1YX8A

Nmr structure of calsensin, 20 low energy structures.
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
83
structure length
83
Chain Sequence
MACKVKAELEAAFKKLDANGDGYVTALELQTFMVTLDAYKALSKDKVKEASAKLIKMADKNSDGKISKEEFLNANAELLCQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calsensin
publication title Solution structure and backbone dynamics of Calsensin, an invertebrate neuronal calcium-binding protein.
pubmed doi rcsb
source organism Haemopis marmorata
molecule tags Metal binding protein
total genus 12
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2005-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13202 EF-hand_5 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1yx8A00
4DCKA 1TNXA 2L4IA 4AQJA 1AHRA 4P5OE 1TOPA 1YRUB 4GBAA 2JC2A 2Y1MA 4MN0A 1XK4C 1GJYA 3RM1A 1GGZA 1CFCA 1WLZA 2GGMA 1OMDA 4Q04A 3TZ1A 1FF1A 2F2PA 3FS7A 4JQ0D 5J3XA 4ETOA 3IQOA 1L7ZA 4YBHB 1M46A 4HRGA 4C0LA 3EKJA 1JBAA 1AVSA 2M7LA 1YRTB 1PSBA 1Y0VH 4DRWA 1LINA 1CKKA 2ZNEA 1ZACA 1DTLA 3TUYB 2OTGB 4BY5A 4USLA 4PALA 1NX2A 2BL0B 1G4YR 1HQVA 1BR1B 1QVIY 2PRUA 3C1VA 3I5FB 2BCAA 3GK4X 2LP2A 2BBNA 1A75A 1BODA 2CBLA 1JUOA 1SPYA 1WRKA 4UPGA 1N65A 2L5XB 1DJZA 1TCFA 3NXAA 1CMFA 1F8HA 2WCEA 3E3RA 3I5HC 2TN4A 4DIRA 1KQMC 4M2QA 1H4BA 1JSAA 5CSJA 1RJVA 2O60A 1XK4A 1DMOA 5DKNA 1M45A 4OV2A 4MRXA 1M31A 3CS1A 2KQ6A 1CDNA 1B7TY 1CDMA 1SL7A 1Y6WA 1VRKA 2M7NA 2P6BB 1B8LA 1NX0A 5HKYA 2FOTA 1ODBA 1R6PA 1XFUO 1YR5A 2HETA 5I2LA 1NCZA 3FWCA 4GNKB 3VGOA 1EG4A 1DJYA 1KK7Z 1UURA 5K89A 3LCPC 5HLOA 5ER5A 5KU1A 1EJ3A 2MJWB 1SCVA 2KAVA 2PALA 1WRZA 1FI5A 2LMUA 1PULA 3EK7A 3TDUA 4XJKA 1NPQA 1MR8A 3LK1A 2ZFDA 1XFYO 2Y1NA 3FWBA 4GAOA 2K8MB 1SW8A 4CLNA 2KBIA 3CZTX 2Y4QA 3EVUA 4CIDA 5D69A 1UHIA 1CNPA 4C0JA 2M97A 1XO5A 1Y1XA 2JPTA 1AK8A 2KAYA 2IS9A 3CGAA 2GV5A 4PHMA 2M1UA 1OE9B 2L50A 1GGWA 4M2OA 2I2RE 3KO0A 3LLEA 1IG5A 3TS5C 1B4CA 3HX4A 4YRUA 1KQVA 4AQIA 1NX1A 3OB2B 3EKHA 3KPXA 4GGFC 1R2UA 4MEWA 3SJSA 1J7PA 4DS7A 1MQ1A 2LAPA 2LCPA 1SRAA 1UUSA 2KYFA 2JQ6A 5CSFA 2BCBA 1QLKA 2L4HA 5F6TA 3DD4A 2I18A 1XFXO 3AAKA 1TRFA 3JTDC 4ZCVA 1S5GY 3BUMB 2ZNDA 4FQOA 2LC5A 3ZNIA 1A75B 2MHHA 2NCOA 1SKTA 1K9UA 4PHNA 1V1FA 4GFTA 1PVAA 2ZN9A 3NSOA 1S3PA 2ZN8A 2LM5A 1H8BA 4N1FA 2MAZA 5HKWA 1WRLA 3WNXB 1Y1AA 1KWOC 3DF0A 3DVEA 1C7WA 5I2OA 3VRRA 3PALA 2JXCA 1K90D 1WDCC 1LVCD 1QVIZ 1UHNA 3OB1B 1OSAA 4GGFA 4XYNA 1CDLA 1FW4A 1UHKA 1W7IB 2KHNA 1M39A 4MZKA 1XFZO 4WQ2A 1MUXA 3SG2A 1NP8A 2Q4UA 2K7CA 1SK6D 2KI4C 1S6IA 4FTGA 2JOJA 1DJIA 2LVKA 1SR6C 2KI6D 5IBWA 2K2FA 3IF7A 3O78A 4OCIA 1EG3A 2GGZA 3M0WA 1LKJA 4OVNF 4XJKB 2L0PA 2MBXA 4PHKA 1F4QA 3BUWB 1B7TZ 2KFHA 1IQ5A 1DF0A 1B47A 2SCPA 1NSHA 3KF9A 1MXEA 2OS8C 3BUXB 3OP0A 3I5GC 2EC6C 1SNLA 3I5HB 1UP5A 1LXFC 4IL1A 1CMGA 1KQMB 1TNPA 2HF5A 3LL8B 4A4BA 5KSZA 1EXRA 3I5IC 3SIAA 4MZJA 4PDZA 2NZ0A 5I2QA 1BR4B 2LHLA 1BU3A 1JFKA 2WNDA 1ZOTB 3KEVA 3QRXA 1DJXA 2FCDA 1SL9A 2KQYA 4PE7A 3AKAA 2H61A 3DVKA 2RGIA 1QV0A 2MLEC 1OZOA 2LE9B 3CLNA 4CPVA 1MWNA 3NSIA 4I5LB 2AMIA 2BCXA 1SCMC 2EGDA 1A2XA 2CXJA 1QIVA 5FYXA 2ZKMX 1TIZA 1K9KA 3PATA 3LK0A 1PSRA 1DJGA 2M49B 3PM8A 1KK8C 2V53A 2I94A 1PVBA 2WCFA 1WLMA 2LUCA 1OMRA 1QATA 2BBMA 4MBEA 4JWQA 1CDPA 4PE4A 2LVJA 1U5IA 2K7OA 3PLFB 1QX7A 2H2KA 2COLB 3BUNB 4M2PA 2KYCA 1SMGA 3IQQA 3H4SE 1YX7A 5AERA 2PSRA 2JNFA 3DF0B 4MZLA 1FBVA 1Y1UA 5HYDA 3SG3A 1K95A 1G33A 4NQGA 4QJ3B 1FPWA 1JF2A 3K21A 3TS5B 1S5GZ 3NSLA 5DKRA 1CFPA 1KFUL 2WCBA 4CFRA 2JRFA 2JTTA 4ZCUA 1K93D 2KGBC 4MLWA 3VRNA 2MRDA 3SG5A 2LLUA 5I8NA 1IJ5A 4N1GA 2F33A 2LP3A 1BJFA 1NX3A 3BXKA 4BY4A 4YGAA 1CFDA 3JTDB 1SYMA 1SY9A 1L2OC 3A4UB 1AJ4A 4PCWA 3SG7A 1YTZC 1CLLA 1A29A 1YUUA 2K7BA 5JJGA 1YVLA 1F70A 1N0YA 2WC8A 2NCPA 2FJUB 3O2PA 1M63B 4JPZB 4MSPA 1NCXA 2LUXA 2LVVA 1RROA 4R1EA 1QX5B 4NDDA 4TNCA 2M1KB 1NWDA 3D0YA 1IQ3A 3A8RA 4YI9A 2VRGA 1KWOB 1MXLC 4GGNA 4PE1A 2Y5IA 5HKZA 5PALA 2QACA 1QTXA 1CLMA 3SG6A 3VROA 4WQ3A 1IRJA 2JULA 3ICBA 2WORA 3EK8A 4I5KA 1WDCB 1J7OA 4QJ4B 3DVMA 1G8IA 3CR5X 3TDIA 3JVTC 1PRWA 5G08A 3NSKA 5JOLA 3PFVA 2LMTA 1YVHA 3BYAA 2H61C 2KI4B 1NYAA 2BE4A 4N5XA 1KSMA 1ZFSA 4P2YB 1F71A 2PASA 1SR6B 5AXIA 2JNXA 3PN7C 3GK1A 4ORBB 1QASA 2K7DA 3WXAA 2PVBA 2L2EA 3GK2A 4GPLB 1NCYA 4YGCB 2LV7A 3BQ3A 1SBJA 3DVJA 2JT8A 2R2IA 1B1GA 3EVVA 2OS8B 1YURA 1DT7B 3I5GB 2EC6B 1CLBA 1RK9A 1GQMA 1DJWA 2LMVA 1K8UA 3F45A 1RWYA 2ZRTA 1KFXL 3CR2A 3CWGA 4DUQA 1CM4A 1A03A 2JU0A 1ALVA 2BECA 2LVIA 1C7VA 3I5IB 1JFJA 4NDBA 1RECA 1HT9A 3OHMB 3FIAA 2OPOA 1C07A 5BPJA 1RFJA 2CCMA 1CFFA 1XVJA 4QJ5B 1NUBA 1IGVA 4PE0A 1F55A 3OX6A 3HCMA 3WHTB 1J55A 4I5JA 2LLTA 3CTNA 1ZMZA 3EK4A 1SCMB 1UWOA 2KDHA 1K9PA 1F4OA 4L9MA 2KFGA 1BOCA 1DGVA 1AP4A 1JF0A 2JT0A 1Q80A 3O6BA 2KAXA 1JC2A 1QX2A 4F0ZB 1UHJA 1F54A 1KK8B 4YGBB 1XFVO 1TNQA 1PK0D 1K94A 1B8RA 1EL4A 1J7RA 4YGEB 3TUYC 2OTGC 3VRQA 2BKHB 1S6CA 1X02A 2NLNA 4PHJA 2LANA 2G2BA 4ICBA 1YUSA 2CNPA 3D0YB 2JXLA 2BL0C 3I5FC 3ZWHA 2JWWA 2O5GA 2L51A 4A4CA 1QIWA 4HSZA 1XA5A 5D7FA 1BLQA 2ISDA 2K2AA 2KGRA 2LNKA 1MHOA 1ZUZA 2LHIA 1S6JA 1YUTA 2QPTA 4NDCA 1CM1A 2M0RA 5DKQA 1E8AA 4AOMA 3BOWA 4HRHA 2M9GA 1DVIA 1IKUA 3GOFA 5KTYA 1S26D 2BE6A 2MA2A 2KOTA 1TN4A 1UHHA 2B1UA 2KNEA 2SASA 1N2DA 1OOJA 1ALWA 2F3ZA 1J1EA 1KFXS 1TCOB 1BT6A 3RLZA 4I5NB 1B9AA 1BF5A 1L2OB 2ZRSA 2F8PA 5AEQA 3EVRA 2JZIA 2LLSA 2JT3A 5GQQC 4D1EA 2A4JA 3CR4X 1BMOA 1KSOA 2BKIB 3D10A 1D1OA 1TTXA 1IJ6A 2HPSA 1OMVA 3VRPA 4U8DA 2EHBA 1MF8B 3WHUB 1OZSA 4ORCB 3OX5A 1S36A 1IWQA 5TNCA 2KI6C 1B8CA 1V1GA 4MRYA 1OQPA 1FI6A 1DF0B 1SL8A 1XYDA 2PMYA 2E6WA 1WY9A 2KBMA 3MSEB 1KK7Y 4OKHA 5HLVA 3O4YA 1DGUA 1JWDA 2M29A 2D8NA 2F3YA 3JVTB 1BG1A 1XFWO 3PSRA 4WRIA 5AFPA 1NIWA 2JTZA 3SIBA 3TDZA 4E68A 2G9BA 1K2HA 3KHEA 3BUOB 5CSIA 4CFQA 2KSPA 2FCEA 3PN7B 2M8UA 1J1DA 2AAOA 2F2OA 4HREE 4MVFA 1LA0A 1IH0A 1QS7A 1AJ5A 1YX8A 2HQWA 1S1EA 2WOSA 1KCYA 2M3WA 5AANA 4YGDB 4ORAB 5CSNA 4OR9B 2NXQA 1QLSA 1J7QA 1K96A 1PALA 1LA3A 5ER4X 4C0KA 4YI8A 2K61A 1A4PA 5B8IB 1CB1A 2E30A 1QV1A 1QXPA 2L98A 2Q91A 3AKBA 1EH2A 3SG4A 4GUKA 2CTNA 2HQ8A 1U5IB 1AUIB 1KFUS 2KFFA 2I7AA 2MLFC 3AAJA 1CTRA 1TNWA 1DJHA 1RTP1 1W7JB 2DOQA 2K0JA 5CPVA 2AUCA 2CT9A 3BOWB 1QJTA
chains in the Genus database with same CATH superfamily
4DCKA 1TNXA 2L4IA 4AQJA 1AHRA 4P5OE 1TOPA 1YRUB 4GBAA 2JC2A 2Y1MA 4MN0A 1XK4C 1GJYA 3RM1A 1GGZA 5FI7A 1CFCA 1WLZA 2GGMA 1OMDA 4Q04A 3TZ1A 1FF1A 2F2PA 3FS7A 4JQ0D 5J3XA 1P28A 4ETOA 3DZTA 3IQOA 1L7ZA 4YBHB 1M46A 4HRGA 2P70A 3DY9A 4C0LA 3EKJA 1JBAA 1AVSA 2M7LA 2KLEA 1YRTB 1PSBA 1Y0VH 4DRWA 1LINA 1CKKA 2ZNEA 1ZACA 1DTLA 3L4AA 3TUYB 2OTGB 4BY5A 4USLA 4PALA 1NX2A 1TWOA 3D77A 2BL0B 1G4YR 1HQVA 1BR1B 1QVIY 2PRUA 3C1VA 3I5FB 2BCAA 3GK4X 2LP2A 2BBNA 1A75A 1BODA 2CBLA 1JUOA 1SPYA 1WRKA 4UPGA 1N65A 2L5XB 3B86A 1DJZA 1TCFA 3NXAA 1CMFA 1F8HA 2WCEA 3E3RA 3I5HC 2TN4A 4DIRA 1KQMC 1LS8A 2KPHA 4M2QA 1H4BA 1JSAA 1TUZA 4FQTA 5CSJA 3S0AA 1RJVA 2O60A 1XK4A 1DMOA 4KYNA 5DKNA 1M45A 4OV2A 4MRXA 1M31A 3CS1A 2KQ6A 3CZ0A 1CDNA 1B7TY 1CDMA 1SL7A 1Y6WA 1VRKA 2M7NA 2P6BB 1B8LA 1NX0A 5HKYA 2FOTA 1XFRA 1ODBA 1R6PA 1DC1A 5FI6A 1YR5A 1XFUO 2HETA 5I2LA 1NCZA 3FWCA 3R1VA 4GNKB 5D3OA 4JD9A 3UNWA 3VGOA 1EG4A 1DJYA 1KK7Z 1UURA 5K89A 3LCPC 5HLOA 5ER5A 5KU1A 1EJ3A 2MJWB 1SCVA 2KAVA 2PALA 1WRZA 1FI5A 2LMUA 1PULA 3EK7A 3TDUA 4XJKA 1NPQA 1MR8A 2K60A 2ZFDA 1XFYO 2Y1NA 3FE8A 3FWBA 3LK1A 4GAOA 2K8MB 1SW8A 4CLNA 2KBIA 3CZTX 2Y4QA 3EVUA 3R72A 4CIDA 5D69A 1UHIA 1CNPA 4C0JA 2M97A 1XO5A 1Y1XA 2JPTA 4PT1A 1AK8A 2KAYA 2IS9A 3CGAA 2GV5A 4PHMA 2M1UA 1OE9B 2L50A 1GGWA 4M2OA 3D74A 2I2RE 3KO0A 3LLEA 1IG5A 3TS5C 1B4CA 3HX4A 4YRUA 1KQVA 4AQIA 1NX1A 3OB2B 3EKHA 3KPXA 4GGFC 1R2UA 4MEWA 3SJSA 1J7PA 3CZ1A 4DS7A 1MQ1A 2LAPA 2LCPA 1SRAA 1UUSA 2KYFA 2JQ6A 5CSFA 2BCBA 1QLKA 2L4HA 5F6TA 3DD4A 2I18A 1XFXO 3AAKA 1TRFA 3JTDC 4ZCVA 1S5GY 3BUMB 2ZNDA 4FQOA 2LC5A 3ZNIA 1A75B 2MHHA 5EL2A 2NCOA 1SKTA 1K9UA 4PHNA 1V1FA 4GFTA 1PVAA 2ZN9A 3NSOA 3B7AA 1S3PA 2ZN8A 3UO9A 2LM5A 1H8BA 4N1FA 2MAZA 5HKWA 1WRLA 3WNXB 1Y1AA 1KWOC 3DF0A 3DVEA 1C7WA 5I2OA 3VRRA 3NHIA 3PALA 2JXCA 1K90D 3K1EA 3FE6A 1WDCC 1LVCD 1QVIZ 1UHNA 2QDIA 3OB1B 1OSAA 4GGFA 4XYNA 1CDLA 1FW4A 1UHKA 1W7IB 2KHNA 1M39A 4MZKA 1XFZO 4WQ2A 1MUXA 3SG2A 1NP8A 2Q4UA 3NHTA 2K7CA 1SK6D 2KI4C 1S6IA 4FTGA 2JOJA 1DJIA 2LVKA 3D76A 3B88A 1SR6C 2KI6D 5IBWA 2K2FA 2WCMA 3IF7A 3O78A 4JKTA 4OCIA 1EG3A 2GGZA 3L4LA 1LKJA 3M0WA 4OVNF 4XJKB 2L0PA 2JPOA 2MBXA 2L2CA 4PHKA 1F4QA 3BUWB 1B7TZ 2KFHA 1IQ5A 1DF0A 1B47A 2SCPA 1NSHA 2YGUA 3KF9A 1MXEA 2OS8C 2PQLA 3BUXB 3OP0A 3I5GC 2P71A 2EC6C 1SNLA 3BJHA 1UP5A 3I5HB 1LXFC 2QEBA 4IL1A 1KQMB 1TNPA 2HF5A 1CMGA 2WCKA 3LL8B 4A4BA 5KSZA 1EXRA 3VB1A 1ORGA 3S0GA 3I5IC 3SIAA 4MZJA 4PDZA 2NZ0A 5I2QA 1BR4B 2LHLA 1BU3A 1JFKA 2WNDA 1ZOTB 3KEVA 3QRXA 1DJXA 2FCDA 1SL9A 2KQYA 3D78A 4PE7A 3AKAA 2H61A 3DVKA 2RGIA 1QV0A 2MLEC 1OZOA 2LE9B 3CLNA 4CPVA 3SS5A 1MWNA 3NSIA 4I5LB 2AMIA 2BCXA 1SCMC 2EGDA 1DQEA 1A2XA 2CXJA 1QIVA 3BFHA 2ZKMX 5FYXA 1TIZA 1K9KA 3PATA 3LK0A 1PSRA 1DJGA 2M49B 3PM8A 3NGVA 1KK8C 2V53A 2I94A 3S0BA 1PVBA 2WCFA 1WLMA 2LUCA 1OMRA 1QATA 2BBMA 4MBEA 4JWQA 1CDPA 4PE4A 2LVJA 1U5IA 2K7OA 2WC6A 3PLFB 1QX7A 4OZDA 2H2KA 3R1OA 2COLB 2FJYA 3BUNB 4M2PA 2KYCA 1SMGA 3IQQA 3DXLA 2QEHA 3H4SE 1YX7A 5AERA 2PSRA 2JNFA 3DF0B 4MZLA 1FBVA 1Y1UA 5HYDA 3SG3A 1K95A 1G33A 4NQGA 4QJ3B 1FPWA 1JF2A 3K21A 3TS5B 1S5GZ 3NSLA 5DKRA 1CFPA 1KFUL 2WCBA 4CFRA 2JRFA 2JTTA 4ZCUA 3BFAA 1K93D 2KGBC 4MLWA 3VRNA 2MRDA 3SG5A 2LLUA 5I8NA 1IJ5A 4N1GA 2F33A 2LP3A 3O4XA 1BJFA 4INWA 1NX3A 3BXKA 4BY4A 4YGAA 1CFDA 3JTDB 1SYMA 5FI2A 1SY9A 1L2OC 3A4UB 1AJ4A 4PCWA 3SG7A 1YTZC 1CLLA 1A29A 1YUUA 2K7BA 5JJGA 1YVLA 1F70A 1N0YA 2WCJA 2WC8A 2NCPA 2FJUB 2L5YA 1M63B 2QEOA 3O2PA 4JPZB 4MSPA 1NCXA 2LUXA 2LVVA 1RROA 4R1EA 1QX5B 4NDDA 4TNCA 2M1KB 1NWDA 3D0YA 1IQ3A 3A8RA 4YI9A 2VRGA 1OW4A 1KWOB 1MXLC 4GGNA 4PE1A 2Y5IA 5HKZA 5PALA 2QACA 1QTXA 1CLMA 3B6XA 1OOHA 3SG6A 3VROA 1W9ZA 1TUJA 4WQ3A 1IRJA 2JULA 1T14A 2WORA 3EK8A 3ICBA 1WDCB 4I5KA 1J7OA 3S0FA 4QJ4B 4IJ7A 3DVMA 4INXA 1G8IA 3CR5X 3TDIA 3BFBA 3JVTC 1PRWA 3CABA 5G08A 3NSKA 5JOLA 3PFVA 2LMTA 3SS3A 1YVHA 3BYAA 2H61C 2KI4B 1NYAA 2BE4A 4N5XA 1KSMA 1ZFSA 4P2YB 5I94A 1F71A 2PASA 1SR6B 5AXIA 2JNXA 2PYQA 3GK1A 3PN7C 4ORBB 1QASA 2K7DA 3WXAA 2QEVA 2PVBA 2L2EA 3GK2A 4GPLB 1NCYA 2WCHA 2LV7A 3BQ3A 1SBJA 4YGCB 1SSEB 3DVJA 2JT8A 3N7HA 2R2IA 1B1GA 3EVVA 2OS8B 1YURA 1DT7B 3I5GB 2EC6B 1CLBA 1RK9A 1GQMA 1DJWA 2LMVA 1K8UA 3F45A 1RWYA 2ZRTA 1KFXL 3CR2A 3CWGA 4DUQA 1CM4A 1A03A 2JU0A 1ALVA 2BECA 2LVIA 1C7VA 3I5IB 3OBVA 1Z4HA 1C3YA 1JFJA 4NDBA 1OOGA 1RECA 1HT9A 3OHMB 3FIAA 2OPOA 1C07A 5BPJA 1RFJA 2CCMA 1CFFA 1XVJA 4QJ5B 1NUBA 1IGVA 4PE0A 1F55A 3L47A 3HCMA 3OX6A 3WHTB 1J55A 4I5JA 2LLTA 3CTNA 1ZMZA 3EK4A 1SCMB 1UWOA 2KDHA 1K9PA 5DICA 1F4OA 4L9MA 2KFGA 2ERBA 1BOCA 1DGVA 1AP4A 1JF0A 2JT0A 3D73A 1Q80A 3O6BA 2KAXA 3S0EA 3RZSA 1JC2A 1QX2A 4F0ZB 1UHJA 1F54A 1KK8B 4YGBB 1XFVO 1TNQA 1PK0D 1K94A 1B8RA 1EL4A 1J7RA 4YGEB 3TUYC 2OTGC 3PJIA 3VRQA 2BKHB 1S6CA 1X02A 2NLNA 3Q8IA 4PHJA 2LANA 2G2BA 4ICBA 1YUSA 2CNPA 3D0YB 2JXLA 2BL0C 3I5FC 3ZWHA 2JWWA 2O5GA 2L51A 4A4CA 1QIWA 4HSZA 3CDNA 3FE9A 1XA5A 5D7FA 3CYZA 1BLQA 2ISDA 2K2AA 2KGRA 2LNKA 1MHOA 1ZUZA 2LHIA 1S6JA 1YUTA 2QPTA 3PM2A 1CM1A 4NDCA 2M0RA 3D75A 5DKQA 1E8AA 4AOMA 3BOWA 4HRHA 2M9GA 1DVIA 1IKUA 3GOFA 5KTYA 1S26D 2BE6A 2MA2A 2KOTA 1TN4A 1UHHA 2B1UA 2KNEA 2SASA 1N2DA 1OOJA 1ALWA 2F3ZA 1J1EA 2GTEA 4F7FA 1KFXS 1TCOB 1OOIX 1BT6A 3RLZA 4I5NB 1B9AA 1BF5A 1L2OB 2ZRSA 2F8PA 5AEQA 3EVRA 2JZIA 2LLSA 1GM0A 2JT3A 5GQQC 4D1EA 3SS4A 2A4JA 2WC5A 3CR4X 1BMOA 1KSOA 2BKIB 3D10A 1D1OA 1TTXA 1IJ6A 2HPSA 1OMVA 3VRPA 4U8DA 2EHBA 1MF8B 3WHUB 1OZSA 4ORCB 3OX5A 1S36A 3IVTA 1IWQA 5TNCA 2KI6C 1B8CA 1V1GA 3QMEA 4MRYA 1OQPA 5HL1A 1FI6A 1DF0B 1SL8A 1OOFA 1XYDA 2PMYA 2E6WA 1WY9A 2KBMA 3MSEB 1KK7Y 4OKHA 5HLVA 3DYEA 3O4YA 1DGUA 1JWDA 2M29A 2D8NA 2F3YA 3JVTB 1BG1A 1XFWO 3PSRA 4WRIA 5AFPA 1NIWA 2JTZA 3SIBA 3TDZA 4E68A 2G9BA 1K2HA 3KHEA 3BUOB 2KLDA 5CSIA 3OGNA 3B87A 4CFQA 2KSPA 2WCLA 1C3ZA 2BAPA 3S0DA 2FCEA 3PN7B 2M8UA 1J1DA 2AAOA 2F2OA 4HREE 4MVFA 1LA0A 1IH0A 1QS7A 1AJ5A 1YX8A 2HQWA 1S1EA 2WOSA 1KCYA 2M3WA 5AANA 4YGDB 4ORAB 5CSNA 4OR9B 2NXQA 1QLSA 1J7QA 3R1PA 1K96A 1PALA 1QWVA 1LA3A 1DELA 3EG5B 5ER4X 4C0KA 4YI8A 1Z2CB 2K61A 1A4PA 5B8IB 1CB1A 2E30A 1QV1A 1QXPA 2L98A 2Q91A 3AKBA 1EH2A 1IIOA 3SG4A 4GUKA 2CTNA 2HQ8A 1U5IB 1AUIB 1KFUS 2KFFA 3CZ2A 2I7AA 2MLFC 3AAJA 3V2LA 1CTRA 1TNWA 1DJHA 1RTP1 1W7JB 2DOQA 2K0JA 5CPVA 1DEKA 2H8VA 2AUCA 2CT9A 2BNXA 3BOWB 1QJTA
chains in the Genus database with same CATH topology
4DCKA 1TNXA 2L4IA 4AQJA 1AHRA 4P5OE 1TOPA 1YRUB 4GBAA 2JC2A 2Y1MA 4MN0A 1XK4C 1GJYA 3RM1A 1GGZA 1CFCA 1WLZA 2GGMA 1OMDA 4Q04A 3TZ1A 1FF1A 2F2PA 3FS7A 4JQ0D 5J3XA 4ETOA 3IQOA 1L7ZA 4YBHB 1M46A 4HRGA 4C0LA 3EKJA 1JBAA 1AVSA 2M7LA 1YRTB 1PSBA 1Y0VH 4DRWA 1LINA 1CKKA 2ZNEA 1ZACA 1DTLA 3TUYB 2OTGB 4BY5A 4USLA 4PALA 1NX2A 2BL0B 1G4YR 1HQVA 1BR1B 1QVIY 2PRUA 3C1VA 3I5FB 2BCAA 3GK4X 2LP2A 2BBNA 1A75A 1BODA 2CBLA 1JUOA 1SPYA 1WRKA 4UPGA 1N65A 2L5XB 1DJZA 1TCFA 3NXAA 1CMFA 1F8HA 2WCEA 3E3RA 3I5HC 2TN4A 4DIRA 1KQMC 4M2QA 1H4BA 1JSAA 5CSJA 1RJVA 2O60A 1XK4A 1DMOA 5DKNA 1M45A 4OV2A 4MRXA 1M31A 3CS1A 2KQ6A 1CDNA 1B7TY 1CDMA 1SL7A 1Y6WA 1VRKA 2M7NA 2P6BB 1B8LA 1NX0A 5HKYA 2FOTA 1ODBA 1R6PA 1XFUO 1YR5A 2HETA 5I2LA 1NCZA 3FWCA 4GNKB 3VGOA 1EG4A 1DJYA 1KK7Z 1UURA 5K89A 3LCPC 5HLOA 5ER5A 5KU1A 1EJ3A 2MJWB 1SCVA 2KAVA 2PALA 1WRZA 1FI5A 2LMUA 1PULA 3EK7A 3TDUA 4XJKA 1NPQA 1MR8A 3LK1A 2ZFDA 1XFYO 2Y1NA 3FWBA 4GAOA 2K8MB 1SW8A 4CLNA 2KBIA 3CZTX 2Y4QA 3EVUA 4CIDA 5D69A 1UHIA 1CNPA 4C0JA 2M97A 1XO5A 1Y1XA 2JPTA 1AK8A 2KAYA 2IS9A 3CGAA 2GV5A 4PHMA 2M1UA 1OE9B 2L50A 1GGWA 4M2OA 2I2RE 3KO0A 3LLEA 1IG5A 3TS5C 1B4CA 3HX4A 4YRUA 1KQVA 4AQIA 1NX1A 3OB2B 3EKHA 3KPXA 4GGFC 1R2UA 4MEWA 3SJSA 1J7PA 4DS7A 1MQ1A 2LAPA 2LCPA 1SRAA 1UUSA 2KYFA 2JQ6A 5CSFA 2BCBA 1QLKA 2L4HA 5F6TA 3DD4A 2I18A 1XFXO 3AAKA 1TRFA 3JTDC 4ZCVA 1S5GY 3BUMB 2ZNDA 4FQOA 2LC5A 3ZNIA 1A75B 2MHHA 2NCOA 1SKTA 1K9UA 4PHNA 1V1FA 4GFTA 1PVAA 2ZN9A 3NSOA 1S3PA 2ZN8A 2LM5A 1H8BA 4N1FA 2MAZA 5HKWA 1WRLA 3WNXB 1Y1AA 1KWOC 3DF0A 3DVEA 1C7WA 5I2OA 3VRRA 3PALA 2JXCA 1K90D 1WDCC 1LVCD 1QVIZ 1UHNA 3OB1B 1OSAA 4GGFA 4XYNA 1CDLA 1FW4A 1UHKA 1W7IB 2KHNA 1M39A 4MZKA 1XFZO 4WQ2A 1MUXA 3SG2A 1NP8A 2Q4UA 2K7CA 1SK6D 2KI4C 1S6IA 4FTGA 2JOJA 1DJIA 2LVKA 1SR6C 2KI6D 5IBWA 2K2FA 3IF7A 3O78A 4OCIA 1EG3A 2GGZA 3M0WA 1LKJA 4OVNF 4XJKB 2L0PA 2MBXA 4PHKA 1F4QA 3BUWB 1B7TZ 2KFHA 1IQ5A 1DF0A 1B47A 2SCPA 1NSHA 3KF9A 1MXEA 2OS8C 3BUXB 3OP0A 3I5GC 2EC6C 1SNLA 3I5HB 1UP5A 1LXFC 4IL1A 1CMGA 1KQMB 1TNPA 2HF5A 3LL8B 4A4BA 5KSZA 1EXRA 3I5IC 3SIAA 4MZJA 4PDZA 2NZ0A 5I2QA 1BR4B 2LHLA 1BU3A 1JFKA 2WNDA 1ZOTB 3KEVA 3QRXA 1DJXA 2FCDA 1SL9A 2KQYA 4PE7A 3AKAA 2H61A 3DVKA 2RGIA 1QV0A 2MLEC 1OZOA 2LE9B 3CLNA 4CPVA 1MWNA 3NSIA 4I5LB 2AMIA 2BCXA 1SCMC 2EGDA 1A2XA 2CXJA 1QIVA 5FYXA 2ZKMX 1TIZA 1K9KA 3PATA 3LK0A 1PSRA 1DJGA 2M49B 3PM8A 1KK8C 2V53A 2I94A 1PVBA 2WCFA 1WLMA 2LUCA 1OMRA 1QATA 2BBMA 4MBEA 4JWQA 1CDPA 4PE4A 2LVJA 1U5IA 2K7OA 3PLFB 1QX7A 2H2KA 2COLB 3BUNB 4M2PA 2KYCA 1SMGA 3IQQA 3H4SE 1YX7A 5AERA 2PSRA 2JNFA 3DF0B 4MZLA 1FBVA 1Y1UA 5HYDA 3SG3A 1K95A 1G33A 4NQGA 4QJ3B 1FPWA 1JF2A 3K21A 3TS5B 1S5GZ 3NSLA 5DKRA 1CFPA 1KFUL 2WCBA 4CFRA 2JRFA 2JTTA 4ZCUA 1K93D 2KGBC 4MLWA 3VRNA 2MRDA 3SG5A 2LLUA 5I8NA 1IJ5A 4N1GA 2F33A 2LP3A 1BJFA 1NX3A 3BXKA 4BY4A 4YGAA 1CFDA 3JTDB 1SYMA 1SY9A 1L2OC 3A4UB 1AJ4A 4PCWA 3SG7A 1YTZC 1CLLA 1A29A 1YUUA 2K7BA 5JJGA 1YVLA 1F70A 1N0YA 2WC8A 2NCPA 2FJUB 3O2PA 1M63B 4JPZB 4MSPA 1NCXA 2LUXA 2LVVA 1RROA 4R1EA 1QX5B 4NDDA 4TNCA 2M1KB 1NWDA 3D0YA 1IQ3A 3A8RA 4YI9A 2VRGA 1KWOB 1MXLC 4GGNA 4PE1A 2Y5IA 5HKZA 5PALA 2QACA 1QTXA 1CLMA 3SG6A 3VROA 4WQ3A 1IRJA 2JULA 3ICBA 2WORA 3EK8A 4I5KA 1WDCB 1J7OA 4QJ4B 3DVMA 1G8IA 3CR5X 3TDIA 3JVTC 1PRWA 5G08A 3NSKA 5JOLA 3PFVA 2LMTA 1YVHA 3BYAA 2H61C 2KI4B 1NYAA 2BE4A 4N5XA 1KSMA 1ZFSA 4P2YB 1F71A 2PASA 1SR6B 5AXIA 2JNXA 3PN7C 3GK1A 4ORBB 1QASA 2K7DA 3WXAA 2PVBA 2L2EA 3GK2A 4GPLB 1NCYA 4YGCB 2LV7A 3BQ3A 1SBJA 3DVJA 2JT8A 2R2IA 1B1GA 3EVVA 2OS8B 1YURA 1DT7B 3I5GB 2EC6B 1CLBA 1RK9A 1GQMA 1DJWA 2LMVA 1K8UA 3F45A 1RWYA 2ZRTA 1KFXL 3CR2A 3CWGA 4DUQA 1CM4A 1A03A 2JU0A 1ALVA 2BECA 2LVIA 1C7VA 3I5IB 1JFJA 4NDBA 1RECA 1HT9A 3OHMB 3FIAA 2OPOA 1C07A 5BPJA 1RFJA 2CCMA 1CFFA 1XVJA 4QJ5B 1NUBA 1IGVA 4PE0A 1F55A 3OX6A 3HCMA 3WHTB 1J55A 4I5JA 2LLTA 3CTNA 1ZMZA 3EK4A 1SCMB 1UWOA 2KDHA 1K9PA 1F4OA 4L9MA 2KFGA 1BOCA 1DGVA 1AP4A 1JF0A 2JT0A 1Q80A 3O6BA 2KAXA 1JC2A 1QX2A 4F0ZB 1UHJA 1F54A 1KK8B 4YGBB 1XFVO 1TNQA 1PK0D 1K94A 1B8RA 1EL4A 1J7RA 4YGEB 3TUYC 2OTGC 3VRQA 2BKHB 1S6CA 1X02A 2NLNA 4PHJA 2LANA 2G2BA 4ICBA 1YUSA 2CNPA 3D0YB 2JXLA 2BL0C 3I5FC 3ZWHA 2JWWA 2O5GA 2L51A 4A4CA 1QIWA 4HSZA 1XA5A 5D7FA 1BLQA 2ISDA 2K2AA 2KGRA 2LNKA 1MHOA 1ZUZA 2LHIA 1S6JA 1YUTA 2QPTA 4NDCA 1CM1A 2M0RA 5DKQA 1E8AA 4AOMA 3BOWA 4HRHA 2M9GA 1DVIA 1IKUA 3GOFA 5KTYA 1S26D 2BE6A 2MA2A 2KOTA 1TN4A 1UHHA 2B1UA 2KNEA 2SASA 1N2DA 1OOJA 1ALWA 2F3ZA 1J1EA 1KFXS 1TCOB 1BT6A 3RLZA 4I5NB 1B9AA 1BF5A 1L2OB 2ZRSA 2F8PA 5AEQA 3EVRA 2JZIA 2LLSA 2JT3A 5GQQC 4D1EA 2A4JA 3CR4X 1BMOA 1KSOA 2BKIB 3D10A 1D1OA 1TTXA 1IJ6A 2HPSA 1OMVA 3VRPA 4U8DA 2EHBA 1MF8B 3WHUB 1OZSA 4ORCB 3OX5A 1S36A 1IWQA 5TNCA 2KI6C 1B8CA 1V1GA 4MRYA 1OQPA 1FI6A 1DF0B 1SL8A 1XYDA 2PMYA 2E6WA 1WY9A 2KBMA 3MSEB 1KK7Y 4OKHA 5HLVA 3O4YA 1DGUA 1JWDA 2M29A 2D8NA 2F3YA 3JVTB 1BG1A 1XFWO 3PSRA 4WRIA 5AFPA 1NIWA 2JTZA 3SIBA 3TDZA 4E68A 2G9BA 1K2HA 3KHEA 3BUOB 5CSIA 4CFQA 2KSPA 2FCEA 3PN7B 2M8UA 1J1DA 2AAOA 2F2OA 4HREE 4MVFA 1LA0A 1IH0A 1QS7A 1AJ5A 1YX8A 2HQWA 1S1EA 2WOSA 1KCYA 2M3WA 5AANA 4YGDB 4ORAB 5CSNA 4OR9B 2NXQA 1QLSA 1J7QA 1K96A 1PALA 1LA3A 5ER4X 4C0KA 4YI8A 2K61A 1A4PA 5B8IB 1CB1A 2E30A 1QV1A 1QXPA 2L98A 2Q91A 3AKBA 1EH2A 3SG4A 4GUKA 2CTNA 2HQ8A 1U5IB 1AUIB 1KFUS 2KFFA 2I7AA 2MLFC 3AAJA 1CTRA 1TNWA 1DJHA 1RTP1 1W7JB 2DOQA 2K0JA 5CPVA 2AUCA 2CT9A 3BOWB 1QJTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DCK A;  1TNX A;  2L4I A;  4AQJ A;  1AHR A;  4P5O E;  1TOP A;  1YRU B;  4GBA A;  2JC2 A;  2Y1M A;  4MN0 A;  1XK4 C;  1GJY A;  3RM1 A;  1GGZ A;  1CFC A;  1WLZ A;  2GGM A;  1OMD A;  4Q04 A;  3TZ1 A;  1FF1 A;  2F2P A;  3FS7 A;  4JQ0 D;  5J3X A;  4ETO A;  3IQO A;  1L7Z A;  4YBH B;  1M46 A;  4HRG A;  4C0L A;  3EKJ A;  1JBA A;  1AVS A;  2M7L A;  1YRT B;  1PSB A;  1Y0V H;  4DRW A;  1LIN A;  1CKK A;  2ZNE A;  1ZAC A;  1DTL A;  3TUY B;  2OTG B;  4BY5 A;  4USL A;  4PAL A;  1NX2 A;  2BL0 B;  1G4Y R;  1HQV A;  1BR1 B;  1QVI Y;  2PRU A;  3C1V A;  3I5F B;  2BCA A;  3GK4 X;  2LP2 A;  2BBN A;  1A75 A;  1BOD A;  2CBL A;  1JUO A;  1SPY A;  1WRK A;  4UPG A;  1N65 A;  2L5X B;  1DJZ A;  1TCF A;  3NXA A;  1CMF A;  1F8H A;  2WCE A;  3E3R A;  3I5H C;  2TN4 A;  4DIR A;  1KQM C;  4M2Q A;  1H4B A;  1JSA A;  5CSJ A;  1RJV A;  2O60 A;  1XK4 A;  1DMO A;  5DKN A;  1M45 A;  4OV2 A;  4MRX A;  1M31 A;  3CS1 A;  2KQ6 A;  1CDN A;  1B7T Y;  1CDM A;  1SL7 A;  1Y6W A;  1VRK A;  2M7N A;  2P6B B;  1B8L A;  1NX0 A;  5HKY A;  2FOT A;  1ODB A;  1R6P A;  1XFU O;  1YR5 A;  2HET A;  5I2L A;  1NCZ A;  3FWC A;  4GNK B;  3VGO A;  1EG4 A;  1DJY A;  1KK7 Z;  1UUR A;  5K89 A;  3LCP C;  5HLO A;  5ER5 A;  5KU1 A;  1EJ3 A;  2MJW B;  1SCV A;  2KAV A;  2PAL A;  1WRZ A;  1FI5 A;  2LMU A;  1PUL A;  3EK7 A;  3TDU A;  4XJK A;  1NPQ A;  1MR8 A;  3LK1 A;  2ZFD A;  1XFY O;  2Y1N A;  3FWB A;  4GAO A;  2K8M B;  1SW8 A;  4CLN A;  2KBI A;  3CZT X;  2Y4Q A;  3EVU A;  4CID A;  5D69 A;  1UHI A;  1CNP A;  4C0J A;  2M97 A;  1XO5 A;  1Y1X A;  2JPT A;  1AK8 A;  2KAY A;  2IS9 A;  3CGA A;  2GV5 A;  4PHM A;  2M1U A;  1OE9 B;  2L50 A;  1GGW A;  4M2O A;  2I2R E;  3KO0 A;  3LLE A;  1IG5 A;  3TS5 C;  1B4C A;  3HX4 A;  4YRU A;  1KQV A;  4AQI A;  1NX1 A;  3OB2 B;  3EKH A;  3KPX A;  4GGF C;  1R2U A;  4MEW A;  3SJS A;  1J7P A;  4DS7 A;  1MQ1 A;  2LAP A;  2LCP A;  1SRA A;  1UUS A;  2KYF A;  2JQ6 A;  5CSF A;  2BCB A;  1QLK A;  2L4H A;  5F6T A;  3DD4 A;  2I18 A;  1XFX O;  3AAK A;  1TRF A;  3JTD C;  4ZCV A;  1S5G Y;  3BUM B;  2ZND A;  4FQO A;  2LC5 A;  3ZNI A;  1A75 B;  2MHH A;  2NCO A;  1SKT A;  1K9U A;  4PHN A;  1V1F A;  4GFT A;  1PVA A;  2ZN9 A;  3NSO A;  1S3P A;  2ZN8 A;  2LM5 A;  1H8B A;  4N1F A;  2MAZ A;  5HKW A;  1WRL A;  3WNX B;  1Y1A A;  1KWO C;  3DF0 A;  3DVE A;  1C7W A;  5I2O A;  3VRR A;  3PAL A;  2JXC A;  1K90 D;  1WDC C;  1LVC D;  1QVI Z;  1UHN A;  3OB1 B;  1OSA A;  4GGF A;  4XYN A;  1CDL A;  1FW4 A;  1UHK A;  1W7I B;  2KHN A;  1M39 A;  4MZK A;  1XFZ O;  4WQ2 A;  1MUX A;  3SG2 A;  1NP8 A;  2Q4U A;  2K7C A;  1SK6 D;  2KI4 C;  1S6I A;  4FTG A;  2JOJ A;  1DJI A;  2LVK A;  1SR6 C;  2KI6 D;  5IBW A;  2K2F A;  3IF7 A;  3O78 A;  4OCI A;  1EG3 A;  2GGZ A;  3M0W A;  1LKJ A;  4OVN F;  4XJK B;  2L0P A;  2MBX A;  4PHK A;  1F4Q A;  3BUW B;  1B7T Z;  2KFH A;  1IQ5 A;  1DF0 A;  1B47 A;  2SCP A;  1NSH A;  3KF9 A;  1MXE A;  2OS8 C;  3BUX B;  3OP0 A;  3I5G C;  2EC6 C;  1SNL A;  3I5H B;  1UP5 A;  1LXF C;  4IL1 A;  1CMG A;  1KQM B;  1TNP A;  2HF5 A;  3LL8 B;  4A4B A;  5KSZ A;  1EXR A;  3I5I C;  3SIA A;  4MZJ A;  4PDZ A;  2NZ0 A;  5I2Q A;  1BR4 B;  2LHL A;  1BU3 A;  1JFK A;  2WND A;  1ZOT B;  3KEV A;  3QRX A;  1DJX A;  2FCD A;  1SL9 A;  2KQY A;  4PE7 A;  3AKA A;  2H61 A;  3DVK A;  2RGI A;  1QV0 A;  2MLE C;  1OZO A;  2LE9 B;  3CLN A;  4CPV A;  1MWN A;  3NSI A;  4I5L B;  2AMI A;  2BCX A;  1SCM C;  2EGD A;  1A2X A;  2CXJ A;  1QIV A;  5FYX A;  2ZKM X;  1TIZ A;  1K9K A;  3PAT A;  3LK0 A;  1PSR A;  1DJG A;  2M49 B;  3PM8 A;  1KK8 C;  2V53 A;  2I94 A;  1PVB A;  2WCF A;  1WLM A;  2LUC A;  1OMR A;  1QAT A;  2BBM A;  4MBE A;  4JWQ A;  1CDP A;  4PE4 A;  2LVJ A;  1U5I A;  2K7O A;  3PLF B;  1QX7 A;  2H2K A;  2COL B;  3BUN B;  4M2P A;  2KYC A;  1SMG A;  3IQQ A;  3H4S E;  1YX7 A;  5AER A;  2PSR A;  2JNF A;  3DF0 B;  4MZL A;  1FBV A;  1Y1U A;  5HYD A;  3SG3 A;  1K95 A;  1G33 A;  4NQG A;  4QJ3 B;  1FPW A;  1JF2 A;  3K21 A;  3TS5 B;  1S5G Z;  3NSL A;  5DKR A;  1CFP A;  1KFU L;  2WCB A;  4CFR A;  2JRF A;  2JTT A;  4ZCU A;  1K93 D;  2KGB C;  4MLW A;  3VRN A;  2MRD A;  3SG5 A;  2LLU A;  5I8N A;  1IJ5 A;  4N1G A;  2F33 A;  2LP3 A;  1BJF A;  1NX3 A;  3BXK A;  4BY4 A;  4YGA A;  1CFD A;  3JTD B;  1SYM A;  1SY9 A;  1L2O C;  3A4U B;  1AJ4 A;  4PCW A;  3SG7 A;  1YTZ C;  1CLL A;  1A29 A;  1YUU A;  2K7B A;  5JJG A;  1YVL A;  1F70 A;  1N0Y A;  2WC8 A;  2NCP A;  2FJU B;  3O2P A;  1M63 B;  4JPZ B;  4MSP A;  1NCX A;  2LUX A;  2LVV A;  1RRO A;  4R1E A;  1QX5 B;  4NDD A;  4TNC A;  2M1K B;  1NWD A;  3D0Y A;  1IQ3 A;  3A8R A;  4YI9 A;  2VRG A;  1KWO B;  1MXL C;  4GGN A;  4PE1 A;  2Y5I A;  5HKZ A;  5PAL A;  2QAC A;  1QTX A;  1CLM A;  3SG6 A;  3VRO A;  4WQ3 A;  1IRJ A;  2JUL A;  3ICB A;  2WOR A;  3EK8 A;  4I5K A;  1WDC B;  1J7O A;  4QJ4 B;  3DVM A;  1G8I A;  3CR5 X;  3TDI A;  3JVT C;  1PRW A;  5G08 A;  3NSK A;  5JOL A;  3PFV A;  2LMT A;  1YVH A;  3BYA A;  2H61 C;  2KI4 B;  1NYA A;  2BE4 A;  4N5X A;  1KSM A;  1ZFS A;  4P2Y B;  1F71 A;  2PAS A;  1SR6 B;  5AXI A;  2JNX A;  3PN7 C;  3GK1 A;  4ORB B;  1QAS A;  2K7D A;  3WXA A;  2PVB A;  2L2E A;  3GK2 A;  4GPL B;  1NCY A;  4YGC B;  2LV7 A;  3BQ3 A;  1SBJ A;  3DVJ A;  2JT8 A;  2R2I A;  1B1G A;  3EVV A;  2OS8 B;  1YUR A;  1DT7 B;  3I5G B;  2EC6 B;  1CLB A;  1RK9 A;  1GQM A;  1DJW A;  2LMV A;  1K8U A;  3F45 A;  1RWY A;  2ZRT A;  1KFX L;  3CR2 A;  3CWG A;  4DUQ A;  1CM4 A;  1A03 A;  2JU0 A;  1ALV A;  2BEC A;  2LVI A;  1C7V A;  3I5I B;  1JFJ A;  4NDB A;  1REC A;  1HT9 A;  3OHM B;  3FIA A;  2OPO A;  1C07 A;  5BPJ A;  1RFJ A;  2CCM A;  1CFF A;  1XVJ A;  4QJ5 B;  1NUB A;  1IGV A;  4PE0 A;  1F55 A;  3OX6 A;  3HCM A;  3WHT B;  1J55 A;  4I5J A;  2LLT A;  3CTN A;  1ZMZ A;  3EK4 A;  1SCM B;  1UWO A;  2KDH A;  1K9P A;  1F4O A;  4L9M A;  2KFG A;  1BOC A;  1DGV A;  1AP4 A;  1JF0 A;  2JT0 A;  1Q80 A;  3O6B A;  2KAX A;  1JC2 A;  1QX2 A;  4F0Z B;  1UHJ A;  1F54 A;  1KK8 B;  4YGB B;  1XFV O;  1TNQ A;  1PK0 D;  1K94 A;  1B8R A;  1EL4 A;  1J7R A;  4YGE B;  3TUY C;  2OTG C;  3VRQ A;  2BKH B;  1S6C A;  1X02 A;  2NLN A;  4PHJ A;  2LAN A;  2G2B A;  4ICB A;  1YUS A;  2CNP A;  3D0Y B;  2JXL A;  2BL0 C;  3I5F C;  3ZWH A;  2JWW A;  2O5G A;  2L51 A;  4A4C A;  1QIW A;  4HSZ A;  1XA5 A;  5D7F A;  1BLQ A;  2ISD A;  2K2A A;  2KGR A;  2LNK A;  1MHO A;  1ZUZ A;  2LHI A;  1S6J A;  1YUT A;  2QPT A;  4NDC A;  1CM1 A;  2M0R A;  5DKQ A;  1E8A A;  4AOM A;  3BOW A;  4HRH A;  2M9G A;  1DVI A;  1IKU A;  3GOF A;  5KTY A;  1S26 D;  2BE6 A;  2MA2 A;  2KOT A;  1TN4 A;  1UHH A;  2B1U A;  2KNE A;  2SAS A;  1N2D A;  1OOJ A;  1ALW A;  2F3Z A;  1J1E A;  1KFX S;  1TCO B;  1BT6 A;  3RLZ A;  4I5N B;  1B9A A;  1BF5 A;  1L2O B;  2ZRS A;  2F8P A;  5AEQ A;  3EVR A;  2JZI A;  2LLS A;  2JT3 A;  5GQQ C;  4D1E A;  2A4J A;  3CR4 X;  1BMO A;  1KSO A;  2BKI B;  3D10 A;  1D1O A;  1TTX A;  1IJ6 A;  2HPS A;  1OMV A;  3VRP A;  4U8D A;  2EHB A;  1MF8 B;  3WHU B;  1OZS A;  4ORC B;  3OX5 A;  1S36 A;  1IWQ A;  5TNC A;  2KI6 C;  1B8C A;  1V1G A;  4MRY A;  1OQP A;  1FI6 A;  1DF0 B;  1SL8 A;  1XYD A;  2PMY A;  2E6W A;  1WY9 A;  2KBM A;  3MSE B;  1KK7 Y;  4OKH A;  5HLV A;  3O4Y A;  1DGU A;  1JWD A;  2M29 A;  2D8N A;  2F3Y A;  3JVT B;  1BG1 A;  1XFW O;  3PSR A;  4WRI A;  5AFP A;  1NIW A;  2JTZ A;  3SIB A;  3TDZ A;  4E68 A;  2G9B A;  1K2H A;  3KHE A;  3BUO B;  5CSI A;  4CFQ A;  2KSP A;  2FCE A;  3PN7 B;  2M8U A;  1J1D A;  2AAO A;  2F2O A;  4HRE E;  4MVF A;  1LA0 A;  1IH0 A;  1QS7 A;  1AJ5 A;  1YX8 A;  2HQW A;  1S1E A;  2WOS A;  1KCY A;  2M3W A;  5AAN A;  4YGD B;  4ORA B;  5CSN A;  4OR9 B;  2NXQ A;  1QLS A;  1J7Q A;  1K96 A;  1PAL A;  1LA3 A;  5ER4 X;  4C0K A;  4YI8 A;  2K61 A;  1A4P A;  5B8I B;  1CB1 A;  2E30 A;  1QV1 A;  1QXP A;  2L98 A;  2Q91 A;  3AKB A;  1EH2 A;  3SG4 A;  4GUK A;  2CTN A;  2HQ8 A;  1U5I B;  1AUI B;  1KFU S;  2KFF A;  2I7A A;  2MLF C;  3AAJ A;  1CTR A;  1TNW A;  1DJH A;  1RTP 1;  1W7J B;  2DOQ A;  2K0J A;  5CPV A;  2AUC A;  2CT9 A;  3BOW B;  1QJT A; 
#chains in the Genus database with same CATH topology
 4DCK A;  1TNX A;  2L4I A;  4AQJ A;  1AHR A;  4P5O E;  1TOP A;  1YRU B;  4GBA A;  2JC2 A;  2Y1M A;  4MN0 A;  1XK4 C;  1GJY A;  3RM1 A;  1GGZ A;  5FI7 A;  1CFC A;  1WLZ A;  2GGM A;  1OMD A;  4Q04 A;  3TZ1 A;  1FF1 A;  2F2P A;  3FS7 A;  4JQ0 D;  5J3X A;  1P28 A;  4ETO A;  3DZT A;  3IQO A;  1L7Z A;  4YBH B;  1M46 A;  4HRG A;  2P70 A;  3DY9 A;  4C0L A;  3EKJ A;  1JBA A;  1AVS A;  2M7L A;  2KLE A;  1YRT B;  1PSB A;  1Y0V H;  4DRW A;  1LIN A;  1CKK A;  2ZNE A;  1ZAC A;  1DTL A;  3L4A A;  3TUY B;  2OTG B;  4BY5 A;  4USL A;  4PAL A;  1NX2 A;  1TWO A;  3D77 A;  2BL0 B;  1G4Y R;  1HQV A;  1BR1 B;  1QVI Y;  2PRU A;  3C1V A;  3I5F B;  2BCA A;  3GK4 X;  2LP2 A;  2BBN A;  1A75 A;  1BOD A;  2CBL A;  1JUO A;  1SPY A;  1WRK A;  4UPG A;  1N65 A;  2L5X B;  3B86 A;  1DJZ A;  1TCF A;  3NXA A;  1CMF A;  1F8H A;  2WCE A;  3E3R A;  3I5H C;  2TN4 A;  4DIR A;  1KQM C;  1LS8 A;  2KPH A;  4M2Q A;  1H4B A;  1JSA A;  1TUZ A;  4FQT A;  5CSJ A;  3S0A A;  1RJV A;  2O60 A;  1XK4 A;  1DMO A;  4KYN A;  5DKN A;  1M45 A;  4OV2 A;  4MRX A;  1M31 A;  3CS1 A;  2KQ6 A;  3CZ0 A;  1CDN A;  1B7T Y;  1CDM A;  1SL7 A;  1Y6W A;  1VRK A;  2M7N A;  2P6B B;  1B8L A;  1NX0 A;  5HKY A;  2FOT A;  1XFR A;  1ODB A;  1R6P A;  1DC1 A;  5FI6 A;  1YR5 A;  1XFU O;  2HET A;  5I2L A;  1NCZ A;  3FWC A;  3R1V A;  4GNK B;  5D3O A;  4JD9 A;  3UNW A;  3VGO A;  1EG4 A;  1DJY A;  1KK7 Z;  1UUR A;  5K89 A;  3LCP C;  5HLO A;  5ER5 A;  5KU1 A;  1EJ3 A;  2MJW B;  1SCV A;  2KAV A;  2PAL A;  1WRZ A;  1FI5 A;  2LMU A;  1PUL A;  3EK7 A;  3TDU A;  4XJK A;  1NPQ A;  1MR8 A;  2K60 A;  2ZFD A;  1XFY O;  2Y1N A;  3FE8 A;  3FWB A;  3LK1 A;  4GAO A;  2K8M B;  1SW8 A;  4CLN A;  2KBI A;  3CZT X;  2Y4Q A;  3EVU A;  3R72 A;  4CID A;  5D69 A;  1UHI A;  1CNP A;  4C0J A;  2M97 A;  1XO5 A;  1Y1X A;  2JPT A;  4PT1 A;  1AK8 A;  2KAY A;  2IS9 A;  3CGA A;  2GV5 A;  4PHM A;  2M1U A;  1OE9 B;  2L50 A;  1GGW A;  4M2O A;  3D74 A;  2I2R E;  3KO0 A;  3LLE A;  1IG5 A;  3TS5 C;  1B4C A;  3HX4 A;  4YRU A;  1KQV A;  4AQI A;  1NX1 A;  3OB2 B;  3EKH A;  3KPX A;  4GGF C;  1R2U A;  4MEW A;  3SJS A;  1J7P A;  3CZ1 A;  4DS7 A;  1MQ1 A;  2LAP A;  2LCP A;  1SRA A;  1UUS A;  2KYF A;  2JQ6 A;  5CSF A;  2BCB A;  1QLK A;  2L4H A;  5F6T A;  3DD4 A;  2I18 A;  1XFX O;  3AAK A;  1TRF A;  3JTD C;  4ZCV A;  1S5G Y;  3BUM B;  2ZND A;  4FQO A;  2LC5 A;  3ZNI A;  1A75 B;  2MHH A;  5EL2 A;  2NCO A;  1SKT A;  1K9U A;  4PHN A;  1V1F A;  4GFT A;  1PVA A;  2ZN9 A;  3NSO A;  3B7A A;  1S3P A;  2ZN8 A;  3UO9 A;  2LM5 A;  1H8B A;  4N1F A;  2MAZ A;  5HKW A;  1WRL A;  3WNX B;  1Y1A A;  1KWO C;  3DF0 A;  3DVE A;  1C7W A;  5I2O A;  3VRR A;  3NHI A;  3PAL A;  2JXC A;  1K90 D;  3K1E A;  3FE6 A;  1WDC C;  1LVC D;  1QVI Z;  1UHN A;  2QDI A;  3OB1 B;  1OSA A;  4GGF A;  4XYN A;  1CDL A;  1FW4 A;  1UHK A;  1W7I B;  2KHN A;  1M39 A;  4MZK A;  1XFZ O;  4WQ2 A;  1MUX A;  3SG2 A;  1NP8 A;  2Q4U A;  3NHT A;  2K7C A;  1SK6 D;  2KI4 C;  1S6I A;  4FTG A;  2JOJ A;  1DJI A;  2LVK A;  3D76 A;  3B88 A;  1SR6 C;  2KI6 D;  5IBW A;  2K2F A;  2WCM A;  3IF7 A;  3O78 A;  4JKT A;  4OCI A;  1EG3 A;  2GGZ A;  3L4L A;  1LKJ A;  3M0W A;  4OVN F;  4XJK B;  2L0P A;  2JPO A;  2MBX A;  2L2C A;  4PHK A;  1F4Q A;  3BUW B;  1B7T Z;  2KFH A;  1IQ5 A;  1DF0 A;  1B47 A;  2SCP A;  1NSH A;  2YGU A;  3KF9 A;  1MXE A;  2OS8 C;  2PQL A;  3BUX B;  3OP0 A;  3I5G C;  2P71 A;  2EC6 C;  1SNL A;  3BJH A;  1UP5 A;  3I5H B;  1LXF C;  2QEB A;  4IL1 A;  1KQM B;  1TNP A;  2HF5 A;  1CMG A;  2WCK A;  3LL8 B;  4A4B A;  5KSZ A;  1EXR A;  3VB1 A;  1ORG A;  3S0G A;  3I5I C;  3SIA A;  4MZJ A;  4PDZ A;  2NZ0 A;  5I2Q A;  1BR4 B;  2LHL A;  1BU3 A;  1JFK A;  2WND A;  1ZOT B;  3KEV A;  3QRX A;  1DJX A;  2FCD A;  1SL9 A;  2KQY A;  3D78 A;  4PE7 A;  3AKA A;  2H61 A;  3DVK A;  2RGI A;  1QV0 A;  2MLE C;  1OZO A;  2LE9 B;  3CLN A;  4CPV A;  3SS5 A;  1MWN A;  3NSI A;  4I5L B;  2AMI A;  2BCX A;  1SCM C;  2EGD A;  1DQE A;  1A2X A;  2CXJ A;  1QIV A;  3BFH A;  2ZKM X;  5FYX A;  1TIZ A;  1K9K A;  3PAT A;  3LK0 A;  1PSR A;  1DJG A;  2M49 B;  3PM8 A;  3NGV A;  1KK8 C;  2V53 A;  2I94 A;  3S0B A;  1PVB A;  2WCF A;  1WLM A;  2LUC A;  1OMR A;  1QAT A;  2BBM A;  4MBE A;  4JWQ A;  1CDP A;  4PE4 A;  2LVJ A;  1U5I A;  2K7O A;  2WC6 A;  3PLF B;  1QX7 A;  4OZD A;  2H2K A;  3R1O A;  2COL B;  2FJY A;  3BUN B;  4M2P A;  2KYC A;  1SMG A;  3IQQ A;  3DXL A;  2QEH A;  3H4S E;  1YX7 A;  5AER A;  2PSR A;  2JNF A;  3DF0 B;  4MZL A;  1FBV A;  1Y1U A;  5HYD A;  3SG3 A;  1K95 A;  1G33 A;  4NQG A;  4QJ3 B;  1FPW A;  1JF2 A;  3K21 A;  3TS5 B;  1S5G Z;  3NSL A;  5DKR A;  1CFP A;  1KFU L;  2WCB A;  4CFR A;  2JRF A;  2JTT A;  4ZCU A;  3BFA A;  1K93 D;  2KGB C;  4MLW A;  3VRN A;  2MRD A;  3SG5 A;  2LLU A;  5I8N A;  1IJ5 A;  4N1G A;  2F33 A;  2LP3 A;  3O4X A;  1BJF A;  4INW A;  1NX3 A;  3BXK A;  4BY4 A;  4YGA A;  1CFD A;  3JTD B;  1SYM A;  5FI2 A;  1SY9 A;  1L2O C;  3A4U B;  1AJ4 A;  4PCW A;  3SG7 A;  1YTZ C;  1CLL A;  1A29 A;  1YUU A;  2K7B A;  5JJG A;  1YVL A;  1F70 A;  1N0Y A;  2WCJ A;  2WC8 A;  2NCP A;  2FJU B;  2L5Y A;  1M63 B;  2QEO A;  3O2P A;  4JPZ B;  4MSP A;  1NCX A;  2LUX A;  2LVV A;  1RRO A;  4R1E A;  1QX5 B;  4NDD A;  4TNC A;  2M1K B;  1NWD A;  3D0Y A;  1IQ3 A;  3A8R A;  4YI9 A;  2VRG A;  1OW4 A;  1KWO B;  1MXL C;  4GGN A;  4PE1 A;  2Y5I A;  5HKZ A;  5PAL A;  2QAC A;  1QTX A;  1CLM A;  3B6X A;  1OOH A;  3SG6 A;  3VRO A;  1W9Z A;  1TUJ A;  4WQ3 A;  1IRJ A;  2JUL A;  1T14 A;  2WOR A;  3EK8 A;  3ICB A;  1WDC B;  4I5K A;  1J7O A;  3S0F A;  4QJ4 B;  4IJ7 A;  3DVM A;  4INX A;  1G8I A;  3CR5 X;  3TDI A;  3BFB A;  3JVT C;  1PRW A;  3CAB A;  5G08 A;  3NSK A;  5JOL A;  3PFV A;  2LMT A;  3SS3 A;  1YVH A;  3BYA A;  2H61 C;  2KI4 B;  1NYA A;  2BE4 A;  4N5X A;  1KSM A;  1ZFS A;  4P2Y B;  5I94 A;  1F71 A;  2PAS A;  1SR6 B;  5AXI A;  2JNX A;  2PYQ A;  3GK1 A;  3PN7 C;  4ORB B;  1QAS A;  2K7D A;  3WXA A;  2QEV A;  2PVB A;  2L2E A;  3GK2 A;  4GPL B;  1NCY A;  2WCH A;  2LV7 A;  3BQ3 A;  1SBJ A;  4YGC B;  1SSE B;  3DVJ A;  2JT8 A;  3N7H A;  2R2I A;  1B1G A;  3EVV A;  2OS8 B;  1YUR A;  1DT7 B;  3I5G B;  2EC6 B;  1CLB A;  1RK9 A;  1GQM A;  1DJW A;  2LMV A;  1K8U A;  3F45 A;  1RWY A;  2ZRT A;  1KFX L;  3CR2 A;  3CWG A;  4DUQ A;  1CM4 A;  1A03 A;  2JU0 A;  1ALV A;  2BEC A;  2LVI A;  1C7V A;  3I5I B;  3OBV A;  1Z4H A;  1C3Y A;  1JFJ A;  4NDB A;  1OOG A;  1REC A;  1HT9 A;  3OHM B;  3FIA A;  2OPO A;  1C07 A;  5BPJ A;  1RFJ A;  2CCM A;  1CFF A;  1XVJ A;  4QJ5 B;  1NUB A;  1IGV A;  4PE0 A;  1F55 A;  3L47 A;  3HCM A;  3OX6 A;  3WHT B;  1J55 A;  4I5J A;  2LLT A;  3CTN A;  1ZMZ A;  3EK4 A;  1SCM B;  1UWO A;  2KDH A;  1K9P A;  5DIC A;  1F4O A;  4L9M A;  2KFG A;  2ERB A;  1BOC A;  1DGV A;  1AP4 A;  1JF0 A;  2JT0 A;  3D73 A;  1Q80 A;  3O6B A;  2KAX A;  3S0E A;  3RZS A;  1JC2 A;  1QX2 A;  4F0Z B;  1UHJ A;  1F54 A;  1KK8 B;  4YGB B;  1XFV O;  1TNQ A;  1PK0 D;  1K94 A;  1B8R A;  1EL4 A;  1J7R A;  4YGE B;  3TUY C;  2OTG C;  3PJI A;  3VRQ A;  2BKH B;  1S6C A;  1X02 A;  2NLN A;  3Q8I A;  4PHJ A;  2LAN A;  2G2B A;  4ICB A;  1YUS A;  2CNP A;  3D0Y B;  2JXL A;  2BL0 C;  3I5F C;  3ZWH A;  2JWW A;  2O5G A;  2L51 A;  4A4C A;  1QIW A;  4HSZ A;  3CDN A;  3FE9 A;  1XA5 A;  5D7F A;  3CYZ A;  1BLQ A;  2ISD A;  2K2A A;  2KGR A;  2LNK A;  1MHO A;  1ZUZ A;  2LHI A;  1S6J A;  1YUT A;  2QPT A;  3PM2 A;  1CM1 A;  4NDC A;  2M0R A;  3D75 A;  5DKQ A;  1E8A A;  4AOM A;  3BOW A;  4HRH A;  2M9G A;  1DVI A;  1IKU A;  3GOF A;  5KTY A;  1S26 D;  2BE6 A;  2MA2 A;  2KOT A;  1TN4 A;  1UHH A;  2B1U A;  2KNE A;  2SAS A;  1N2D A;  1OOJ A;  1ALW A;  2F3Z A;  1J1E A;  2GTE A;  4F7F A;  1KFX S;  1TCO B;  1OOI X;  1BT6 A;  3RLZ A;  4I5N B;  1B9A A;  1BF5 A;  1L2O B;  2ZRS A;  2F8P A;  5AEQ A;  3EVR A;  2JZI A;  2LLS A;  1GM0 A;  2JT3 A;  5GQQ C;  4D1E A;  3SS4 A;  2A4J A;  2WC5 A;  3CR4 X;  1BMO A;  1KSO A;  2BKI B;  3D10 A;  1D1O A;  1TTX A;  1IJ6 A;  2HPS A;  1OMV A;  3VRP A;  4U8D A;  2EHB A;  1MF8 B;  3WHU B;  1OZS A;  4ORC B;  3OX5 A;  1S36 A;  3IVT A;  1IWQ A;  5TNC A;  2KI6 C;  1B8C A;  1V1G A;  3QME A;  4MRY A;  1OQP A;  5HL1 A;  1FI6 A;  1DF0 B;  1SL8 A;  1OOF A;  1XYD A;  2PMY A;  2E6W A;  1WY9 A;  2KBM A;  3MSE B;  1KK7 Y;  4OKH A;  5HLV A;  3DYE A;  3O4Y A;  1DGU A;  1JWD A;  2M29 A;  2D8N A;  2F3Y A;  3JVT B;  1BG1 A;  1XFW O;  3PSR A;  4WRI A;  5AFP A;  1NIW A;  2JTZ A;  3SIB A;  3TDZ A;  4E68 A;  2G9B A;  1K2H A;  3KHE A;  3BUO B;  2KLD A;  5CSI A;  3OGN A;  3B87 A;  4CFQ A;  2KSP A;  2WCL A;  1C3Z A;  2BAP A;  3S0D A;  2FCE A;  3PN7 B;  2M8U A;  1J1D A;  2AAO A;  2F2O A;  4HRE E;  4MVF A;  1LA0 A;  1IH0 A;  1QS7 A;  1AJ5 A;  1YX8 A;  2HQW A;  1S1E A;  2WOS A;  1KCY A;  2M3W A;  5AAN A;  4YGD B;  4ORA B;  5CSN A;  4OR9 B;  2NXQ A;  1QLS A;  1J7Q A;  3R1P A;  1K96 A;  1PAL A;  1QWV A;  1LA3 A;  1DEL A;  3EG5 B;  5ER4 X;  4C0K A;  4YI8 A;  1Z2C B;  2K61 A;  1A4P A;  5B8I B;  1CB1 A;  2E30 A;  1QV1 A;  1QXP A;  2L98 A;  2Q91 A;  3AKB A;  1EH2 A;  1IIO A;  3SG4 A;  4GUK A;  2CTN A;  2HQ8 A;  1U5I B;  1AUI B;  1KFU S;  2KFF A;  3CZ2 A;  2I7A A;  2MLF C;  3AAJ A;  3V2L A;  1CTR A;  1TNW A;  1DJH A;  1RTP 1;  1W7J B;  2DOQ A;  2K0J A;  5CPV A;  1DEK A;  2H8V A;  2AUC A;  2CT9 A;  2BNX A;  3BOW B;  1QJT A; 
#chains in the Genus database with same CATH homology
 4DCK A;  1TNX A;  2L4I A;  4AQJ A;  1AHR A;  4P5O E;  1TOP A;  1YRU B;  4GBA A;  2JC2 A;  2Y1M A;  4MN0 A;  1XK4 C;  1GJY A;  3RM1 A;  1GGZ A;  1CFC A;  1WLZ A;  2GGM A;  1OMD A;  4Q04 A;  3TZ1 A;  1FF1 A;  2F2P A;  3FS7 A;  4JQ0 D;  5J3X A;  4ETO A;  3IQO A;  1L7Z A;  4YBH B;  1M46 A;  4HRG A;  4C0L A;  3EKJ A;  1JBA A;  1AVS A;  2M7L A;  1YRT B;  1PSB A;  1Y0V H;  4DRW A;  1LIN A;  1CKK A;  2ZNE A;  1ZAC A;  1DTL A;  3TUY B;  2OTG B;  4BY5 A;  4USL A;  4PAL A;  1NX2 A;  2BL0 B;  1G4Y R;  1HQV A;  1BR1 B;  1QVI Y;  2PRU A;  3C1V A;  3I5F B;  2BCA A;  3GK4 X;  2LP2 A;  2BBN A;  1A75 A;  1BOD A;  2CBL A;  1JUO A;  1SPY A;  1WRK A;  4UPG A;  1N65 A;  2L5X B;  1DJZ A;  1TCF A;  3NXA A;  1CMF A;  1F8H A;  2WCE A;  3E3R A;  3I5H C;  2TN4 A;  4DIR A;  1KQM C;  4M2Q A;  1H4B A;  1JSA A;  5CSJ A;  1RJV A;  2O60 A;  1XK4 A;  1DMO A;  5DKN A;  1M45 A;  4OV2 A;  4MRX A;  1M31 A;  3CS1 A;  2KQ6 A;  1CDN A;  1B7T Y;  1CDM A;  1SL7 A;  1Y6W A;  1VRK A;  2M7N A;  2P6B B;  1B8L A;  1NX0 A;  5HKY A;  2FOT A;  1ODB A;  1R6P A;  1XFU O;  1YR5 A;  2HET A;  5I2L A;  1NCZ A;  3FWC A;  4GNK B;  3VGO A;  1EG4 A;  1DJY A;  1KK7 Z;  1UUR A;  5K89 A;  3LCP C;  5HLO A;  5ER5 A;  5KU1 A;  1EJ3 A;  2MJW B;  1SCV A;  2KAV A;  2PAL A;  1WRZ A;  1FI5 A;  2LMU A;  1PUL A;  3EK7 A;  3TDU A;  4XJK A;  1NPQ A;  1MR8 A;  3LK1 A;  2ZFD A;  1XFY O;  2Y1N A;  3FWB A;  4GAO A;  2K8M B;  1SW8 A;  4CLN A;  2KBI A;  3CZT X;  2Y4Q A;  3EVU A;  4CID A;  5D69 A;  1UHI A;  1CNP A;  4C0J A;  2M97 A;  1XO5 A;  1Y1X A;  2JPT A;  1AK8 A;  2KAY A;  2IS9 A;  3CGA A;  2GV5 A;  4PHM A;  2M1U A;  1OE9 B;  2L50 A;  1GGW A;  4M2O A;  2I2R E;  3KO0 A;  3LLE A;  1IG5 A;  3TS5 C;  1B4C A;  3HX4 A;  4YRU A;  1KQV A;  4AQI A;  1NX1 A;  3OB2 B;  3EKH A;  3KPX A;  4GGF C;  1R2U A;  4MEW A;  3SJS A;  1J7P A;  4DS7 A;  1MQ1 A;  2LAP A;  2LCP A;  1SRA A;  1UUS A;  2KYF A;  2JQ6 A;  5CSF A;  2BCB A;  1QLK A;  2L4H A;  5F6T A;  3DD4 A;  2I18 A;  1XFX O;  3AAK A;  1TRF A;  3JTD C;  4ZCV A;  1S5G Y;  3BUM B;  2ZND A;  4FQO A;  2LC5 A;  3ZNI A;  1A75 B;  2MHH A;  2NCO A;  1SKT A;  1K9U A;  4PHN A;  1V1F A;  4GFT A;  1PVA A;  2ZN9 A;  3NSO A;  1S3P A;  2ZN8 A;  2LM5 A;  1H8B A;  4N1F A;  2MAZ A;  5HKW A;  1WRL A;  3WNX B;  1Y1A A;  1KWO C;  3DF0 A;  3DVE A;  1C7W A;  5I2O A;  3VRR A;  3PAL A;  2JXC A;  1K90 D;  1WDC C;  1LVC D;  1QVI Z;  1UHN A;  3OB1 B;  1OSA A;  4GGF A;  4XYN A;  1CDL A;  1FW4 A;  1UHK A;  1W7I B;  2KHN A;  1M39 A;  4MZK A;  1XFZ O;  4WQ2 A;  1MUX A;  3SG2 A;  1NP8 A;  2Q4U A;  2K7C A;  1SK6 D;  2KI4 C;  1S6I A;  4FTG A;  2JOJ A;  1DJI A;  2LVK A;  1SR6 C;  2KI6 D;  5IBW A;  2K2F A;  3IF7 A;  3O78 A;  4OCI A;  1EG3 A;  2GGZ A;  3M0W A;  1LKJ A;  4OVN F;  4XJK B;  2L0P A;  2MBX A;  4PHK A;  1F4Q A;  3BUW B;  1B7T Z;  2KFH A;  1IQ5 A;  1DF0 A;  1B47 A;  2SCP A;  1NSH A;  3KF9 A;  1MXE A;  2OS8 C;  3BUX B;  3OP0 A;  3I5G C;  2EC6 C;  1SNL A;  3I5H B;  1UP5 A;  1LXF C;  4IL1 A;  1CMG A;  1KQM B;  1TNP A;  2HF5 A;  3LL8 B;  4A4B A;  5KSZ A;  1EXR A;  3I5I C;  3SIA A;  4MZJ A;  4PDZ A;  2NZ0 A;  5I2Q A;  1BR4 B;  2LHL A;  1BU3 A;  1JFK A;  2WND A;  1ZOT B;  3KEV A;  3QRX A;  1DJX A;  2FCD A;  1SL9 A;  2KQY A;  4PE7 A;  3AKA A;  2H61 A;  3DVK A;  2RGI A;  1QV0 A;  2MLE C;  1OZO A;  2LE9 B;  3CLN A;  4CPV A;  1MWN A;  3NSI A;  4I5L B;  2AMI A;  2BCX A;  1SCM C;  2EGD A;  1A2X A;  2CXJ A;  1QIV A;  5FYX A;  2ZKM X;  1TIZ A;  1K9K A;  3PAT A;  3LK0 A;  1PSR A;  1DJG A;  2M49 B;  3PM8 A;  1KK8 C;  2V53 A;  2I94 A;  1PVB A;  2WCF A;  1WLM A;  2LUC A;  1OMR A;  1QAT A;  2BBM A;  4MBE A;  4JWQ A;  1CDP A;  4PE4 A;  2LVJ A;  1U5I A;  2K7O A;  3PLF B;  1QX7 A;  2H2K A;  2COL B;  3BUN B;  4M2P A;  2KYC A;  1SMG A;  3IQQ A;  3H4S E;  1YX7 A;  5AER A;  2PSR A;  2JNF A;  3DF0 B;  4MZL A;  1FBV A;  1Y1U A;  5HYD A;  3SG3 A;  1K95 A;  1G33 A;  4NQG A;  4QJ3 B;  1FPW A;  1JF2 A;  3K21 A;  3TS5 B;  1S5G Z;  3NSL A;  5DKR A;  1CFP A;  1KFU L;  2WCB A;  4CFR A;  2JRF A;  2JTT A;  4ZCU A;  1K93 D;  2KGB C;  4MLW A;  3VRN A;  2MRD A;  3SG5 A;  2LLU A;  5I8N A;  1IJ5 A;  4N1G A;  2F33 A;  2LP3 A;  1BJF A;  1NX3 A;  3BXK A;  4BY4 A;  4YGA A;  1CFD A;  3JTD B;  1SYM A;  1SY9 A;  1L2O C;  3A4U B;  1AJ4 A;  4PCW A;  3SG7 A;  1YTZ C;  1CLL A;  1A29 A;  1YUU A;  2K7B A;  5JJG A;  1YVL A;  1F70 A;  1N0Y A;  2WC8 A;  2NCP A;  2FJU B;  3O2P A;  1M63 B;  4JPZ B;  4MSP A;  1NCX A;  2LUX A;  2LVV A;  1RRO A;  4R1E A;  1QX5 B;  4NDD A;  4TNC A;  2M1K B;  1NWD A;  3D0Y A;  1IQ3 A;  3A8R A;  4YI9 A;  2VRG A;  1KWO B;  1MXL C;  4GGN A;  4PE1 A;  2Y5I A;  5HKZ A;  5PAL A;  2QAC A;  1QTX A;  1CLM A;  3SG6 A;  3VRO A;  4WQ3 A;  1IRJ A;  2JUL A;  3ICB A;  2WOR A;  3EK8 A;  4I5K A;  1WDC B;  1J7O A;  4QJ4 B;  3DVM A;  1G8I A;  3CR5 X;  3TDI A;  3JVT C;  1PRW A;  5G08 A;  3NSK A;  5JOL A;  3PFV A;  2LMT A;  1YVH A;  3BYA A;  2H61 C;  2KI4 B;  1NYA A;  2BE4 A;  4N5X A;  1KSM A;  1ZFS A;  4P2Y B;  1F71 A;  2PAS A;  1SR6 B;  5AXI A;  2JNX A;  3PN7 C;  3GK1 A;  4ORB B;  1QAS A;  2K7D A;  3WXA A;  2PVB A;  2L2E A;  3GK2 A;  4GPL B;  1NCY A;  4YGC B;  2LV7 A;  3BQ3 A;  1SBJ A;  3DVJ A;  2JT8 A;  2R2I A;  1B1G A;  3EVV A;  2OS8 B;  1YUR A;  1DT7 B;  3I5G B;  2EC6 B;  1CLB A;  1RK9 A;  1GQM A;  1DJW A;  2LMV A;  1K8U A;  3F45 A;  1RWY A;  2ZRT A;  1KFX L;  3CR2 A;  3CWG A;  4DUQ A;  1CM4 A;  1A03 A;  2JU0 A;  1ALV A;  2BEC A;  2LVI A;  1C7V A;  3I5I B;  1JFJ A;  4NDB A;  1REC A;  1HT9 A;  3OHM B;  3FIA A;  2OPO A;  1C07 A;  5BPJ A;  1RFJ A;  2CCM A;  1CFF A;  1XVJ A;  4QJ5 B;  1NUB A;  1IGV A;  4PE0 A;  1F55 A;  3OX6 A;  3HCM A;  3WHT B;  1J55 A;  4I5J A;  2LLT A;  3CTN A;  1ZMZ A;  3EK4 A;  1SCM B;  1UWO A;  2KDH A;  1K9P A;  1F4O A;  4L9M A;  2KFG A;  1BOC A;  1DGV A;  1AP4 A;  1JF0 A;  2JT0 A;  1Q80 A;  3O6B A;  2KAX A;  1JC2 A;  1QX2 A;  4F0Z B;  1UHJ A;  1F54 A;  1KK8 B;  4YGB B;  1XFV O;  1TNQ A;  1PK0 D;  1K94 A;  1B8R A;  1EL4 A;  1J7R A;  4YGE B;  3TUY C;  2OTG C;  3VRQ A;  2BKH B;  1S6C A;  1X02 A;  2NLN A;  4PHJ A;  2LAN A;  2G2B A;  4ICB A;  1YUS A;  2CNP A;  3D0Y B;  2JXL A;  2BL0 C;  3I5F C;  3ZWH A;  2JWW A;  2O5G A;  2L51 A;  4A4C A;  1QIW A;  4HSZ A;  1XA5 A;  5D7F A;  1BLQ A;  2ISD A;  2K2A A;  2KGR A;  2LNK A;  1MHO A;  1ZUZ A;  2LHI A;  1S6J A;  1YUT A;  2QPT A;  4NDC A;  1CM1 A;  2M0R A;  5DKQ A;  1E8A A;  4AOM A;  3BOW A;  4HRH A;  2M9G A;  1DVI A;  1IKU A;  3GOF A;  5KTY A;  1S26 D;  2BE6 A;  2MA2 A;  2KOT A;  1TN4 A;  1UHH A;  2B1U A;  2KNE A;  2SAS A;  1N2D A;  1OOJ A;  1ALW A;  2F3Z A;  1J1E A;  1KFX S;  1TCO B;  1BT6 A;  3RLZ A;  4I5N B;  1B9A A;  1BF5 A;  1L2O B;  2ZRS A;  2F8P A;  5AEQ A;  3EVR A;  2JZI A;  2LLS A;  2JT3 A;  5GQQ C;  4D1E A;  2A4J A;  3CR4 X;  1BMO A;  1KSO A;  2BKI B;  3D10 A;  1D1O A;  1TTX A;  1IJ6 A;  2HPS A;  1OMV A;  3VRP A;  4U8D A;  2EHB A;  1MF8 B;  3WHU B;  1OZS A;  4ORC B;  3OX5 A;  1S36 A;  1IWQ A;  5TNC A;  2KI6 C;  1B8C A;  1V1G A;  4MRY A;  1OQP A;  1FI6 A;  1DF0 B;  1SL8 A;  1XYD A;  2PMY A;  2E6W A;  1WY9 A;  2KBM A;  3MSE B;  1KK7 Y;  4OKH A;  5HLV A;  3O4Y A;  1DGU A;  1JWD A;  2M29 A;  2D8N A;  2F3Y A;  3JVT B;  1BG1 A;  1XFW O;  3PSR A;  4WRI A;  5AFP A;  1NIW A;  2JTZ A;  3SIB A;  3TDZ A;  4E68 A;  2G9B A;  1K2H A;  3KHE A;  3BUO B;  5CSI A;  4CFQ A;  2KSP A;  2FCE A;  3PN7 B;  2M8U A;  1J1D A;  2AAO A;  2F2O A;  4HRE E;  4MVF A;  1LA0 A;  1IH0 A;  1QS7 A;  1AJ5 A;  1YX8 A;  2HQW A;  1S1E A;  2WOS A;  1KCY A;  2M3W A;  5AAN A;  4YGD B;  4ORA B;  5CSN A;  4OR9 B;  2NXQ A;  1QLS A;  1J7Q A;  1K96 A;  1PAL A;  1LA3 A;  5ER4 X;  4C0K A;  4YI8 A;  2K61 A;  1A4P A;  5B8I B;  1CB1 A;  2E30 A;  1QV1 A;  1QXP A;  2L98 A;  2Q91 A;  3AKB A;  1EH2 A;  3SG4 A;  4GUK A;  2CTN A;  2HQ8 A;  1U5I B;  1AUI B;  1KFU S;  2KFF A;  2I7A A;  2MLF C;  3AAJ A;  1CTR A;  1TNW A;  1DJH A;  1RTP 1;  1W7J B;  2DOQ A;  2K0J A;  5CPV A;  2AUC A;  2CT9 A;  3BOW B;  1QJT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...