3KF9A

Crystal structure of the sdcen/skmlck complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
149
structure length
149
Chain Sequence
GLTEEQKQEIREAFDLFDTDGSGTIDAKELKVAMRALGFEPKKEEIKKMIADIDKDGSGTIDFEEFLQMMTAKMGERDSREEIMKAFRLFDDDETGKISFKNLKRVAKELGENMTDEELQEMIDEADRDGDGEVNEEEFFRIMKKTSLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caltractin
publication title Structural features of the complexes formed by Scherffelia dubia centrin
rcsb
source organism Scherffelia dubia
molecule tags Cell cycle/calcium-binding protein
total genus 47
structure length 149
sequence length 149
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3kf9A02
1J1DA 3BOWA 5ER4X 1WY9A 1AJ4A 3TUYB 3A8RA 1LA3A 1XK4C 1YUSA 1YTZC 3BOWB 1EH2A 1TNWA 1AHRA 1A2XA 2WCBA 1CFPA 2K7CA 2OPOA 1NX3A 2VRGA 2M9GA 3LLEA 1A75A 3NSIA 4GBAA 1YX7A 1KQMB 2JC2A 3IF7A 1L2OC 4DIRA 1A75B 1JF0A 2BCXA 1U5IB 1M31A 1A29A 1CLLA 1PSRA 3EVVA 2BKIB 2M1KB 2LE9B 3NSKA 2KSPA 2LLUA 4A4CA 1K94A 2JWWA 2LUCA 3CLNA 2JULA 4P5OE 3EKHA 4MRXA 1PVAA 3OB2B 2CCMA 5CPVA 2M8UA 3VRPA 1TCOB 2LHIA 1DJWA 3ZWHA 1WLMA 2NLNA 2NCOA 3DVKA 1M45A 1MF8B 4MSPA 2AAOA 3PFVA 1BG1A 1IKUA 5AEQA 1UHKA 2BE4A 1LKJA 2Y1MA 2JRFA 3VRNA 4M2PA 1FBVA 3PLFB 1OOJA 1R6PA 1SY9A 2L0PA 1KSMA 2DOQA 1NUBA 1Y1AA 1OQPA 1CM1A 1F4OA 1JSAA 2K2FA 1MXLC 1ZMZA 4GGFA 1NIWA 5G08A 4MEWA 1F4QA 3SG3A 2ZRTA 2LVJA 3A4UB 3OX6A 3AKBA 4CPVA 1TNPA 1KWOB 2COLB 4MRYA 1KK8C 4ZCUA 2K0JA 3AAJA 3CS1A 1TRFA 3BYAA 4DCKA 1J7RA 3VROA 4YGBB 3KO0A 2CXJA 1J7PA 4YGEB 1EG4A 2M29A 4U8DA 5AANA 1M63B 3WHUB 2MBXA 3EK7A 3WHTB 1IJ5A 1B8RA 1TNQA 1WDCB 1ALVA 1XYDA 1FPWA 2E6WA 2WCEA 2KFHA 1ODBA 4PE1A 1NX0A 1K9PA 2ZKMX 4C0KA 4E68A 4I5KA 1OMVA 3KPXA 5TNCA 1C7WA 2HF5A 4MVFA 1LINA 2M7LA 2O60A 4GFTA 2JU0A 2KAYA 2NZ0A 1EG3A 3SG5A 1CDMA 1HQVA 4NDBA 1OE9B 3RLZA 1F70A 1ALWA 1UHNA 4OKHA 4YBHB 1J7QA 1SMGA 1FI5A 2KBIA 1PALA 3AAKA 1AP4A 4ETOA 2LNKA 2CTNA 1B8LA 1QASA 3JVTB 1H4BA 2L2EA 1K9KA 3VGOA 2K7OA 3OX5A 2QACA 1NYAA 5HLOA 3I5IC 1CTRA 5I2OA 1AK8A 2MLEC 4MZLA 2Y5IA 3SJSA 3PN7C 3VRRA 1DMOA 3KEVA 2JXCA 1SL8A 2KNEA 1S6CA 1GQMA 3CWGA 1QJTA 3M0WA 4PHKA 4ORBB 4CFRA 2OTGB 2G9BA 1R2UA 2HETA 2L4HA 5PALA 5IBWA 1MHOA 5DKQA 4CIDA 1K2HA 2PASA 1WLZA 4OR9B 2KBMA 2MA2A 3I5IB 2B1UA 2LVVA 2P6BB 5CSFA 1YX8A 1TOPA 3OB1B 4YI8A 1DVIA 3NSLA 1CDNA 1MUXA 3SG6A 1Y1XA 2L98A 3BUMB 3TDZA 2F3ZA 2KYFA 4DUQA 1XFYO 1SBJA 2JT3A 2K8MB 5J3XA 4MLWA 2FCEA 4C0JA 3EVRA 1BODA 1DF0A 2BCBA 5JOLA 3CGAA 1QXPA 3O78A 3EVUA 4ZCVA 2MHHA 2L50A 4WRIA 1AJ5A 1WRZA 4D1EA 2GGMA 1UHJA 1DJIA 1LVCD 1W7JB 1DF0B 2CNPA 4P2YB 5BPJA 2V53A 1LXFC 2IS9A 3DVMA 3FS7A 4NDCA 2LMTA 4GPLB 4Q04A 5GQQC 2JTZA 3TZ1A 2JT8A 3LL8B 1A03A 2O5GA 1E8AA 1MQ1A 1SKTA 1KQVA 1NSHA 2EGDA 3NSOA 1CLBA 3QRXA 1KFUL 2FOTA 2Q4UA 5KU1A 4JWQA 3DVEA 1DTLA 3CTNA 2KAVA 1SNLA 4GNKB 1JF2A 1DGVA 5AFPA 1B47A 4GGFC 1CDLA 1M39A 1KWOC 2JZIA 1KCYA 1DJHA 1QVIY 4HREE 1QX5B 2KQYA 3PALA 4FQOA 4HRHA 1RECA 1UURA 2F33A 1SL7A 1S26D 1QX2A 1CMGA 4WQ2A 2H61A 2BCAA 2K7BA 1RWYA 3FWBA 1UUSA 1QIWA 1CFDA 3I5GB 4I5LB 1XVJA 4QJ5B 1SCVA 1WDCC 4YRUA 4AQIA 3GK2A 3O4YA 1YURA 1HT9A 5CSNA 3BXKA 1B9AA 1NX2A 1EJ3A 3IQQA 4CLNA 3SIAA 2KQ6A 1SR6C 1XFVO 1J7OA 1DJYA 1NCZA 2LV7A 1BU3A 1CDPA 2KOTA 1DJXA 4PHNA 2M49B 1JUOA 2WNDA 1OMRA 1BT6A 2KHNA 2JTTA 1XFZO 1F71A 2K61A 4ORAB 2K7DA 1PSBA 2KYCA 4PALA 3GOFA 3EK8A 4JPZB 3JVTC 1IWQA 4PHMA 1TTXA 1XO5A 2LCPA 2M7NA 3KF9A 1S36A 3IQOA 3E3RA 1SCMB 1SR6B 4N1GA 1IQ3A 2KI6D 2QPTA 3K21A 4OVNF 4PHJA 2M97A 3HX4A 3HCMA 1KFUS 2KI6C 2SASA 1Y1UA 1UWOA 2KI4C 2FCDA 1YUTA 5F6TA 2OTGC 5I2QA 2FJUB 4BY5A 2MRDA 1YVLA 4GAOA 1EL4A 2BKHB 3D0YA 2JT0A 1YRUB 1RJVA 1WRKA 3WXAA 2JNFA 4TNCA 2MAZA 4C0LA 4M2QA 3D0YB 2AMIA 2HQWA 2OS8C 1H8BA 2NCPA 2ZNDA 1N65A 2F2OA 1K90D 1EXRA 3F45A 4MN0A 2RGIA 5AERA 2KI4B 1UP5A 3GK4X 2CBLA 3D10A 3I5FC 1TIZA 1QVIZ 2L5XB 5DKRA 5K89A 2PMYA 1QLSA 2SCPA 1B8CA 1KK7Y 2I18A 1CNPA 1XFXO 1OZOA 5HYDA 1K93D 5CSJA 2HQ8A 2LVKA 2LLSA 4HSZA 4BY4A 2OS8B 1XFWO 1BJFA 3BQ3A 5HLVA 4JQ0D 1GJYA 5CSIA 1F55A 1CMFA 1QV1A 2M0RA 3C1VA 3DD4A 2KDHA 4WQ3A 3WNXB 1QX7A 2EHBA 3EKJA 2ZN9A 3I5FB 1Q80A 1QATA 3KHEA 1BLQA 1L7ZA 4L9MA 1IQ5A 3CR5X 5B8IB 4GGNA 1FW4A 2M1UA 2JPTA 3LCPC 2E30A 3GK1A 1NCXA 1QIVA 1CLMA 3O6BA 1J55A 1G4YR 1V1FA 2LM5A 2R2IA 2ZNEA 4OV2A 5I2LA 3SIBA 4XJKA 1SK6D 1OZSA 1B1GA 4HRGA 2LMVA 1D1OA 4XJKB 2PVBA 4NDDA 1JFKA 2F2PA 2LLTA 4I5JA 2F3YA 1SYMA 1NX1A 3H4SE 2I2RE 3I5GC 4R1EA 2H61C 2JNXA 1YRTB 3NXAA 3CZTX 1RK9A 4PDZA 2LC5A 1IRJA 1XFUO 1NCYA 5DKNA 4DS7A 1U5IA 1A4PA 2CT9A 2LANA 1MR8A 2LAPA 2G2BA 3I5HC 5FYXA 2BBNA 2D8NA 1TNXA 1XK4A 4IL1A 3AKAA 3BUXB 1NP8A 2LP2A 1DJZA 1ZACA 5AXIA 1CKKA 2LVIA 1GGWA 2TN4A 1K95A 1N0YA 2ZRSA 1KK7Z 1SPYA 1PRWA 1Y6WA 1TCFA 2JQ6A 4N5XA 5JJGA 4QJ4B 2PALA 2Y1NA 1SW8A 1TN4A 3PSRA 1K9UA 3I5HB 1SCMC 1L2OB 1PULA 4CFQA 1WRLA 4YGCB 1ZFSA 2I94A 3TDUA 3BUWB 2NXQA 1OMDA 1PVBA 1UHHA 2WOSA 3FWCA 5D69A 5HKWA 1FI6A 4M2OA 1DT7B 1CFCA 1S5GY 4DRWA 2L4IA 1B7TY 1CM4A 3PM8A 1S6JA 4YGDB 1BF5A 1SRAA 2GV5A 1BOCA 2HPSA 1XA5A 1BMOA 2JXLA 2LUXA 3O2PA 5HKZA 2BECA 1FF1A 4PE7A 3EK4A 1RROA 2AUCA 1KFXL 2H2KA 1S3PA 2WORA 2MJWB 1IGVA 2K2AA 2LP3A 4PCWA 2PRUA 2Y4QA 4PE0A 1BR1B 1JC2A 3SG4A 1PK0D 1QTXA 3LK1A 1G33A 1IH0A 2ISDA 5KTYA 1C07A 1MWNA 2A4JA 2Q91A 1YR5A 3OP0A 2F8PA 3RM1A 1X02A 3MSEB 1C7VA 2KAXA 3JTDC 1IG5A 4FTGA 1F8HA 1MXEA 1KK8B 2GGZA 3TDIA 2I7AA 5ER5A 4MZKA 2KFGA 2L51A 1CB1A 1ZOTB 2ZN8A 1DGUA 1DJGA 3TS5C 4AQJA 1S1EA 4I5NB 1LA0A 3SG7A 2ZFDA 2KGRA 1V1GA 4YGAA 4GUKA 2KGBC 1AUIB 4AOMA 1B4CA 1W7IB 1QS7A 1RFJA 3LK0A 1F54A 3JTDB 1M46A 1JBAA 4A4BA 4OCIA 4YI9A 4UPGA 1IJ6A 2JOJA 2LMUA 5D7FA 4MBEA 4MZJA 3TS5B 1NPQA 3FIAA 4NQGA 5I8NA 3OHMB 1JWDA 1ZUZA 2EC6C 2BL0C 2MLFC 3SG2A 4USLA 3CR2A 4QJ3B 1KSOA 4XYNA 2PSRA 1UHIA 1J1EA 3PATA 3TUYC 1N2DA 1RTP1 5HKYA 3DVJA 1OSAA 3CR4X 1QLKA 1S6IA 4N1FA 1JFJA 1NWDA 2WC8A 2WCFA 1VRKA 3ICBA 4ICBA 4F0ZB 1BR4B 3DF0A 1YVHA 1AVSA 2LHLA 1KFXS 1G8IA 1GGZA 1S5GZ 1SL9A 3PN7B 5KSZA 3DF0B 2BBMA 3BUOB 4PE4A 1B7TZ 1KQMC 2EC6B 2M3WA 4ORCB 3BUNB 3VRQA 1K8UA 2BL0B 1QV0A 2BE6A 1K96A 1YUUA 2KFFA 1CFFA 1Y0VH 3ZNIA
chains in the Genus database with same CATH superfamily
1J1DA 3BOWA 5ER4X 1WY9A 1AJ4A 3TUYB 3A8RA 1LA3A 1XK4C 1YUSA 1YTZC 3BOWB 1EH2A 1TNWA 1AHRA 1A2XA 2WCBA 1CFPA 2K7CA 2KPHA 2OPOA 1NX3A 2VRGA 3UO9A 2M9GA 3LLEA 1A75A 3NSIA 4GBAA 1YX7A 1KQMB 2JC2A 1DC1A 3IF7A 1L2OC 4DIRA 1A75B 1JF0A 2BCXA 1U5IB 1M31A 1A29A 1CLLA 1PSRA 3EVVA 3SS3A 1ORGA 2BKIB 2M1KB 2LE9B 3NSKA 2KSPA 2LLUA 3NGVA 2BNXA 4A4CA 1K94A 2JWWA 2LUCA 3CLNA 2JULA 3NHTA 4P5OE 3EKHA 4MRXA 1PVAA 3OB2B 2CCMA 5CPVA 2M8UA 3VRPA 1TCOB 2LHIA 1DJWA 3ZWHA 1WLMA 2L2CA 2NCOA 2NLNA 3DVKA 1M45A 1MF8B 4MSPA 2AAOA 3PFVA 1BG1A 1IKUA 5AEQA 1DEKA 1UHKA 1LKJA 2BE4A 2Y1MA 2JRFA 3VRNA 2WCLA 4M2PA 1FBVA 3PLFB 1OOJA 1R6PA 1SY9A 2L0PA 1KSMA 2DOQA 1NUBA 1Y1AA 1OQPA 1CM1A 1F4OA 4IJ7A 1JSAA 2K2FA 1MXLC 3BFAA 1ZMZA 4GGFA 1NIWA 5G08A 4MEWA 1F4QA 3SG3A 2ZRTA 2LVJA 3A4UB 3OX6A 3AKBA 4CPVA 1TNPA 1KWOB 2COLB 4MRYA 1KK8C 4ZCUA 2K0JA 3AAJA 3CS1A 1TRFA 3BYAA 4DCKA 1J7RA 3VROA 4YGBB 3KO0A 2CXJA 1J7PA 4YGEB 1EG4A 2M29A 4U8DA 5AANA 4FQTA 3UNWA 1M63B 3WHUB 2MBXA 3EK7A 3WHTB 1IJ5A 1B8RA 1TNQA 1WDCB 1ALVA 1XYDA 1FPWA 3B6XA 2E6WA 2WCEA 2KFHA 1ODBA 4PE1A 1NX0A 1K9PA 2ZKMX 4C0KA 4E68A 1IIOA 2K60A 4I5KA 1OMVA 3KPXA 2FJYA 3D73A 5TNCA 1C7WA 3B86A 2HF5A 4MVFA 1LINA 2M7LA 2O60A 4GFTA 2JU0A 2KAYA 2NZ0A 4OZDA 1EG3A 3SG5A 1CDMA 1TWOA 1HQVA 4NDBA 1OE9B 3RLZA 1F70A 1ALWA 1UHNA 5EL2A 4OKHA 4YBHB 1J7QA 1SMGA 1FI5A 2KBIA 1PALA 3AAKA 3CYZA 3EG5B 3FE6A 1AP4A 1C3ZA 4ETOA 2LNKA 2CTNA 1B8LA 1QASA 3JVTB 3D76A 1H4BA 2L2EA 1K9KA 3VGOA 2K7OA 3OX5A 2QACA 1NYAA 5HLOA 3I5IC 1CTRA 5I2OA 1AK8A 2MLEC 3B88A 4MZLA 2Y5IA 3SJSA 3PN7C 3VRRA 1DELA 1DMOA 3KEVA 2JXCA 1SL8A 2KNEA 1S6CA 1GQMA 3CWGA 1QJTA 3M0WA 4PHKA 4ORBB 4CFRA 2OTGB 2G9BA 3NHIA 1R2UA 2HETA 2L4HA 5PALA 3VB1A 5IBWA 1MHOA 5DKQA 4CIDA 1K2HA 2P71A 2PASA 1WLZA 4OR9B 2KBMA 2MA2A 4F7FA 3I5IB 2B1UA 2LVVA 2P6BB 3QMEA 5CSFA 1YX8A 2QEHA 1TOPA 3OB1B 4YI8A 1DVIA 3NSLA 1CDNA 1MUXA 3SG6A 1Y1XA 2L98A 3BFBA 3BUMB 2F3ZA 2KYFA 3TDZA 4DUQA 2KLEA 1XFYO 5FI7A 1SBJA 1OOIX 2JT3A 2K8MB 3L47A 4MLWA 5J3XA 2FCEA 4C0JA 3EVRA 1BODA 1DF0A 2BCBA 5JOLA 3CGAA 1QXPA 3O78A 3EVUA 1LS8A 2MHHA 2L50A 4WRIA 1AJ5A 1WRZA 4ZCVA 2GGMA 1UHJA 1DJIA 4D1EA 1LVCD 1W7JB 1DF0B 2CNPA 3O4XA 4P2YB 5BPJA 2V53A 1LXFC 1XFRA 2IS9A 3DVMA 3FS7A 4NDCA 2LMTA 4GPLB 4Q04A 5GQQC 2JTZA 3TZ1A 2JT8A 3LL8B 1CFFA 1A03A 2O5GA 2PQLA 1E8AA 1MQ1A 1SKTA 3RZSA 1KQVA 1NSHA 2EGDA 3D74A 3NSOA 1CLBA 3D75A 3QRXA 1KFUL 2FOTA 2Q4UA 3DZTA 5KU1A 4JWQA 3DVEA 1DTLA 3CTNA 1GM0A 2KAVA 1SNLA 4GNKB 3S0BA 1JF2A 1DGVA 5AFPA 3FE9A 1B47A 4GGFC 1CDLA 1M39A 1KWOC 2JZIA 3DYEA 1KCYA 1DJHA 1QVIY 4HREE 1QX5B 2KQYA 3PALA 4FQOA 4HRHA 1RECA 1UURA 2F33A 1SL7A 3S0FA 1S26D 1QX2A 1CMGA 4WQ2A 2H61A 2BCAA 2K7BA 1RWYA 3FWBA 1UUSA 1QIWA 1CFDA 3I5GB 4I5LB 1XVJA 4QJ5B 1SCVA 1WDCC 1DQEA 4YRUA 1OW4A 3GK2A 3O4YA 1YURA 5FI2A 4AQIA 1HT9A 5CSNA 3BXKA 1B9AA 1NX2A 1EJ3A 3IQQA 4CLNA 3SIAA 1C3YA 3CZ1A 2KQ6A 1SR6C 1XFVO 1J7OA 1DJYA 1NCZA 2LV7A 1BU3A 1CDPA 4PT1A 2KOTA 1DJXA 4PHNA 2M49B 1JUOA 2WNDA 1OMRA 1BT6A 2KHNA 5I94A 2JTTA 1XFZO 2WC6A 1F71A 2K61A 4ORAB 2K7DA 1PSBA 2KYCA 4PALA 3GOFA 2WCKA 3EK8A 4JPZB 3JVTC 1IWQA 4PHMA 1TTXA 1XO5A 2LCPA 2M7NA 3KF9A 1S36A 3IQOA 3E3RA 1SCMB 1SR6B 2BAPA 4N1GA 2KI6D 2QPTA 1IQ3A 3K21A 4OVNF 4PHJA 2M97A 3HX4A 3HCMA 1KFUS 2KI6C 2SASA 1Y1UA 1UWOA 2KI4C 4INXA 2FCDA 1YUTA 5F6TA 2OTGC 3L4AA 5I2QA 2FJUB 4BY5A 2MRDA 1YVLA 4GAOA 4JKTA 1EL4A 2BKHB 3D0YA 3D78A 2JT0A 1YRUB 1RJVA 1WRKA 3N7HA 2JNFA 3R72A 4TNCA 2MAZA 3WXAA 4C0LA 2P70A 4M2QA 3D0YB 2AMIA 2HQWA 2OS8C 1H8BA 2NCPA 2ZNDA 1N65A 2F2OA 1K90D 1EXRA 3F45A 4MN0A 2RGIA 5AERA 2KI4B 1UP5A 3GK4X 2CBLA 3D10A 3OBVA 3I5FC 1TIZA 1QVIZ 2L5XB 5DKRA 5K89A 2PMYA 1QLSA 2SCPA 3Q8IA 1B8CA 1KK7Y 2I18A 1CNPA 1XFXO 1OZOA 5HYDA 1K93D 2QEBA 5CSJA 2HQ8A 2LVKA 3L4LA 2LLSA 4HSZA 4BY4A 2L5YA 2OS8B 1XFWO 1BJFA 3BQ3A 5HLVA 4JQ0D 1GJYA 5CSIA 1F55A 1CMFA 1QV1A 2M0RA 3C1VA 3DD4A 2KDHA 4WQ3A 3OGNA 3WNXB 1QX7A 2EHBA 3EKJA 2ZN9A 3I5FB 1Q80A 1QATA 3KHEA 3SS4A 2WCJA 1BLQA 1L7ZA 4L9MA 1IQ5A 3CR5X 5B8IB 4GGNA 1FW4A 2M1UA 2JPTA 3LCPC 2E30A 3GK1A 1NCXA 1QIVA 1CLMA 3O6BA 1J55A 1G4YR 1V1FA 2LM5A 2R2IA 2ZNEA 4OV2A 5I2LA 3SIBA 4XJKA 1SK6D 1OZSA 1B1GA 1OOGA 4HRGA 2LMVA 1D1OA 4XJKB 2PVBA 2WCHA 3S0DA 4NDDA 3BJHA 2GTEA 1JFKA 2F2PA 2LLTA 4I5JA 2F3YA 1SYMA 3S0AA 1NX1A 3H4SE 2I2RE 3I5GC 3R1VA 3B87A 2H61C 2JNXA 4R1EA 2QEOA 1YRTB 3NXAA 1W9ZA 3CZTX 1RK9A 4PDZA 2LC5A 3K1EA 1IRJA 1XFUO 1NCYA 1TUJA 2PYQA 1U5IA 1A4PA 2CT9A 2LANA 1MR8A 2LAPA 5DKNA 4DS7A 2G2BA 3I5HC 5FYXA 2BBNA 2D8NA 5DICA 1TNXA 1XK4A 1T14A 3R1PA 4IL1A 3AKAA 3BUXB 1NP8A 2LP2A 1DJZA 1ZACA 5AXIA 1CKKA 3DY9A 2LVIA 3CDNA 2TN4A 1K95A 1N0YA 1GGWA 2ZRSA 3D77A 1KK7Z 1SPYA 1PRWA 1Y6WA 1TCFA 2JQ6A 4N5XA 5JJGA 3PJIA 4QJ4B 2PALA 2Y1NA 1SW8A 1TN4A 3PSRA 1K9UA 3I5HB 1SCMC 1L2OB 1PULA 4CFQA 1WRLA 4YGCB 1OOFA 1ZFSA 2I94A 3IVTA 3BUWB 3TDUA 2NXQA 3FE8A 1OMDA 1PVBA 1UHHA 2QEVA 2WOSA 2JPOA 3FWCA 5D69A 5HKWA 1FI6A 4M2OA 1DT7B 1CFCA 1S5GY 4DRWA 3PM2A 3V2LA 2ERBA 2QDIA 2L4IA 4INWA 1B7TY 1CM4A 3PM8A 1S6JA 4YGDB 1BF5A 1SRAA 2GV5A 1BOCA 1F8HA 2HPSA 1XA5A 1BMOA 2JXLA 2LUXA 3O2PA 5HKZA 2BECA 1FF1A 4PE7A 3EK4A 1RROA 2AUCA 1KFXL 2H2KA 1S3PA 2WORA 2MJWB 1IGVA 2K2AA 1Z4HA 2LP3A 4PCWA 1P28A 2PRUA 2Y4QA 4PE0A 1BR1B 5D3OA 1JC2A 3SG4A 1PK0D 1QTXA 3LK1A 1G33A 1IH0A 2ISDA 1OOHA 5KTYA 1C07A 1MWNA 2A4JA 2Q91A 1YR5A 3OP0A 2F8PA 3RM1A 1QWVA 1X02A 3MSEB 5FI6A 1C7VA 2KAXA 3JTDC 1IG5A 1TUZA 2WCMA 1MXEA 1KK8B 2GGZA 4FTGA 2I7AA 5ER5A 3SS5A 3CZ2A 2KFGA 4MZKA 2L51A 3CABA 3TDIA 1CB1A 1ZOTB 2ZN8A 1DGUA 1DJGA 3TS5C 3S0GA 4AQJA 1S1EA 4I5NB 1LA0A 3SG7A 2ZFDA 3BFHA 2KGRA 1V1GA 4YGAA 4GUKA 2KGBC 1AUIB 4JD9A 4AOMA 1B4CA 1W7IB 1QS7A 1RFJA 3LK0A 1F54A 3JTDB 1M46A 3CZ0A 3DXLA 4A4BA 1JBAA 4OCIA 4YI9A 3R1OA 4UPGA 1IJ6A 2JOJA 2LMUA 5D7FA 4MBEA 1SSEB 4MZJA 3TS5B 1NPQA 3FIAA 4NQGA 5I8NA 3OHMB 1JWDA 1ZUZA 2EC6C 4KYNA 2BL0C 2MLFC 3SG2A 4USLA 3CR2A 4QJ3B 1KSOA 4XYNA 2PSRA 1UHIA 1J1EA 3PATA 3TUYC 1N2DA 1RTP1 5HKYA 3DVJA 1OSAA 3CR4X 1QLKA 1S6IA 4N1FA 1JFJA 1NWDA 2WC8A 2KLDA 1VRKA 2WCFA 3ICBA 4ICBA 4F0ZB 1BR4B 3DF0A 1YVHA 1Z2CB 2H8VA 5HL1A 1AVSA 2LHLA 1KFXS 1G8IA 1GGZA 1S5GZ 1SL9A 3PN7B 5KSZA 3DF0B 3S0EA 2BBMA 3BUOB 4PE4A 1B7TZ 1KQMC 2EC6B 2M3WA 4ORCB 3BUNB 3VRQA 1K8UA 2BL0B 1QV0A 2BE6A 1K96A 1YUUA 2KFFA 2YGUA 2WC5A 3B7AA 1Y0VH 3ZNIA
chains in the Genus database with same CATH topology
1J1DA 3BOWA 5ER4X 1WY9A 1AJ4A 3TUYB 3A8RA 1LA3A 1XK4C 1YUSA 1YTZC 3BOWB 1EH2A 1TNWA 1AHRA 1A2XA 2WCBA 1CFPA 2K7CA 2OPOA 1NX3A 2VRGA 2M9GA 3LLEA 1A75A 3NSIA 4GBAA 1YX7A 1KQMB 2JC2A 3IF7A 1L2OC 4DIRA 1A75B 1JF0A 2BCXA 1U5IB 1M31A 1A29A 1CLLA 1PSRA 3EVVA 2BKIB 2M1KB 2LE9B 3NSKA 2KSPA 2LLUA 4A4CA 1K94A 2JWWA 2LUCA 3CLNA 2JULA 4P5OE 3EKHA 4MRXA 1PVAA 3OB2B 2CCMA 5CPVA 2M8UA 3VRPA 1TCOB 2LHIA 1DJWA 3ZWHA 1WLMA 2NLNA 2NCOA 3DVKA 1M45A 1MF8B 4MSPA 2AAOA 3PFVA 1BG1A 1IKUA 5AEQA 1UHKA 2BE4A 1LKJA 2Y1MA 2JRFA 3VRNA 4M2PA 1FBVA 3PLFB 1OOJA 1R6PA 1SY9A 2L0PA 1KSMA 2DOQA 1NUBA 1Y1AA 1OQPA 1CM1A 1F4OA 1JSAA 2K2FA 1MXLC 1ZMZA 4GGFA 1NIWA 5G08A 4MEWA 1F4QA 3SG3A 2ZRTA 2LVJA 3A4UB 3OX6A 3AKBA 4CPVA 1TNPA 1KWOB 2COLB 4MRYA 1KK8C 4ZCUA 2K0JA 3AAJA 3CS1A 1TRFA 3BYAA 4DCKA 1J7RA 3VROA 4YGBB 3KO0A 2CXJA 1J7PA 4YGEB 1EG4A 2M29A 4U8DA 5AANA 1M63B 3WHUB 2MBXA 3EK7A 3WHTB 1IJ5A 1B8RA 1TNQA 1WDCB 1ALVA 1XYDA 1FPWA 2E6WA 2WCEA 2KFHA 1ODBA 4PE1A 1NX0A 1K9PA 2ZKMX 4C0KA 4E68A 4I5KA 1OMVA 3KPXA 5TNCA 1C7WA 2HF5A 4MVFA 1LINA 2M7LA 2O60A 4GFTA 2JU0A 2KAYA 2NZ0A 1EG3A 3SG5A 1CDMA 1HQVA 4NDBA 1OE9B 3RLZA 1F70A 1ALWA 1UHNA 4OKHA 4YBHB 1J7QA 1SMGA 1FI5A 2KBIA 1PALA 3AAKA 1AP4A 4ETOA 2LNKA 2CTNA 1B8LA 1QASA 3JVTB 1H4BA 2L2EA 1K9KA 3VGOA 2K7OA 3OX5A 2QACA 1NYAA 5HLOA 3I5IC 1CTRA 5I2OA 1AK8A 2MLEC 4MZLA 2Y5IA 3SJSA 3PN7C 3VRRA 1DMOA 3KEVA 2JXCA 1SL8A 2KNEA 1S6CA 1GQMA 3CWGA 1QJTA 3M0WA 4PHKA 4ORBB 4CFRA 2OTGB 2G9BA 1R2UA 2HETA 2L4HA 5PALA 5IBWA 1MHOA 5DKQA 4CIDA 1K2HA 2PASA 1WLZA 4OR9B 2KBMA 2MA2A 3I5IB 2B1UA 2LVVA 2P6BB 5CSFA 1YX8A 1TOPA 3OB1B 4YI8A 1DVIA 3NSLA 1CDNA 1MUXA 3SG6A 1Y1XA 2L98A 3BUMB 3TDZA 2F3ZA 2KYFA 4DUQA 1XFYO 1SBJA 2JT3A 2K8MB 5J3XA 4MLWA 2FCEA 4C0JA 3EVRA 1BODA 1DF0A 2BCBA 5JOLA 3CGAA 1QXPA 3O78A 3EVUA 4ZCVA 2MHHA 2L50A 4WRIA 1AJ5A 1WRZA 4D1EA 2GGMA 1UHJA 1DJIA 1LVCD 1W7JB 1DF0B 2CNPA 4P2YB 5BPJA 2V53A 1LXFC 2IS9A 3DVMA 3FS7A 4NDCA 2LMTA 4GPLB 4Q04A 5GQQC 2JTZA 3TZ1A 2JT8A 3LL8B 1A03A 2O5GA 1E8AA 1MQ1A 1SKTA 1KQVA 1NSHA 2EGDA 3NSOA 1CLBA 3QRXA 1KFUL 2FOTA 2Q4UA 5KU1A 4JWQA 3DVEA 1DTLA 3CTNA 2KAVA 1SNLA 4GNKB 1JF2A 1DGVA 5AFPA 1B47A 4GGFC 1CDLA 1M39A 1KWOC 2JZIA 1KCYA 1DJHA 1QVIY 4HREE 1QX5B 2KQYA 3PALA 4FQOA 4HRHA 1RECA 1UURA 2F33A 1SL7A 1S26D 1QX2A 1CMGA 4WQ2A 2H61A 2BCAA 2K7BA 1RWYA 3FWBA 1UUSA 1QIWA 1CFDA 3I5GB 4I5LB 1XVJA 4QJ5B 1SCVA 1WDCC 4YRUA 4AQIA 3GK2A 3O4YA 1YURA 1HT9A 5CSNA 3BXKA 1B9AA 1NX2A 1EJ3A 3IQQA 4CLNA 3SIAA 2KQ6A 1SR6C 1XFVO 1J7OA 1DJYA 1NCZA 2LV7A 1BU3A 1CDPA 2KOTA 1DJXA 4PHNA 2M49B 1JUOA 2WNDA 1OMRA 1BT6A 2KHNA 2JTTA 1XFZO 1F71A 2K61A 4ORAB 2K7DA 1PSBA 2KYCA 4PALA 3GOFA 3EK8A 4JPZB 3JVTC 1IWQA 4PHMA 1TTXA 1XO5A 2LCPA 2M7NA 3KF9A 1S36A 3IQOA 3E3RA 1SCMB 1SR6B 4N1GA 1IQ3A 2KI6D 2QPTA 3K21A 4OVNF 4PHJA 2M97A 3HX4A 3HCMA 1KFUS 2KI6C 2SASA 1Y1UA 1UWOA 2KI4C 2FCDA 1YUTA 5F6TA 2OTGC 5I2QA 2FJUB 4BY5A 2MRDA 1YVLA 4GAOA 1EL4A 2BKHB 3D0YA 2JT0A 1YRUB 1RJVA 1WRKA 3WXAA 2JNFA 4TNCA 2MAZA 4C0LA 4M2QA 3D0YB 2AMIA 2HQWA 2OS8C 1H8BA 2NCPA 2ZNDA 1N65A 2F2OA 1K90D 1EXRA 3F45A 4MN0A 2RGIA 5AERA 2KI4B 1UP5A 3GK4X 2CBLA 3D10A 3I5FC 1TIZA 1QVIZ 2L5XB 5DKRA 5K89A 2PMYA 1QLSA 2SCPA 1B8CA 1KK7Y 2I18A 1CNPA 1XFXO 1OZOA 5HYDA 1K93D 5CSJA 2HQ8A 2LVKA 2LLSA 4HSZA 4BY4A 2OS8B 1XFWO 1BJFA 3BQ3A 5HLVA 4JQ0D 1GJYA 5CSIA 1F55A 1CMFA 1QV1A 2M0RA 3C1VA 3DD4A 2KDHA 4WQ3A 3WNXB 1QX7A 2EHBA 3EKJA 2ZN9A 3I5FB 1Q80A 1QATA 3KHEA 1BLQA 1L7ZA 4L9MA 1IQ5A 3CR5X 5B8IB 4GGNA 1FW4A 2M1UA 2JPTA 3LCPC 2E30A 3GK1A 1NCXA 1QIVA 1CLMA 3O6BA 1J55A 1G4YR 1V1FA 2LM5A 2R2IA 2ZNEA 4OV2A 5I2LA 3SIBA 4XJKA 1SK6D 1OZSA 1B1GA 4HRGA 2LMVA 1D1OA 4XJKB 2PVBA 4NDDA 1JFKA 2F2PA 2LLTA 4I5JA 2F3YA 1SYMA 1NX1A 3H4SE 2I2RE 3I5GC 4R1EA 2H61C 2JNXA 1YRTB 3NXAA 3CZTX 1RK9A 4PDZA 2LC5A 1IRJA 1XFUO 1NCYA 5DKNA 4DS7A 1U5IA 1A4PA 2CT9A 2LANA 1MR8A 2LAPA 2G2BA 3I5HC 5FYXA 2BBNA 2D8NA 1TNXA 1XK4A 4IL1A 3AKAA 3BUXB 1NP8A 2LP2A 1DJZA 1ZACA 5AXIA 1CKKA 2LVIA 1GGWA 2TN4A 1K95A 1N0YA 2ZRSA 1KK7Z 1SPYA 1PRWA 1Y6WA 1TCFA 2JQ6A 4N5XA 5JJGA 4QJ4B 2PALA 2Y1NA 1SW8A 1TN4A 3PSRA 1K9UA 3I5HB 1SCMC 1L2OB 1PULA 4CFQA 1WRLA 4YGCB 1ZFSA 2I94A 3TDUA 3BUWB 2NXQA 1OMDA 1PVBA 1UHHA 2WOSA 3FWCA 5D69A 5HKWA 1FI6A 4M2OA 1DT7B 1CFCA 1S5GY 4DRWA 2L4IA 1B7TY 1CM4A 3PM8A 1S6JA 4YGDB 1BF5A 1SRAA 2GV5A 1BOCA 2HPSA 1XA5A 1BMOA 2JXLA 2LUXA 3O2PA 5HKZA 2BECA 1FF1A 4PE7A 3EK4A 1RROA 2AUCA 1KFXL 2H2KA 1S3PA 2WORA 2MJWB 1IGVA 2K2AA 2LP3A 4PCWA 2PRUA 2Y4QA 4PE0A 1BR1B 1JC2A 3SG4A 1PK0D 1QTXA 3LK1A 1G33A 1IH0A 2ISDA 5KTYA 1C07A 1MWNA 2A4JA 2Q91A 1YR5A 3OP0A 2F8PA 3RM1A 1X02A 3MSEB 1C7VA 2KAXA 3JTDC 1IG5A 4FTGA 1F8HA 1MXEA 1KK8B 2GGZA 3TDIA 2I7AA 5ER5A 4MZKA 2KFGA 2L51A 1CB1A 1ZOTB 2ZN8A 1DGUA 1DJGA 3TS5C 4AQJA 1S1EA 4I5NB 1LA0A 3SG7A 2ZFDA 2KGRA 1V1GA 4YGAA 4GUKA 2KGBC 1AUIB 4AOMA 1B4CA 1W7IB 1QS7A 1RFJA 3LK0A 1F54A 3JTDB 1M46A 1JBAA 4A4BA 4OCIA 4YI9A 4UPGA 1IJ6A 2JOJA 2LMUA 5D7FA 4MBEA 4MZJA 3TS5B 1NPQA 3FIAA 4NQGA 5I8NA 3OHMB 1JWDA 1ZUZA 2EC6C 2BL0C 2MLFC 3SG2A 4USLA 3CR2A 4QJ3B 1KSOA 4XYNA 2PSRA 1UHIA 1J1EA 3PATA 3TUYC 1N2DA 1RTP1 5HKYA 3DVJA 1OSAA 3CR4X 1QLKA 1S6IA 4N1FA 1JFJA 1NWDA 2WC8A 2WCFA 1VRKA 3ICBA 4ICBA 4F0ZB 1BR4B 3DF0A 1YVHA 1AVSA 2LHLA 1KFXS 1G8IA 1GGZA 1S5GZ 1SL9A 3PN7B 5KSZA 3DF0B 2BBMA 3BUOB 4PE4A 1B7TZ 1KQMC 2EC6B 2M3WA 4ORCB 3BUNB 3VRQA 1K8UA 2BL0B 1QV0A 2BE6A 1K96A 1YUUA 2KFFA 1CFFA 1Y0VH 3ZNIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J1D A;  3BOW A;  5ER4 X;  1WY9 A;  1AJ4 A;  3TUY B;  3A8R A;  1LA3 A;  1XK4 C;  1YUS A;  1YTZ C;  3BOW B;  1EH2 A;  1TNW A;  1AHR A;  1A2X A;  2WCB A;  1CFP A;  2K7C A;  2OPO A;  1NX3 A;  2VRG A;  2M9G A;  3LLE A;  1A75 A;  3NSI A;  4GBA A;  1YX7 A;  1KQM B;  2JC2 A;  3IF7 A;  1L2O C;  4DIR A;  1A75 B;  1JF0 A;  2BCX A;  1U5I B;  1M31 A;  1A29 A;  1CLL A;  1PSR A;  3EVV A;  2BKI B;  2M1K B;  2LE9 B;  3NSK A;  2KSP A;  2LLU A;  4A4C A;  1K94 A;  2JWW A;  2LUC A;  3CLN A;  2JUL A;  4P5O E;  3EKH A;  4MRX A;  1PVA A;  3OB2 B;  2CCM A;  5CPV A;  2M8U A;  3VRP A;  1TCO B;  2LHI A;  1DJW A;  3ZWH A;  1WLM A;  2NLN A;  2NCO A;  3DVK A;  1M45 A;  1MF8 B;  4MSP A;  2AAO A;  3PFV A;  1BG1 A;  1IKU A;  5AEQ A;  1UHK A;  2BE4 A;  1LKJ A;  2Y1M A;  2JRF A;  3VRN A;  4M2P A;  1FBV A;  3PLF B;  1OOJ A;  1R6P A;  1SY9 A;  2L0P A;  1KSM A;  2DOQ A;  1NUB A;  1Y1A A;  1OQP A;  1CM1 A;  1F4O A;  1JSA A;  2K2F A;  1MXL C;  1ZMZ A;  4GGF A;  1NIW A;  5G08 A;  4MEW A;  1F4Q A;  3SG3 A;  2ZRT A;  2LVJ A;  3A4U B;  3OX6 A;  3AKB A;  4CPV A;  1TNP A;  1KWO B;  2COL B;  4MRY A;  1KK8 C;  4ZCU A;  2K0J A;  3AAJ A;  3CS1 A;  1TRF A;  3BYA A;  4DCK A;  1J7R A;  3VRO A;  4YGB B;  3KO0 A;  2CXJ A;  1J7P A;  4YGE B;  1EG4 A;  2M29 A;  4U8D A;  5AAN A;  1M63 B;  3WHU B;  2MBX A;  3EK7 A;  3WHT B;  1IJ5 A;  1B8R A;  1TNQ A;  1WDC B;  1ALV A;  1XYD A;  1FPW A;  2E6W A;  2WCE A;  2KFH A;  1ODB A;  4PE1 A;  1NX0 A;  1K9P A;  2ZKM X;  4C0K A;  4E68 A;  4I5K A;  1OMV A;  3KPX A;  5TNC A;  1C7W A;  2HF5 A;  4MVF A;  1LIN A;  2M7L A;  2O60 A;  4GFT A;  2JU0 A;  2KAY A;  2NZ0 A;  1EG3 A;  3SG5 A;  1CDM A;  1HQV A;  4NDB A;  1OE9 B;  3RLZ A;  1F70 A;  1ALW A;  1UHN A;  4OKH A;  4YBH B;  1J7Q A;  1SMG A;  1FI5 A;  2KBI A;  1PAL A;  3AAK A;  1AP4 A;  4ETO A;  2LNK A;  2CTN A;  1B8L A;  1QAS A;  3JVT B;  1H4B A;  2L2E A;  1K9K A;  3VGO A;  2K7O A;  3OX5 A;  2QAC A;  1NYA A;  5HLO A;  3I5I C;  1CTR A;  5I2O A;  1AK8 A;  2MLE C;  4MZL A;  2Y5I A;  3SJS A;  3PN7 C;  3VRR A;  1DMO A;  3KEV A;  2JXC A;  1SL8 A;  2KNE A;  1S6C A;  1GQM A;  3CWG A;  1QJT A;  3M0W A;  4PHK A;  4ORB B;  4CFR A;  2OTG B;  2G9B A;  1R2U A;  2HET A;  2L4H A;  5PAL A;  5IBW A;  1MHO A;  5DKQ A;  4CID A;  1K2H A;  2PAS A;  1WLZ A;  4OR9 B;  2KBM A;  2MA2 A;  3I5I B;  2B1U A;  2LVV A;  2P6B B;  5CSF A;  1YX8 A;  1TOP A;  3OB1 B;  4YI8 A;  1DVI A;  3NSL A;  1CDN A;  1MUX A;  3SG6 A;  1Y1X A;  2L98 A;  3BUM B;  3TDZ A;  2F3Z A;  2KYF A;  4DUQ A;  1XFY O;  1SBJ A;  2JT3 A;  2K8M B;  5J3X A;  4MLW A;  2FCE A;  4C0J A;  3EVR A;  1BOD A;  1DF0 A;  2BCB A;  5JOL A;  3CGA A;  1QXP A;  3O78 A;  3EVU A;  4ZCV A;  2MHH A;  2L50 A;  4WRI A;  1AJ5 A;  1WRZ A;  4D1E A;  2GGM A;  1UHJ A;  1DJI A;  1LVC D;  1W7J B;  1DF0 B;  2CNP A;  4P2Y B;  5BPJ A;  2V53 A;  1LXF C;  2IS9 A;  3DVM A;  3FS7 A;  4NDC A;  2LMT A;  4GPL B;  4Q04 A;  5GQQ C;  2JTZ A;  3TZ1 A;  2JT8 A;  3LL8 B;  1A03 A;  2O5G A;  1E8A A;  1MQ1 A;  1SKT A;  1KQV A;  1NSH A;  2EGD A;  3NSO A;  1CLB A;  3QRX A;  1KFU L;  2FOT A;  2Q4U A;  5KU1 A;  4JWQ A;  3DVE A;  1DTL A;  3CTN A;  2KAV A;  1SNL A;  4GNK B;  1JF2 A;  1DGV A;  5AFP A;  1B47 A;  4GGF C;  1CDL A;  1M39 A;  1KWO C;  2JZI A;  1KCY A;  1DJH A;  1QVI Y;  4HRE E;  1QX5 B;  2KQY A;  3PAL A;  4FQO A;  4HRH A;  1REC A;  1UUR A;  2F33 A;  1SL7 A;  1S26 D;  1QX2 A;  1CMG A;  4WQ2 A;  2H61 A;  2BCA A;  2K7B A;  1RWY A;  3FWB A;  1UUS A;  1QIW A;  1CFD A;  3I5G B;  4I5L B;  1XVJ A;  4QJ5 B;  1SCV A;  1WDC C;  4YRU A;  4AQI A;  3GK2 A;  3O4Y A;  1YUR A;  1HT9 A;  5CSN A;  3BXK A;  1B9A A;  1NX2 A;  1EJ3 A;  3IQQ A;  4CLN A;  3SIA A;  2KQ6 A;  1SR6 C;  1XFV O;  1J7O A;  1DJY A;  1NCZ A;  2LV7 A;  1BU3 A;  1CDP A;  2KOT A;  1DJX A;  4PHN A;  2M49 B;  1JUO A;  2WND A;  1OMR A;  1BT6 A;  2KHN A;  2JTT A;  1XFZ O;  1F71 A;  2K61 A;  4ORA B;  2K7D A;  1PSB A;  2KYC A;  4PAL A;  3GOF A;  3EK8 A;  4JPZ B;  3JVT C;  1IWQ A;  4PHM A;  1TTX A;  1XO5 A;  2LCP A;  2M7N A;  3KF9 A;  1S36 A;  3IQO A;  3E3R A;  1SCM B;  1SR6 B;  4N1G A;  1IQ3 A;  2KI6 D;  2QPT A;  3K21 A;  4OVN F;  4PHJ A;  2M97 A;  3HX4 A;  3HCM A;  1KFU S;  2KI6 C;  2SAS A;  1Y1U A;  1UWO A;  2KI4 C;  2FCD A;  1YUT A;  5F6T A;  2OTG C;  5I2Q A;  2FJU B;  4BY5 A;  2MRD A;  1YVL A;  4GAO A;  1EL4 A;  2BKH B;  3D0Y A;  2JT0 A;  1YRU B;  1RJV A;  1WRK A;  3WXA A;  2JNF A;  4TNC A;  2MAZ A;  4C0L A;  4M2Q A;  3D0Y B;  2AMI A;  2HQW A;  2OS8 C;  1H8B A;  2NCP A;  2ZND A;  1N65 A;  2F2O A;  1K90 D;  1EXR A;  3F45 A;  4MN0 A;  2RGI A;  5AER A;  2KI4 B;  1UP5 A;  3GK4 X;  2CBL A;  3D10 A;  3I5F C;  1TIZ A;  1QVI Z;  2L5X B;  5DKR A;  5K89 A;  2PMY A;  1QLS A;  2SCP A;  1B8C A;  1KK7 Y;  2I18 A;  1CNP A;  1XFX O;  1OZO A;  5HYD A;  1K93 D;  5CSJ A;  2HQ8 A;  2LVK A;  2LLS A;  4HSZ A;  4BY4 A;  2OS8 B;  1XFW O;  1BJF A;  3BQ3 A;  5HLV A;  4JQ0 D;  1GJY A;  5CSI A;  1F55 A;  1CMF A;  1QV1 A;  2M0R A;  3C1V A;  3DD4 A;  2KDH A;  4WQ3 A;  3WNX B;  1QX7 A;  2EHB A;  3EKJ A;  2ZN9 A;  3I5F B;  1Q80 A;  1QAT A;  3KHE A;  1BLQ A;  1L7Z A;  4L9M A;  1IQ5 A;  3CR5 X;  5B8I B;  4GGN A;  1FW4 A;  2M1U A;  2JPT A;  3LCP C;  2E30 A;  3GK1 A;  1NCX A;  1QIV A;  1CLM A;  3O6B A;  1J55 A;  1G4Y R;  1V1F A;  2LM5 A;  2R2I A;  2ZNE A;  4OV2 A;  5I2L A;  3SIB A;  4XJK A;  1SK6 D;  1OZS A;  1B1G A;  4HRG A;  2LMV A;  1D1O A;  4XJK B;  2PVB A;  4NDD A;  1JFK A;  2F2P A;  2LLT A;  4I5J A;  2F3Y A;  1SYM A;  1NX1 A;  3H4S E;  2I2R E;  3I5G C;  4R1E A;  2H61 C;  2JNX A;  1YRT B;  3NXA A;  3CZT X;  1RK9 A;  4PDZ A;  2LC5 A;  1IRJ A;  1XFU O;  1NCY A;  5DKN A;  4DS7 A;  1U5I A;  1A4P A;  2CT9 A;  2LAN A;  1MR8 A;  2LAP A;  2G2B A;  3I5H C;  5FYX A;  2BBN A;  2D8N A;  1TNX A;  1XK4 A;  4IL1 A;  3AKA A;  3BUX B;  1NP8 A;  2LP2 A;  1DJZ A;  1ZAC A;  5AXI A;  1CKK A;  2LVI A;  1GGW A;  2TN4 A;  1K95 A;  1N0Y A;  2ZRS A;  1KK7 Z;  1SPY A;  1PRW A;  1Y6W A;  1TCF A;  2JQ6 A;  4N5X A;  5JJG A;  4QJ4 B;  2PAL A;  2Y1N A;  1SW8 A;  1TN4 A;  3PSR A;  1K9U A;  3I5H B;  1SCM C;  1L2O B;  1PUL A;  4CFQ A;  1WRL A;  4YGC B;  1ZFS A;  2I94 A;  3TDU A;  3BUW B;  2NXQ A;  1OMD A;  1PVB A;  1UHH A;  2WOS A;  3FWC A;  5D69 A;  5HKW A;  1FI6 A;  4M2O A;  1DT7 B;  1CFC A;  1S5G Y;  4DRW A;  2L4I A;  1B7T Y;  1CM4 A;  3PM8 A;  1S6J A;  4YGD B;  1BF5 A;  1SRA A;  2GV5 A;  1BOC A;  2HPS A;  1XA5 A;  1BMO A;  2JXL A;  2LUX A;  3O2P A;  5HKZ A;  2BEC A;  1FF1 A;  4PE7 A;  3EK4 A;  1RRO A;  2AUC A;  1KFX L;  2H2K A;  1S3P A;  2WOR A;  2MJW B;  1IGV A;  2K2A A;  2LP3 A;  4PCW A;  2PRU A;  2Y4Q A;  4PE0 A;  1BR1 B;  1JC2 A;  3SG4 A;  1PK0 D;  1QTX A;  3LK1 A;  1G33 A;  1IH0 A;  2ISD A;  5KTY A;  1C07 A;  1MWN A;  2A4J A;  2Q91 A;  1YR5 A;  3OP0 A;  2F8P A;  3RM1 A;  1X02 A;  3MSE B;  1C7V A;  2KAX A;  3JTD C;  1IG5 A;  4FTG A;  1F8H A;  1MXE A;  1KK8 B;  2GGZ A;  3TDI A;  2I7A A;  5ER5 A;  4MZK A;  2KFG A;  2L51 A;  1CB1 A;  1ZOT B;  2ZN8 A;  1DGU A;  1DJG A;  3TS5 C;  4AQJ A;  1S1E A;  4I5N B;  1LA0 A;  3SG7 A;  2ZFD A;  2KGR A;  1V1G A;  4YGA A;  4GUK A;  2KGB C;  1AUI B;  4AOM A;  1B4C A;  1W7I B;  1QS7 A;  1RFJ A;  3LK0 A;  1F54 A;  3JTD B;  1M46 A;  1JBA A;  4A4B A;  4OCI A;  4YI9 A;  4UPG A;  1IJ6 A;  2JOJ A;  2LMU A;  5D7F A;  4MBE A;  4MZJ A;  3TS5 B;  1NPQ A;  3FIA A;  4NQG A;  5I8N A;  3OHM B;  1JWD A;  1ZUZ A;  2EC6 C;  2BL0 C;  2MLF C;  3SG2 A;  4USL A;  3CR2 A;  4QJ3 B;  1KSO A;  4XYN A;  2PSR A;  1UHI A;  1J1E A;  3PAT A;  3TUY C;  1N2D A;  1RTP 1;  5HKY A;  3DVJ A;  1OSA A;  3CR4 X;  1QLK A;  1S6I A;  4N1F A;  1JFJ A;  1NWD A;  2WC8 A;  2WCF A;  1VRK A;  3ICB A;  4ICB A;  4F0Z B;  1BR4 B;  3DF0 A;  1YVH A;  1AVS A;  2LHL A;  1KFX S;  1G8I A;  1GGZ A;  1S5G Z;  1SL9 A;  3PN7 B;  5KSZ A;  3DF0 B;  2BBM A;  3BUO B;  4PE4 A;  1B7T Z;  1KQM C;  2EC6 B;  2M3W A;  4ORC B;  3BUN B;  3VRQ A;  1K8U A;  2BL0 B;  1QV0 A;  2BE6 A;  1K96 A;  1YUU A;  2KFF A;  1CFF A;  1Y0V H;  3ZNI A; 
#chains in the Genus database with same CATH topology
 1J1D A;  3BOW A;  5ER4 X;  1WY9 A;  1AJ4 A;  3TUY B;  3A8R A;  1LA3 A;  1XK4 C;  1YUS A;  1YTZ C;  3BOW B;  1EH2 A;  1TNW A;  1AHR A;  1A2X A;  2WCB A;  1CFP A;  2K7C A;  2KPH A;  2OPO A;  1NX3 A;  2VRG A;  3UO9 A;  2M9G A;  3LLE A;  1A75 A;  3NSI A;  4GBA A;  1YX7 A;  1KQM B;  2JC2 A;  1DC1 A;  3IF7 A;  1L2O C;  4DIR A;  1A75 B;  1JF0 A;  2BCX A;  1U5I B;  1M31 A;  1A29 A;  1CLL A;  1PSR A;  3EVV A;  3SS3 A;  1ORG A;  2BKI B;  2M1K B;  2LE9 B;  3NSK A;  2KSP A;  2LLU A;  3NGV A;  2BNX A;  4A4C A;  1K94 A;  2JWW A;  2LUC A;  3CLN A;  2JUL A;  3NHT A;  4P5O E;  3EKH A;  4MRX A;  1PVA A;  3OB2 B;  2CCM A;  5CPV A;  2M8U A;  3VRP A;  1TCO B;  2LHI A;  1DJW A;  3ZWH A;  1WLM A;  2L2C A;  2NCO A;  2NLN A;  3DVK A;  1M45 A;  1MF8 B;  4MSP A;  2AAO A;  3PFV A;  1BG1 A;  1IKU A;  5AEQ A;  1DEK A;  1UHK A;  1LKJ A;  2BE4 A;  2Y1M A;  2JRF A;  3VRN A;  2WCL A;  4M2P A;  1FBV A;  3PLF B;  1OOJ A;  1R6P A;  1SY9 A;  2L0P A;  1KSM A;  2DOQ A;  1NUB A;  1Y1A A;  1OQP A;  1CM1 A;  1F4O A;  4IJ7 A;  1JSA A;  2K2F A;  1MXL C;  3BFA A;  1ZMZ A;  4GGF A;  1NIW A;  5G08 A;  4MEW A;  1F4Q A;  3SG3 A;  2ZRT A;  2LVJ A;  3A4U B;  3OX6 A;  3AKB A;  4CPV A;  1TNP A;  1KWO B;  2COL B;  4MRY A;  1KK8 C;  4ZCU A;  2K0J A;  3AAJ A;  3CS1 A;  1TRF A;  3BYA A;  4DCK A;  1J7R A;  3VRO A;  4YGB B;  3KO0 A;  2CXJ A;  1J7P A;  4YGE B;  1EG4 A;  2M29 A;  4U8D A;  5AAN A;  4FQT A;  3UNW A;  1M63 B;  3WHU B;  2MBX A;  3EK7 A;  3WHT B;  1IJ5 A;  1B8R A;  1TNQ A;  1WDC B;  1ALV A;  1XYD A;  1FPW A;  3B6X A;  2E6W A;  2WCE A;  2KFH A;  1ODB A;  4PE1 A;  1NX0 A;  1K9P A;  2ZKM X;  4C0K A;  4E68 A;  1IIO A;  2K60 A;  4I5K A;  1OMV A;  3KPX A;  2FJY A;  3D73 A;  5TNC A;  1C7W A;  3B86 A;  2HF5 A;  4MVF A;  1LIN A;  2M7L A;  2O60 A;  4GFT A;  2JU0 A;  2KAY A;  2NZ0 A;  4OZD A;  1EG3 A;  3SG5 A;  1CDM A;  1TWO A;  1HQV A;  4NDB A;  1OE9 B;  3RLZ A;  1F70 A;  1ALW A;  1UHN A;  5EL2 A;  4OKH A;  4YBH B;  1J7Q A;  1SMG A;  1FI5 A;  2KBI A;  1PAL A;  3AAK A;  3CYZ A;  3EG5 B;  3FE6 A;  1AP4 A;  1C3Z A;  4ETO A;  2LNK A;  2CTN A;  1B8L A;  1QAS A;  3JVT B;  3D76 A;  1H4B A;  2L2E A;  1K9K A;  3VGO A;  2K7O A;  3OX5 A;  2QAC A;  1NYA A;  5HLO A;  3I5I C;  1CTR A;  5I2O A;  1AK8 A;  2MLE C;  3B88 A;  4MZL A;  2Y5I A;  3SJS A;  3PN7 C;  3VRR A;  1DEL A;  1DMO A;  3KEV A;  2JXC A;  1SL8 A;  2KNE A;  1S6C A;  1GQM A;  3CWG A;  1QJT A;  3M0W A;  4PHK A;  4ORB B;  4CFR A;  2OTG B;  2G9B A;  3NHI A;  1R2U A;  2HET A;  2L4H A;  5PAL A;  3VB1 A;  5IBW A;  1MHO A;  5DKQ A;  4CID A;  1K2H A;  2P71 A;  2PAS A;  1WLZ A;  4OR9 B;  2KBM A;  2MA2 A;  4F7F A;  3I5I B;  2B1U A;  2LVV A;  2P6B B;  3QME A;  5CSF A;  1YX8 A;  2QEH A;  1TOP A;  3OB1 B;  4YI8 A;  1DVI A;  3NSL A;  1CDN A;  1MUX A;  3SG6 A;  1Y1X A;  2L98 A;  3BFB A;  3BUM B;  2F3Z A;  2KYF A;  3TDZ A;  4DUQ A;  2KLE A;  1XFY O;  5FI7 A;  1SBJ A;  1OOI X;  2JT3 A;  2K8M B;  3L47 A;  4MLW A;  5J3X A;  2FCE A;  4C0J A;  3EVR A;  1BOD A;  1DF0 A;  2BCB A;  5JOL A;  3CGA A;  1QXP A;  3O78 A;  3EVU A;  1LS8 A;  2MHH A;  2L50 A;  4WRI A;  1AJ5 A;  1WRZ A;  4ZCV A;  2GGM A;  1UHJ A;  1DJI A;  4D1E A;  1LVC D;  1W7J B;  1DF0 B;  2CNP A;  3O4X A;  4P2Y B;  5BPJ A;  2V53 A;  1LXF C;  1XFR A;  2IS9 A;  3DVM A;  3FS7 A;  4NDC A;  2LMT A;  4GPL B;  4Q04 A;  5GQQ C;  2JTZ A;  3TZ1 A;  2JT8 A;  3LL8 B;  1CFF A;  1A03 A;  2O5G A;  2PQL A;  1E8A A;  1MQ1 A;  1SKT A;  3RZS A;  1KQV A;  1NSH A;  2EGD A;  3D74 A;  3NSO A;  1CLB A;  3D75 A;  3QRX A;  1KFU L;  2FOT A;  2Q4U A;  3DZT A;  5KU1 A;  4JWQ A;  3DVE A;  1DTL A;  3CTN A;  1GM0 A;  2KAV A;  1SNL A;  4GNK B;  3S0B A;  1JF2 A;  1DGV A;  5AFP A;  3FE9 A;  1B47 A;  4GGF C;  1CDL A;  1M39 A;  1KWO C;  2JZI A;  3DYE A;  1KCY A;  1DJH A;  1QVI Y;  4HRE E;  1QX5 B;  2KQY A;  3PAL A;  4FQO A;  4HRH A;  1REC A;  1UUR A;  2F33 A;  1SL7 A;  3S0F A;  1S26 D;  1QX2 A;  1CMG A;  4WQ2 A;  2H61 A;  2BCA A;  2K7B A;  1RWY A;  3FWB A;  1UUS A;  1QIW A;  1CFD A;  3I5G B;  4I5L B;  1XVJ A;  4QJ5 B;  1SCV A;  1WDC C;  1DQE A;  4YRU A;  1OW4 A;  3GK2 A;  3O4Y A;  1YUR A;  5FI2 A;  4AQI A;  1HT9 A;  5CSN A;  3BXK A;  1B9A A;  1NX2 A;  1EJ3 A;  3IQQ A;  4CLN A;  3SIA A;  1C3Y A;  3CZ1 A;  2KQ6 A;  1SR6 C;  1XFV O;  1J7O A;  1DJY A;  1NCZ A;  2LV7 A;  1BU3 A;  1CDP A;  4PT1 A;  2KOT A;  1DJX A;  4PHN A;  2M49 B;  1JUO A;  2WND A;  1OMR A;  1BT6 A;  2KHN A;  5I94 A;  2JTT A;  1XFZ O;  2WC6 A;  1F71 A;  2K61 A;  4ORA B;  2K7D A;  1PSB A;  2KYC A;  4PAL A;  3GOF A;  2WCK A;  3EK8 A;  4JPZ B;  3JVT C;  1IWQ A;  4PHM A;  1TTX A;  1XO5 A;  2LCP A;  2M7N A;  3KF9 A;  1S36 A;  3IQO A;  3E3R A;  1SCM B;  1SR6 B;  2BAP A;  4N1G A;  2KI6 D;  2QPT A;  1IQ3 A;  3K21 A;  4OVN F;  4PHJ A;  2M97 A;  3HX4 A;  3HCM A;  1KFU S;  2KI6 C;  2SAS A;  1Y1U A;  1UWO A;  2KI4 C;  4INX A;  2FCD A;  1YUT A;  5F6T A;  2OTG C;  3L4A A;  5I2Q A;  2FJU B;  4BY5 A;  2MRD A;  1YVL A;  4GAO A;  4JKT A;  1EL4 A;  2BKH B;  3D0Y A;  3D78 A;  2JT0 A;  1YRU B;  1RJV A;  1WRK A;  3N7H A;  2JNF A;  3R72 A;  4TNC A;  2MAZ A;  3WXA A;  4C0L A;  2P70 A;  4M2Q A;  3D0Y B;  2AMI A;  2HQW A;  2OS8 C;  1H8B A;  2NCP A;  2ZND A;  1N65 A;  2F2O A;  1K90 D;  1EXR A;  3F45 A;  4MN0 A;  2RGI A;  5AER A;  2KI4 B;  1UP5 A;  3GK4 X;  2CBL A;  3D10 A;  3OBV A;  3I5F C;  1TIZ A;  1QVI Z;  2L5X B;  5DKR A;  5K89 A;  2PMY A;  1QLS A;  2SCP A;  3Q8I A;  1B8C A;  1KK7 Y;  2I18 A;  1CNP A;  1XFX O;  1OZO A;  5HYD A;  1K93 D;  2QEB A;  5CSJ A;  2HQ8 A;  2LVK A;  3L4L A;  2LLS A;  4HSZ A;  4BY4 A;  2L5Y A;  2OS8 B;  1XFW O;  1BJF A;  3BQ3 A;  5HLV A;  4JQ0 D;  1GJY A;  5CSI A;  1F55 A;  1CMF A;  1QV1 A;  2M0R A;  3C1V A;  3DD4 A;  2KDH A;  4WQ3 A;  3OGN A;  3WNX B;  1QX7 A;  2EHB A;  3EKJ A;  2ZN9 A;  3I5F B;  1Q80 A;  1QAT A;  3KHE A;  3SS4 A;  2WCJ A;  1BLQ A;  1L7Z A;  4L9M A;  1IQ5 A;  3CR5 X;  5B8I B;  4GGN A;  1FW4 A;  2M1U A;  2JPT A;  3LCP C;  2E30 A;  3GK1 A;  1NCX A;  1QIV A;  1CLM A;  3O6B A;  1J55 A;  1G4Y R;  1V1F A;  2LM5 A;  2R2I A;  2ZNE A;  4OV2 A;  5I2L A;  3SIB A;  4XJK A;  1SK6 D;  1OZS A;  1B1G A;  1OOG A;  4HRG A;  2LMV A;  1D1O A;  4XJK B;  2PVB A;  2WCH A;  3S0D A;  4NDD A;  3BJH A;  2GTE A;  1JFK A;  2F2P A;  2LLT A;  4I5J A;  2F3Y A;  1SYM A;  3S0A A;  1NX1 A;  3H4S E;  2I2R E;  3I5G C;  3R1V A;  3B87 A;  2H61 C;  2JNX A;  4R1E A;  2QEO A;  1YRT B;  3NXA A;  1W9Z A;  3CZT X;  1RK9 A;  4PDZ A;  2LC5 A;  3K1E A;  1IRJ A;  1XFU O;  1NCY A;  1TUJ A;  2PYQ A;  1U5I A;  1A4P A;  2CT9 A;  2LAN A;  1MR8 A;  2LAP A;  5DKN A;  4DS7 A;  2G2B A;  3I5H C;  5FYX A;  2BBN A;  2D8N A;  5DIC A;  1TNX A;  1XK4 A;  1T14 A;  3R1P A;  4IL1 A;  3AKA A;  3BUX B;  1NP8 A;  2LP2 A;  1DJZ A;  1ZAC A;  5AXI A;  1CKK A;  3DY9 A;  2LVI A;  3CDN A;  2TN4 A;  1K95 A;  1N0Y A;  1GGW A;  2ZRS A;  3D77 A;  1KK7 Z;  1SPY A;  1PRW A;  1Y6W A;  1TCF A;  2JQ6 A;  4N5X A;  5JJG A;  3PJI A;  4QJ4 B;  2PAL A;  2Y1N A;  1SW8 A;  1TN4 A;  3PSR A;  1K9U A;  3I5H B;  1SCM C;  1L2O B;  1PUL A;  4CFQ A;  1WRL A;  4YGC B;  1OOF A;  1ZFS A;  2I94 A;  3IVT A;  3BUW B;  3TDU A;  2NXQ A;  3FE8 A;  1OMD A;  1PVB A;  1UHH A;  2QEV A;  2WOS A;  2JPO A;  3FWC A;  5D69 A;  5HKW A;  1FI6 A;  4M2O A;  1DT7 B;  1CFC A;  1S5G Y;  4DRW A;  3PM2 A;  3V2L A;  2ERB A;  2QDI A;  2L4I A;  4INW A;  1B7T Y;  1CM4 A;  3PM8 A;  1S6J A;  4YGD B;  1BF5 A;  1SRA A;  2GV5 A;  1BOC A;  1F8H A;  2HPS A;  1XA5 A;  1BMO A;  2JXL A;  2LUX A;  3O2P A;  5HKZ A;  2BEC A;  1FF1 A;  4PE7 A;  3EK4 A;  1RRO A;  2AUC A;  1KFX L;  2H2K A;  1S3P A;  2WOR A;  2MJW B;  1IGV A;  2K2A A;  1Z4H A;  2LP3 A;  4PCW A;  1P28 A;  2PRU A;  2Y4Q A;  4PE0 A;  1BR1 B;  5D3O A;  1JC2 A;  3SG4 A;  1PK0 D;  1QTX A;  3LK1 A;  1G33 A;  1IH0 A;  2ISD A;  1OOH A;  5KTY A;  1C07 A;  1MWN A;  2A4J A;  2Q91 A;  1YR5 A;  3OP0 A;  2F8P A;  3RM1 A;  1QWV A;  1X02 A;  3MSE B;  5FI6 A;  1C7V A;  2KAX A;  3JTD C;  1IG5 A;  1TUZ A;  2WCM A;  1MXE A;  1KK8 B;  2GGZ A;  4FTG A;  2I7A A;  5ER5 A;  3SS5 A;  3CZ2 A;  2KFG A;  4MZK A;  2L51 A;  3CAB A;  3TDI A;  1CB1 A;  1ZOT B;  2ZN8 A;  1DGU A;  1DJG A;  3TS5 C;  3S0G A;  4AQJ A;  1S1E A;  4I5N B;  1LA0 A;  3SG7 A;  2ZFD A;  3BFH A;  2KGR A;  1V1G A;  4YGA A;  4GUK A;  2KGB C;  1AUI B;  4JD9 A;  4AOM A;  1B4C A;  1W7I B;  1QS7 A;  1RFJ A;  3LK0 A;  1F54 A;  3JTD B;  1M46 A;  3CZ0 A;  3DXL A;  4A4B A;  1JBA A;  4OCI A;  4YI9 A;  3R1O A;  4UPG A;  1IJ6 A;  2JOJ A;  2LMU A;  5D7F A;  4MBE A;  1SSE B;  4MZJ A;  3TS5 B;  1NPQ A;  3FIA A;  4NQG A;  5I8N A;  3OHM B;  1JWD A;  1ZUZ A;  2EC6 C;  4KYN A;  2BL0 C;  2MLF C;  3SG2 A;  4USL A;  3CR2 A;  4QJ3 B;  1KSO A;  4XYN A;  2PSR A;  1UHI A;  1J1E A;  3PAT A;  3TUY C;  1N2D A;  1RTP 1;  5HKY A;  3DVJ A;  1OSA A;  3CR4 X;  1QLK A;  1S6I A;  4N1F A;  1JFJ A;  1NWD A;  2WC8 A;  2KLD A;  1VRK A;  2WCF A;  3ICB A;  4ICB A;  4F0Z B;  1BR4 B;  3DF0 A;  1YVH A;  1Z2C B;  2H8V A;  5HL1 A;  1AVS A;  2LHL A;  1KFX S;  1G8I A;  1GGZ A;  1S5G Z;  1SL9 A;  3PN7 B;  5KSZ A;  3DF0 B;  3S0E A;  2BBM A;  3BUO B;  4PE4 A;  1B7T Z;  1KQM C;  2EC6 B;  2M3W A;  4ORC B;  3BUN B;  3VRQ A;  1K8U A;  2BL0 B;  1QV0 A;  2BE6 A;  1K96 A;  1YUU A;  2KFF A;  2YGU A;  2WC5 A;  3B7A A;  1Y0V H;  3ZNI A; 
#chains in the Genus database with same CATH homology
 1J1D A;  3BOW A;  5ER4 X;  1WY9 A;  1AJ4 A;  3TUY B;  3A8R A;  1LA3 A;  1XK4 C;  1YUS A;  1YTZ C;  3BOW B;  1EH2 A;  1TNW A;  1AHR A;  1A2X A;  2WCB A;  1CFP A;  2K7C A;  2OPO A;  1NX3 A;  2VRG A;  2M9G A;  3LLE A;  1A75 A;  3NSI A;  4GBA A;  1YX7 A;  1KQM B;  2JC2 A;  3IF7 A;  1L2O C;  4DIR A;  1A75 B;  1JF0 A;  2BCX A;  1U5I B;  1M31 A;  1A29 A;  1CLL A;  1PSR A;  3EVV A;  2BKI B;  2M1K B;  2LE9 B;  3NSK A;  2KSP A;  2LLU A;  4A4C A;  1K94 A;  2JWW A;  2LUC A;  3CLN A;  2JUL A;  4P5O E;  3EKH A;  4MRX A;  1PVA A;  3OB2 B;  2CCM A;  5CPV A;  2M8U A;  3VRP A;  1TCO B;  2LHI A;  1DJW A;  3ZWH A;  1WLM A;  2NLN A;  2NCO A;  3DVK A;  1M45 A;  1MF8 B;  4MSP A;  2AAO A;  3PFV A;  1BG1 A;  1IKU A;  5AEQ A;  1UHK A;  2BE4 A;  1LKJ A;  2Y1M A;  2JRF A;  3VRN A;  4M2P A;  1FBV A;  3PLF B;  1OOJ A;  1R6P A;  1SY9 A;  2L0P A;  1KSM A;  2DOQ A;  1NUB A;  1Y1A A;  1OQP A;  1CM1 A;  1F4O A;  1JSA A;  2K2F A;  1MXL C;  1ZMZ A;  4GGF A;  1NIW A;  5G08 A;  4MEW A;  1F4Q A;  3SG3 A;  2ZRT A;  2LVJ A;  3A4U B;  3OX6 A;  3AKB A;  4CPV A;  1TNP A;  1KWO B;  2COL B;  4MRY A;  1KK8 C;  4ZCU A;  2K0J A;  3AAJ A;  3CS1 A;  1TRF A;  3BYA A;  4DCK A;  1J7R A;  3VRO A;  4YGB B;  3KO0 A;  2CXJ A;  1J7P A;  4YGE B;  1EG4 A;  2M29 A;  4U8D A;  5AAN A;  1M63 B;  3WHU B;  2MBX A;  3EK7 A;  3WHT B;  1IJ5 A;  1B8R A;  1TNQ A;  1WDC B;  1ALV A;  1XYD A;  1FPW A;  2E6W A;  2WCE A;  2KFH A;  1ODB A;  4PE1 A;  1NX0 A;  1K9P A;  2ZKM X;  4C0K A;  4E68 A;  4I5K A;  1OMV A;  3KPX A;  5TNC A;  1C7W A;  2HF5 A;  4MVF A;  1LIN A;  2M7L A;  2O60 A;  4GFT A;  2JU0 A;  2KAY A;  2NZ0 A;  1EG3 A;  3SG5 A;  1CDM A;  1HQV A;  4NDB A;  1OE9 B;  3RLZ A;  1F70 A;  1ALW A;  1UHN A;  4OKH A;  4YBH B;  1J7Q A;  1SMG A;  1FI5 A;  2KBI A;  1PAL A;  3AAK A;  1AP4 A;  4ETO A;  2LNK A;  2CTN A;  1B8L A;  1QAS A;  3JVT B;  1H4B A;  2L2E A;  1K9K A;  3VGO A;  2K7O A;  3OX5 A;  2QAC A;  1NYA A;  5HLO A;  3I5I C;  1CTR A;  5I2O A;  1AK8 A;  2MLE C;  4MZL A;  2Y5I A;  3SJS A;  3PN7 C;  3VRR A;  1DMO A;  3KEV A;  2JXC A;  1SL8 A;  2KNE A;  1S6C A;  1GQM A;  3CWG A;  1QJT A;  3M0W A;  4PHK A;  4ORB B;  4CFR A;  2OTG B;  2G9B A;  1R2U A;  2HET A;  2L4H A;  5PAL A;  5IBW A;  1MHO A;  5DKQ A;  4CID A;  1K2H A;  2PAS A;  1WLZ A;  4OR9 B;  2KBM A;  2MA2 A;  3I5I B;  2B1U A;  2LVV A;  2P6B B;  5CSF A;  1YX8 A;  1TOP A;  3OB1 B;  4YI8 A;  1DVI A;  3NSL A;  1CDN A;  1MUX A;  3SG6 A;  1Y1X A;  2L98 A;  3BUM B;  3TDZ A;  2F3Z A;  2KYF A;  4DUQ A;  1XFY O;  1SBJ A;  2JT3 A;  2K8M B;  5J3X A;  4MLW A;  2FCE A;  4C0J A;  3EVR A;  1BOD A;  1DF0 A;  2BCB A;  5JOL A;  3CGA A;  1QXP A;  3O78 A;  3EVU A;  4ZCV A;  2MHH A;  2L50 A;  4WRI A;  1AJ5 A;  1WRZ A;  4D1E A;  2GGM A;  1UHJ A;  1DJI A;  1LVC D;  1W7J B;  1DF0 B;  2CNP A;  4P2Y B;  5BPJ A;  2V53 A;  1LXF C;  2IS9 A;  3DVM A;  3FS7 A;  4NDC A;  2LMT A;  4GPL B;  4Q04 A;  5GQQ C;  2JTZ A;  3TZ1 A;  2JT8 A;  3LL8 B;  1A03 A;  2O5G A;  1E8A A;  1MQ1 A;  1SKT A;  1KQV A;  1NSH A;  2EGD A;  3NSO A;  1CLB A;  3QRX A;  1KFU L;  2FOT A;  2Q4U A;  5KU1 A;  4JWQ A;  3DVE A;  1DTL A;  3CTN A;  2KAV A;  1SNL A;  4GNK B;  1JF2 A;  1DGV A;  5AFP A;  1B47 A;  4GGF C;  1CDL A;  1M39 A;  1KWO C;  2JZI A;  1KCY A;  1DJH A;  1QVI Y;  4HRE E;  1QX5 B;  2KQY A;  3PAL A;  4FQO A;  4HRH A;  1REC A;  1UUR A;  2F33 A;  1SL7 A;  1S26 D;  1QX2 A;  1CMG A;  4WQ2 A;  2H61 A;  2BCA A;  2K7B A;  1RWY A;  3FWB A;  1UUS A;  1QIW A;  1CFD A;  3I5G B;  4I5L B;  1XVJ A;  4QJ5 B;  1SCV A;  1WDC C;  4YRU A;  4AQI A;  3GK2 A;  3O4Y A;  1YUR A;  1HT9 A;  5CSN A;  3BXK A;  1B9A A;  1NX2 A;  1EJ3 A;  3IQQ A;  4CLN A;  3SIA A;  2KQ6 A;  1SR6 C;  1XFV O;  1J7O A;  1DJY A;  1NCZ A;  2LV7 A;  1BU3 A;  1CDP A;  2KOT A;  1DJX A;  4PHN A;  2M49 B;  1JUO A;  2WND A;  1OMR A;  1BT6 A;  2KHN A;  2JTT A;  1XFZ O;  1F71 A;  2K61 A;  4ORA B;  2K7D A;  1PSB A;  2KYC A;  4PAL A;  3GOF A;  3EK8 A;  4JPZ B;  3JVT C;  1IWQ A;  4PHM A;  1TTX A;  1XO5 A;  2LCP A;  2M7N A;  3KF9 A;  1S36 A;  3IQO A;  3E3R A;  1SCM B;  1SR6 B;  4N1G A;  1IQ3 A;  2KI6 D;  2QPT A;  3K21 A;  4OVN F;  4PHJ A;  2M97 A;  3HX4 A;  3HCM A;  1KFU S;  2KI6 C;  2SAS A;  1Y1U A;  1UWO A;  2KI4 C;  2FCD A;  1YUT A;  5F6T A;  2OTG C;  5I2Q A;  2FJU B;  4BY5 A;  2MRD A;  1YVL A;  4GAO A;  1EL4 A;  2BKH B;  3D0Y A;  2JT0 A;  1YRU B;  1RJV A;  1WRK A;  3WXA A;  2JNF A;  4TNC A;  2MAZ A;  4C0L A;  4M2Q A;  3D0Y B;  2AMI A;  2HQW A;  2OS8 C;  1H8B A;  2NCP A;  2ZND A;  1N65 A;  2F2O A;  1K90 D;  1EXR A;  3F45 A;  4MN0 A;  2RGI A;  5AER A;  2KI4 B;  1UP5 A;  3GK4 X;  2CBL A;  3D10 A;  3I5F C;  1TIZ A;  1QVI Z;  2L5X B;  5DKR A;  5K89 A;  2PMY A;  1QLS A;  2SCP A;  1B8C A;  1KK7 Y;  2I18 A;  1CNP A;  1XFX O;  1OZO A;  5HYD A;  1K93 D;  5CSJ A;  2HQ8 A;  2LVK A;  2LLS A;  4HSZ A;  4BY4 A;  2OS8 B;  1XFW O;  1BJF A;  3BQ3 A;  5HLV A;  4JQ0 D;  1GJY A;  5CSI A;  1F55 A;  1CMF A;  1QV1 A;  2M0R A;  3C1V A;  3DD4 A;  2KDH A;  4WQ3 A;  3WNX B;  1QX7 A;  2EHB A;  3EKJ A;  2ZN9 A;  3I5F B;  1Q80 A;  1QAT A;  3KHE A;  1BLQ A;  1L7Z A;  4L9M A;  1IQ5 A;  3CR5 X;  5B8I B;  4GGN A;  1FW4 A;  2M1U A;  2JPT A;  3LCP C;  2E30 A;  3GK1 A;  1NCX A;  1QIV A;  1CLM A;  3O6B A;  1J55 A;  1G4Y R;  1V1F A;  2LM5 A;  2R2I A;  2ZNE A;  4OV2 A;  5I2L A;  3SIB A;  4XJK A;  1SK6 D;  1OZS A;  1B1G A;  4HRG A;  2LMV A;  1D1O A;  4XJK B;  2PVB A;  4NDD A;  1JFK A;  2F2P A;  2LLT A;  4I5J A;  2F3Y A;  1SYM A;  1NX1 A;  3H4S E;  2I2R E;  3I5G C;  4R1E A;  2H61 C;  2JNX A;  1YRT B;  3NXA A;  3CZT X;  1RK9 A;  4PDZ A;  2LC5 A;  1IRJ A;  1XFU O;  1NCY A;  5DKN A;  4DS7 A;  1U5I A;  1A4P A;  2CT9 A;  2LAN A;  1MR8 A;  2LAP A;  2G2B A;  3I5H C;  5FYX A;  2BBN A;  2D8N A;  1TNX A;  1XK4 A;  4IL1 A;  3AKA A;  3BUX B;  1NP8 A;  2LP2 A;  1DJZ A;  1ZAC A;  5AXI A;  1CKK A;  2LVI A;  1GGW A;  2TN4 A;  1K95 A;  1N0Y A;  2ZRS A;  1KK7 Z;  1SPY A;  1PRW A;  1Y6W A;  1TCF A;  2JQ6 A;  4N5X A;  5JJG A;  4QJ4 B;  2PAL A;  2Y1N A;  1SW8 A;  1TN4 A;  3PSR A;  1K9U A;  3I5H B;  1SCM C;  1L2O B;  1PUL A;  4CFQ A;  1WRL A;  4YGC B;  1ZFS A;  2I94 A;  3TDU A;  3BUW B;  2NXQ A;  1OMD A;  1PVB A;  1UHH A;  2WOS A;  3FWC A;  5D69 A;  5HKW A;  1FI6 A;  4M2O A;  1DT7 B;  1CFC A;  1S5G Y;  4DRW A;  2L4I A;  1B7T Y;  1CM4 A;  3PM8 A;  1S6J A;  4YGD B;  1BF5 A;  1SRA A;  2GV5 A;  1BOC A;  2HPS A;  1XA5 A;  1BMO A;  2JXL A;  2LUX A;  3O2P A;  5HKZ A;  2BEC A;  1FF1 A;  4PE7 A;  3EK4 A;  1RRO A;  2AUC A;  1KFX L;  2H2K A;  1S3P A;  2WOR A;  2MJW B;  1IGV A;  2K2A A;  2LP3 A;  4PCW A;  2PRU A;  2Y4Q A;  4PE0 A;  1BR1 B;  1JC2 A;  3SG4 A;  1PK0 D;  1QTX A;  3LK1 A;  1G33 A;  1IH0 A;  2ISD A;  5KTY A;  1C07 A;  1MWN A;  2A4J A;  2Q91 A;  1YR5 A;  3OP0 A;  2F8P A;  3RM1 A;  1X02 A;  3MSE B;  1C7V A;  2KAX A;  3JTD C;  1IG5 A;  4FTG A;  1F8H A;  1MXE A;  1KK8 B;  2GGZ A;  3TDI A;  2I7A A;  5ER5 A;  4MZK A;  2KFG A;  2L51 A;  1CB1 A;  1ZOT B;  2ZN8 A;  1DGU A;  1DJG A;  3TS5 C;  4AQJ A;  1S1E A;  4I5N B;  1LA0 A;  3SG7 A;  2ZFD A;  2KGR A;  1V1G A;  4YGA A;  4GUK A;  2KGB C;  1AUI B;  4AOM A;  1B4C A;  1W7I B;  1QS7 A;  1RFJ A;  3LK0 A;  1F54 A;  3JTD B;  1M46 A;  1JBA A;  4A4B A;  4OCI A;  4YI9 A;  4UPG A;  1IJ6 A;  2JOJ A;  2LMU A;  5D7F A;  4MBE A;  4MZJ A;  3TS5 B;  1NPQ A;  3FIA A;  4NQG A;  5I8N A;  3OHM B;  1JWD A;  1ZUZ A;  2EC6 C;  2BL0 C;  2MLF C;  3SG2 A;  4USL A;  3CR2 A;  4QJ3 B;  1KSO A;  4XYN A;  2PSR A;  1UHI A;  1J1E A;  3PAT A;  3TUY C;  1N2D A;  1RTP 1;  5HKY A;  3DVJ A;  1OSA A;  3CR4 X;  1QLK A;  1S6I A;  4N1F A;  1JFJ A;  1NWD A;  2WC8 A;  2WCF A;  1VRK A;  3ICB A;  4ICB A;  4F0Z B;  1BR4 B;  3DF0 A;  1YVH A;  1AVS A;  2LHL A;  1KFX S;  1G8I A;  1GGZ A;  1S5G Z;  1SL9 A;  3PN7 B;  5KSZ A;  3DF0 B;  2BBM A;  3BUO B;  4PE4 A;  1B7T Z;  1KQM C;  2EC6 B;  2M3W A;  4ORC B;  3BUN B;  3VRQ A;  1K8U A;  2BL0 B;  1QV0 A;  2BE6 A;  1K96 A;  1YUU A;  2KFF A;  1CFF A;  1Y0V H;  3ZNI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...