1YX8A

Nmr structure of calsensin, 20 low energy structures.
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
83
structure length
83
Chain Sequence
MACKVKAELEAAFKKLDANGDGYVTALELQTFMVTLDAYKALSKDKVKEASAKLIKMADKNSDGKISKEEFLNANAELLCQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Calsensin
publication title Solution structure and backbone dynamics of Calsensin, an invertebrate neuronal calcium-binding protein.
pubmed doi rcsb
source organism Haemopis marmorata
total genus 12
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2005-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13202 EF-hand_5 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1yx8A00
2CBLA 2L98A 2JULA 3SIAA 2KSPA 1QV0A 2OS8B 2H2KA 2PALA 3BOWB 4NDBA 2WCFA 3OB1B 1R6PA 3LLEA 3I5HB 1YUUA 2EC6C 3EK4A 5AFPA 1GGWA 2I7AA 1C07A 3CGAA 1OOJA 1N0YA 2L51A 4YI8A 2NCPA 3PLFB 2LP2A 1LA0A 1QS7A 2BL0B 1RFJA 1TNPA 1XO5A 1KWOB 3NSIA 2RGIA 3CLNA 4GGFC 1M46A 2M1UA 4MLWA 1OQPA 3WNXB 1DJYA 2LMTA 1E8AA 2K8MB 5IBWA 1NX0A 1CLLA 5D69A 2LM5A 2F2PA 2KHNA 2M9GA 1Q80A 1S3PA 1UHNA 2K61A 1WRZA 2NXQA 3DF0A 3I5GC 1XFUO 5ER4X 2V53A 1KK7Y 1G4YR 1QV1A 2HETA 2KYCA 2CCMA 3D0YA 2Q4UA 3SIBA 3CR2A 2Y4QA 3BUXB 1OMRA 2KFGA 1QASA 2LCPA 2KDHA 2AAOA 2JOJA 4GGFA 1DJZA 1A75A 1QX2A 2K7BA 4PALA 4ETOA 2MRDA 2EHBA 1PSBA 1BU3A 1C7VA 5PALA 1L2OB 3TDUA 3CZTX 3TUYB 2ZNEA 4C0KA 1CB1A 1FPWA 3BUNB 2HF5A 4E68A 1WDCC 4MZJA 4PCWA 1SPYA 1MWNA 2KBMA 2HPSA 1QVIY 3FIAA 2JZIA 2LP3A 1NX1A 1KFXL 1AUIB 2ZRSA 2FCEA 1B8LA 2H61C 1CDLA 2L4IA 2BKHB 3E3RA 2M29A 4AQIA 2LLSA 5CSFA 1KK8C 2JT3A 1KFUS 3KEVA 5JOLA 4DRWA 2BKIB 5HLOA 2K7OA 3SG4A 3BOWA 3PN7C 2ZN9A 2PRUA 1S6CA 4PE1A 1H8BA 1A4PA 1LA3A 1YX7A 1DTLA 3NSLA 1CFPA 1B7TY 1G33A 1D1OA 2ISDA 4NDDA 1TOPA 3SG6A 4JPZB 4MVFA 5DKNA 4DS7A 2L0PA 1L7ZA 2KI6D 5GQQC 2JWWA 3BYAA 2TN4A 3TDIA 1QIVA 1PK0D 1Y1AA 4I5LB 2CNPA 1JFKA 1NSHA 2Y1NA 4CIDA 2EC6B 3CS1A 4ICBA 1YVLA 2M7NA 1BODA 1RECA 1F70A 1OZOA 1K9PA 3D0YB 4C0LA 1S1EA 1WRLA 3DVKA 1EXRA 4PE4A 1DVIA 2KAXA 1J55A 2R2IA 1BJFA 4MN0A 3MSEB 2IS9A 1BR4B 1WLMA 1J1EA 2MLEC 1EJ3A 1QXPA 1IKUA 2M97A 1S6IA 3OX5A 1NCZA 1ALVA 3VGOA 2OTGC 1DF0B 3RLZA 2QACA 4I5JA 4NQGA 5D7FA 1NX2A 1NYAA 1IQ5A 4JWQA 1UUSA 1XK4A 3LCPC 4I5NB 1ZACA 1UWOA 2I94A 1RJVA 1SKTA 3I5GB 2F3YA 1DGUA 4DUQA 3AKBA 4P5OE 1PALA 2I18A 3DD4A 2M1KB 5G08A 1S6JA 3CR5X 4QJ3B 4CLNA 1PVAA 1CDPA 2CT9A 4GPLB 2K7DA 5I2QA 3BQ3A 1FI6A 3GK4X 1Y6WA 4P2YB 3WHUB 1V1FA 1SR6C 1HT9A 1TN4A 3SG7A 2JRFA 2LUXA 3JVTC 1IJ5A 3VRPA 1WY9A 1PVBA 1WDCB 3D10A 3EKJA 3DVMA 3ICBA 3LK1A 1N2DA 1IQ3A 5I2OA 2LVIA 1CDNA 4ORBB 1GGZA 1R2UA 1J7RA 2M49B 2G9BA 2KQ6A 4I5KA 1JF0A 3ZWHA 1J7PA 1K9UA 3C1VA 5KTYA 1JBAA 1M31A 5CSJA 1SL9A 2JNFA 2WNDA 3ZNIA 1BR1B 1SY9A 1WLZA 3EKHA 4QJ4B 2E30A 1QX7A 4MRYA 3NSKA 1B4CA 3PATA 1KK7Z 4BY5A 3PN7B 1FF1A 4FQOA 4YGCB 1AJ4A 1V1GA 4MZLA 1FW4A 1A03A 2PMYA 4HREE 2CXJA 3WHTB 1SCVA 1B47A 1CLBA 3PFVA 1TNXA 1CFDA 1LVCD 2GGZA 3CR4X 1K90D 2K7CA 2K2FA 1NWDA 1KFUL 3O78A 1NIWA 1KQVA 2JXLA 1XYDA 3EK8A 1J7QA 5HKZA 1OSAA 2LHIA 3IF7A 4YRUA 1ODBA 1DF0A 1YUTA 2A4JA 2KQYA 1IRJA 1Y1XA 3KO0A 5K89A 1CFCA 2I2RE 1QVIZ 1SW8A 4GBAA 1QATA 1YR5A 1LKJA 1U5IA 3GK2A 1XVJA 4YGDB 1PSRA 1F4QA 2LMUA 1JF2A 5CSIA 2OTGB 4XJKB 2LVKA 4GUKA 4IL1A 1MQ1A 4YGEB 3LK0A 2JTTA 1CNPA 4CPVA 1KQMC 1BOCA 1SK6D 2JQ6A 2KGRA 2F2OA 1QJTA 4MRXA 4YI9A 4WRIA 4PE0A 4A4CA 2COLB 1WRKA 1B7TZ 2WOSA 4PHJA 1MHOA 3TS5C 1EG3A 1UP5A 1SYMA 3BXKA 1K93D 2PSRA 3I5IC 1CMFA 1AJ5A 4ZCUA 1SCMC 5AXIA 1KSMA 3EK7A 4ORAB 1F71A 1Y0VH 1S5GY 3M0WA 4CFQA 2KGBC 2L50A 1G8IA 4HRGA 4C0JA 2KFFA 1SR6B 1K9KA 1A2XA 5TNCA 3PM8A 5HKYA 1CLMA 1SL8A 3JVTB 2M3WA 2LANA 1KCYA 2H61A 2KOTA 2FCDA 4UPGA 3K21A 5HLVA 1IJ6A 3I5FC 1BG1A 1KSOA 2AUCA 3TZ1A 2VRGA 2SASA 1DT7B 3H4SE 2ZN8A 4TNCA 5DKQA 1UHJA 2KI4C 3DVJA 4WQ2A 3A4UB 1DMOA 2BCXA 4ORCB 1JWDA 2ZNDA 4MBEA 1PRWA 1IG5A 1TTXA 1BMOA 2JC2A 2JNXA 4HSZA 3VRRA 1K2HA 1MF8B 2BBMA 1U5IB 1N65A 1JUOA 1OZSA 3OB2B 4PHNA 4OVNF 2LUCA 1BT6A 1MXEA 2WCBA 1UHKA 4OR9B 4HRHA 2F33A 1SNLA 4QJ5B 1JFJA 1SMGA 1UHHA 2MA2A 3WXAA 2NLNA 1JC2A 1QLSA 1CTRA 2OPOA 1YRTB 1EG4A 2G2BA 2L2EA 4XJKA 1OE9B 1NCYA 1YRUB 1OMVA 1AK8A 3VRNA 2JXCA 2Q91A 2LVJA 2MAZA 4Q04A 4DIRA 2O60A 3AAKA 3JTDC 4USLA 1CM1A 2JT0A 2KBIA 2MJWB 3FS7A 1XFVO 1ALWA 2HQWA 2JT8A 4M2QA 1M45A 5CSNA 2LMVA 2GGMA 1KQMB 2F3ZA 2M0RA 1XA5A 1W7IB 4OKHA 2LNKA 3SG5A 1XFYO 2GV5A 2PVBA 3SG2A 3TS5B 3IQQA 2F8PA 2KNEA 1KK8B 1F8HA 5AEQA 3IQOA 1DJGA 4PHMA 1SBJA 3I5IB 1SCMB 3HCMA 3GOFA 4OV2A 1TRFA 2Y1MA 3PSRA 4YGBB 3TDZA 1F54A 1YX8A 2KI6C 2LVVA 4M2PA 1CFFA 1A29A 3FWBA 4MEWA 1XFXO 1MUXA 2L5XB 1B8RA 2LHLA 4FTGA 1J7OA 2K0JA 3NXAA 1AP4A 4XYNA 1BLQA 4N1GA 1HQVA 3I5FB 5I2LA 1K96A 3BUOB 2BCBA 2E6WA 1X02A 1K94A 1FI5A 2BCAA 1UHIA 5I8NA 1CM4A 2Y5IA 3DVEA 2JU0A 2KI4B 4M2OA 1F4OA 3F45A 1NCXA 5FYXA 4AOMA 2LAPA 1IWQA 1RK9A 2KFHA 3OX6A 4MSPA 1UURA 5J3XA 1LINA 4R1EA 3EVVA 4YGAA 4JQ0D 4F0ZB 4U8DA 4DCKA 4N1FA 2EGDA 1DJWA 1NP8A 2CTNA 1DGVA 2M8UA 3KF9A 4GGNA 4NDCA 3CTNA 3HX4A 1CMGA 1YUSA 1IGVA 2LC5A 2MHHA 3SG3A 4MZKA 1B1GA 2D8NA 1S5GZ 1LXFC 1RROA 3PALA 2O5GA 4WQ3A 3AKAA 5JJGA 2AMIA 2OS8C 2P6BB 2JTZA 3VRQA 3RM1A 2WC8A 1GJYA 2LV7A 1SL7A 1XFZO 2PASA 1NPQA 5HYDA 1NUBA 2WORA 3I5HC 1K8UA 5HKWA 1CKKA 1NX3A 4PHKA 1MR8A 1W7JB 4GAOA 3SJSA 3KHEA 2BE4A 3JTDB 5CPVA 1XFWO 2FJUB 2BL0C 1YURA 3BUWB 1TCFA 1KWOC 3QRXA 4A4BA 3AAJA 1TNWA 3OHMB 3OP0A 1EH2A 5F6TA 1ZOTB 2SCPA 1S36A 1M39A 2NCOA 2MLFC 2MBXA 1H4BA 1B8CA 1S26D 1RTP1 1AHRA 4GFTA 4PDZA 5AANA 1MXLC 5B8IB 1DJIA 1TCOB 2ZFDA 2LLUA 2WCEA 4L9MA 4CFRA 4D1EA 2B1UA 3CWGA 2HQ8A 5KSZA 1ZFSA 2L4HA 1K95A 3A8RA 2BBNA 3LL8B 1XK4C 1QTXA 1C7WA 1AVSA 2QPTA 3EVRA 1IH0A 4ZCVA 3DF0B 1KFXS 3EVUA 5AERA 2DOQA 2ZKMX 2NZ0A 3GK1A 1L2OC 4AQJA 3TUYC 4BY4A 2BECA 3FWCA 2KYFA 2KAVA 2M7LA 3O6BA 2JPTA 1JSAA 2BE6A 1QX5B 1BF5A 2LE9B 1A75B 1QLKA 1GQMA 1PULA 1DJXA 2FOTA 1F55A 4OCIA 5KU1A 1ZUZA 1EL4A 1J1DA 2K2AA 3VROA 4N5XA 1YTZC 2LLTA 1TNQA 2KAYA 1CDMA 1M63B 1YVHA 1FBVA 3O2PA 1QIWA 5BPJA 3BUMB 2ZRTA 1Y1UA 5DKRA 1B9AA 4YBHB 1ZMZA 3NSOA 1VRKA 4GNKB 1DJHA 5ER5A 3KPXA 1RWYA 1SRAA 1OMDA 1TIZA 3O4YA 4PE7A
chains in the Genus database with same CATH superfamily
2CBLA 2L98A 2JULA 3SIAA 2KSPA 1QV0A 2OS8B 3V2LA 2H2KA 2PALA 3BOWB 4NDBA 2WCFA 2GTEA 4OZDA 3OB1B 1R6PA 3LLEA 3I5HB 1YUUA 2EC6C 3CDNA 1TUJA 3EK4A 5AFPA 1GGWA 1TUZA 2I7AA 1C07A 3CGAA 1OOJA 1N0YA 2L51A 2WCJA 4YI8A 2NCPA 3PLFB 2LP2A 1LA0A 1QS7A 2BL0B 1RFJA 1TNPA 1XO5A 1KWOB 1W9ZA 3NSIA 5I94A 2RGIA 3CLNA 2QEHA 4GGFC 1M46A 2M1UA 2JPOA 4MLWA 1P28A 1OQPA 3WNXB 1DJYA 2LMTA 1E8AA 2K8MB 2ERBA 2FJYA 5IBWA 1NX0A 1CLLA 5D69A 2LM5A 2F2PA 2KHNA 2M9GA 3BFAA 3SS3A 1Q80A 1S3PA 1UHNA 2K61A 1WRZA 2NXQA 3DF0A 3I5GC 1XFUO 5ER4X 2V53A 1KK7Y 1G4YR 1QV1A 2HETA 2KYCA 2CCMA 3BFBA 2Q4UA 3D0YA 3SIBA 3CR2A 2Y4QA 3BUXB 3S0GA 1OMRA 2KFGA 1QASA 3VB1A 2LCPA 2KDHA 2AAOA 2JOJA 4GGFA 2P70A 1DJZA 1A75A 1QX2A 2K7BA 4PALA 4ETOA 2MRDA 2EHBA 1PSBA 1BU3A 1C7VA 5PALA 3SS5A 1L2OB 3TDUA 3CZTX 3TUYB 3B7AA 2ZNEA 4C0KA 1CB1A 1FPWA 3BUNB 2HF5A 2KLDA 4E68A 1WDCC 4MZJA 4PCWA 1SPYA 1MWNA 2KBMA 2HPSA 1QVIY 3FIAA 2JZIA 5EL2A 2LP3A 1NX1A 1KFXL 1AUIB 2PQLA 2FCEA 2ZRSA 1B8LA 2H61C 1CDLA 2L4IA 2BKHB 3E3RA 2M29A 4AQIA 2LLSA 5CSFA 1KK8C 3FE8A 3DYEA 2JT3A 1KFUS 3KEVA 5JOLA 4DRWA 2BKIB 5HLOA 2K7OA 3SG4A 3BOWA 3PN7C 2ZN9A 5DICA 2PRUA 1S6CA 4PE1A 1H8BA 1A4PA 1LA3A 1YX7A 4JKTA 1DTLA 2QDIA 3NSLA 1B7TY 1G33A 1CFPA 1D1OA 2ISDA 4NDDA 4INWA 1TOPA 3SG6A 3OGNA 4JPZB 4MVFA 3NHIA 5DKNA 4DS7A 2L0PA 1L7ZA 2KI6D 5GQQC 3UO9A 2JWWA 3BYAA 2TN4A 3TDIA 1QIVA 1PK0D 1Y1AA 4I5LB 2CNPA 1JFKA 1NSHA 2Y1NA 4CIDA 1ORGA 2EC6B 3CS1A 1TWOA 4ICBA 1YVLA 2M7NA 1BODA 1RECA 1F70A 1OZOA 1K9PA 3D0YB 4C0LA 1S1EA 1WRLA 3DVKA 1EXRA 4PE4A 1DVIA 2KAXA 1J55A 2R2IA 1BJFA 4MN0A 3MSEB 2IS9A 1BR4B 1WLMA 1J1EA 2MLEC 1EJ3A 1QXPA 2P71A 2M97A 1S6IA 3OX5A 1NCZA 1ALVA 3VGOA 2OTGC 1DF0B 3RLZA 2QACA 4I5JA 4NQGA 5D7FA 1NX2A 1NYAA 1IQ5A 4JWQA 1UUSA 1XK4A 3LCPC 4I5NB 1ZACA 3R1PA 1UWOA 2I94A 1RJVA 1SKTA 3I5GB 2F3YA 1DGUA 4DUQA 3AKBA 4P5OE 1PALA 2I18A 3D74A 2M1KB 3DD4A 5G08A 1S6JA 3CR5X 1T14A 4QJ3B 4CLNA 1PVAA 1CDPA 2CT9A 4GPLB 2K7DA 1DQEA 5I2QA 3BQ3A 1FI6A 3D77A 3GK4X 1Y6WA 1Z4HA 4P2YB 3WHUB 3S0FA 1V1FA 1SR6C 1HT9A 1TN4A 3SG7A 3L4AA 2JRFA 2LUXA 3JVTC 1IJ5A 3VRPA 1WY9A 1PVBA 1WDCB 3D10A 3EKJA 3DVMA 3ICBA 3LK1A 1N2DA 1IQ3A 5I2OA 2LVIA 1CDNA 4ORBB 1GGZA 3CZ2A 1R2UA 1J7RA 2M49B 3S0EA 2G9BA 2KQ6A 4I5KA 1JF0A 3ZWHA 1J7PA 1K9UA 3C1VA 3S0DA 5KTYA 3L4LA 1JBAA 1M31A 5CSJA 1SL9A 2JNFA 2WNDA 3ZNIA 1BR1B 1SY9A 1WLZA 3EG5B 3EKHA 4QJ4B 2E30A 1QX7A 3CZ1A 4MRYA 3B86A 3NSKA 1B4CA 3PATA 1KK7Z 4BY5A 3PN7B 1FF1A 4FQOA 4YGCB 1AJ4A 1V1GA 4MZLA 1FW4A 1A03A 2PMYA 3DY9A 4HREE 2CXJA 1OOIX 3WHTB 1SCVA 1B47A 1CLBA 3PFVA 1TNXA 1CFDA 1LVCD 2GGZA 2H8VA 3CR4X 1K90D 2K7CA 2K2FA 1NWDA 1KFUL 3O78A 3S0AA 1NIWA 1KQVA 2JXLA 1XYDA 3EK8A 2WCMA 5HKZA 1OSAA 2LHIA 3IF7A 4YRUA 1ODBA 1J7QA 1DF0A 1YUTA 2A4JA 2KQYA 1IRJA 1Y1XA 3KO0A 5K89A 1CFCA 2I2RE 1QVIZ 1SW8A 4GBAA 1QATA 1YR5A 1LKJA 1U5IA 3GK2A 1XVJA 4PT1A 1PSRA 4YGDB 2WC5A 1F4QA 2LMUA 1JF2A 5CSIA 2OTGB 4XJKB 2LVKA 4GUKA 4IL1A 1MQ1A 4YGEB 3LK0A 2JTTA 1CNPA 4CPVA 1KQMC 1BOCA 4KYNA 1SK6D 2JQ6A 2KGRA 2F2OA 1QJTA 4MRXA 4YI9A 4WRIA 4PE0A 4A4CA 2COLB 1WRKA 1B7TZ 1QWVA 2WOSA 4PHJA 1MHOA 3TS5C 1EG3A 2WCHA 1UP5A 1SYMA 3BXKA 1K93D 2PSRA 3I5IC 1CMFA 1AJ5A 4ZCUA 1OOFA 1SCMC 5AXIA 1KSMA 3EK7A 4F7FA 4ORAB 1F71A 1Y0VH 1S5GY 3M0WA 4CFQA 2KGBC 2L50A 1G8IA 4HRGA 4C0JA 2KFFA 1SR6B 1K9KA 1A2XA 5TNCA 3PM8A 5HKYA 1CLMA 1SL8A 3JVTB 2M3WA 2LANA 3QMEA 1KCYA 2H61A 2KOTA 2FCDA 4UPGA 3K21A 5HLVA 1IJ6A 3I5FC 1BG1A 1KSOA 2AUCA 3TZ1A 2VRGA 2SASA 1DT7B 3H4SE 2ZN8A 4TNCA 5DKQA 1UHJA 2KI4C 3DVJA 4WQ2A 3BJHA 3A4UB 1Z2CB 1DMOA 2BCXA 4ORCB 1JWDA 2ZNDA 4MBEA 1PRWA 1IG5A 1TTXA 1BMOA 2JC2A 2JNXA 4HSZA 3VRRA 1K2HA 1MF8B 2BBMA 1U5IB 1N65A 1OOHA 1JUOA 1OZSA 3N7HA 3PM2A 4JD9A 3OB2B 4PHNA 4OVNF 5FI2A 2LUCA 1BT6A 1MXEA 2WCBA 1UHKA 4OR9B 4HRHA 2F33A 1SNLA 3UNWA 4QJ5B 1JFJA 1SMGA 1UHHA 2MA2A 3WXAA 2NLNA 1JC2A 1QLSA 1CTRA 2OPOA 3FE9A 1YRTB 1EG4A 2G2BA 2L2EA 4XJKA 1OE9B 1NCYA 1YRUB 3DZTA 1OMVA 1AK8A 3VRNA 2JXCA 2Q91A 2LVJA 2MAZA 4Q04A 4DIRA 2PYQA 2O60A 3AAKA 3JTDC 4USLA 1CM1A 2JT0A 2KBIA 2WCKA 2MJWB 3FS7A 1XFVO 3D73A 1ALWA 2HQWA 2JT8A 4M2QA 1M45A 5HL1A 5CSNA 2BNXA 2LMVA 2GGMA 1KQMB 2BAPA 2F3ZA 2M0RA 3D75A 1XA5A 1W7IB 4OKHA 2LNKA 3SG5A 1XFYO 2GV5A 2PVBA 3CYZA 3BFHA 3SG2A 3K1EA 3TS5B 3FE6A 3IQQA 3D76A 2F8PA 2KNEA 1KK8B 1F8HA 3IVTA 5AEQA 3IQOA 1DJGA 4PHMA 1SBJA 3I5IB 2WC6A 1SCMB 3R1VA 3HCMA 3GOFA 4OV2A 1TRFA 2Y1MA 3PSRA 4YGBB 3TDZA 1F54A 1YX8A 2KI6C 2LVVA 1OW4A 4M2PA 1CFFA 1A29A 3FWBA 4MEWA 3DXLA 1XFXO 1MUXA 2L5XB 2K60A 3SS4A 1B8RA 2LHLA 4FTGA 5FI6A 1J7OA 2K0JA 3NXAA 1AP4A 4XYNA 1BLQA 4N1GA 1HQVA 3I5FB 5I2LA 1K96A 3BUOB 2BCBA 2E6WA 1X02A 1K94A 3NGVA 1XFRA 1FI5A 2BCAA 1UHIA 5I8NA 1CM4A 2Y5IA 3DVEA 2JU0A 2KI4B 4M2OA 1F4OA 3F45A 3O4XA 3S0BA 1NCXA 2QEBA 5FYXA 4AOMA 3OBVA 2LAPA 1IWQA 1RK9A 2KFHA 3OX6A 3R72A 4MSPA 1UURA 5J3XA 1IIOA 1LINA 4R1EA 3EVVA 4YGAA 4JQ0D 4F0ZB 4U8DA 3CZ0A 4N1FA 4DCKA 2EGDA 3B87A 1DJWA 1NP8A 4IJ7A 2CTNA 1DGVA 2M8UA 3KF9A 4GGNA 4NDCA 3CTNA 3HX4A 1CMGA 5D3OA 1SSEB 1IGVA 1YUSA 2LC5A 2MHHA 3SG3A 4MZKA 1B1GA 2D8NA 1S5GZ 1LXFC 1RROA 3PALA 2O5GA 3NHTA 3AKAA 4WQ3A 2AMIA 5JJGA 2OS8C 2P6BB 2JTZA 3VRQA 3RM1A 2WC8A 1GJYA 2LV7A 1SL7A 1XFZO 2PASA 1NPQA 5HYDA 1NUBA 2WORA 3I5HC 1K8UA 5HKWA 1CKKA 1NX3A 4PHKA 1MR8A 3B6XA 1W7JB 3D78A 4GAOA 3SJSA 3KHEA 2BE4A 3JTDB 5CPVA 3PJIA 1XFWO 2FJUB 2BL0C 3L47A 1IKUA 1YURA 3BUWB 1TCFA 1KWOC 3QRXA 4A4BA 3AAJA 1TNWA 3OHMB 3OP0A 1EH2A 5F6TA 1ZOTB 2SCPA 1S36A 1M39A 2NCOA 4FQTA 2MLFC 2MBXA 1H4BA 1B8CA 1S26D 1RTP1 1AHRA 4GFTA 4PDZA 5AANA 1MXLC 5FI7A 5B8IB 1DJIA 1TCOB 2ZFDA 2LLUA 2WCEA 4L9MA 4CFRA 4D1EA 2QEVA 2B1UA 2L2CA 3CWGA 3Q8IA 2HQ8A 5KSZA 1ZFSA 2KPHA 1GM0A 2L4HA 1K95A 3A8RA 2BBNA 3LL8B 1XK4C 1QTXA 2QEOA 1C7WA 1AVSA 2QPTA 3EVRA 1IH0A 4ZCVA 3DF0B 1KFXS 1DEKA 3EVUA 5AERA 2DOQA 3RZSA 2ZKMX 2NZ0A 3GK1A 2WCLA 1L2OC 4AQJA 2KLEA 3TUYC 4BY4A 1C3ZA 2BECA 3FWCA 2KYFA 2KAVA 2L5YA 3O6BA 2JPTA 4INXA 2BE6A 2M7LA 1JSAA 1QX5B 3R1OA 1BF5A 1OOGA 3B88A 2LE9B 1A75B 1QLKA 1C3YA 1GQMA 1PULA 1DJXA 2FOTA 1F55A 4OCIA 5KU1A 1ZUZA 2YGUA 1EL4A 1J1DA 2K2AA 3VROA 4N5XA 1YTZC 2LLTA 1TNQA 2KAYA 1DC1A 1LS8A 1CDMA 1M63B 1YVHA 1FBVA 3O2PA 1QIWA 5BPJA 3BUMB 2ZRTA 1Y1UA 3CABA 5DKRA 1DELA 1B9AA 4YBHB 1ZMZA 3NSOA 1VRKA 4GNKB 1DJHA 5ER5A 3KPXA 1RWYA 1SRAA 1OMDA 1TIZA 3O4YA 4PE7A
chains in the Genus database with same CATH topology
2CBLA 2L98A 2JULA 3SIAA 2KSPA 1QV0A 2OS8B 2H2KA 2PALA 3BOWB 4NDBA 2WCFA 3OB1B 1R6PA 3LLEA 3I5HB 1YUUA 2EC6C 3EK4A 5AFPA 1GGWA 2I7AA 1C07A 3CGAA 1OOJA 1N0YA 2L51A 4YI8A 2NCPA 3PLFB 2LP2A 1LA0A 1QS7A 2BL0B 1RFJA 1TNPA 1XO5A 1KWOB 3NSIA 2RGIA 3CLNA 4GGFC 1M46A 2M1UA 4MLWA 1OQPA 3WNXB 1DJYA 2LMTA 1E8AA 2K8MB 5IBWA 1NX0A 1CLLA 5D69A 2LM5A 2F2PA 2KHNA 2M9GA 1Q80A 1S3PA 1UHNA 2K61A 1WRZA 2NXQA 3DF0A 3I5GC 1XFUO 5ER4X 2V53A 1KK7Y 1G4YR 1QV1A 2HETA 2KYCA 2CCMA 3D0YA 2Q4UA 3SIBA 3CR2A 2Y4QA 3BUXB 1OMRA 2KFGA 1QASA 2LCPA 2KDHA 2AAOA 2JOJA 4GGFA 1DJZA 1A75A 1QX2A 2K7BA 4PALA 4ETOA 2MRDA 2EHBA 1PSBA 1BU3A 1C7VA 5PALA 1L2OB 3TDUA 3CZTX 3TUYB 2ZNEA 4C0KA 1CB1A 1FPWA 3BUNB 2HF5A 4E68A 1WDCC 4MZJA 4PCWA 1SPYA 1MWNA 2KBMA 2HPSA 1QVIY 3FIAA 2JZIA 2LP3A 1NX1A 1KFXL 1AUIB 2ZRSA 2FCEA 1B8LA 2H61C 1CDLA 2L4IA 2BKHB 3E3RA 2M29A 4AQIA 2LLSA 5CSFA 1KK8C 2JT3A 1KFUS 3KEVA 5JOLA 4DRWA 2BKIB 5HLOA 2K7OA 3SG4A 3BOWA 3PN7C 2ZN9A 2PRUA 1S6CA 4PE1A 1H8BA 1A4PA 1LA3A 1YX7A 1DTLA 3NSLA 1CFPA 1B7TY 1G33A 1D1OA 2ISDA 4NDDA 1TOPA 3SG6A 4JPZB 4MVFA 5DKNA 4DS7A 2L0PA 1L7ZA 2KI6D 5GQQC 2JWWA 3BYAA 2TN4A 3TDIA 1QIVA 1PK0D 1Y1AA 4I5LB 2CNPA 1JFKA 1NSHA 2Y1NA 4CIDA 2EC6B 3CS1A 4ICBA 1YVLA 2M7NA 1BODA 1RECA 1F70A 1OZOA 1K9PA 3D0YB 4C0LA 1S1EA 1WRLA 3DVKA 1EXRA 4PE4A 1DVIA 2KAXA 1J55A 2R2IA 1BJFA 4MN0A 3MSEB 2IS9A 1BR4B 1WLMA 1J1EA 2MLEC 1EJ3A 1QXPA 1IKUA 2M97A 1S6IA 3OX5A 1NCZA 1ALVA 3VGOA 2OTGC 1DF0B 3RLZA 2QACA 4I5JA 4NQGA 5D7FA 1NX2A 1NYAA 1IQ5A 4JWQA 1UUSA 1XK4A 3LCPC 4I5NB 1ZACA 1UWOA 2I94A 1RJVA 1SKTA 3I5GB 2F3YA 1DGUA 4DUQA 3AKBA 4P5OE 1PALA 2I18A 3DD4A 2M1KB 5G08A 1S6JA 3CR5X 4QJ3B 4CLNA 1PVAA 1CDPA 2CT9A 4GPLB 2K7DA 5I2QA 3BQ3A 1FI6A 3GK4X 1Y6WA 4P2YB 3WHUB 1V1FA 1SR6C 1HT9A 1TN4A 3SG7A 2JRFA 2LUXA 3JVTC 1IJ5A 3VRPA 1WY9A 1PVBA 1WDCB 3D10A 3EKJA 3DVMA 3ICBA 3LK1A 1N2DA 1IQ3A 5I2OA 2LVIA 1CDNA 4ORBB 1GGZA 1R2UA 1J7RA 2M49B 2G9BA 2KQ6A 4I5KA 1JF0A 3ZWHA 1J7PA 1K9UA 3C1VA 5KTYA 1JBAA 1M31A 5CSJA 1SL9A 2JNFA 2WNDA 3ZNIA 1BR1B 1SY9A 1WLZA 3EKHA 4QJ4B 2E30A 1QX7A 4MRYA 3NSKA 1B4CA 3PATA 1KK7Z 4BY5A 3PN7B 1FF1A 4FQOA 4YGCB 1AJ4A 1V1GA 4MZLA 1FW4A 1A03A 2PMYA 4HREE 2CXJA 3WHTB 1SCVA 1B47A 1CLBA 3PFVA 1TNXA 1CFDA 1LVCD 2GGZA 3CR4X 1K90D 2K7CA 2K2FA 1NWDA 1KFUL 3O78A 1NIWA 1KQVA 2JXLA 1XYDA 3EK8A 1J7QA 5HKZA 1OSAA 2LHIA 3IF7A 4YRUA 1ODBA 1DF0A 1YUTA 2A4JA 2KQYA 1IRJA 1Y1XA 3KO0A 5K89A 1CFCA 2I2RE 1QVIZ 1SW8A 4GBAA 1QATA 1YR5A 1LKJA 1U5IA 3GK2A 1XVJA 4YGDB 1PSRA 1F4QA 2LMUA 1JF2A 5CSIA 2OTGB 4XJKB 2LVKA 4GUKA 4IL1A 1MQ1A 4YGEB 3LK0A 2JTTA 1CNPA 4CPVA 1KQMC 1BOCA 1SK6D 2JQ6A 2KGRA 2F2OA 1QJTA 4MRXA 4YI9A 4WRIA 4PE0A 4A4CA 2COLB 1WRKA 1B7TZ 2WOSA 4PHJA 1MHOA 3TS5C 1EG3A 1UP5A 1SYMA 3BXKA 1K93D 2PSRA 3I5IC 1CMFA 1AJ5A 4ZCUA 1SCMC 5AXIA 1KSMA 3EK7A 4ORAB 1F71A 1Y0VH 1S5GY 3M0WA 4CFQA 2KGBC 2L50A 1G8IA 4HRGA 4C0JA 2KFFA 1SR6B 1K9KA 1A2XA 5TNCA 3PM8A 5HKYA 1CLMA 1SL8A 3JVTB 2M3WA 2LANA 1KCYA 2H61A 2KOTA 2FCDA 4UPGA 3K21A 5HLVA 1IJ6A 3I5FC 1BG1A 1KSOA 2AUCA 3TZ1A 2VRGA 2SASA 1DT7B 3H4SE 2ZN8A 4TNCA 5DKQA 1UHJA 2KI4C 3DVJA 4WQ2A 3A4UB 1DMOA 2BCXA 4ORCB 1JWDA 2ZNDA 4MBEA 1PRWA 1IG5A 1TTXA 1BMOA 2JC2A 2JNXA 4HSZA 3VRRA 1K2HA 1MF8B 2BBMA 1U5IB 1N65A 1JUOA 1OZSA 3OB2B 4PHNA 4OVNF 2LUCA 1BT6A 1MXEA 2WCBA 1UHKA 4OR9B 4HRHA 2F33A 1SNLA 4QJ5B 1JFJA 1SMGA 1UHHA 2MA2A 3WXAA 2NLNA 1JC2A 1QLSA 1CTRA 2OPOA 1YRTB 1EG4A 2G2BA 2L2EA 4XJKA 1OE9B 1NCYA 1YRUB 1OMVA 1AK8A 3VRNA 2JXCA 2Q91A 2LVJA 2MAZA 4Q04A 4DIRA 2O60A 3AAKA 3JTDC 4USLA 1CM1A 2JT0A 2KBIA 2MJWB 3FS7A 1XFVO 1ALWA 2HQWA 2JT8A 4M2QA 1M45A 5CSNA 2LMVA 2GGMA 1KQMB 2F3ZA 2M0RA 1XA5A 1W7IB 4OKHA 2LNKA 3SG5A 1XFYO 2GV5A 2PVBA 3SG2A 3TS5B 3IQQA 2F8PA 2KNEA 1KK8B 1F8HA 5AEQA 3IQOA 1DJGA 4PHMA 1SBJA 3I5IB 1SCMB 3HCMA 3GOFA 4OV2A 1TRFA 2Y1MA 3PSRA 4YGBB 3TDZA 1F54A 1YX8A 2KI6C 2LVVA 4M2PA 1CFFA 1A29A 3FWBA 4MEWA 1XFXO 1MUXA 2L5XB 1B8RA 2LHLA 4FTGA 1J7OA 2K0JA 3NXAA 1AP4A 4XYNA 1BLQA 4N1GA 1HQVA 3I5FB 5I2LA 1K96A 3BUOB 2BCBA 2E6WA 1X02A 1K94A 1FI5A 2BCAA 1UHIA 5I8NA 1CM4A 2Y5IA 3DVEA 2JU0A 2KI4B 4M2OA 1F4OA 3F45A 1NCXA 5FYXA 4AOMA 2LAPA 1IWQA 1RK9A 2KFHA 3OX6A 4MSPA 1UURA 5J3XA 1LINA 4R1EA 3EVVA 4YGAA 4JQ0D 4F0ZB 4U8DA 4DCKA 4N1FA 2EGDA 1DJWA 1NP8A 2CTNA 1DGVA 2M8UA 3KF9A 4GGNA 4NDCA 3CTNA 3HX4A 1CMGA 1YUSA 1IGVA 2LC5A 2MHHA 3SG3A 4MZKA 1B1GA 2D8NA 1S5GZ 1LXFC 1RROA 3PALA 2O5GA 4WQ3A 3AKAA 5JJGA 2AMIA 2OS8C 2P6BB 2JTZA 3VRQA 3RM1A 2WC8A 1GJYA 2LV7A 1SL7A 1XFZO 2PASA 1NPQA 5HYDA 1NUBA 2WORA 3I5HC 1K8UA 5HKWA 1CKKA 1NX3A 4PHKA 1MR8A 1W7JB 4GAOA 3SJSA 3KHEA 2BE4A 3JTDB 5CPVA 1XFWO 2FJUB 2BL0C 1YURA 3BUWB 1TCFA 1KWOC 3QRXA 4A4BA 3AAJA 1TNWA 3OHMB 3OP0A 1EH2A 5F6TA 1ZOTB 2SCPA 1S36A 1M39A 2NCOA 2MLFC 2MBXA 1H4BA 1B8CA 1S26D 1RTP1 1AHRA 4GFTA 4PDZA 5AANA 1MXLC 5B8IB 1DJIA 1TCOB 2ZFDA 2LLUA 2WCEA 4L9MA 4CFRA 4D1EA 2B1UA 3CWGA 2HQ8A 5KSZA 1ZFSA 2L4HA 1K95A 3A8RA 2BBNA 3LL8B 1XK4C 1QTXA 1C7WA 1AVSA 2QPTA 3EVRA 1IH0A 4ZCVA 3DF0B 1KFXS 3EVUA 5AERA 2DOQA 2ZKMX 2NZ0A 3GK1A 1L2OC 4AQJA 3TUYC 4BY4A 2BECA 3FWCA 2KYFA 2KAVA 2M7LA 3O6BA 2JPTA 1JSAA 2BE6A 1QX5B 1BF5A 2LE9B 1A75B 1QLKA 1GQMA 1PULA 1DJXA 2FOTA 1F55A 4OCIA 5KU1A 1ZUZA 1EL4A 1J1DA 2K2AA 3VROA 4N5XA 1YTZC 2LLTA 1TNQA 2KAYA 1CDMA 1M63B 1YVHA 1FBVA 3O2PA 1QIWA 5BPJA 3BUMB 2ZRTA 1Y1UA 5DKRA 1B9AA 4YBHB 1ZMZA 3NSOA 1VRKA 4GNKB 1DJHA 5ER5A 3KPXA 1RWYA 1SRAA 1OMDA 1TIZA 3O4YA 4PE7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CBL A;  2L98 A;  2JUL A;  3SIA A;  2KSP A;  1QV0 A;  2OS8 B;  2H2K A;  2PAL A;  3BOW B;  4NDB A;  2WCF A;  3OB1 B;  1R6P A;  3LLE A;  3I5H B;  1YUU A;  2EC6 C;  3EK4 A;  5AFP A;  1GGW A;  2I7A A;  1C07 A;  3CGA A;  1OOJ A;  1N0Y A;  2L51 A;  4YI8 A;  2NCP A;  3PLF B;  2LP2 A;  1LA0 A;  1QS7 A;  2BL0 B;  1RFJ A;  1TNP A;  1XO5 A;  1KWO B;  3NSI A;  2RGI A;  3CLN A;  4GGF C;  1M46 A;  2M1U A;  4MLW A;  1OQP A;  3WNX B;  1DJY A;  2LMT A;  1E8A A;  2K8M B;  5IBW A;  1NX0 A;  1CLL A;  5D69 A;  2LM5 A;  2F2P A;  2KHN A;  2M9G A;  1Q80 A;  1S3P A;  1UHN A;  2K61 A;  1WRZ A;  2NXQ A;  3DF0 A;  3I5G C;  1XFU O;  5ER4 X;  2V53 A;  1KK7 Y;  1G4Y R;  1QV1 A;  2HET A;  2KYC A;  2CCM A;  3D0Y A;  2Q4U A;  3SIB A;  3CR2 A;  2Y4Q A;  3BUX B;  1OMR A;  2KFG A;  1QAS A;  2LCP A;  2KDH A;  2AAO A;  2JOJ A;  4GGF A;  1DJZ A;  1A75 A;  1QX2 A;  2K7B A;  4PAL A;  4ETO A;  2MRD A;  2EHB A;  1PSB A;  1BU3 A;  1C7V A;  5PAL A;  1L2O B;  3TDU A;  3CZT X;  3TUY B;  2ZNE A;  4C0K A;  1CB1 A;  1FPW A;  3BUN B;  2HF5 A;  4E68 A;  1WDC C;  4MZJ A;  4PCW A;  1SPY A;  1MWN A;  2KBM A;  2HPS A;  1QVI Y;  3FIA A;  2JZI A;  2LP3 A;  1NX1 A;  1KFX L;  1AUI B;  2ZRS A;  2FCE A;  1B8L A;  2H61 C;  1CDL A;  2L4I A;  2BKH B;  3E3R A;  2M29 A;  4AQI A;  2LLS A;  5CSF A;  1KK8 C;  2JT3 A;  1KFU S;  3KEV A;  5JOL A;  4DRW A;  2BKI B;  5HLO A;  2K7O A;  3SG4 A;  3BOW A;  3PN7 C;  2ZN9 A;  2PRU A;  1S6C A;  4PE1 A;  1H8B A;  1A4P A;  1LA3 A;  1YX7 A;  1DTL A;  3NSL A;  1CFP A;  1B7T Y;  1G33 A;  1D1O A;  2ISD A;  4NDD A;  1TOP A;  3SG6 A;  4JPZ B;  4MVF A;  5DKN A;  4DS7 A;  2L0P A;  1L7Z A;  2KI6 D;  5GQQ C;  2JWW A;  3BYA A;  2TN4 A;  3TDI A;  1QIV A;  1PK0 D;  1Y1A A;  4I5L B;  2CNP A;  1JFK A;  1NSH A;  2Y1N A;  4CID A;  2EC6 B;  3CS1 A;  4ICB A;  1YVL A;  2M7N A;  1BOD A;  1REC A;  1F70 A;  1OZO A;  1K9P A;  3D0Y B;  4C0L A;  1S1E A;  1WRL A;  3DVK A;  1EXR A;  4PE4 A;  1DVI A;  2KAX A;  1J55 A;  2R2I A;  1BJF A;  4MN0 A;  3MSE B;  2IS9 A;  1BR4 B;  1WLM A;  1J1E A;  2MLE C;  1EJ3 A;  1QXP A;  1IKU A;  2M97 A;  1S6I A;  3OX5 A;  1NCZ A;  1ALV A;  3VGO A;  2OTG C;  1DF0 B;  3RLZ A;  2QAC A;  4I5J A;  4NQG A;  5D7F A;  1NX2 A;  1NYA A;  1IQ5 A;  4JWQ A;  1UUS A;  1XK4 A;  3LCP C;  4I5N B;  1ZAC A;  1UWO A;  2I94 A;  1RJV A;  1SKT A;  3I5G B;  2F3Y A;  1DGU A;  4DUQ A;  3AKB A;  4P5O E;  1PAL A;  2I18 A;  3DD4 A;  2M1K B;  5G08 A;  1S6J A;  3CR5 X;  4QJ3 B;  4CLN A;  1PVA A;  1CDP A;  2CT9 A;  4GPL B;  2K7D A;  5I2Q A;  3BQ3 A;  1FI6 A;  3GK4 X;  1Y6W A;  4P2Y B;  3WHU B;  1V1F A;  1SR6 C;  1HT9 A;  1TN4 A;  3SG7 A;  2JRF A;  2LUX A;  3JVT C;  1IJ5 A;  3VRP A;  1WY9 A;  1PVB A;  1WDC B;  3D10 A;  3EKJ A;  3DVM A;  3ICB A;  3LK1 A;  1N2D A;  1IQ3 A;  5I2O A;  2LVI A;  1CDN A;  4ORB B;  1GGZ A;  1R2U A;  1J7R A;  2M49 B;  2G9B A;  2KQ6 A;  4I5K A;  1JF0 A;  3ZWH A;  1J7P A;  1K9U A;  3C1V A;  5KTY A;  1JBA A;  1M31 A;  5CSJ A;  1SL9 A;  2JNF A;  2WND A;  3ZNI A;  1BR1 B;  1SY9 A;  1WLZ A;  3EKH A;  4QJ4 B;  2E30 A;  1QX7 A;  4MRY A;  3NSK A;  1B4C A;  3PAT A;  1KK7 Z;  4BY5 A;  3PN7 B;  1FF1 A;  4FQO A;  4YGC B;  1AJ4 A;  1V1G A;  4MZL A;  1FW4 A;  1A03 A;  2PMY A;  4HRE E;  2CXJ A;  3WHT B;  1SCV A;  1B47 A;  1CLB A;  3PFV A;  1TNX A;  1CFD A;  1LVC D;  2GGZ A;  3CR4 X;  1K90 D;  2K7C A;  2K2F A;  1NWD A;  1KFU L;  3O78 A;  1NIW A;  1KQV A;  2JXL A;  1XYD A;  3EK8 A;  1J7Q A;  5HKZ A;  1OSA A;  2LHI A;  3IF7 A;  4YRU A;  1ODB A;  1DF0 A;  1YUT A;  2A4J A;  2KQY A;  1IRJ A;  1Y1X A;  3KO0 A;  5K89 A;  1CFC A;  2I2R E;  1QVI Z;  1SW8 A;  4GBA A;  1QAT A;  1YR5 A;  1LKJ A;  1U5I A;  3GK2 A;  1XVJ A;  4YGD B;  1PSR A;  1F4Q A;  2LMU A;  1JF2 A;  5CSI A;  2OTG B;  4XJK B;  2LVK A;  4GUK A;  4IL1 A;  1MQ1 A;  4YGE B;  3LK0 A;  2JTT A;  1CNP A;  4CPV A;  1KQM C;  1BOC A;  1SK6 D;  2JQ6 A;  2KGR A;  2F2O A;  1QJT A;  4MRX A;  4YI9 A;  4WRI A;  4PE0 A;  4A4C A;  2COL B;  1WRK A;  1B7T Z;  2WOS A;  4PHJ A;  1MHO A;  3TS5 C;  1EG3 A;  1UP5 A;  1SYM A;  3BXK A;  1K93 D;  2PSR A;  3I5I C;  1CMF A;  1AJ5 A;  4ZCU A;  1SCM C;  5AXI A;  1KSM A;  3EK7 A;  4ORA B;  1F71 A;  1Y0V H;  1S5G Y;  3M0W A;  4CFQ A;  2KGB C;  2L50 A;  1G8I A;  4HRG A;  4C0J A;  2KFF A;  1SR6 B;  1K9K A;  1A2X A;  5TNC A;  3PM8 A;  5HKY A;  1CLM A;  1SL8 A;  3JVT B;  2M3W A;  2LAN A;  1KCY A;  2H61 A;  2KOT A;  2FCD A;  4UPG A;  3K21 A;  5HLV A;  1IJ6 A;  3I5F C;  1BG1 A;  1KSO A;  2AUC A;  3TZ1 A;  2VRG A;  2SAS A;  1DT7 B;  3H4S E;  2ZN8 A;  4TNC A;  5DKQ A;  1UHJ A;  2KI4 C;  3DVJ A;  4WQ2 A;  3A4U B;  1DMO A;  2BCX A;  4ORC B;  1JWD A;  2ZND A;  4MBE A;  1PRW A;  1IG5 A;  1TTX A;  1BMO A;  2JC2 A;  2JNX A;  4HSZ A;  3VRR A;  1K2H A;  1MF8 B;  2BBM A;  1U5I B;  1N65 A;  1JUO A;  1OZS A;  3OB2 B;  4PHN A;  4OVN F;  2LUC A;  1BT6 A;  1MXE A;  2WCB A;  1UHK A;  4OR9 B;  4HRH A;  2F33 A;  1SNL A;  4QJ5 B;  1JFJ A;  1SMG A;  1UHH A;  2MA2 A;  3WXA A;  2NLN A;  1JC2 A;  1QLS A;  1CTR A;  2OPO A;  1YRT B;  1EG4 A;  2G2B A;  2L2E A;  4XJK A;  1OE9 B;  1NCY A;  1YRU B;  1OMV A;  1AK8 A;  3VRN A;  2JXC A;  2Q91 A;  2LVJ A;  2MAZ A;  4Q04 A;  4DIR A;  2O60 A;  3AAK A;  3JTD C;  4USL A;  1CM1 A;  2JT0 A;  2KBI A;  2MJW B;  3FS7 A;  1XFV O;  1ALW A;  2HQW A;  2JT8 A;  4M2Q A;  1M45 A;  5CSN A;  2LMV A;  2GGM A;  1KQM B;  2F3Z A;  2M0R A;  1XA5 A;  1W7I B;  4OKH A;  2LNK A;  3SG5 A;  1XFY O;  2GV5 A;  2PVB A;  3SG2 A;  3TS5 B;  3IQQ A;  2F8P A;  2KNE A;  1KK8 B;  1F8H A;  5AEQ A;  3IQO A;  1DJG A;  4PHM A;  1SBJ A;  3I5I B;  1SCM B;  3HCM A;  3GOF A;  4OV2 A;  1TRF A;  2Y1M A;  3PSR A;  4YGB B;  3TDZ A;  1F54 A;  1YX8 A;  2KI6 C;  2LVV A;  4M2P A;  1CFF A;  1A29 A;  3FWB A;  4MEW A;  1XFX O;  1MUX A;  2L5X B;  1B8R A;  2LHL A;  4FTG A;  1J7O A;  2K0J A;  3NXA A;  1AP4 A;  4XYN A;  1BLQ A;  4N1G A;  1HQV A;  3I5F B;  5I2L A;  1K96 A;  3BUO B;  2BCB A;  2E6W A;  1X02 A;  1K94 A;  1FI5 A;  2BCA A;  1UHI A;  5I8N A;  1CM4 A;  2Y5I A;  3DVE A;  2JU0 A;  2KI4 B;  4M2O A;  1F4O A;  3F45 A;  1NCX A;  5FYX A;  4AOM A;  2LAP A;  1IWQ A;  1RK9 A;  2KFH A;  3OX6 A;  4MSP A;  1UUR A;  5J3X A;  1LIN A;  4R1E A;  3EVV A;  4YGA A;  4JQ0 D;  4F0Z B;  4U8D A;  4DCK A;  4N1F A;  2EGD A;  1DJW A;  1NP8 A;  2CTN A;  1DGV A;  2M8U A;  3KF9 A;  4GGN A;  4NDC A;  3CTN A;  3HX4 A;  1CMG A;  1YUS A;  1IGV A;  2LC5 A;  2MHH A;  3SG3 A;  4MZK A;  1B1G A;  2D8N A;  1S5G Z;  1LXF C;  1RRO A;  3PAL A;  2O5G A;  4WQ3 A;  3AKA A;  5JJG A;  2AMI A;  2OS8 C;  2P6B B;  2JTZ A;  3VRQ A;  3RM1 A;  2WC8 A;  1GJY A;  2LV7 A;  1SL7 A;  1XFZ O;  2PAS A;  1NPQ A;  5HYD A;  1NUB A;  2WOR A;  3I5H C;  1K8U A;  5HKW A;  1CKK A;  1NX3 A;  4PHK A;  1MR8 A;  1W7J B;  4GAO A;  3SJS A;  3KHE A;  2BE4 A;  3JTD B;  5CPV A;  1XFW O;  2FJU B;  2BL0 C;  1YUR A;  3BUW B;  1TCF A;  1KWO C;  3QRX A;  4A4B A;  3AAJ A;  1TNW A;  3OHM B;  3OP0 A;  1EH2 A;  5F6T A;  1ZOT B;  2SCP A;  1S36 A;  1M39 A;  2NCO A;  2MLF C;  2MBX A;  1H4B A;  1B8C A;  1S26 D;  1RTP 1;  1AHR A;  4GFT A;  4PDZ A;  5AAN A;  1MXL C;  5B8I B;  1DJI A;  1TCO B;  2ZFD A;  2LLU A;  2WCE A;  4L9M A;  4CFR A;  4D1E A;  2B1U A;  3CWG A;  2HQ8 A;  5KSZ A;  1ZFS A;  2L4H A;  1K95 A;  3A8R A;  2BBN A;  3LL8 B;  1XK4 C;  1QTX A;  1C7W A;  1AVS A;  2QPT A;  3EVR A;  1IH0 A;  4ZCV A;  3DF0 B;  1KFX S;  3EVU A;  5AER A;  2DOQ A;  2ZKM X;  2NZ0 A;  3GK1 A;  1L2O C;  4AQJ A;  3TUY C;  4BY4 A;  2BEC A;  3FWC A;  2KYF A;  2KAV A;  2M7L A;  3O6B A;  2JPT A;  1JSA A;  2BE6 A;  1QX5 B;  1BF5 A;  2LE9 B;  1A75 B;  1QLK A;  1GQM A;  1PUL A;  1DJX A;  2FOT A;  1F55 A;  4OCI A;  5KU1 A;  1ZUZ A;  1EL4 A;  1J1D A;  2K2A A;  3VRO A;  4N5X A;  1YTZ C;  2LLT A;  1TNQ A;  2KAY A;  1CDM A;  1M63 B;  1YVH A;  1FBV A;  3O2P A;  1QIW A;  5BPJ A;  3BUM B;  2ZRT A;  1Y1U A;  5DKR A;  1B9A A;  4YBH B;  1ZMZ A;  3NSO A;  1VRK A;  4GNK B;  1DJH A;  5ER5 A;  3KPX A;  1RWY A;  1SRA A;  1OMD A;  1TIZ A;  3O4Y A;  4PE7 A; 
#chains in the Genus database with same CATH topology
 2CBL A;  2L98 A;  2JUL A;  3SIA A;  2KSP A;  1QV0 A;  2OS8 B;  3V2L A;  2H2K A;  2PAL A;  3BOW B;  4NDB A;  2WCF A;  2GTE A;  4OZD A;  3OB1 B;  1R6P A;  3LLE A;  3I5H B;  1YUU A;  2EC6 C;  3CDN A;  1TUJ A;  3EK4 A;  5AFP A;  1GGW A;  1TUZ A;  2I7A A;  1C07 A;  3CGA A;  1OOJ A;  1N0Y A;  2L51 A;  2WCJ A;  4YI8 A;  2NCP A;  3PLF B;  2LP2 A;  1LA0 A;  1QS7 A;  2BL0 B;  1RFJ A;  1TNP A;  1XO5 A;  1KWO B;  1W9Z A;  3NSI A;  5I94 A;  2RGI A;  3CLN A;  2QEH A;  4GGF C;  1M46 A;  2M1U A;  2JPO A;  4MLW A;  1P28 A;  1OQP A;  3WNX B;  1DJY A;  2LMT A;  1E8A A;  2K8M B;  2ERB A;  2FJY A;  5IBW A;  1NX0 A;  1CLL A;  5D69 A;  2LM5 A;  2F2P A;  2KHN A;  2M9G A;  3BFA A;  3SS3 A;  1Q80 A;  1S3P A;  1UHN A;  2K61 A;  1WRZ A;  2NXQ A;  3DF0 A;  3I5G C;  1XFU O;  5ER4 X;  2V53 A;  1KK7 Y;  1G4Y R;  1QV1 A;  2HET A;  2KYC A;  2CCM A;  3BFB A;  2Q4U A;  3D0Y A;  3SIB A;  3CR2 A;  2Y4Q A;  3BUX B;  3S0G A;  1OMR A;  2KFG A;  1QAS A;  3VB1 A;  2LCP A;  2KDH A;  2AAO A;  2JOJ A;  4GGF A;  2P70 A;  1DJZ A;  1A75 A;  1QX2 A;  2K7B A;  4PAL A;  4ETO A;  2MRD A;  2EHB A;  1PSB A;  1BU3 A;  1C7V A;  5PAL A;  3SS5 A;  1L2O B;  3TDU A;  3CZT X;  3TUY B;  3B7A A;  2ZNE A;  4C0K A;  1CB1 A;  1FPW A;  3BUN B;  2HF5 A;  2KLD A;  4E68 A;  1WDC C;  4MZJ A;  4PCW A;  1SPY A;  1MWN A;  2KBM A;  2HPS A;  1QVI Y;  3FIA A;  2JZI A;  5EL2 A;  2LP3 A;  1NX1 A;  1KFX L;  1AUI B;  2PQL A;  2FCE A;  2ZRS A;  1B8L A;  2H61 C;  1CDL A;  2L4I A;  2BKH B;  3E3R A;  2M29 A;  4AQI A;  2LLS A;  5CSF A;  1KK8 C;  3FE8 A;  3DYE A;  2JT3 A;  1KFU S;  3KEV A;  5JOL A;  4DRW A;  2BKI B;  5HLO A;  2K7O A;  3SG4 A;  3BOW A;  3PN7 C;  2ZN9 A;  5DIC A;  2PRU A;  1S6C A;  4PE1 A;  1H8B A;  1A4P A;  1LA3 A;  1YX7 A;  4JKT A;  1DTL A;  2QDI A;  3NSL A;  1B7T Y;  1G33 A;  1CFP A;  1D1O A;  2ISD A;  4NDD A;  4INW A;  1TOP A;  3SG6 A;  3OGN A;  4JPZ B;  4MVF A;  3NHI A;  5DKN A;  4DS7 A;  2L0P A;  1L7Z A;  2KI6 D;  5GQQ C;  3UO9 A;  2JWW A;  3BYA A;  2TN4 A;  3TDI A;  1QIV A;  1PK0 D;  1Y1A A;  4I5L B;  2CNP A;  1JFK A;  1NSH A;  2Y1N A;  4CID A;  1ORG A;  2EC6 B;  3CS1 A;  1TWO A;  4ICB A;  1YVL A;  2M7N A;  1BOD A;  1REC A;  1F70 A;  1OZO A;  1K9P A;  3D0Y B;  4C0L A;  1S1E A;  1WRL A;  3DVK A;  1EXR A;  4PE4 A;  1DVI A;  2KAX A;  1J55 A;  2R2I A;  1BJF A;  4MN0 A;  3MSE B;  2IS9 A;  1BR4 B;  1WLM A;  1J1E A;  2MLE C;  1EJ3 A;  1QXP A;  2P71 A;  2M97 A;  1S6I A;  3OX5 A;  1NCZ A;  1ALV A;  3VGO A;  2OTG C;  1DF0 B;  3RLZ A;  2QAC A;  4I5J A;  4NQG A;  5D7F A;  1NX2 A;  1NYA A;  1IQ5 A;  4JWQ A;  1UUS A;  1XK4 A;  3LCP C;  4I5N B;  1ZAC A;  3R1P A;  1UWO A;  2I94 A;  1RJV A;  1SKT A;  3I5G B;  2F3Y A;  1DGU A;  4DUQ A;  3AKB A;  4P5O E;  1PAL A;  2I18 A;  3D74 A;  2M1K B;  3DD4 A;  5G08 A;  1S6J A;  3CR5 X;  1T14 A;  4QJ3 B;  4CLN A;  1PVA A;  1CDP A;  2CT9 A;  4GPL B;  2K7D A;  1DQE A;  5I2Q A;  3BQ3 A;  1FI6 A;  3D77 A;  3GK4 X;  1Y6W A;  1Z4H A;  4P2Y B;  3WHU B;  3S0F A;  1V1F A;  1SR6 C;  1HT9 A;  1TN4 A;  3SG7 A;  3L4A A;  2JRF A;  2LUX A;  3JVT C;  1IJ5 A;  3VRP A;  1WY9 A;  1PVB A;  1WDC B;  3D10 A;  3EKJ A;  3DVM A;  3ICB A;  3LK1 A;  1N2D A;  1IQ3 A;  5I2O A;  2LVI A;  1CDN A;  4ORB B;  1GGZ A;  3CZ2 A;  1R2U A;  1J7R A;  2M49 B;  3S0E A;  2G9B A;  2KQ6 A;  4I5K A;  1JF0 A;  3ZWH A;  1J7P A;  1K9U A;  3C1V A;  3S0D A;  5KTY A;  3L4L A;  1JBA A;  1M31 A;  5CSJ A;  1SL9 A;  2JNF A;  2WND A;  3ZNI A;  1BR1 B;  1SY9 A;  1WLZ A;  3EG5 B;  3EKH A;  4QJ4 B;  2E30 A;  1QX7 A;  3CZ1 A;  4MRY A;  3B86 A;  3NSK A;  1B4C A;  3PAT A;  1KK7 Z;  4BY5 A;  3PN7 B;  1FF1 A;  4FQO A;  4YGC B;  1AJ4 A;  1V1G A;  4MZL A;  1FW4 A;  1A03 A;  2PMY A;  3DY9 A;  4HRE E;  2CXJ A;  1OOI X;  3WHT B;  1SCV A;  1B47 A;  1CLB A;  3PFV A;  1TNX A;  1CFD A;  1LVC D;  2GGZ A;  2H8V A;  3CR4 X;  1K90 D;  2K7C A;  2K2F A;  1NWD A;  1KFU L;  3O78 A;  3S0A A;  1NIW A;  1KQV A;  2JXL A;  1XYD A;  3EK8 A;  2WCM A;  5HKZ A;  1OSA A;  2LHI A;  3IF7 A;  4YRU A;  1ODB A;  1J7Q A;  1DF0 A;  1YUT A;  2A4J A;  2KQY A;  1IRJ A;  1Y1X A;  3KO0 A;  5K89 A;  1CFC A;  2I2R E;  1QVI Z;  1SW8 A;  4GBA A;  1QAT A;  1YR5 A;  1LKJ A;  1U5I A;  3GK2 A;  1XVJ A;  4PT1 A;  1PSR A;  4YGD B;  2WC5 A;  1F4Q A;  2LMU A;  1JF2 A;  5CSI A;  2OTG B;  4XJK B;  2LVK A;  4GUK A;  4IL1 A;  1MQ1 A;  4YGE B;  3LK0 A;  2JTT A;  1CNP A;  4CPV A;  1KQM C;  1BOC A;  4KYN A;  1SK6 D;  2JQ6 A;  2KGR A;  2F2O A;  1QJT A;  4MRX A;  4YI9 A;  4WRI A;  4PE0 A;  4A4C A;  2COL B;  1WRK A;  1B7T Z;  1QWV A;  2WOS A;  4PHJ A;  1MHO A;  3TS5 C;  1EG3 A;  2WCH A;  1UP5 A;  1SYM A;  3BXK A;  1K93 D;  2PSR A;  3I5I C;  1CMF A;  1AJ5 A;  4ZCU A;  1OOF A;  1SCM C;  5AXI A;  1KSM A;  3EK7 A;  4F7F A;  4ORA B;  1F71 A;  1Y0V H;  1S5G Y;  3M0W A;  4CFQ A;  2KGB C;  2L50 A;  1G8I A;  4HRG A;  4C0J A;  2KFF A;  1SR6 B;  1K9K A;  1A2X A;  5TNC A;  3PM8 A;  5HKY A;  1CLM A;  1SL8 A;  3JVT B;  2M3W A;  2LAN A;  3QME A;  1KCY A;  2H61 A;  2KOT A;  2FCD A;  4UPG A;  3K21 A;  5HLV A;  1IJ6 A;  3I5F C;  1BG1 A;  1KSO A;  2AUC A;  3TZ1 A;  2VRG A;  2SAS A;  1DT7 B;  3H4S E;  2ZN8 A;  4TNC A;  5DKQ A;  1UHJ A;  2KI4 C;  3DVJ A;  4WQ2 A;  3BJH A;  3A4U B;  1Z2C B;  1DMO A;  2BCX A;  4ORC B;  1JWD A;  2ZND A;  4MBE A;  1PRW A;  1IG5 A;  1TTX A;  1BMO A;  2JC2 A;  2JNX A;  4HSZ A;  3VRR A;  1K2H A;  1MF8 B;  2BBM A;  1U5I B;  1N65 A;  1OOH A;  1JUO A;  1OZS A;  3N7H A;  3PM2 A;  4JD9 A;  3OB2 B;  4PHN A;  4OVN F;  5FI2 A;  2LUC A;  1BT6 A;  1MXE A;  2WCB A;  1UHK A;  4OR9 B;  4HRH A;  2F33 A;  1SNL A;  3UNW A;  4QJ5 B;  1JFJ A;  1SMG A;  1UHH A;  2MA2 A;  3WXA A;  2NLN A;  1JC2 A;  1QLS A;  1CTR A;  2OPO A;  3FE9 A;  1YRT B;  1EG4 A;  2G2B A;  2L2E A;  4XJK A;  1OE9 B;  1NCY A;  1YRU B;  3DZT A;  1OMV A;  1AK8 A;  3VRN A;  2JXC A;  2Q91 A;  2LVJ A;  2MAZ A;  4Q04 A;  4DIR A;  2PYQ A;  2O60 A;  3AAK A;  3JTD C;  4USL A;  1CM1 A;  2JT0 A;  2KBI A;  2WCK A;  2MJW B;  3FS7 A;  1XFV O;  3D73 A;  1ALW A;  2HQW A;  2JT8 A;  4M2Q A;  1M45 A;  5HL1 A;  5CSN A;  2BNX A;  2LMV A;  2GGM A;  1KQM B;  2BAP A;  2F3Z A;  2M0R A;  3D75 A;  1XA5 A;  1W7I B;  4OKH A;  2LNK A;  3SG5 A;  1XFY O;  2GV5 A;  2PVB A;  3CYZ A;  3BFH A;  3SG2 A;  3K1E A;  3TS5 B;  3FE6 A;  3IQQ A;  3D76 A;  2F8P A;  2KNE A;  1KK8 B;  1F8H A;  3IVT A;  5AEQ A;  3IQO A;  1DJG A;  4PHM A;  1SBJ A;  3I5I B;  2WC6 A;  1SCM B;  3R1V A;  3HCM A;  3GOF A;  4OV2 A;  1TRF A;  2Y1M A;  3PSR A;  4YGB B;  3TDZ A;  1F54 A;  1YX8 A;  2KI6 C;  2LVV A;  1OW4 A;  4M2P A;  1CFF A;  1A29 A;  3FWB A;  4MEW A;  3DXL A;  1XFX O;  1MUX A;  2L5X B;  2K60 A;  3SS4 A;  1B8R A;  2LHL A;  4FTG A;  5FI6 A;  1J7O A;  2K0J A;  3NXA A;  1AP4 A;  4XYN A;  1BLQ A;  4N1G A;  1HQV A;  3I5F B;  5I2L A;  1K96 A;  3BUO B;  2BCB A;  2E6W A;  1X02 A;  1K94 A;  3NGV A;  1XFR A;  1FI5 A;  2BCA A;  1UHI A;  5I8N A;  1CM4 A;  2Y5I A;  3DVE A;  2JU0 A;  2KI4 B;  4M2O A;  1F4O A;  3F45 A;  3O4X A;  3S0B A;  1NCX A;  2QEB A;  5FYX A;  4AOM A;  3OBV A;  2LAP A;  1IWQ A;  1RK9 A;  2KFH A;  3OX6 A;  3R72 A;  4MSP A;  1UUR A;  5J3X A;  1IIO A;  1LIN A;  4R1E A;  3EVV A;  4YGA A;  4JQ0 D;  4F0Z B;  4U8D A;  3CZ0 A;  4N1F A;  4DCK A;  2EGD A;  3B87 A;  1DJW A;  1NP8 A;  4IJ7 A;  2CTN A;  1DGV A;  2M8U A;  3KF9 A;  4GGN A;  4NDC A;  3CTN A;  3HX4 A;  1CMG A;  5D3O A;  1SSE B;  1IGV A;  1YUS A;  2LC5 A;  2MHH A;  3SG3 A;  4MZK A;  1B1G A;  2D8N A;  1S5G Z;  1LXF C;  1RRO A;  3PAL A;  2O5G A;  3NHT A;  3AKA A;  4WQ3 A;  2AMI A;  5JJG A;  2OS8 C;  2P6B B;  2JTZ A;  3VRQ A;  3RM1 A;  2WC8 A;  1GJY A;  2LV7 A;  1SL7 A;  1XFZ O;  2PAS A;  1NPQ A;  5HYD A;  1NUB A;  2WOR A;  3I5H C;  1K8U A;  5HKW A;  1CKK A;  1NX3 A;  4PHK A;  1MR8 A;  3B6X A;  1W7J B;  3D78 A;  4GAO A;  3SJS A;  3KHE A;  2BE4 A;  3JTD B;  5CPV A;  3PJI A;  1XFW O;  2FJU B;  2BL0 C;  3L47 A;  1IKU A;  1YUR A;  3BUW B;  1TCF A;  1KWO C;  3QRX A;  4A4B A;  3AAJ A;  1TNW A;  3OHM B;  3OP0 A;  1EH2 A;  5F6T A;  1ZOT B;  2SCP A;  1S36 A;  1M39 A;  2NCO A;  4FQT A;  2MLF C;  2MBX A;  1H4B A;  1B8C A;  1S26 D;  1RTP 1;  1AHR A;  4GFT A;  4PDZ A;  5AAN A;  1MXL C;  5FI7 A;  5B8I B;  1DJI A;  1TCO B;  2ZFD A;  2LLU A;  2WCE A;  4L9M A;  4CFR A;  4D1E A;  2QEV A;  2B1U A;  2L2C A;  3CWG A;  3Q8I A;  2HQ8 A;  5KSZ A;  1ZFS A;  2KPH A;  1GM0 A;  2L4H A;  1K95 A;  3A8R A;  2BBN A;  3LL8 B;  1XK4 C;  1QTX A;  2QEO A;  1C7W A;  1AVS A;  2QPT A;  3EVR A;  1IH0 A;  4ZCV A;  3DF0 B;  1KFX S;  1DEK A;  3EVU A;  5AER A;  2DOQ A;  3RZS A;  2ZKM X;  2NZ0 A;  3GK1 A;  2WCL A;  1L2O C;  4AQJ A;  2KLE A;  3TUY C;  4BY4 A;  1C3Z A;  2BEC A;  3FWC A;  2KYF A;  2KAV A;  2L5Y A;  3O6B A;  2JPT A;  4INX A;  2BE6 A;  2M7L A;  1JSA A;  1QX5 B;  3R1O A;  1BF5 A;  1OOG A;  3B88 A;  2LE9 B;  1A75 B;  1QLK A;  1C3Y A;  1GQM A;  1PUL A;  1DJX A;  2FOT A;  1F55 A;  4OCI A;  5KU1 A;  1ZUZ A;  2YGU A;  1EL4 A;  1J1D A;  2K2A A;  3VRO A;  4N5X A;  1YTZ C;  2LLT A;  1TNQ A;  2KAY A;  1DC1 A;  1LS8 A;  1CDM A;  1M63 B;  1YVH A;  1FBV A;  3O2P A;  1QIW A;  5BPJ A;  3BUM B;  2ZRT A;  1Y1U A;  3CAB A;  5DKR A;  1DEL A;  1B9A A;  4YBH B;  1ZMZ A;  3NSO A;  1VRK A;  4GNK B;  1DJH A;  5ER5 A;  3KPX A;  1RWY A;  1SRA A;  1OMD A;  1TIZ A;  3O4Y A;  4PE7 A; 
#chains in the Genus database with same CATH homology
 2CBL A;  2L98 A;  2JUL A;  3SIA A;  2KSP A;  1QV0 A;  2OS8 B;  2H2K A;  2PAL A;  3BOW B;  4NDB A;  2WCF A;  3OB1 B;  1R6P A;  3LLE A;  3I5H B;  1YUU A;  2EC6 C;  3EK4 A;  5AFP A;  1GGW A;  2I7A A;  1C07 A;  3CGA A;  1OOJ A;  1N0Y A;  2L51 A;  4YI8 A;  2NCP A;  3PLF B;  2LP2 A;  1LA0 A;  1QS7 A;  2BL0 B;  1RFJ A;  1TNP A;  1XO5 A;  1KWO B;  3NSI A;  2RGI A;  3CLN A;  4GGF C;  1M46 A;  2M1U A;  4MLW A;  1OQP A;  3WNX B;  1DJY A;  2LMT A;  1E8A A;  2K8M B;  5IBW A;  1NX0 A;  1CLL A;  5D69 A;  2LM5 A;  2F2P A;  2KHN A;  2M9G A;  1Q80 A;  1S3P A;  1UHN A;  2K61 A;  1WRZ A;  2NXQ A;  3DF0 A;  3I5G C;  1XFU O;  5ER4 X;  2V53 A;  1KK7 Y;  1G4Y R;  1QV1 A;  2HET A;  2KYC A;  2CCM A;  3D0Y A;  2Q4U A;  3SIB A;  3CR2 A;  2Y4Q A;  3BUX B;  1OMR A;  2KFG A;  1QAS A;  2LCP A;  2KDH A;  2AAO A;  2JOJ A;  4GGF A;  1DJZ A;  1A75 A;  1QX2 A;  2K7B A;  4PAL A;  4ETO A;  2MRD A;  2EHB A;  1PSB A;  1BU3 A;  1C7V A;  5PAL A;  1L2O B;  3TDU A;  3CZT X;  3TUY B;  2ZNE A;  4C0K A;  1CB1 A;  1FPW A;  3BUN B;  2HF5 A;  4E68 A;  1WDC C;  4MZJ A;  4PCW A;  1SPY A;  1MWN A;  2KBM A;  2HPS A;  1QVI Y;  3FIA A;  2JZI A;  2LP3 A;  1NX1 A;  1KFX L;  1AUI B;  2ZRS A;  2FCE A;  1B8L A;  2H61 C;  1CDL A;  2L4I A;  2BKH B;  3E3R A;  2M29 A;  4AQI A;  2LLS A;  5CSF A;  1KK8 C;  2JT3 A;  1KFU S;  3KEV A;  5JOL A;  4DRW A;  2BKI B;  5HLO A;  2K7O A;  3SG4 A;  3BOW A;  3PN7 C;  2ZN9 A;  2PRU A;  1S6C A;  4PE1 A;  1H8B A;  1A4P A;  1LA3 A;  1YX7 A;  1DTL A;  3NSL A;  1CFP A;  1B7T Y;  1G33 A;  1D1O A;  2ISD A;  4NDD A;  1TOP A;  3SG6 A;  4JPZ B;  4MVF A;  5DKN A;  4DS7 A;  2L0P A;  1L7Z A;  2KI6 D;  5GQQ C;  2JWW A;  3BYA A;  2TN4 A;  3TDI A;  1QIV A;  1PK0 D;  1Y1A A;  4I5L B;  2CNP A;  1JFK A;  1NSH A;  2Y1N A;  4CID A;  2EC6 B;  3CS1 A;  4ICB A;  1YVL A;  2M7N A;  1BOD A;  1REC A;  1F70 A;  1OZO A;  1K9P A;  3D0Y B;  4C0L A;  1S1E A;  1WRL A;  3DVK A;  1EXR A;  4PE4 A;  1DVI A;  2KAX A;  1J55 A;  2R2I A;  1BJF A;  4MN0 A;  3MSE B;  2IS9 A;  1BR4 B;  1WLM A;  1J1E A;  2MLE C;  1EJ3 A;  1QXP A;  1IKU A;  2M97 A;  1S6I A;  3OX5 A;  1NCZ A;  1ALV A;  3VGO A;  2OTG C;  1DF0 B;  3RLZ A;  2QAC A;  4I5J A;  4NQG A;  5D7F A;  1NX2 A;  1NYA A;  1IQ5 A;  4JWQ A;  1UUS A;  1XK4 A;  3LCP C;  4I5N B;  1ZAC A;  1UWO A;  2I94 A;  1RJV A;  1SKT A;  3I5G B;  2F3Y A;  1DGU A;  4DUQ A;  3AKB A;  4P5O E;  1PAL A;  2I18 A;  3DD4 A;  2M1K B;  5G08 A;  1S6J A;  3CR5 X;  4QJ3 B;  4CLN A;  1PVA A;  1CDP A;  2CT9 A;  4GPL B;  2K7D A;  5I2Q A;  3BQ3 A;  1FI6 A;  3GK4 X;  1Y6W A;  4P2Y B;  3WHU B;  1V1F A;  1SR6 C;  1HT9 A;  1TN4 A;  3SG7 A;  2JRF A;  2LUX A;  3JVT C;  1IJ5 A;  3VRP A;  1WY9 A;  1PVB A;  1WDC B;  3D10 A;  3EKJ A;  3DVM A;  3ICB A;  3LK1 A;  1N2D A;  1IQ3 A;  5I2O A;  2LVI A;  1CDN A;  4ORB B;  1GGZ A;  1R2U A;  1J7R A;  2M49 B;  2G9B A;  2KQ6 A;  4I5K A;  1JF0 A;  3ZWH A;  1J7P A;  1K9U A;  3C1V A;  5KTY A;  1JBA A;  1M31 A;  5CSJ A;  1SL9 A;  2JNF A;  2WND A;  3ZNI A;  1BR1 B;  1SY9 A;  1WLZ A;  3EKH A;  4QJ4 B;  2E30 A;  1QX7 A;  4MRY A;  3NSK A;  1B4C A;  3PAT A;  1KK7 Z;  4BY5 A;  3PN7 B;  1FF1 A;  4FQO A;  4YGC B;  1AJ4 A;  1V1G A;  4MZL A;  1FW4 A;  1A03 A;  2PMY A;  4HRE E;  2CXJ A;  3WHT B;  1SCV A;  1B47 A;  1CLB A;  3PFV A;  1TNX A;  1CFD A;  1LVC D;  2GGZ A;  3CR4 X;  1K90 D;  2K7C A;  2K2F A;  1NWD A;  1KFU L;  3O78 A;  1NIW A;  1KQV A;  2JXL A;  1XYD A;  3EK8 A;  1J7Q A;  5HKZ A;  1OSA A;  2LHI A;  3IF7 A;  4YRU A;  1ODB A;  1DF0 A;  1YUT A;  2A4J A;  2KQY A;  1IRJ A;  1Y1X A;  3KO0 A;  5K89 A;  1CFC A;  2I2R E;  1QVI Z;  1SW8 A;  4GBA A;  1QAT A;  1YR5 A;  1LKJ A;  1U5I A;  3GK2 A;  1XVJ A;  4YGD B;  1PSR A;  1F4Q A;  2LMU A;  1JF2 A;  5CSI A;  2OTG B;  4XJK B;  2LVK A;  4GUK A;  4IL1 A;  1MQ1 A;  4YGE B;  3LK0 A;  2JTT A;  1CNP A;  4CPV A;  1KQM C;  1BOC A;  1SK6 D;  2JQ6 A;  2KGR A;  2F2O A;  1QJT A;  4MRX A;  4YI9 A;  4WRI A;  4PE0 A;  4A4C A;  2COL B;  1WRK A;  1B7T Z;  2WOS A;  4PHJ A;  1MHO A;  3TS5 C;  1EG3 A;  1UP5 A;  1SYM A;  3BXK A;  1K93 D;  2PSR A;  3I5I C;  1CMF A;  1AJ5 A;  4ZCU A;  1SCM C;  5AXI A;  1KSM A;  3EK7 A;  4ORA B;  1F71 A;  1Y0V H;  1S5G Y;  3M0W A;  4CFQ A;  2KGB C;  2L50 A;  1G8I A;  4HRG A;  4C0J A;  2KFF A;  1SR6 B;  1K9K A;  1A2X A;  5TNC A;  3PM8 A;  5HKY A;  1CLM A;  1SL8 A;  3JVT B;  2M3W A;  2LAN A;  1KCY A;  2H61 A;  2KOT A;  2FCD A;  4UPG A;  3K21 A;  5HLV A;  1IJ6 A;  3I5F C;  1BG1 A;  1KSO A;  2AUC A;  3TZ1 A;  2VRG A;  2SAS A;  1DT7 B;  3H4S E;  2ZN8 A;  4TNC A;  5DKQ A;  1UHJ A;  2KI4 C;  3DVJ A;  4WQ2 A;  3A4U B;  1DMO A;  2BCX A;  4ORC B;  1JWD A;  2ZND A;  4MBE A;  1PRW A;  1IG5 A;  1TTX A;  1BMO A;  2JC2 A;  2JNX A;  4HSZ A;  3VRR A;  1K2H A;  1MF8 B;  2BBM A;  1U5I B;  1N65 A;  1JUO A;  1OZS A;  3OB2 B;  4PHN A;  4OVN F;  2LUC A;  1BT6 A;  1MXE A;  2WCB A;  1UHK A;  4OR9 B;  4HRH A;  2F33 A;  1SNL A;  4QJ5 B;  1JFJ A;  1SMG A;  1UHH A;  2MA2 A;  3WXA A;  2NLN A;  1JC2 A;  1QLS A;  1CTR A;  2OPO A;  1YRT B;  1EG4 A;  2G2B A;  2L2E A;  4XJK A;  1OE9 B;  1NCY A;  1YRU B;  1OMV A;  1AK8 A;  3VRN A;  2JXC A;  2Q91 A;  2LVJ A;  2MAZ A;  4Q04 A;  4DIR A;  2O60 A;  3AAK A;  3JTD C;  4USL A;  1CM1 A;  2JT0 A;  2KBI A;  2MJW B;  3FS7 A;  1XFV O;  1ALW A;  2HQW A;  2JT8 A;  4M2Q A;  1M45 A;  5CSN A;  2LMV A;  2GGM A;  1KQM B;  2F3Z A;  2M0R A;  1XA5 A;  1W7I B;  4OKH A;  2LNK A;  3SG5 A;  1XFY O;  2GV5 A;  2PVB A;  3SG2 A;  3TS5 B;  3IQQ A;  2F8P A;  2KNE A;  1KK8 B;  1F8H A;  5AEQ A;  3IQO A;  1DJG A;  4PHM A;  1SBJ A;  3I5I B;  1SCM B;  3HCM A;  3GOF A;  4OV2 A;  1TRF A;  2Y1M A;  3PSR A;  4YGB B;  3TDZ A;  1F54 A;  1YX8 A;  2KI6 C;  2LVV A;  4M2P A;  1CFF A;  1A29 A;  3FWB A;  4MEW A;  1XFX O;  1MUX A;  2L5X B;  1B8R A;  2LHL A;  4FTG A;  1J7O A;  2K0J A;  3NXA A;  1AP4 A;  4XYN A;  1BLQ A;  4N1G A;  1HQV A;  3I5F B;  5I2L A;  1K96 A;  3BUO B;  2BCB A;  2E6W A;  1X02 A;  1K94 A;  1FI5 A;  2BCA A;  1UHI A;  5I8N A;  1CM4 A;  2Y5I A;  3DVE A;  2JU0 A;  2KI4 B;  4M2O A;  1F4O A;  3F45 A;  1NCX A;  5FYX A;  4AOM A;  2LAP A;  1IWQ A;  1RK9 A;  2KFH A;  3OX6 A;  4MSP A;  1UUR A;  5J3X A;  1LIN A;  4R1E A;  3EVV A;  4YGA A;  4JQ0 D;  4F0Z B;  4U8D A;  4DCK A;  4N1F A;  2EGD A;  1DJW A;  1NP8 A;  2CTN A;  1DGV A;  2M8U A;  3KF9 A;  4GGN A;  4NDC A;  3CTN A;  3HX4 A;  1CMG A;  1YUS A;  1IGV A;  2LC5 A;  2MHH A;  3SG3 A;  4MZK A;  1B1G A;  2D8N A;  1S5G Z;  1LXF C;  1RRO A;  3PAL A;  2O5G A;  4WQ3 A;  3AKA A;  5JJG A;  2AMI A;  2OS8 C;  2P6B B;  2JTZ A;  3VRQ A;  3RM1 A;  2WC8 A;  1GJY A;  2LV7 A;  1SL7 A;  1XFZ O;  2PAS A;  1NPQ A;  5HYD A;  1NUB A;  2WOR A;  3I5H C;  1K8U A;  5HKW A;  1CKK A;  1NX3 A;  4PHK A;  1MR8 A;  1W7J B;  4GAO A;  3SJS A;  3KHE A;  2BE4 A;  3JTD B;  5CPV A;  1XFW O;  2FJU B;  2BL0 C;  1YUR A;  3BUW B;  1TCF A;  1KWO C;  3QRX A;  4A4B A;  3AAJ A;  1TNW A;  3OHM B;  3OP0 A;  1EH2 A;  5F6T A;  1ZOT B;  2SCP A;  1S36 A;  1M39 A;  2NCO A;  2MLF C;  2MBX A;  1H4B A;  1B8C A;  1S26 D;  1RTP 1;  1AHR A;  4GFT A;  4PDZ A;  5AAN A;  1MXL C;  5B8I B;  1DJI A;  1TCO B;  2ZFD A;  2LLU A;  2WCE A;  4L9M A;  4CFR A;  4D1E A;  2B1U A;  3CWG A;  2HQ8 A;  5KSZ A;  1ZFS A;  2L4H A;  1K95 A;  3A8R A;  2BBN A;  3LL8 B;  1XK4 C;  1QTX A;  1C7W A;  1AVS A;  2QPT A;  3EVR A;  1IH0 A;  4ZCV A;  3DF0 B;  1KFX S;  3EVU A;  5AER A;  2DOQ A;  2ZKM X;  2NZ0 A;  3GK1 A;  1L2O C;  4AQJ A;  3TUY C;  4BY4 A;  2BEC A;  3FWC A;  2KYF A;  2KAV A;  2M7L A;  3O6B A;  2JPT A;  1JSA A;  2BE6 A;  1QX5 B;  1BF5 A;  2LE9 B;  1A75 B;  1QLK A;  1GQM A;  1PUL A;  1DJX A;  2FOT A;  1F55 A;  4OCI A;  5KU1 A;  1ZUZ A;  1EL4 A;  1J1D A;  2K2A A;  3VRO A;  4N5X A;  1YTZ C;  2LLT A;  1TNQ A;  2KAY A;  1CDM A;  1M63 B;  1YVH A;  1FBV A;  3O2P A;  1QIW A;  5BPJ A;  3BUM B;  2ZRT A;  1Y1U A;  5DKR A;  1B9A A;  4YBH B;  1ZMZ A;  3NSO A;  1VRK A;  4GNK B;  1DJH A;  5ER5 A;  3KPX A;  1RWY A;  1SRA A;  1OMD A;  1TIZ A;  3O4Y A;  4PE7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...