3KF9A

Crystal structure of the sdcen/skmlck complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
149
structure length
149
Chain Sequence
GLTEEQKQEIREAFDLFDTDGSGTIDAKELKVAMRALGFEPKKEEIKKMIADIDKDGSGTIDFEEFLQMMTAKMGERDSREEIMKAFRLFDDDETGKISFKNLKRVAKELGENMTDEELQEMIDEADRDGDGEVNEEEFFRIMKKTSLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle/calcium-binding protein
molecule keywords Caltractin
publication title Structural features of the complexes formed by Scherffelia dubia centrin
rcsb
source organism Scherffelia dubia
total genus 47
structure length 149
sequence length 149
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3kf9A02
4N5XA 2KFHA 2WOSA 1UHHA 1YUTA 3VROA 1PULA 1TCOB 2PVBA 3D0YA 3DVJA 2ZNEA 3EVVA 2BE6A 1QASA 1BLQA 2F3YA 2LUCA 1KK7Z 2CBLA 2EHBA 1TOPA 2KAVA 1FPWA 1X02A 1CFFA 2BCAA 2EC6C 2K0JA 1SYMA 1S6IA 1A03A 2K2FA 3IQOA 1Y1XA 2GGZA 3A4UB 3DD4A 2K61A 1K93D 2G2BA 1KK8C 4WQ2A 1QX2A 2JC2A 1GGZA 3EK7A 1AJ4A 1DJGA 2CT9A 3BUOB 1J7QA 5HKZA 1YVLA 5DKNA 4WQ3A 1F71A 2E6WA 1EG4A 1CFCA 2OTGB 1ZMZA 3BQ3A 3AKBA 1R2UA 1Q80A 1IQ5A 1WDCB 1SKTA 2M49B 1Y1AA 1YRUB 4PCWA 4YGDB 4PHMA 1IG5A 3DVKA 1NX2A 5AERA 2NCOA 4DCKA 4YI9A 4JWQA 5JJGA 4MRYA 3DVEA 4OKHA 2NXQA 2K7DA 2RGIA 1KQMC 3TUYC 4OVNF 2SCPA 1UUSA 2LVJA 1V1GA 3D10A 3GK1A 1AVSA 2EC6B 4DRWA 2MLEC 1QIVA 4PE4A 4M2OA 1DF0B 1MF8B 1EH2A 4P5OE 2JTZA 1CB1A 1IWQA 1CDLA 1NX1A 5ER5A 1IJ6A 1OMRA 3DF0B 1HT9A 4PE0A 5D7FA 4HREE 4P2YB 1S5GZ 3PATA 3PLFB 4QJ3B 2HPSA 1CNPA 3IQQA 5G08A 5F6TA 1WRKA 2M8UA 3RLZA 2ZFDA 3CWGA 5K89A 1SL9A 2KAYA 2LLTA 4MRXA 4DUQA 2M97A 1M39A 2LUXA 4XYNA 2ZRSA 2K7CA 2M0RA 1IKUA 4QJ5B 1KQMB 3TUYB 1JSAA 1J1EA 5AFPA 1DGUA 4AQJA 3LK1A 3I5IC 4I5NB 1EG3A 3TDIA 1LA0A 5TNCA 2LNKA 1DJZA 4I5JA 1M45A 1YX7A 2BE4A 1SL7A 2H61C 1L2OC 2BBMA 2LMTA 4PDZA 3OB1B 2PMYA 2PASA 5B8IB 1H8BA 1F4OA 4GNKB 2BCBA 3PSRA 3AAJA 2LVIA 1AJ5A 3AAKA 2L2EA 4MZLA 2KQ6A 3NSOA 2QPTA 4YBHB 1BU3A 4MEWA 1Y0VH 4YGEB 2PALA 2F2OA 2JQ6A 1QTXA 1S6CA 4PE7A 5DKRA 2LAPA 3KF9A 1BF5A 1K90D 1J7RA 1A75A 2LE9B 4U8DA 2BL0C 4A4CA 2M1KB 1EJ3A 2HQWA 5CSFA 3CR4X 3BYAA 1FW4A 1YUUA 1KFUS 1DJHA 3TDZA 1D1OA 1YUSA 3FWCA 1SNLA 2JTTA 2KGRA 2M29A 1QX5B 1C07A 1TTXA 2AUCA 3I5HC 3GK2A 4HSZA 1AUIB 1ZACA 3OX5A 1QLKA 4ORCB 4ZCUA 5I2OA 1PK0D 1DJWA 1XFVO 2HF5A 1BR4B 1OQPA 3EK8A 4QJ4B 1UHIA 2BBNA 2JULA 3I5IB 3VRQA 2LVKA 3VRNA 1QS7A 3EKJA 2JWWA 1ALVA 3ZNIA 4YRUA 1XK4C 1L2OB 2ZNDA 4CIDA 1JFJA 1JF0A 1K8UA 1B47A 1DMOA 3OHMB 3WNXB 3BUXB 1TIZA 1JBAA 1SR6C 1FI5A 1LKJA 1OE9B 1K9UA 1KFXS 4HRHA 1CKKA 1J55A 1TCFA 2BCXA 2H2KA 1G4YR 1BR1B 2I2RE 1M63B 2LANA 5D69A 3SG4A 4BY4A 2JT8A 4E68A 3LLEA 4NDCA 2KI6C 2BL0B 5HYDA 3VGOA 2CNPA 2F8PA 1NCZA 1SW8A 3BOWB 2LLUA 2L98A 1WY9A 1W7IB 3DVMA 5FYXA 5BPJA 1NIWA 3PM8A 1KQVA 1QIWA 3WXAA 2LMVA 1AHRA 5HLOA 1MR8A 1DJXA 2LM5A 1XVJA 1TNPA 5JOLA 3I5HB 1FBVA 1EL4A 1KFUL 3SG7A 3O2PA 1CLMA 1CDPA 1K94A 3NSIA 4PE1A 2CCMA 1JWDA 5HKYA 1PALA 3SG6A 1N2DA 2FJUB 3DF0A 4XJKA 1S3PA 5AEQA 2LP3A 2A4JA 1SR6B 3NSKA 1QX7A 5CSIA 2E30A 1R6PA 2JRFA 1CM1A 5CPVA 4ZCVA 1QJTA 2CXJA 4USLA 1IGVA 2AMIA 3CR2A 3BUMB 3RM1A 1NX3A 1W7JB 1KFXL 1OMDA 2KAXA 1GGWA 2EGDA 3PN7C 1B4CA 1A2XA 1S6JA 1B9AA 3EVUA 2F2PA 3TS5C 4UPGA 1SK6D 3CLNA 1FF1A 2I94A 3F45A 2HQ8A 1N65A 2I7AA 1L7ZA 1JUOA 1B7TY 3JVTC 5HKWA 1F8HA 1WLMA 1F54A 1MWNA 2ZKMX 2KGBC 3VRRA 2K7BA 4NDDA 2M7LA 1RECA 2WCBA 1OSAA 4HRGA 4MLWA 1TNQA 3KPXA 3O4YA 4MZJA 3NSLA 1K96A 2PSRA 2COLB 3FS7A 3TZ1A 2ZN9A 1RK9A 2WCFA 4N1FA 4F0ZB 2JXCA 1XA5A 3CTNA 5KSZA 2WCEA 2KYFA 4PHJA 1WLZA 2Y5IA 1YURA 2JT3A 1J7OA 2JNXA 4GBAA 4GGFA 1OMVA 2BKHB 1CMFA 1XFUO 1B8LA 3PN7B 1ALWA 3TS5B 2MA2A 1U5IB 2G9BA 2KOTA 1G33A 5GQQC 1SPYA 1CM4A 2BKIB 4C0KA 1E8AA 3JVTB 1KWOB 1G8IA 3AKAA 1F55A 1B1GA 1Y1UA 2LLSA 1H4BA 1YVHA 5AXIA 1C7WA 2KI6D 3LCPC 2NZ0A 3I5GC 1QXPA 3OP0A 2MLFC 4CPVA 1GQMA 1J1DA 1PSBA 4AQIA 1XFXO 1UURA 1ZOTB 3JTDB 2H61A 5DKQA 3NXAA 1A4PA 3FIAA 1XYDA 1QV0A 1WRLA 2ISDA 2LHLA 2Y4QA 1TNWA 2R2IA 3CS1A 3M0WA 1JFKA 4AOMA 4M2PA 1XFYO 3WHUB 4BY5A 1CFPA 1TN4A 2LHIA 2PRUA 3VRPA 2CTNA 3CZTX 1ODBA 2JXLA 1BOCA 1RROA 2KBIA 1DTLA 1IQ3A 2P6BB 2ZN8A 2KFFA 2KQYA 4YGAA 1B8RA 2KYCA 2OS8C 1YRTB 4NQGA 1CLBA 2HETA 2L4IA 1KK7Y 2JOJA 2LMUA 2Y1NA 1PRWA 3BOWA 1UHKA 1DT7B 5KTYA 1CLLA 2LVVA 1OOJA 1QATA 4MVFA 2MBXA 5I2LA 2D8NA 2GGMA 3H4SE 4GAOA 4JPZB 2LC5A 1BMOA 3SIBA 1NCXA 3SG5A 3I5GB 1JF2A 4FQOA 4PALA 2JPTA 4M2QA 1OZOA 4MSPA 3D0YB 1GJYA 3TDUA 1K95A 2IS9A 1CFDA 3KHEA 2BECA 1XK4A 4MBEA 4ETOA 2LV7A 1QLSA 1MQ1A 2FOTA 2L5XB 2JU0A 3O6BA 4YGCB 1SCVA 2NCPA 2M9GA 4YI8A 4GFTA 1JC2A 1DF0A 1V1FA 4NDBA 1IH0A 5HLVA 1KSMA 2F33A 3IF7A 4PHKA 1NP8A 4CFQA 2JT0A 1S36A 2OS8B 3SG3A 4DIRA 1NPQA 4OCIA 5J3XA 2L4HA 3BUNB 1BG1A 4GGNA 3OB2B 4D1EA 1C7VA 3SIAA 4I5KA 2L51A 1NUBA 4ORAB 3E3RA 1NYAA 3OX6A 1BODA 3I5FC 3EKHA 4A4BA 4Q04A 4ORBB 3C1VA 4YGBB 1K2HA 1M31A 1QVIY 1Y6WA 2K8MB 1QV1A 2LCPA 1EXRA 2M7NA 1KWOC 5I8NA 5I2QA 1A29A 1S5GY 2KNEA 3FWBA 2MRDA 4IL1A 1QVIZ 2FCDA 4MN0A 1YTZC 2MHHA 2O60A 4XJKB 1MXLC 2KFGA 2KI4C 2V53A 4WRIA 1J7PA 1B7TZ 1RFJA 1PVBA 1KK8B 3ZWHA 4C0JA 3JTDC 2K2AA 3HX4A 2M1UA 3A8RA 1RWYA 3KO0A 3PFVA 2MAZA 1WRZA 1BJFA 1LXFC 1MHOA 4MZKA 3EK4A 1FI6A 1AP4A 4ICBA 2NLNA 1AK8A 1KSOA 1IJ5A 4GGFC 1NCYA 3KEVA 1KCYA 3HCMA 1IRJA 5AANA 1MXEA 1ZFSA 2ZRTA 3GK4X 2QACA 4CLNA 1SBJA 1SCMC 4JQ0D 1HQVA 1U5IA 2M3WA 2DOQA 4FTGA 1BT6A 1DJYA 1UP5A 3PALA 4I5LB 5KU1A 3MSEB 1RJVA 2F3ZA 4C0LA 3I5FB 1UHJA 2L0PA 1NWDA 1CTRA 2B1UA 3BXKA 3QRXA 5CSNA 3SJSA 4L9MA 2SASA 4N1GA 2O5GA 1XFWO 3EVRA 2JNFA 2JZIA 3WHTB 2I18A 3O78A 2Q91A 1LINA 2WC8A 3GOFA 3K21A 5PALA 2WORA 2Y1MA 4DS7A 1YR5A 3BUWB 3LK0A 2KHNA 2K7OA 1TRFA 2VRGA 1XFZO 4PHNA 2KI4B 3SG2A 3CR5X 1LVCD 1B8CA 1K9PA 2WNDA 1TNXA 1PVAA 2FCEA 4GUKA 1SRAA 1CDNA 2LP2A 1LA3A 1PSRA 1NSHA 1NX0A 1M46A 2OPOA 2GV5A 4CFRA 1MUXA 5CSJA 1F4QA 1CDMA 1SY9A 1ZUZA 5IBWA 3ICBA 2KBMA 4TNCA 2TN4A 2Q4UA 1OZSA 4OV2A 2MJWB 2AAOA 1S1EA 5ER4X 1CMGA 4R1EA 1RTP1 1XO5A 2L50A 2KDHA 1SL8A 1UWOA 1DGVA 1SCMB 2OTGC 1SMGA 1UHNA 4GPLB 4OR9B 1DJIA 1VRKA 3CGAA 3LL8B 1K9KA 1A75B 1WDCC 1F70A 1YX8A 1DVIA 2KSPA 1S26D 1N0YA
chains in the Genus database with same CATH superfamily
4N5XA 2KFHA 2WOSA 1UHHA 1YUTA 3VROA 1PULA 1TCOB 2PVBA 3D0YA 2QEVA 3DVJA 2ZNEA 3EVVA 2BE6A 1QASA 1BLQA 2F3YA 2LUCA 1KK7Z 2CBLA 2EHBA 1TOPA 2KAVA 1FPWA 1X02A 4C0LA 1CFFA 2BCAA 2EC6C 2K0JA 1SYMA 1S6IA 1A03A 2QEOA 2K2FA 3IQOA 2K60A 2WCLA 1Y1XA 2GGZA 3A4UB 3DD4A 2K61A 1K93D 4INXA 1T14A 2G2BA 1KK8C 4WQ2A 1QX2A 2JC2A 1GGZA 3EK7A 1AJ4A 1DJGA 2CT9A 3BUOB 1J7QA 5HKZA 1YVLA 5DKNA 4WQ3A 1F71A 2E6WA 1EG4A 1DC1A 1CFCA 2OTGB 1ZMZA 3BQ3A 3AKBA 1R2UA 2WCJA 1Q80A 1IQ5A 3D76A 1WDCB 1SKTA 2M49B 1Y1AA 1YRUB 4PCWA 4YGDB 4PHMA 1IG5A 3DVKA 1NX2A 5AERA 2NCOA 4DCKA 3PM2A 3L4LA 4YI9A 4JWQA 5JJGA 4MRYA 3DVEA 4OKHA 2NXQA 2K7DA 2RGIA 1KQMC 3TUYC 4OVNF 2SCPA 1UUSA 2LVJA 1V1GA 3D10A 3SS3A 3GK1A 1AVSA 2EC6B 4DRWA 2MLEC 1QIVA 2WC5A 4PE4A 4M2OA 1DF0B 1MF8B 1EH2A 4P5OE 2JTZA 1CB1A 3UNWA 1IWQA 1CDLA 1NX1A 2GTEA 5ER5A 1IJ6A 1OMRA 3DF0B 1HT9A 3Q8IA 4PE0A 5D7FA 5HL1A 1Z2CB 4HREE 4P2YB 3D77A 1S5GZ 3PATA 3PLFB 4QJ3B 2HPSA 1DELA 5FI2A 3SS4A 1CNPA 3OBVA 3IQQA 5G08A 3S0EA 3RZSA 5FI7A 5F6TA 1WRKA 2M8UA 3RLZA 2ZFDA 3CWGA 5K89A 1SL9A 1IIOA 2KAYA 2LLTA 4MRXA 4DUQA 2M97A 1M39A 2LUXA 4XYNA 2ZRSA 2K7CA 2M0RA 4PT1A 1IKUA 4QJ5B 1KQMB 3TUYB 1JSAA 1J1EA 5AFPA 1DGUA 4AQJA 3LK1A 3I5IC 4I5NB 1EG3A 3TDIA 1LA0A 5TNCA 2LNKA 1DJZA 4I5JA 1M45A 1YX7A 3S0FA 2BE4A 1SL7A 2H61C 1L2OC 2BBMA 2LMTA 4PDZA 3SS5A 3OB1B 2PMYA 2PASA 5B8IB 1H8BA 1F4OA 2P71A 4GNKB 2BCBA 3PSRA 3AAJA 2LVIA 1AJ5A 3AAKA 2L2EA 2WCKA 2WCMA 4MZLA 2KQ6A 5I94A 3NSOA 2QPTA 4YBHB 1BU3A 4MEWA 1Y0VH 4YGEB 5D3OA 1C3ZA 2F2OA 2JQ6A 1QTXA 1S6CA 2PALA 4PE7A 5DKRA 2LAPA 3S0DA 3KF9A 1BF5A 1K90D 3B86A 1J7RA 1A75A 2LE9B 4U8DA 2BL0C 4A4CA 2M1KB 3B6XA 1EJ3A 2HQWA 5CSFA 3CR4X 3BYAA 1FW4A 1YUUA 1KFUS 1DJHA 3TDZA 1D1OA 1YUSA 4INWA 3FWCA 1SNLA 2JTTA 2KGRA 2M29A 1QX5B 1C07A 1TTXA 1OOGA 2AUCA 3I5HC 3GK2A 4HSZA 1AUIB 1ZACA 3OX5A 1QLKA 4ORCB 5EL2A 4ZCUA 1PK0D 5I2OA 1DJWA 1XFVO 2HF5A 1BR4B 1OQPA 3EK8A 3BJHA 4QJ4B 1UHIA 2BBNA 2JULA 3I5IB 3VRQA 2LVKA 3VRNA 1QS7A 2BAPA 2WC6A 3EKJA 2JWWA 1ALVA 3ZNIA 3R1VA 4YRUA 1XK4C 1L2OB 2ZNDA 4CIDA 1JFJA 1JF0A 1K8UA 1B47A 1DMOA 3R72A 3OHMB 3WNXB 3BUXB 1TIZA 1JBAA 1SR6C 1FI5A 1LKJA 1OE9B 1K9UA 1KFXS 4HRHA 1CKKA 1J55A 1TCFA 2BCXA 2H2KA 1G4YR 1BR1B 2I2RE 1M63B 2LANA 5D69A 3SG4A 4BY4A 2JT8A 3V2LA 4E68A 3LLEA 4NDCA 2KI6C 3DYEA 2BL0B 5HYDA 3VGOA 2CNPA 2F8PA 1NCZA 2PYQA 1SW8A 3BOWB 2LLUA 2L98A 1WY9A 1W7IB 1OW4A 3DVMA 5FYXA 1NIWA 3PM8A 5BPJA 1QIWA 1P28A 3WXAA 2LMVA 1AHRA 3D74A 5HLOA 1MR8A 1KQVA 1DJXA 2YGUA 2LM5A 1XVJA 1TNPA 5JOLA 3I5HB 1FBVA 1EL4A 3FE8A 1KFUL 3D73A 3SG7A 3O2PA 1CLMA 4F7FA 1CDPA 1K94A 3NSIA 4PE1A 2QEBA 2CCMA 1JWDA 1SSEB 5HKYA 1PALA 3SG6A 1N2DA 2FJUB 3B88A 2KPHA 3DF0A 4XJKA 1S3PA 5AEQA 2LP3A 1C3YA 2A4JA 3S0GA 1SR6B 3NSKA 1QX7A 5CSIA 2E30A 1R6PA 2JRFA 1CM1A 5CPVA 5DICA 4ZCVA 1QJTA 2CXJA 4USLA 1IGVA 2AMIA 1OOHA 3CR2A 3BUMB 3RM1A 1NX3A 1W7JB 3DXLA 1KFXL 1OMDA 2KAXA 1GGWA 2EGDA 3PN7C 1B4CA 1A2XA 1S6JA 1B9AA 3EVUA 2F2PA 3TS5C 4UPGA 1SK6D 3CLNA 1FF1A 2I94A 3F45A 2HQ8A 1N65A 2JPOA 2I7AA 1L7ZA 1JUOA 1B7TY 3JVTC 5HKWA 1F8HA 1WLMA 1F54A 1MWNA 2ZKMX 2KGBC 3VRRA 2K7BA 4NDDA 2M7LA 1RECA 3O4XA 2WCBA 1OSAA 4HRGA 4MLWA 1TNQA 4IJ7A 3KPXA 3O4YA 4MZJA 3NSLA 1K96A 2PSRA 2COLB 3FS7A 3TZ1A 2ZN9A 1RK9A 2WCFA 4N1FA 4F0ZB 2L2CA 2JXCA 1XA5A 3CTNA 5KSZA 2WCEA 2KYFA 4PHJA 1WLZA 2Y5IA 1YURA 3EG5B 2JT3A 1J7OA 1TWOA 3B87A 2JNXA 3QMEA 4GBAA 3VB1A 4GGFA 1OMVA 2BKHB 3BFAA 1XFUO 1CMFA 2WCHA 4KYNA 1B8LA 3PN7B 3K1EA 1ALWA 3TS5B 2MA2A 1U5IB 2G9BA 2KOTA 1G33A 5GQQC 1SPYA 1CM4A 2BKIB 4C0KA 1E8AA 3JVTB 1KWOB 1TUJA 1G8IA 3AKAA 3NHTA 1F55A 1B1GA 1Y1UA 2LLSA 1H4BA 1YVHA 5AXIA 3OGNA 3L4AA 1C7WA 2KI6D 3LCPC 2NZ0A 3I5GC 1QXPA 3OP0A 2MLFC 1ORGA 3B7AA 5FI6A 4CPVA 1GQMA 1J1DA 1PSBA 4AQIA 1XFXO 1UURA 1ZOTB 3JTDB 2H61A 5DKQA 3NXAA 3R1OA 1A4PA 3FIAA 1XYDA 1QV0A 1WRLA 2ISDA 2LHLA 2Y4QA 1TNWA 2R2IA 3CS1A 3M0WA 1JFKA 4AOMA 4M2PA 1XFYO 3CZ0A 3WHUB 4BY5A 1CFPA 1TN4A 2LHIA 2PRUA 3VRPA 2CTNA 3CZTX 1ODBA 2JXLA 1BOCA 1QWVA 1RROA 2KBIA 1DTLA 3BFHA 1IQ3A 2P6BB 2ZN8A 2KFFA 2KQYA 4YGAA 2BNXA 1B8RA 2KYCA 2OS8C 1YRTB 4NQGA 1CLBA 2HETA 2L4IA 1KK7Y 2JOJA 2LMUA 2Y1NA 1PRWA 3BOWA 1TUZA 1UHKA 1DT7B 4FQTA 5KTYA 1CLLA 2LVVA 1OOJA 1QATA 4MVFA 2MBXA 5I2LA 2D8NA 2GGMA 3H4SE 4GAOA 4JPZB 1Z4HA 2LC5A 1BMOA 2QDIA 3SIBA 1NCXA 3SG5A 3I5GB 1JF2A 4FQOA 4PALA 1FI6A 2JPTA 4M2QA 1OZOA 4MSPA 3D0YB 1GJYA 3TDUA 1K95A 2IS9A 1CFDA 3KHEA 1XK4A 2BECA 4MBEA 4ETOA 2LV7A 1QLSA 1MQ1A 2FOTA 2L5XB 2JU0A 3O6BA 4YGCB 1SCVA 2NCPA 2M9GA 4YI8A 4GFTA 1JC2A 1DF0A 1V1FA 4NDBA 3DY9A 3BFBA 1IH0A 5HLVA 1KSMA 3CYZA 2F33A 3IF7A 3DZTA 4PHKA 1NP8A 4CFQA 2JT0A 1S36A 2OS8B 3SG3A 4DIRA 1NPQA 4OCIA 5J3XA 2L4HA 3BUNB 1BG1A 4GGNA 3OB2B 4D1EA 1C7VA 3SIAA 4I5KA 2L51A 1NUBA 4ORAB 3E3RA 1NYAA 3OX6A 1XFRA 1BODA 3I5FC 3EKHA 4A4BA 4Q04A 4ORBB 3C1VA 4YGBB 1K2HA 1M31A 1QVIY 1Y6WA 2K8MB 2KLDA 1QV1A 2LCPA 1EXRA 2M7NA 3FE6A 1KWOC 5I8NA 5I2QA 1A29A 1S5GY 2H8VA 2KLEA 2KNEA 3FWBA 2MRDA 4IL1A 1QVIZ 2FCDA 4MN0A 1YTZC 2MHHA 2O60A 4XJKB 1MXLC 2KFGA 2KI4C 2V53A 4WRIA 1J7PA 1B7TZ 1RFJA 1PVBA 3D75A 1KK8B 3NGVA 3ZWHA 4C0JA 3JTDC 2K2AA 3HX4A 2M1UA 3A8RA 3CDNA 1RWYA 3KO0A 1DEKA 3PFVA 2MAZA 3R1PA 1WRZA 1BJFA 1LXFC 1MHOA 4MZKA 3EK4A 3FE9A 4OZDA 4ICBA 1AP4A 2NLNA 1AK8A 1KSOA 1IJ5A 3CZ1A 4GGFC 1NCYA 3KEVA 1KCYA 3HCMA 1IRJA 5AANA 1MXEA 1ZFSA 3UO9A 2ZRTA 1GM0A 3N7HA 3GK4X 2QACA 3CABA 4CLNA 1SBJA 3D78A 1SCMC 4JQ0D 1HQVA 1U5IA 2M3WA 2DOQA 4FTGA 1BT6A 1DJYA 1UP5A 3PALA 4I5LB 5KU1A 3MSEB 2L5YA 1RJVA 2F3ZA 3S0BA 2QEHA 1W9ZA 3I5FB 1UHJA 2L0PA 1NWDA 1CTRA 1OOFA 2B1UA 3BXKA 3L47A 3QRXA 5CSNA 3SJSA 4L9MA 2SASA 4N1GA 2O5GA 1XFWO 3EVRA 3IVTA 2JNFA 3CZ2A 2JZIA 3WHTB 1DQEA 2I18A 2Q91A 1LINA 2WC8A 3O78A 3GOFA 3K21A 5PALA 2WORA 2Y1MA 4DS7A 1YR5A 3BUWB 3LK0A 2KHNA 2K7OA 1TRFA 2VRGA 1XFZO 2P70A 4PHNA 2KI4B 3NHIA 3SG2A 3CR5X 1LVCD 1B8CA 1K9PA 2WNDA 1TNXA 1PVAA 2FCEA 2PQLA 4GUKA 4JD9A 1SRAA 1CDNA 2LP2A 1LA3A 1PSRA 1NSHA 1NX0A 1M46A 2OPOA 3PJIA 2ERBA 2GV5A 4CFRA 1MUXA 5CSJA 1F4QA 1CDMA 3S0AA 1SY9A 1ZUZA 5IBWA 3ICBA 2KBMA 4TNCA 2TN4A 2Q4UA 1OZSA 4OV2A 2MJWB 2AAOA 1S1EA 5ER4X 4JKTA 1CMGA 4R1EA 1RTP1 1XO5A 1OOIX 2L50A 2KDHA 1SL8A 1UWOA 1DGVA 1SCMB 2OTGC 1SMGA 1UHNA 4GPLB 4OR9B 1DJIA 1LS8A 1VRKA 3CGAA 3LL8B 1K9KA 1A75B 1WDCC 1F70A 1YX8A 1DVIA 2KSPA 1S26D 1N0YA 2FJYA
chains in the Genus database with same CATH topology
4N5XA 2KFHA 2WOSA 1UHHA 1YUTA 3VROA 1PULA 1TCOB 2PVBA 3D0YA 3DVJA 2ZNEA 3EVVA 2BE6A 1QASA 1BLQA 2F3YA 2LUCA 1KK7Z 2CBLA 2EHBA 1TOPA 2KAVA 1FPWA 1X02A 1CFFA 2BCAA 2EC6C 2K0JA 1SYMA 1S6IA 1A03A 2K2FA 3IQOA 1Y1XA 2GGZA 3A4UB 3DD4A 2K61A 1K93D 2G2BA 1KK8C 4WQ2A 1QX2A 2JC2A 1GGZA 3EK7A 1AJ4A 1DJGA 2CT9A 3BUOB 1J7QA 5HKZA 1YVLA 5DKNA 4WQ3A 1F71A 2E6WA 1EG4A 1CFCA 2OTGB 1ZMZA 3BQ3A 3AKBA 1R2UA 1Q80A 1IQ5A 1WDCB 1SKTA 2M49B 1Y1AA 1YRUB 4PCWA 4YGDB 4PHMA 1IG5A 3DVKA 1NX2A 5AERA 2NCOA 4DCKA 4YI9A 4JWQA 5JJGA 4MRYA 3DVEA 4OKHA 2NXQA 2K7DA 2RGIA 1KQMC 3TUYC 4OVNF 2SCPA 1UUSA 2LVJA 1V1GA 3D10A 3GK1A 1AVSA 2EC6B 4DRWA 2MLEC 1QIVA 4PE4A 4M2OA 1DF0B 1MF8B 1EH2A 4P5OE 2JTZA 1CB1A 1IWQA 1CDLA 1NX1A 5ER5A 1IJ6A 1OMRA 3DF0B 1HT9A 4PE0A 5D7FA 4HREE 4P2YB 1S5GZ 3PATA 3PLFB 4QJ3B 2HPSA 1CNPA 3IQQA 5G08A 5F6TA 1WRKA 2M8UA 3RLZA 2ZFDA 3CWGA 5K89A 1SL9A 2KAYA 2LLTA 4MRXA 4DUQA 2M97A 1M39A 2LUXA 4XYNA 2ZRSA 2K7CA 2M0RA 1IKUA 4QJ5B 1KQMB 3TUYB 1JSAA 1J1EA 5AFPA 1DGUA 4AQJA 3LK1A 3I5IC 4I5NB 1EG3A 3TDIA 1LA0A 5TNCA 2LNKA 1DJZA 4I5JA 1M45A 1YX7A 2BE4A 1SL7A 2H61C 1L2OC 2BBMA 2LMTA 4PDZA 3OB1B 2PMYA 2PASA 5B8IB 1H8BA 1F4OA 4GNKB 2BCBA 3PSRA 3AAJA 2LVIA 1AJ5A 3AAKA 2L2EA 4MZLA 2KQ6A 3NSOA 2QPTA 4YBHB 1BU3A 4MEWA 1Y0VH 4YGEB 2PALA 2F2OA 2JQ6A 1QTXA 1S6CA 4PE7A 5DKRA 2LAPA 3KF9A 1BF5A 1K90D 1J7RA 1A75A 2LE9B 4U8DA 2BL0C 4A4CA 2M1KB 1EJ3A 2HQWA 5CSFA 3CR4X 3BYAA 1FW4A 1YUUA 1KFUS 1DJHA 3TDZA 1D1OA 1YUSA 3FWCA 1SNLA 2JTTA 2KGRA 2M29A 1QX5B 1C07A 1TTXA 2AUCA 3I5HC 3GK2A 4HSZA 1AUIB 1ZACA 3OX5A 1QLKA 4ORCB 4ZCUA 5I2OA 1PK0D 1DJWA 1XFVO 2HF5A 1BR4B 1OQPA 3EK8A 4QJ4B 1UHIA 2BBNA 2JULA 3I5IB 3VRQA 2LVKA 3VRNA 1QS7A 3EKJA 2JWWA 1ALVA 3ZNIA 4YRUA 1XK4C 1L2OB 2ZNDA 4CIDA 1JFJA 1JF0A 1K8UA 1B47A 1DMOA 3OHMB 3WNXB 3BUXB 1TIZA 1JBAA 1SR6C 1FI5A 1LKJA 1OE9B 1K9UA 1KFXS 4HRHA 1CKKA 1J55A 1TCFA 2BCXA 2H2KA 1G4YR 1BR1B 2I2RE 1M63B 2LANA 5D69A 3SG4A 4BY4A 2JT8A 4E68A 3LLEA 4NDCA 2KI6C 2BL0B 5HYDA 3VGOA 2CNPA 2F8PA 1NCZA 1SW8A 3BOWB 2LLUA 2L98A 1WY9A 1W7IB 3DVMA 5FYXA 5BPJA 1NIWA 3PM8A 1KQVA 1QIWA 3WXAA 2LMVA 1AHRA 5HLOA 1MR8A 1DJXA 2LM5A 1XVJA 1TNPA 5JOLA 3I5HB 1FBVA 1EL4A 1KFUL 3SG7A 3O2PA 1CLMA 1CDPA 1K94A 3NSIA 4PE1A 2CCMA 1JWDA 5HKYA 1PALA 3SG6A 1N2DA 2FJUB 3DF0A 4XJKA 1S3PA 5AEQA 2LP3A 2A4JA 1SR6B 3NSKA 1QX7A 5CSIA 2E30A 1R6PA 2JRFA 1CM1A 5CPVA 4ZCVA 1QJTA 2CXJA 4USLA 1IGVA 2AMIA 3CR2A 3BUMB 3RM1A 1NX3A 1W7JB 1KFXL 1OMDA 2KAXA 1GGWA 2EGDA 3PN7C 1B4CA 1A2XA 1S6JA 1B9AA 3EVUA 2F2PA 3TS5C 4UPGA 1SK6D 3CLNA 1FF1A 2I94A 3F45A 2HQ8A 1N65A 2I7AA 1L7ZA 1JUOA 1B7TY 3JVTC 5HKWA 1F8HA 1WLMA 1F54A 1MWNA 2ZKMX 2KGBC 3VRRA 2K7BA 4NDDA 2M7LA 1RECA 2WCBA 1OSAA 4HRGA 4MLWA 1TNQA 3KPXA 3O4YA 4MZJA 3NSLA 1K96A 2PSRA 2COLB 3FS7A 3TZ1A 2ZN9A 1RK9A 2WCFA 4N1FA 4F0ZB 2JXCA 1XA5A 3CTNA 5KSZA 2WCEA 2KYFA 4PHJA 1WLZA 2Y5IA 1YURA 2JT3A 1J7OA 2JNXA 4GBAA 4GGFA 1OMVA 2BKHB 1CMFA 1XFUO 1B8LA 3PN7B 1ALWA 3TS5B 2MA2A 1U5IB 2G9BA 2KOTA 1G33A 5GQQC 1SPYA 1CM4A 2BKIB 4C0KA 1E8AA 3JVTB 1KWOB 1G8IA 3AKAA 1F55A 1B1GA 1Y1UA 2LLSA 1H4BA 1YVHA 5AXIA 1C7WA 2KI6D 3LCPC 2NZ0A 3I5GC 1QXPA 3OP0A 2MLFC 4CPVA 1GQMA 1J1DA 1PSBA 4AQIA 1XFXO 1UURA 1ZOTB 3JTDB 2H61A 5DKQA 3NXAA 1A4PA 3FIAA 1XYDA 1QV0A 1WRLA 2ISDA 2LHLA 2Y4QA 1TNWA 2R2IA 3CS1A 3M0WA 1JFKA 4AOMA 4M2PA 1XFYO 3WHUB 4BY5A 1CFPA 1TN4A 2LHIA 2PRUA 3VRPA 2CTNA 3CZTX 1ODBA 2JXLA 1BOCA 1RROA 2KBIA 1DTLA 1IQ3A 2P6BB 2ZN8A 2KFFA 2KQYA 4YGAA 1B8RA 2KYCA 2OS8C 1YRTB 4NQGA 1CLBA 2HETA 2L4IA 1KK7Y 2JOJA 2LMUA 2Y1NA 1PRWA 3BOWA 1UHKA 1DT7B 5KTYA 1CLLA 2LVVA 1OOJA 1QATA 4MVFA 2MBXA 5I2LA 2D8NA 2GGMA 3H4SE 4GAOA 4JPZB 2LC5A 1BMOA 3SIBA 1NCXA 3SG5A 3I5GB 1JF2A 4FQOA 4PALA 2JPTA 4M2QA 1OZOA 4MSPA 3D0YB 1GJYA 3TDUA 1K95A 2IS9A 1CFDA 3KHEA 2BECA 1XK4A 4MBEA 4ETOA 2LV7A 1QLSA 1MQ1A 2FOTA 2L5XB 2JU0A 3O6BA 4YGCB 1SCVA 2NCPA 2M9GA 4YI8A 4GFTA 1JC2A 1DF0A 1V1FA 4NDBA 1IH0A 5HLVA 1KSMA 2F33A 3IF7A 4PHKA 1NP8A 4CFQA 2JT0A 1S36A 2OS8B 3SG3A 4DIRA 1NPQA 4OCIA 5J3XA 2L4HA 3BUNB 1BG1A 4GGNA 3OB2B 4D1EA 1C7VA 3SIAA 4I5KA 2L51A 1NUBA 4ORAB 3E3RA 1NYAA 3OX6A 1BODA 3I5FC 3EKHA 4A4BA 4Q04A 4ORBB 3C1VA 4YGBB 1K2HA 1M31A 1QVIY 1Y6WA 2K8MB 1QV1A 2LCPA 1EXRA 2M7NA 1KWOC 5I8NA 5I2QA 1A29A 1S5GY 2KNEA 3FWBA 2MRDA 4IL1A 1QVIZ 2FCDA 4MN0A 1YTZC 2MHHA 2O60A 4XJKB 1MXLC 2KFGA 2KI4C 2V53A 4WRIA 1J7PA 1B7TZ 1RFJA 1PVBA 1KK8B 3ZWHA 4C0JA 3JTDC 2K2AA 3HX4A 2M1UA 3A8RA 1RWYA 3KO0A 3PFVA 2MAZA 1WRZA 1BJFA 1LXFC 1MHOA 4MZKA 3EK4A 1FI6A 1AP4A 4ICBA 2NLNA 1AK8A 1KSOA 1IJ5A 4GGFC 1NCYA 3KEVA 1KCYA 3HCMA 1IRJA 5AANA 1MXEA 1ZFSA 2ZRTA 3GK4X 2QACA 4CLNA 1SBJA 1SCMC 4JQ0D 1HQVA 1U5IA 2M3WA 2DOQA 4FTGA 1BT6A 1DJYA 1UP5A 3PALA 4I5LB 5KU1A 3MSEB 1RJVA 2F3ZA 4C0LA 3I5FB 1UHJA 2L0PA 1NWDA 1CTRA 2B1UA 3BXKA 3QRXA 5CSNA 3SJSA 4L9MA 2SASA 4N1GA 2O5GA 1XFWO 3EVRA 2JNFA 2JZIA 3WHTB 2I18A 3O78A 2Q91A 1LINA 2WC8A 3GOFA 3K21A 5PALA 2WORA 2Y1MA 4DS7A 1YR5A 3BUWB 3LK0A 2KHNA 2K7OA 1TRFA 2VRGA 1XFZO 4PHNA 2KI4B 3SG2A 3CR5X 1LVCD 1B8CA 1K9PA 2WNDA 1TNXA 1PVAA 2FCEA 4GUKA 1SRAA 1CDNA 2LP2A 1LA3A 1PSRA 1NSHA 1NX0A 1M46A 2OPOA 2GV5A 4CFRA 1MUXA 5CSJA 1F4QA 1CDMA 1SY9A 1ZUZA 5IBWA 3ICBA 2KBMA 4TNCA 2TN4A 2Q4UA 1OZSA 4OV2A 2MJWB 2AAOA 1S1EA 5ER4X 1CMGA 4R1EA 1RTP1 1XO5A 2L50A 2KDHA 1SL8A 1UWOA 1DGVA 1SCMB 2OTGC 1SMGA 1UHNA 4GPLB 4OR9B 1DJIA 1VRKA 3CGAA 3LL8B 1K9KA 1A75B 1WDCC 1F70A 1YX8A 1DVIA 2KSPA 1S26D 1N0YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N5X A;  2KFH A;  2WOS A;  1UHH A;  1YUT A;  3VRO A;  1PUL A;  1TCO B;  2PVB A;  3D0Y A;  3DVJ A;  2ZNE A;  3EVV A;  2BE6 A;  1QAS A;  1BLQ A;  2F3Y A;  2LUC A;  1KK7 Z;  2CBL A;  2EHB A;  1TOP A;  2KAV A;  1FPW A;  1X02 A;  1CFF A;  2BCA A;  2EC6 C;  2K0J A;  1SYM A;  1S6I A;  1A03 A;  2K2F A;  3IQO A;  1Y1X A;  2GGZ A;  3A4U B;  3DD4 A;  2K61 A;  1K93 D;  2G2B A;  1KK8 C;  4WQ2 A;  1QX2 A;  2JC2 A;  1GGZ A;  3EK7 A;  1AJ4 A;  1DJG A;  2CT9 A;  3BUO B;  1J7Q A;  5HKZ A;  1YVL A;  5DKN A;  4WQ3 A;  1F71 A;  2E6W A;  1EG4 A;  1CFC A;  2OTG B;  1ZMZ A;  3BQ3 A;  3AKB A;  1R2U A;  1Q80 A;  1IQ5 A;  1WDC B;  1SKT A;  2M49 B;  1Y1A A;  1YRU B;  4PCW A;  4YGD B;  4PHM A;  1IG5 A;  3DVK A;  1NX2 A;  5AER A;  2NCO A;  4DCK A;  4YI9 A;  4JWQ A;  5JJG A;  4MRY A;  3DVE A;  4OKH A;  2NXQ A;  2K7D A;  2RGI A;  1KQM C;  3TUY C;  4OVN F;  2SCP A;  1UUS A;  2LVJ A;  1V1G A;  3D10 A;  3GK1 A;  1AVS A;  2EC6 B;  4DRW A;  2MLE C;  1QIV A;  4PE4 A;  4M2O A;  1DF0 B;  1MF8 B;  1EH2 A;  4P5O E;  2JTZ A;  1CB1 A;  1IWQ A;  1CDL A;  1NX1 A;  5ER5 A;  1IJ6 A;  1OMR A;  3DF0 B;  1HT9 A;  4PE0 A;  5D7F A;  4HRE E;  4P2Y B;  1S5G Z;  3PAT A;  3PLF B;  4QJ3 B;  2HPS A;  1CNP A;  3IQQ A;  5G08 A;  5F6T A;  1WRK A;  2M8U A;  3RLZ A;  2ZFD A;  3CWG A;  5K89 A;  1SL9 A;  2KAY A;  2LLT A;  4MRX A;  4DUQ A;  2M97 A;  1M39 A;  2LUX A;  4XYN A;  2ZRS A;  2K7C A;  2M0R A;  1IKU A;  4QJ5 B;  1KQM B;  3TUY B;  1JSA A;  1J1E A;  5AFP A;  1DGU A;  4AQJ A;  3LK1 A;  3I5I C;  4I5N B;  1EG3 A;  3TDI A;  1LA0 A;  5TNC A;  2LNK A;  1DJZ A;  4I5J A;  1M45 A;  1YX7 A;  2BE4 A;  1SL7 A;  2H61 C;  1L2O C;  2BBM A;  2LMT A;  4PDZ A;  3OB1 B;  2PMY A;  2PAS A;  5B8I B;  1H8B A;  1F4O A;  4GNK B;  2BCB A;  3PSR A;  3AAJ A;  2LVI A;  1AJ5 A;  3AAK A;  2L2E A;  4MZL A;  2KQ6 A;  3NSO A;  2QPT A;  4YBH B;  1BU3 A;  4MEW A;  1Y0V H;  4YGE B;  2PAL A;  2F2O A;  2JQ6 A;  1QTX A;  1S6C A;  4PE7 A;  5DKR A;  2LAP A;  3KF9 A;  1BF5 A;  1K90 D;  1J7R A;  1A75 A;  2LE9 B;  4U8D A;  2BL0 C;  4A4C A;  2M1K B;  1EJ3 A;  2HQW A;  5CSF A;  3CR4 X;  3BYA A;  1FW4 A;  1YUU A;  1KFU S;  1DJH A;  3TDZ A;  1D1O A;  1YUS A;  3FWC A;  1SNL A;  2JTT A;  2KGR A;  2M29 A;  1QX5 B;  1C07 A;  1TTX A;  2AUC A;  3I5H C;  3GK2 A;  4HSZ A;  1AUI B;  1ZAC A;  3OX5 A;  1QLK A;  4ORC B;  4ZCU A;  5I2O A;  1PK0 D;  1DJW A;  1XFV O;  2HF5 A;  1BR4 B;  1OQP A;  3EK8 A;  4QJ4 B;  1UHI A;  2BBN A;  2JUL A;  3I5I B;  3VRQ A;  2LVK A;  3VRN A;  1QS7 A;  3EKJ A;  2JWW A;  1ALV A;  3ZNI A;  4YRU A;  1XK4 C;  1L2O B;  2ZND A;  4CID A;  1JFJ A;  1JF0 A;  1K8U A;  1B47 A;  1DMO A;  3OHM B;  3WNX B;  3BUX B;  1TIZ A;  1JBA A;  1SR6 C;  1FI5 A;  1LKJ A;  1OE9 B;  1K9U A;  1KFX S;  4HRH A;  1CKK A;  1J55 A;  1TCF A;  2BCX A;  2H2K A;  1G4Y R;  1BR1 B;  2I2R E;  1M63 B;  2LAN A;  5D69 A;  3SG4 A;  4BY4 A;  2JT8 A;  4E68 A;  3LLE A;  4NDC A;  2KI6 C;  2BL0 B;  5HYD A;  3VGO A;  2CNP A;  2F8P A;  1NCZ A;  1SW8 A;  3BOW B;  2LLU A;  2L98 A;  1WY9 A;  1W7I B;  3DVM A;  5FYX A;  5BPJ A;  1NIW A;  3PM8 A;  1KQV A;  1QIW A;  3WXA A;  2LMV A;  1AHR A;  5HLO A;  1MR8 A;  1DJX A;  2LM5 A;  1XVJ A;  1TNP A;  5JOL A;  3I5H B;  1FBV A;  1EL4 A;  1KFU L;  3SG7 A;  3O2P A;  1CLM A;  1CDP A;  1K94 A;  3NSI A;  4PE1 A;  2CCM A;  1JWD A;  5HKY A;  1PAL A;  3SG6 A;  1N2D A;  2FJU B;  3DF0 A;  4XJK A;  1S3P A;  5AEQ A;  2LP3 A;  2A4J A;  1SR6 B;  3NSK A;  1QX7 A;  5CSI A;  2E30 A;  1R6P A;  2JRF A;  1CM1 A;  5CPV A;  4ZCV A;  1QJT A;  2CXJ A;  4USL A;  1IGV A;  2AMI A;  3CR2 A;  3BUM B;  3RM1 A;  1NX3 A;  1W7J B;  1KFX L;  1OMD A;  2KAX A;  1GGW A;  2EGD A;  3PN7 C;  1B4C A;  1A2X A;  1S6J A;  1B9A A;  3EVU A;  2F2P A;  3TS5 C;  4UPG A;  1SK6 D;  3CLN A;  1FF1 A;  2I94 A;  3F45 A;  2HQ8 A;  1N65 A;  2I7A A;  1L7Z A;  1JUO A;  1B7T Y;  3JVT C;  5HKW A;  1F8H A;  1WLM A;  1F54 A;  1MWN A;  2ZKM X;  2KGB C;  3VRR A;  2K7B A;  4NDD A;  2M7L A;  1REC A;  2WCB A;  1OSA A;  4HRG A;  4MLW A;  1TNQ A;  3KPX A;  3O4Y A;  4MZJ A;  3NSL A;  1K96 A;  2PSR A;  2COL B;  3FS7 A;  3TZ1 A;  2ZN9 A;  1RK9 A;  2WCF A;  4N1F A;  4F0Z B;  2JXC A;  1XA5 A;  3CTN A;  5KSZ A;  2WCE A;  2KYF A;  4PHJ A;  1WLZ A;  2Y5I A;  1YUR A;  2JT3 A;  1J7O A;  2JNX A;  4GBA A;  4GGF A;  1OMV A;  2BKH B;  1CMF A;  1XFU O;  1B8L A;  3PN7 B;  1ALW A;  3TS5 B;  2MA2 A;  1U5I B;  2G9B A;  2KOT A;  1G33 A;  5GQQ C;  1SPY A;  1CM4 A;  2BKI B;  4C0K A;  1E8A A;  3JVT B;  1KWO B;  1G8I A;  3AKA A;  1F55 A;  1B1G A;  1Y1U A;  2LLS A;  1H4B A;  1YVH A;  5AXI A;  1C7W A;  2KI6 D;  3LCP C;  2NZ0 A;  3I5G C;  1QXP A;  3OP0 A;  2MLF C;  4CPV A;  1GQM A;  1J1D A;  1PSB A;  4AQI A;  1XFX O;  1UUR A;  1ZOT B;  3JTD B;  2H61 A;  5DKQ A;  3NXA A;  1A4P A;  3FIA A;  1XYD A;  1QV0 A;  1WRL A;  2ISD A;  2LHL A;  2Y4Q A;  1TNW A;  2R2I A;  3CS1 A;  3M0W A;  1JFK A;  4AOM A;  4M2P A;  1XFY O;  3WHU B;  4BY5 A;  1CFP A;  1TN4 A;  2LHI A;  2PRU A;  3VRP A;  2CTN A;  3CZT X;  1ODB A;  2JXL A;  1BOC A;  1RRO A;  2KBI A;  1DTL A;  1IQ3 A;  2P6B B;  2ZN8 A;  2KFF A;  2KQY A;  4YGA A;  1B8R A;  2KYC A;  2OS8 C;  1YRT B;  4NQG A;  1CLB A;  2HET A;  2L4I A;  1KK7 Y;  2JOJ A;  2LMU A;  2Y1N A;  1PRW A;  3BOW A;  1UHK A;  1DT7 B;  5KTY A;  1CLL A;  2LVV A;  1OOJ A;  1QAT A;  4MVF A;  2MBX A;  5I2L A;  2D8N A;  2GGM A;  3H4S E;  4GAO A;  4JPZ B;  2LC5 A;  1BMO A;  3SIB A;  1NCX A;  3SG5 A;  3I5G B;  1JF2 A;  4FQO A;  4PAL A;  2JPT A;  4M2Q A;  1OZO A;  4MSP A;  3D0Y B;  1GJY A;  3TDU A;  1K95 A;  2IS9 A;  1CFD A;  3KHE A;  2BEC A;  1XK4 A;  4MBE A;  4ETO A;  2LV7 A;  1QLS A;  1MQ1 A;  2FOT A;  2L5X B;  2JU0 A;  3O6B A;  4YGC B;  1SCV A;  2NCP A;  2M9G A;  4YI8 A;  4GFT A;  1JC2 A;  1DF0 A;  1V1F A;  4NDB A;  1IH0 A;  5HLV A;  1KSM A;  2F33 A;  3IF7 A;  4PHK A;  1NP8 A;  4CFQ A;  2JT0 A;  1S36 A;  2OS8 B;  3SG3 A;  4DIR A;  1NPQ A;  4OCI A;  5J3X A;  2L4H A;  3BUN B;  1BG1 A;  4GGN A;  3OB2 B;  4D1E A;  1C7V A;  3SIA A;  4I5K A;  2L51 A;  1NUB A;  4ORA B;  3E3R A;  1NYA A;  3OX6 A;  1BOD A;  3I5F C;  3EKH A;  4A4B A;  4Q04 A;  4ORB B;  3C1V A;  4YGB B;  1K2H A;  1M31 A;  1QVI Y;  1Y6W A;  2K8M B;  1QV1 A;  2LCP A;  1EXR A;  2M7N A;  1KWO C;  5I8N A;  5I2Q A;  1A29 A;  1S5G Y;  2KNE A;  3FWB A;  2MRD A;  4IL1 A;  1QVI Z;  2FCD A;  4MN0 A;  1YTZ C;  2MHH A;  2O60 A;  4XJK B;  1MXL C;  2KFG A;  2KI4 C;  2V53 A;  4WRI A;  1J7P A;  1B7T Z;  1RFJ A;  1PVB A;  1KK8 B;  3ZWH A;  4C0J A;  3JTD C;  2K2A A;  3HX4 A;  2M1U A;  3A8R A;  1RWY A;  3KO0 A;  3PFV A;  2MAZ A;  1WRZ A;  1BJF A;  1LXF C;  1MHO A;  4MZK A;  3EK4 A;  1FI6 A;  1AP4 A;  4ICB A;  2NLN A;  1AK8 A;  1KSO A;  1IJ5 A;  4GGF C;  1NCY A;  3KEV A;  1KCY A;  3HCM A;  1IRJ A;  5AAN A;  1MXE A;  1ZFS A;  2ZRT A;  3GK4 X;  2QAC A;  4CLN A;  1SBJ A;  1SCM C;  4JQ0 D;  1HQV A;  1U5I A;  2M3W A;  2DOQ A;  4FTG A;  1BT6 A;  1DJY A;  1UP5 A;  3PAL A;  4I5L B;  5KU1 A;  3MSE B;  1RJV A;  2F3Z A;  4C0L A;  3I5F B;  1UHJ A;  2L0P A;  1NWD A;  1CTR A;  2B1U A;  3BXK A;  3QRX A;  5CSN A;  3SJS A;  4L9M A;  2SAS A;  4N1G A;  2O5G A;  1XFW O;  3EVR A;  2JNF A;  2JZI A;  3WHT B;  2I18 A;  3O78 A;  2Q91 A;  1LIN A;  2WC8 A;  3GOF A;  3K21 A;  5PAL A;  2WOR A;  2Y1M A;  4DS7 A;  1YR5 A;  3BUW B;  3LK0 A;  2KHN A;  2K7O A;  1TRF A;  2VRG A;  1XFZ O;  4PHN A;  2KI4 B;  3SG2 A;  3CR5 X;  1LVC D;  1B8C A;  1K9P A;  2WND A;  1TNX A;  1PVA A;  2FCE A;  4GUK A;  1SRA A;  1CDN A;  2LP2 A;  1LA3 A;  1PSR A;  1NSH A;  1NX0 A;  1M46 A;  2OPO A;  2GV5 A;  4CFR A;  1MUX A;  5CSJ A;  1F4Q A;  1CDM A;  1SY9 A;  1ZUZ A;  5IBW A;  3ICB A;  2KBM A;  4TNC A;  2TN4 A;  2Q4U A;  1OZS A;  4OV2 A;  2MJW B;  2AAO A;  1S1E A;  5ER4 X;  1CMG A;  4R1E A;  1RTP 1;  1XO5 A;  2L50 A;  2KDH A;  1SL8 A;  1UWO A;  1DGV A;  1SCM B;  2OTG C;  1SMG A;  1UHN A;  4GPL B;  4OR9 B;  1DJI A;  1VRK A;  3CGA A;  3LL8 B;  1K9K A;  1A75 B;  1WDC C;  1F70 A;  1YX8 A;  1DVI A;  2KSP A;  1S26 D;  1N0Y A; 
#chains in the Genus database with same CATH topology
 4N5X A;  2KFH A;  2WOS A;  1UHH A;  1YUT A;  3VRO A;  1PUL A;  1TCO B;  2PVB A;  3D0Y A;  2QEV A;  3DVJ A;  2ZNE A;  3EVV A;  2BE6 A;  1QAS A;  1BLQ A;  2F3Y A;  2LUC A;  1KK7 Z;  2CBL A;  2EHB A;  1TOP A;  2KAV A;  1FPW A;  1X02 A;  4C0L A;  1CFF A;  2BCA A;  2EC6 C;  2K0J A;  1SYM A;  1S6I A;  1A03 A;  2QEO A;  2K2F A;  3IQO A;  2K60 A;  2WCL A;  1Y1X A;  2GGZ A;  3A4U B;  3DD4 A;  2K61 A;  1K93 D;  4INX A;  1T14 A;  2G2B A;  1KK8 C;  4WQ2 A;  1QX2 A;  2JC2 A;  1GGZ A;  3EK7 A;  1AJ4 A;  1DJG A;  2CT9 A;  3BUO B;  1J7Q A;  5HKZ A;  1YVL A;  5DKN A;  4WQ3 A;  1F71 A;  2E6W A;  1EG4 A;  1DC1 A;  1CFC A;  2OTG B;  1ZMZ A;  3BQ3 A;  3AKB A;  1R2U A;  2WCJ A;  1Q80 A;  1IQ5 A;  3D76 A;  1WDC B;  1SKT A;  2M49 B;  1Y1A A;  1YRU B;  4PCW A;  4YGD B;  4PHM A;  1IG5 A;  3DVK A;  1NX2 A;  5AER A;  2NCO A;  4DCK A;  3PM2 A;  3L4L A;  4YI9 A;  4JWQ A;  5JJG A;  4MRY A;  3DVE A;  4OKH A;  2NXQ A;  2K7D A;  2RGI A;  1KQM C;  3TUY C;  4OVN F;  2SCP A;  1UUS A;  2LVJ A;  1V1G A;  3D10 A;  3SS3 A;  3GK1 A;  1AVS A;  2EC6 B;  4DRW A;  2MLE C;  1QIV A;  2WC5 A;  4PE4 A;  4M2O A;  1DF0 B;  1MF8 B;  1EH2 A;  4P5O E;  2JTZ A;  1CB1 A;  3UNW A;  1IWQ A;  1CDL A;  1NX1 A;  2GTE A;  5ER5 A;  1IJ6 A;  1OMR A;  3DF0 B;  1HT9 A;  3Q8I A;  4PE0 A;  5D7F A;  5HL1 A;  1Z2C B;  4HRE E;  4P2Y B;  3D77 A;  1S5G Z;  3PAT A;  3PLF B;  4QJ3 B;  2HPS A;  1DEL A;  5FI2 A;  3SS4 A;  1CNP A;  3OBV A;  3IQQ A;  5G08 A;  3S0E A;  3RZS A;  5FI7 A;  5F6T A;  1WRK A;  2M8U A;  3RLZ A;  2ZFD A;  3CWG A;  5K89 A;  1SL9 A;  1IIO A;  2KAY A;  2LLT A;  4MRX A;  4DUQ A;  2M97 A;  1M39 A;  2LUX A;  4XYN A;  2ZRS A;  2K7C A;  2M0R A;  4PT1 A;  1IKU A;  4QJ5 B;  1KQM B;  3TUY B;  1JSA A;  1J1E A;  5AFP A;  1DGU A;  4AQJ A;  3LK1 A;  3I5I C;  4I5N B;  1EG3 A;  3TDI A;  1LA0 A;  5TNC A;  2LNK A;  1DJZ A;  4I5J A;  1M45 A;  1YX7 A;  3S0F A;  2BE4 A;  1SL7 A;  2H61 C;  1L2O C;  2BBM A;  2LMT A;  4PDZ A;  3SS5 A;  3OB1 B;  2PMY A;  2PAS A;  5B8I B;  1H8B A;  1F4O A;  2P71 A;  4GNK B;  2BCB A;  3PSR A;  3AAJ A;  2LVI A;  1AJ5 A;  3AAK A;  2L2E A;  2WCK A;  2WCM A;  4MZL A;  2KQ6 A;  5I94 A;  3NSO A;  2QPT A;  4YBH B;  1BU3 A;  4MEW A;  1Y0V H;  4YGE B;  5D3O A;  1C3Z A;  2F2O A;  2JQ6 A;  1QTX A;  1S6C A;  2PAL A;  4PE7 A;  5DKR A;  2LAP A;  3S0D A;  3KF9 A;  1BF5 A;  1K90 D;  3B86 A;  1J7R A;  1A75 A;  2LE9 B;  4U8D A;  2BL0 C;  4A4C A;  2M1K B;  3B6X A;  1EJ3 A;  2HQW A;  5CSF A;  3CR4 X;  3BYA A;  1FW4 A;  1YUU A;  1KFU S;  1DJH A;  3TDZ A;  1D1O A;  1YUS A;  4INW A;  3FWC A;  1SNL A;  2JTT A;  2KGR A;  2M29 A;  1QX5 B;  1C07 A;  1TTX A;  1OOG A;  2AUC A;  3I5H C;  3GK2 A;  4HSZ A;  1AUI B;  1ZAC A;  3OX5 A;  1QLK A;  4ORC B;  5EL2 A;  4ZCU A;  1PK0 D;  5I2O A;  1DJW A;  1XFV O;  2HF5 A;  1BR4 B;  1OQP A;  3EK8 A;  3BJH A;  4QJ4 B;  1UHI A;  2BBN A;  2JUL A;  3I5I B;  3VRQ A;  2LVK A;  3VRN A;  1QS7 A;  2BAP A;  2WC6 A;  3EKJ A;  2JWW A;  1ALV A;  3ZNI A;  3R1V A;  4YRU A;  1XK4 C;  1L2O B;  2ZND A;  4CID A;  1JFJ A;  1JF0 A;  1K8U A;  1B47 A;  1DMO A;  3R72 A;  3OHM B;  3WNX B;  3BUX B;  1TIZ A;  1JBA A;  1SR6 C;  1FI5 A;  1LKJ A;  1OE9 B;  1K9U A;  1KFX S;  4HRH A;  1CKK A;  1J55 A;  1TCF A;  2BCX A;  2H2K A;  1G4Y R;  1BR1 B;  2I2R E;  1M63 B;  2LAN A;  5D69 A;  3SG4 A;  4BY4 A;  2JT8 A;  3V2L A;  4E68 A;  3LLE A;  4NDC A;  2KI6 C;  3DYE A;  2BL0 B;  5HYD A;  3VGO A;  2CNP A;  2F8P A;  1NCZ A;  2PYQ A;  1SW8 A;  3BOW B;  2LLU A;  2L98 A;  1WY9 A;  1W7I B;  1OW4 A;  3DVM A;  5FYX A;  1NIW A;  3PM8 A;  5BPJ A;  1QIW A;  1P28 A;  3WXA A;  2LMV A;  1AHR A;  3D74 A;  5HLO A;  1MR8 A;  1KQV A;  1DJX A;  2YGU A;  2LM5 A;  1XVJ A;  1TNP A;  5JOL A;  3I5H B;  1FBV A;  1EL4 A;  3FE8 A;  1KFU L;  3D73 A;  3SG7 A;  3O2P A;  1CLM A;  4F7F A;  1CDP A;  1K94 A;  3NSI A;  4PE1 A;  2QEB A;  2CCM A;  1JWD A;  1SSE B;  5HKY A;  1PAL A;  3SG6 A;  1N2D A;  2FJU B;  3B88 A;  2KPH A;  3DF0 A;  4XJK A;  1S3P A;  5AEQ A;  2LP3 A;  1C3Y A;  2A4J A;  3S0G A;  1SR6 B;  3NSK A;  1QX7 A;  5CSI A;  2E30 A;  1R6P A;  2JRF A;  1CM1 A;  5CPV A;  5DIC A;  4ZCV A;  1QJT A;  2CXJ A;  4USL A;  1IGV A;  2AMI A;  1OOH A;  3CR2 A;  3BUM B;  3RM1 A;  1NX3 A;  1W7J B;  3DXL A;  1KFX L;  1OMD A;  2KAX A;  1GGW A;  2EGD A;  3PN7 C;  1B4C A;  1A2X A;  1S6J A;  1B9A A;  3EVU A;  2F2P A;  3TS5 C;  4UPG A;  1SK6 D;  3CLN A;  1FF1 A;  2I94 A;  3F45 A;  2HQ8 A;  1N65 A;  2JPO A;  2I7A A;  1L7Z A;  1JUO A;  1B7T Y;  3JVT C;  5HKW A;  1F8H A;  1WLM A;  1F54 A;  1MWN A;  2ZKM X;  2KGB C;  3VRR A;  2K7B A;  4NDD A;  2M7L A;  1REC A;  3O4X A;  2WCB A;  1OSA A;  4HRG A;  4MLW A;  1TNQ A;  4IJ7 A;  3KPX A;  3O4Y A;  4MZJ A;  3NSL A;  1K96 A;  2PSR A;  2COL B;  3FS7 A;  3TZ1 A;  2ZN9 A;  1RK9 A;  2WCF A;  4N1F A;  4F0Z B;  2L2C A;  2JXC A;  1XA5 A;  3CTN A;  5KSZ A;  2WCE A;  2KYF A;  4PHJ A;  1WLZ A;  2Y5I A;  1YUR A;  3EG5 B;  2JT3 A;  1J7O A;  1TWO A;  3B87 A;  2JNX A;  3QME A;  4GBA A;  3VB1 A;  4GGF A;  1OMV A;  2BKH B;  3BFA A;  1XFU O;  1CMF A;  2WCH A;  4KYN A;  1B8L A;  3PN7 B;  3K1E A;  1ALW A;  3TS5 B;  2MA2 A;  1U5I B;  2G9B A;  2KOT A;  1G33 A;  5GQQ C;  1SPY A;  1CM4 A;  2BKI B;  4C0K A;  1E8A A;  3JVT B;  1KWO B;  1TUJ A;  1G8I A;  3AKA A;  3NHT A;  1F55 A;  1B1G A;  1Y1U A;  2LLS A;  1H4B A;  1YVH A;  5AXI A;  3OGN A;  3L4A A;  1C7W A;  2KI6 D;  3LCP C;  2NZ0 A;  3I5G C;  1QXP A;  3OP0 A;  2MLF C;  1ORG A;  3B7A A;  5FI6 A;  4CPV A;  1GQM A;  1J1D A;  1PSB A;  4AQI A;  1XFX O;  1UUR A;  1ZOT B;  3JTD B;  2H61 A;  5DKQ A;  3NXA A;  3R1O A;  1A4P A;  3FIA A;  1XYD A;  1QV0 A;  1WRL A;  2ISD A;  2LHL A;  2Y4Q A;  1TNW A;  2R2I A;  3CS1 A;  3M0W A;  1JFK A;  4AOM A;  4M2P A;  1XFY O;  3CZ0 A;  3WHU B;  4BY5 A;  1CFP A;  1TN4 A;  2LHI A;  2PRU A;  3VRP A;  2CTN A;  3CZT X;  1ODB A;  2JXL A;  1BOC A;  1QWV A;  1RRO A;  2KBI A;  1DTL A;  3BFH A;  1IQ3 A;  2P6B B;  2ZN8 A;  2KFF A;  2KQY A;  4YGA A;  2BNX A;  1B8R A;  2KYC A;  2OS8 C;  1YRT B;  4NQG A;  1CLB A;  2HET A;  2L4I A;  1KK7 Y;  2JOJ A;  2LMU A;  2Y1N A;  1PRW A;  3BOW A;  1TUZ A;  1UHK A;  1DT7 B;  4FQT A;  5KTY A;  1CLL A;  2LVV A;  1OOJ A;  1QAT A;  4MVF A;  2MBX A;  5I2L A;  2D8N A;  2GGM A;  3H4S E;  4GAO A;  4JPZ B;  1Z4H A;  2LC5 A;  1BMO A;  2QDI A;  3SIB A;  1NCX A;  3SG5 A;  3I5G B;  1JF2 A;  4FQO A;  4PAL A;  1FI6 A;  2JPT A;  4M2Q A;  1OZO A;  4MSP A;  3D0Y B;  1GJY A;  3TDU A;  1K95 A;  2IS9 A;  1CFD A;  3KHE A;  1XK4 A;  2BEC A;  4MBE A;  4ETO A;  2LV7 A;  1QLS A;  1MQ1 A;  2FOT A;  2L5X B;  2JU0 A;  3O6B A;  4YGC B;  1SCV A;  2NCP A;  2M9G A;  4YI8 A;  4GFT A;  1JC2 A;  1DF0 A;  1V1F A;  4NDB A;  3DY9 A;  3BFB A;  1IH0 A;  5HLV A;  1KSM A;  3CYZ A;  2F33 A;  3IF7 A;  3DZT A;  4PHK A;  1NP8 A;  4CFQ A;  2JT0 A;  1S36 A;  2OS8 B;  3SG3 A;  4DIR A;  1NPQ A;  4OCI A;  5J3X A;  2L4H A;  3BUN B;  1BG1 A;  4GGN A;  3OB2 B;  4D1E A;  1C7V A;  3SIA A;  4I5K A;  2L51 A;  1NUB A;  4ORA B;  3E3R A;  1NYA A;  3OX6 A;  1XFR A;  1BOD A;  3I5F C;  3EKH A;  4A4B A;  4Q04 A;  4ORB B;  3C1V A;  4YGB B;  1K2H A;  1M31 A;  1QVI Y;  1Y6W A;  2K8M B;  2KLD A;  1QV1 A;  2LCP A;  1EXR A;  2M7N A;  3FE6 A;  1KWO C;  5I8N A;  5I2Q A;  1A29 A;  1S5G Y;  2H8V A;  2KLE A;  2KNE A;  3FWB A;  2MRD A;  4IL1 A;  1QVI Z;  2FCD A;  4MN0 A;  1YTZ C;  2MHH A;  2O60 A;  4XJK B;  1MXL C;  2KFG A;  2KI4 C;  2V53 A;  4WRI A;  1J7P A;  1B7T Z;  1RFJ A;  1PVB A;  3D75 A;  1KK8 B;  3NGV A;  3ZWH A;  4C0J A;  3JTD C;  2K2A A;  3HX4 A;  2M1U A;  3A8R A;  3CDN A;  1RWY A;  3KO0 A;  1DEK A;  3PFV A;  2MAZ A;  3R1P A;  1WRZ A;  1BJF A;  1LXF C;  1MHO A;  4MZK A;  3EK4 A;  3FE9 A;  4OZD A;  4ICB A;  1AP4 A;  2NLN A;  1AK8 A;  1KSO A;  1IJ5 A;  3CZ1 A;  4GGF C;  1NCY A;  3KEV A;  1KCY A;  3HCM A;  1IRJ A;  5AAN A;  1MXE A;  1ZFS A;  3UO9 A;  2ZRT A;  1GM0 A;  3N7H A;  3GK4 X;  2QAC A;  3CAB A;  4CLN A;  1SBJ A;  3D78 A;  1SCM C;  4JQ0 D;  1HQV A;  1U5I A;  2M3W A;  2DOQ A;  4FTG A;  1BT6 A;  1DJY A;  1UP5 A;  3PAL A;  4I5L B;  5KU1 A;  3MSE B;  2L5Y A;  1RJV A;  2F3Z A;  3S0B A;  2QEH A;  1W9Z A;  3I5F B;  1UHJ A;  2L0P A;  1NWD A;  1CTR A;  1OOF A;  2B1U A;  3BXK A;  3L47 A;  3QRX A;  5CSN A;  3SJS A;  4L9M A;  2SAS A;  4N1G A;  2O5G A;  1XFW O;  3EVR A;  3IVT A;  2JNF A;  3CZ2 A;  2JZI A;  3WHT B;  1DQE A;  2I18 A;  2Q91 A;  1LIN A;  2WC8 A;  3O78 A;  3GOF A;  3K21 A;  5PAL A;  2WOR A;  2Y1M A;  4DS7 A;  1YR5 A;  3BUW B;  3LK0 A;  2KHN A;  2K7O A;  1TRF A;  2VRG A;  1XFZ O;  2P70 A;  4PHN A;  2KI4 B;  3NHI A;  3SG2 A;  3CR5 X;  1LVC D;  1B8C A;  1K9P A;  2WND A;  1TNX A;  1PVA A;  2FCE A;  2PQL A;  4GUK A;  4JD9 A;  1SRA A;  1CDN A;  2LP2 A;  1LA3 A;  1PSR A;  1NSH A;  1NX0 A;  1M46 A;  2OPO A;  3PJI A;  2ERB A;  2GV5 A;  4CFR A;  1MUX A;  5CSJ A;  1F4Q A;  1CDM A;  3S0A A;  1SY9 A;  1ZUZ A;  5IBW A;  3ICB A;  2KBM A;  4TNC A;  2TN4 A;  2Q4U A;  1OZS A;  4OV2 A;  2MJW B;  2AAO A;  1S1E A;  5ER4 X;  4JKT A;  1CMG A;  4R1E A;  1RTP 1;  1XO5 A;  1OOI X;  2L50 A;  2KDH A;  1SL8 A;  1UWO A;  1DGV A;  1SCM B;  2OTG C;  1SMG A;  1UHN A;  4GPL B;  4OR9 B;  1DJI A;  1LS8 A;  1VRK A;  3CGA A;  3LL8 B;  1K9K A;  1A75 B;  1WDC C;  1F70 A;  1YX8 A;  1DVI A;  2KSP A;  1S26 D;  1N0Y A;  2FJY A; 
#chains in the Genus database with same CATH homology
 4N5X A;  2KFH A;  2WOS A;  1UHH A;  1YUT A;  3VRO A;  1PUL A;  1TCO B;  2PVB A;  3D0Y A;  3DVJ A;  2ZNE A;  3EVV A;  2BE6 A;  1QAS A;  1BLQ A;  2F3Y A;  2LUC A;  1KK7 Z;  2CBL A;  2EHB A;  1TOP A;  2KAV A;  1FPW A;  1X02 A;  1CFF A;  2BCA A;  2EC6 C;  2K0J A;  1SYM A;  1S6I A;  1A03 A;  2K2F A;  3IQO A;  1Y1X A;  2GGZ A;  3A4U B;  3DD4 A;  2K61 A;  1K93 D;  2G2B A;  1KK8 C;  4WQ2 A;  1QX2 A;  2JC2 A;  1GGZ A;  3EK7 A;  1AJ4 A;  1DJG A;  2CT9 A;  3BUO B;  1J7Q A;  5HKZ A;  1YVL A;  5DKN A;  4WQ3 A;  1F71 A;  2E6W A;  1EG4 A;  1CFC A;  2OTG B;  1ZMZ A;  3BQ3 A;  3AKB A;  1R2U A;  1Q80 A;  1IQ5 A;  1WDC B;  1SKT A;  2M49 B;  1Y1A A;  1YRU B;  4PCW A;  4YGD B;  4PHM A;  1IG5 A;  3DVK A;  1NX2 A;  5AER A;  2NCO A;  4DCK A;  4YI9 A;  4JWQ A;  5JJG A;  4MRY A;  3DVE A;  4OKH A;  2NXQ A;  2K7D A;  2RGI A;  1KQM C;  3TUY C;  4OVN F;  2SCP A;  1UUS A;  2LVJ A;  1V1G A;  3D10 A;  3GK1 A;  1AVS A;  2EC6 B;  4DRW A;  2MLE C;  1QIV A;  4PE4 A;  4M2O A;  1DF0 B;  1MF8 B;  1EH2 A;  4P5O E;  2JTZ A;  1CB1 A;  1IWQ A;  1CDL A;  1NX1 A;  5ER5 A;  1IJ6 A;  1OMR A;  3DF0 B;  1HT9 A;  4PE0 A;  5D7F A;  4HRE E;  4P2Y B;  1S5G Z;  3PAT A;  3PLF B;  4QJ3 B;  2HPS A;  1CNP A;  3IQQ A;  5G08 A;  5F6T A;  1WRK A;  2M8U A;  3RLZ A;  2ZFD A;  3CWG A;  5K89 A;  1SL9 A;  2KAY A;  2LLT A;  4MRX A;  4DUQ A;  2M97 A;  1M39 A;  2LUX A;  4XYN A;  2ZRS A;  2K7C A;  2M0R A;  1IKU A;  4QJ5 B;  1KQM B;  3TUY B;  1JSA A;  1J1E A;  5AFP A;  1DGU A;  4AQJ A;  3LK1 A;  3I5I C;  4I5N B;  1EG3 A;  3TDI A;  1LA0 A;  5TNC A;  2LNK A;  1DJZ A;  4I5J A;  1M45 A;  1YX7 A;  2BE4 A;  1SL7 A;  2H61 C;  1L2O C;  2BBM A;  2LMT A;  4PDZ A;  3OB1 B;  2PMY A;  2PAS A;  5B8I B;  1H8B A;  1F4O A;  4GNK B;  2BCB A;  3PSR A;  3AAJ A;  2LVI A;  1AJ5 A;  3AAK A;  2L2E A;  4MZL A;  2KQ6 A;  3NSO A;  2QPT A;  4YBH B;  1BU3 A;  4MEW A;  1Y0V H;  4YGE B;  2PAL A;  2F2O A;  2JQ6 A;  1QTX A;  1S6C A;  4PE7 A;  5DKR A;  2LAP A;  3KF9 A;  1BF5 A;  1K90 D;  1J7R A;  1A75 A;  2LE9 B;  4U8D A;  2BL0 C;  4A4C A;  2M1K B;  1EJ3 A;  2HQW A;  5CSF A;  3CR4 X;  3BYA A;  1FW4 A;  1YUU A;  1KFU S;  1DJH A;  3TDZ A;  1D1O A;  1YUS A;  3FWC A;  1SNL A;  2JTT A;  2KGR A;  2M29 A;  1QX5 B;  1C07 A;  1TTX A;  2AUC A;  3I5H C;  3GK2 A;  4HSZ A;  1AUI B;  1ZAC A;  3OX5 A;  1QLK A;  4ORC B;  4ZCU A;  5I2O A;  1PK0 D;  1DJW A;  1XFV O;  2HF5 A;  1BR4 B;  1OQP A;  3EK8 A;  4QJ4 B;  1UHI A;  2BBN A;  2JUL A;  3I5I B;  3VRQ A;  2LVK A;  3VRN A;  1QS7 A;  3EKJ A;  2JWW A;  1ALV A;  3ZNI A;  4YRU A;  1XK4 C;  1L2O B;  2ZND A;  4CID A;  1JFJ A;  1JF0 A;  1K8U A;  1B47 A;  1DMO A;  3OHM B;  3WNX B;  3BUX B;  1TIZ A;  1JBA A;  1SR6 C;  1FI5 A;  1LKJ A;  1OE9 B;  1K9U A;  1KFX S;  4HRH A;  1CKK A;  1J55 A;  1TCF A;  2BCX A;  2H2K A;  1G4Y R;  1BR1 B;  2I2R E;  1M63 B;  2LAN A;  5D69 A;  3SG4 A;  4BY4 A;  2JT8 A;  4E68 A;  3LLE A;  4NDC A;  2KI6 C;  2BL0 B;  5HYD A;  3VGO A;  2CNP A;  2F8P A;  1NCZ A;  1SW8 A;  3BOW B;  2LLU A;  2L98 A;  1WY9 A;  1W7I B;  3DVM A;  5FYX A;  5BPJ A;  1NIW A;  3PM8 A;  1KQV A;  1QIW A;  3WXA A;  2LMV A;  1AHR A;  5HLO A;  1MR8 A;  1DJX A;  2LM5 A;  1XVJ A;  1TNP A;  5JOL A;  3I5H B;  1FBV A;  1EL4 A;  1KFU L;  3SG7 A;  3O2P A;  1CLM A;  1CDP A;  1K94 A;  3NSI A;  4PE1 A;  2CCM A;  1JWD A;  5HKY A;  1PAL A;  3SG6 A;  1N2D A;  2FJU B;  3DF0 A;  4XJK A;  1S3P A;  5AEQ A;  2LP3 A;  2A4J A;  1SR6 B;  3NSK A;  1QX7 A;  5CSI A;  2E30 A;  1R6P A;  2JRF A;  1CM1 A;  5CPV A;  4ZCV A;  1QJT A;  2CXJ A;  4USL A;  1IGV A;  2AMI A;  3CR2 A;  3BUM B;  3RM1 A;  1NX3 A;  1W7J B;  1KFX L;  1OMD A;  2KAX A;  1GGW A;  2EGD A;  3PN7 C;  1B4C A;  1A2X A;  1S6J A;  1B9A A;  3EVU A;  2F2P A;  3TS5 C;  4UPG A;  1SK6 D;  3CLN A;  1FF1 A;  2I94 A;  3F45 A;  2HQ8 A;  1N65 A;  2I7A A;  1L7Z A;  1JUO A;  1B7T Y;  3JVT C;  5HKW A;  1F8H A;  1WLM A;  1F54 A;  1MWN A;  2ZKM X;  2KGB C;  3VRR A;  2K7B A;  4NDD A;  2M7L A;  1REC A;  2WCB A;  1OSA A;  4HRG A;  4MLW A;  1TNQ A;  3KPX A;  3O4Y A;  4MZJ A;  3NSL A;  1K96 A;  2PSR A;  2COL B;  3FS7 A;  3TZ1 A;  2ZN9 A;  1RK9 A;  2WCF A;  4N1F A;  4F0Z B;  2JXC A;  1XA5 A;  3CTN A;  5KSZ A;  2WCE A;  2KYF A;  4PHJ A;  1WLZ A;  2Y5I A;  1YUR A;  2JT3 A;  1J7O A;  2JNX A;  4GBA A;  4GGF A;  1OMV A;  2BKH B;  1CMF A;  1XFU O;  1B8L A;  3PN7 B;  1ALW A;  3TS5 B;  2MA2 A;  1U5I B;  2G9B A;  2KOT A;  1G33 A;  5GQQ C;  1SPY A;  1CM4 A;  2BKI B;  4C0K A;  1E8A A;  3JVT B;  1KWO B;  1G8I A;  3AKA A;  1F55 A;  1B1G A;  1Y1U A;  2LLS A;  1H4B A;  1YVH A;  5AXI A;  1C7W A;  2KI6 D;  3LCP C;  2NZ0 A;  3I5G C;  1QXP A;  3OP0 A;  2MLF C;  4CPV A;  1GQM A;  1J1D A;  1PSB A;  4AQI A;  1XFX O;  1UUR A;  1ZOT B;  3JTD B;  2H61 A;  5DKQ A;  3NXA A;  1A4P A;  3FIA A;  1XYD A;  1QV0 A;  1WRL A;  2ISD A;  2LHL A;  2Y4Q A;  1TNW A;  2R2I A;  3CS1 A;  3M0W A;  1JFK A;  4AOM A;  4M2P A;  1XFY O;  3WHU B;  4BY5 A;  1CFP A;  1TN4 A;  2LHI A;  2PRU A;  3VRP A;  2CTN A;  3CZT X;  1ODB A;  2JXL A;  1BOC A;  1RRO A;  2KBI A;  1DTL A;  1IQ3 A;  2P6B B;  2ZN8 A;  2KFF A;  2KQY A;  4YGA A;  1B8R A;  2KYC A;  2OS8 C;  1YRT B;  4NQG A;  1CLB A;  2HET A;  2L4I A;  1KK7 Y;  2JOJ A;  2LMU A;  2Y1N A;  1PRW A;  3BOW A;  1UHK A;  1DT7 B;  5KTY A;  1CLL A;  2LVV A;  1OOJ A;  1QAT A;  4MVF A;  2MBX A;  5I2L A;  2D8N A;  2GGM A;  3H4S E;  4GAO A;  4JPZ B;  2LC5 A;  1BMO A;  3SIB A;  1NCX A;  3SG5 A;  3I5G B;  1JF2 A;  4FQO A;  4PAL A;  2JPT A;  4M2Q A;  1OZO A;  4MSP A;  3D0Y B;  1GJY A;  3TDU A;  1K95 A;  2IS9 A;  1CFD A;  3KHE A;  2BEC A;  1XK4 A;  4MBE A;  4ETO A;  2LV7 A;  1QLS A;  1MQ1 A;  2FOT A;  2L5X B;  2JU0 A;  3O6B A;  4YGC B;  1SCV A;  2NCP A;  2M9G A;  4YI8 A;  4GFT A;  1JC2 A;  1DF0 A;  1V1F A;  4NDB A;  1IH0 A;  5HLV A;  1KSM A;  2F33 A;  3IF7 A;  4PHK A;  1NP8 A;  4CFQ A;  2JT0 A;  1S36 A;  2OS8 B;  3SG3 A;  4DIR A;  1NPQ A;  4OCI A;  5J3X A;  2L4H A;  3BUN B;  1BG1 A;  4GGN A;  3OB2 B;  4D1E A;  1C7V A;  3SIA A;  4I5K A;  2L51 A;  1NUB A;  4ORA B;  3E3R A;  1NYA A;  3OX6 A;  1BOD A;  3I5F C;  3EKH A;  4A4B A;  4Q04 A;  4ORB B;  3C1V A;  4YGB B;  1K2H A;  1M31 A;  1QVI Y;  1Y6W A;  2K8M B;  1QV1 A;  2LCP A;  1EXR A;  2M7N A;  1KWO C;  5I8N A;  5I2Q A;  1A29 A;  1S5G Y;  2KNE A;  3FWB A;  2MRD A;  4IL1 A;  1QVI Z;  2FCD A;  4MN0 A;  1YTZ C;  2MHH A;  2O60 A;  4XJK B;  1MXL C;  2KFG A;  2KI4 C;  2V53 A;  4WRI A;  1J7P A;  1B7T Z;  1RFJ A;  1PVB A;  1KK8 B;  3ZWH A;  4C0J A;  3JTD C;  2K2A A;  3HX4 A;  2M1U A;  3A8R A;  1RWY A;  3KO0 A;  3PFV A;  2MAZ A;  1WRZ A;  1BJF A;  1LXF C;  1MHO A;  4MZK A;  3EK4 A;  1FI6 A;  1AP4 A;  4ICB A;  2NLN A;  1AK8 A;  1KSO A;  1IJ5 A;  4GGF C;  1NCY A;  3KEV A;  1KCY A;  3HCM A;  1IRJ A;  5AAN A;  1MXE A;  1ZFS A;  2ZRT A;  3GK4 X;  2QAC A;  4CLN A;  1SBJ A;  1SCM C;  4JQ0 D;  1HQV A;  1U5I A;  2M3W A;  2DOQ A;  4FTG A;  1BT6 A;  1DJY A;  1UP5 A;  3PAL A;  4I5L B;  5KU1 A;  3MSE B;  1RJV A;  2F3Z A;  4C0L A;  3I5F B;  1UHJ A;  2L0P A;  1NWD A;  1CTR A;  2B1U A;  3BXK A;  3QRX A;  5CSN A;  3SJS A;  4L9M A;  2SAS A;  4N1G A;  2O5G A;  1XFW O;  3EVR A;  2JNF A;  2JZI A;  3WHT B;  2I18 A;  3O78 A;  2Q91 A;  1LIN A;  2WC8 A;  3GOF A;  3K21 A;  5PAL A;  2WOR A;  2Y1M A;  4DS7 A;  1YR5 A;  3BUW B;  3LK0 A;  2KHN A;  2K7O A;  1TRF A;  2VRG A;  1XFZ O;  4PHN A;  2KI4 B;  3SG2 A;  3CR5 X;  1LVC D;  1B8C A;  1K9P A;  2WND A;  1TNX A;  1PVA A;  2FCE A;  4GUK A;  1SRA A;  1CDN A;  2LP2 A;  1LA3 A;  1PSR A;  1NSH A;  1NX0 A;  1M46 A;  2OPO A;  2GV5 A;  4CFR A;  1MUX A;  5CSJ A;  1F4Q A;  1CDM A;  1SY9 A;  1ZUZ A;  5IBW A;  3ICB A;  2KBM A;  4TNC A;  2TN4 A;  2Q4U A;  1OZS A;  4OV2 A;  2MJW B;  2AAO A;  1S1E A;  5ER4 X;  1CMG A;  4R1E A;  1RTP 1;  1XO5 A;  2L50 A;  2KDH A;  1SL8 A;  1UWO A;  1DGV A;  1SCM B;  2OTG C;  1SMG A;  1UHN A;  4GPL B;  4OR9 B;  1DJI A;  1VRK A;  3CGA A;  3LL8 B;  1K9K A;  1A75 B;  1WDC C;  1F70 A;  1YX8 A;  1DVI A;  2KSP A;  1S26 D;  1N0Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...