  1CDN A;  1QXP A;  1N65 A;  4YRU A;  1EG3 A;  4ETO A;  5HKY A;  4I5L B;  4Q04 A;  2JU0 A;  2HET A;  2KI6 C;  3D10 A;  2Q91 A;  3D0Y A;  3CR4 X;  3IF7 A;  2ISD A;  2JOJ A;  1B9A A;  2JRF A;  1UHJ A;  1IWQ A;  3O6B A;  3CS1 A;  1JFJ A;  1S5G Z;  4FTG A;  3D0Y B;  2B1U A;  3AAK A;  1RRO A;  1M39 A;  2F3Y A;  2LP3 A;  3KO0 A;  4GGF A;  3PLF B;  3ZNI A;  1DGV A;  1SL9 A;  5AAN A;  1SBJ A;  3LK0 A;  2OTG B;  4ICB A;  2GV5 A;  5CPV A;  2ZND A;  1OOJ A;  3PN7 B;  1MXL C;  1LIN A;  3BOW A;  4NDD A;  1JC2 A;  1G4Y R;  2LUC A;  1KQM B;  1XFY O;  1YX7 A;  2HQW A;  3BOW B;  5HLO A;  3I5F B;  1LVC D;  1IH0 A;  4PE4 A;  4P2Y B;  1KK8 C;  2LMV A;  3SG4 A;  4ZCV A;  5G08 A;  1B1G A;  1QLS A;  2BBM A;  1Q80 A;  1SL7 A;  2KQY A;  2M49 B;  3NXA A;  3VRN A;  2WC8 A;  4I5N B;  1C7W A;  4C0K A;  3K21 A;  1KWO B;  1BG1 A;  1ZMZ A;  2M1U A;  1S6C A;  3EVU A;  3VGO A;  1KFU L;  2AAO A;  1K8U A;  1K90 D;  1UUS A;  1Y6W A;  2JUL A;  3PM8 A;  2CTN A;  2BE4 A;  4N5X A;  1UHI A;  2OS8 C;  5K89 A;  1J1D A;  1WRZ A;  3LL8 B;  1WDC C;  3FS7 A;  1ODB A;  1OSA A;  4YI9 A;  1LXF C;  1CLM A;  5AEQ A;  1S26 D;  2KQ6 A;  1K9K A;  3NSK A;  1J1E A;  2PAS A;  3SG2 A;  1G8I A;  5HKZ A;  1BU3 A;  3CWG A;  2COL B;  2R2I A;  2FOT A;  4A4B A;  3EK4 A;  4JPZ B;  2VRG A;  2JNX A;  1CB1 A;  1BMO A;  2H61 A;  4NDC A;  1TNQ A;  3CGA A;  2Y1M A;  1WRL A;  2K7B A;  5CSN A;  1B8L A;  1IJ6 A;  1NX1 A;  1C7V A;  1B4C A;  3JTD B;  1PSR A;  2KBI A;  3EVR A;  2JXC A;  4PE0 A;  2P6B B;  2KAY A;  3SG6 A;  1CFP A;  2K61 A;  1W7I B;  2KYF A;  2MLE C;  3O78 A;  1X02 A;  3RM1 A;  1QJT A;  1TRF A;  1XK4 A;  3RLZ A;  1EH2 A;  1PRW A;  1M63 B;  1REC A;  1DJG A;  1XFU O;  1K9U A;  2IS9 A;  4ORA B;  1K93 D;  2HQ8 A;  1C07 A;  1A29 A;  2E6W A;  2K2F A;  2LHL A;  2PMY A;  2ZKM X;  1LKJ A;  2M7N A;  4UPG A;  1GJY A;  3TUY C;  1KFX S;  2LNK A;  5AXI A;  1NCY A;  2KYC A;  3F45 A;  4YGB B;  2MJW B;  2WCF A;  3GOF A;  4WRI A;  2WOS A;  2F33 A;  2O5G A;  1QAS A;  1UWO A;  2G9B A;  1SCM B;  2LP2 A;  3PAT A;  2LM5 A;  3TZ1 A;  3AAJ A;  2K7D A;  5JOL A;  4PHN A;  2L4I A;  3HCM A;  1JWD A;  2ZN9 A;  3BUM B;  1R2U A;  1NWD A;  4WQ2 A;  1WRK A;  1CTR A;  4C0J A;  1TIZ A;  3BUW B;  2NLN A;  1AHR A;  4YGE B;  2OS8 B;  4GGF C;  3ICB A;  1SKT A;  3EK7 A;  3PN7 C;  2M8U A;  1NYA A;  1SPY A;  1M45 A;  3CLN A;  5F6T A;  2FCD A;  2PAL A;  4DRW A;  1V1F A;  3I5F C;  2BEC A;  4MEW A;  3VRP A;  3FWC A;  5KU1 A;  4ORC B;  5IBW A;  1J7P A;  1F8H A;  5J3X A;  2NCP A;  2LAN A;  1E8A A;  4YGC B;  5HLV A;  1MUX A;  2DOQ A;  3WXA A;  1S1E A;  2MRD A;  3HX4 A;  1J7O A;  1FPW A;  1G33 A;  4GFT A;  1F4O A;  1DTL A;  2K8M B;  1CM1 A;  1EXR A;  2PRU A;  1JF2 A;  2M1K B;  1IG5 A;  1ZUZ A;  1V1G A;  3PFV A;  1YX8 A;  1S6I A;  1YUR A;  3SJS A;  4OCI A;  4YGD B;  2LMU A;  1UUR A;  2K7C A;  1AJ4 A;  3TDZ A;  1F55 A;  2V53 A;  3TUY B;  2I18 A;  3ZWH A;  1L2O C;  2LVI A;  3MSE B;  4MZK A;  4NDB A;  4USL A;  3FWB A;  1TCF A;  4N1F A;  5HYD A;  1QLK A;  1N0Y A;  1EJ3 A;  2KSP A;  2LVV A;  3JTD C;  1BR4 B;  2H61 C;  2BCX A;  3GK4 X;  5HKW A;  3EKJ A;  2JZI A;  1CFF A;  1TNP A;  2L0P A;  1BT6 A;  4MRY A;  4TNC A;  2KBM A;  1A4P A;  1EL4 A;  1SCV A;  2G2B A;  1NSH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...