1YX8A

Nmr structure of calsensin, 20 low energy structures.
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
83
structure length
83
Chain Sequence
MACKVKAELEAAFKKLDANGDGYVTALELQTFMVTLDAYKALSKDKVKEASAKLIKMADKNSDGKISKEEFLNANAELLCQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calsensin
publication title Solution structure and backbone dynamics of Calsensin, an invertebrate neuronal calcium-binding protein.
pubmed doi rcsb
source organism Haemopis marmorata
molecule tags Metal binding protein
total genus 12
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2005-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13202 EF-hand_5 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1yx8A00
2JT0A 5G08A 2M7NA 4PE1A 1KSOA 2K61A 4BY4A 4M2QA 1V1FA 1QX5B 1SL8A 2F33A 4PALA 5GQQC 3EVUA 1SNLA 1XFZO 2QACA 1UHIA 3F45A 2LC5A 3CR5X 3IF7A 5BPJA 2LHIA 1Y6WA 1SK6D 2KI4B 1QASA 2LLTA 3BOWA 4MVFA 3EK8A 2O60A 2MLEC 2HF5A 4E68A 3DVEA 3A8RA 1TN4A 1SPYA 3LK1A 2ZNEA 3LL8B 4WQ3A 2JZIA 4L9MA 1KWOB 3JTDC 1UUSA 3SIAA 3DF0B 1KWOC 3GK2A 4OVNF 2PASA 5CSFA 1EJ3A 4N1FA 1W7IB 1RECA 1H8BA 1SCMC 1GGZA 1PSRA 2K7OA 3KPXA 2GV5A 1NWDA 2L5XB 3CZTX 1AJ5A 2HPSA 4D1EA 1CTRA 1V1GA 1CFPA 2M3WA 1IJ5A 1PVBA 1TNXA 2P6BB 5J3XA 2PMYA 1R6PA 1L2OC 3PSRA 3DD4A 1EG4A 1UHNA 1S5GY 4JWQA 1A75B 1JF0A 4ETOA 1A03A 2EC6B 1CKKA 2Q4UA 1B1GA 5CSNA 3KO0A 1OSAA 3PN7B 2M8UA 3I5GB 3BUOB 5TNCA 3RM1A 1K94A 2KNEA 4MZLA 2WCEA 2M0RA 5AFPA 1QIWA 1CM4A 5HLVA 3K21A 2MHHA 3BUNB 4ZCUA 1N0YA 1XYDA 1ALWA 2EHBA 2I7AA 1QX2A 1K2HA 3SG5A 2WCFA 3M0WA 3NSIA 4PHMA 4MEWA 5I2OA 1C7WA 2LMVA 1DJHA 1IJ6A 1NP8A 1SMGA 2LAPA 1QX7A 3FS7A 3VRRA 1OMVA 4HRGA 5CSIA 1C7VA 2LUXA 4PHNA 1NUBA 3ZWHA 3EVRA 2JT8A 3NXAA 1BU3A 2LE9B 3BUXB 4GAOA 2GGZA 1LVCD 2M49B 3SIBA 2LCPA 2CT9A 1UP5A 4I5NB 3O6BA 1Y1AA 1CDPA 1JF2A 3VRQA 1J7OA 3OP0A 4DUQA 4GFTA 2B1UA 2AAOA 1J1EA 1IRJA 2JXCA 1YVHA 1NPQA 2JT3A 2LV7A 1G4YR 1AJ4A 2HETA 1A29A 1N65A 1RFJA 1KFXS 2BL0C 2JTTA 3D0YA 4ZCVA 3BUWB 2M7LA 1TNWA 5K89A 1J7PA 1F4OA 3JVTB 3CLNA 1DF0B 2EGDA 4USLA 5DKRA 1B7TZ 5AEQA 3FWBA 1IGVA 4M2OA 1NSHA 3WXAA 1LXFC 1NX3A 2WCBA 1WLZA 1JFJA 4I5JA 4YGDB 3SG6A 1AHRA 5ER4X 1CB1A 1MQ1A 2F2PA 2TN4A 1AK8A 3IQQA 3I5FC 4JQ0D 1YR5A 1BJFA 3DVJA 4A4CA 5AANA 1OOJA 1TIZA 2M1KB 1FW4A 3TDIA 2BBNA 1JUOA 3TUYB 3KF9A 3BOWB 5AXIA 1OMDA 2WNDA 3I5IB 1RWYA 1IH0A 3E3RA 3I5IC 4QJ3B 2LNKA 1ZUZA 2ZN9A 3VGOA 1TNPA 1NYAA 3EK4A 1B8CA 1LA3A 1YUUA 1TCFA 3H4SE 2FCDA 5ER5A 2KGRA 4CIDA 1SW8A 1Y0VH 1KFUS 2JRFA 1QJTA 1DVIA 1A2XA 1ZACA 2ZN8A 2BE4A 2JOJA 1B8LA 4DCKA 4XYNA 2LANA 1F54A 1EH2A 5I8NA 4R1EA 2FJUB 3CTNA 1SBJA 4ORBB 1KQMC 1XFUO 3O4YA 3VROA 1K93D 1QXPA 1ZFSA 1B8RA 1DT7B 2F3YA 1DMOA 4CPVA 4TNCA 2BCBA 1KK8B 2ZKMX 4N1GA 1KK8C 1OZOA 3DVMA 3JTDB 2KFFA 1VRKA 2HQWA 1IKUA 2H61C 1SCMB 2IS9A 4Q04A 1IQ3A 1CLBA 1RK9A 2LP2A 1BT6A 2WORA 1FBVA 2LP3A 1S36A 1PULA 1NCXA 3VRPA 1H4BA 3WHTB 4DS7A 2BBMA 1M39A 1WY9A 4C0JA 3ICBA 3PFVA 5PALA 1HT9A 2Y4QA 4GBAA 1XFVO 3I5HC 2FCEA 2ISDA 2RGIA 5AERA 1L2OB 2WC8A 2BKHB 4M2PA 3A4UB 2AMIA 4YI8A 4MRYA 4PE7A 1K96A 2LMUA 2H61A 1BODA 1F8HA 1QIVA 1TRFA 2ZFDA 5IBWA 2K8MB 5B8IB 1XFXO 3KHEA 2M97A 1UURA 2KSPA 4YGBB 1IWQA 2NCPA 1WRLA 2L4HA 3BUMB 4IL1A 4YGCB 4CFRA 4PHJA 1EL4A 1KQVA 3SG4A 1EG3A 2CXJA 1RROA 1QS7A 3CR4X 2L4IA 2CNPA 1M46A 5I2QA 2K2AA 1J7RA 1R2UA 3D0YB 3GK1A 1SYMA 4I5KA 1JFKA 1RTP1 1FPWA 4I5LB 1YUTA 1QLKA 2AUCA 4OR9B 2JWWA 4OV2A 3ZNIA 1YTZC 4AQIA 1GGWA 2PVBA 2JULA 3PALA 1LA0A 1B7TY 5KTYA 1K90D 3NSKA 1CDLA 4FTGA 4GPLB 3TZ1A 3PLFB 5KSZA 2K2FA 1XK4C 1QVIZ 3LK0A 1J1DA 1PVAA 2KI6D 1AP4A 3EKJA 5D7FA 3CWGA 1SL7A 2MLFC 1A75A 2NXQA 2BL0B 4XJKA 5DKNA 1J7QA 1NX2A 1YX7A 3IQOA 1CFDA 1E8AA 4A4BA 1FF1A 1M31A 1RJVA 5JOLA 1S6IA 1JBAA 2Y1NA 2MRDA 3AKAA 4CLNA 2M1UA 2ZRSA 1QLSA 2BE6A 1IQ5A 2Q91A 1SRAA 1MF8B 2JC2A 1K9KA 3SG3A 3DVKA 1CNPA 1XK4A 5HKWA 3I5FB 1YRTB 1A4PA 1SCVA 2KYFA 3TS5C 3FWCA 2KBMA 3BYAA 3EVVA 1L7ZA 1QV1A 1CLMA 1PK0D 1WDCC 4AOMA 2L0PA 1NX1A 2JNFA 2KGBC 4PCWA 1KCYA 2ZNDA 2NCOA 2L51A 4MZJA 4BY5A 4DRWA 1SR6C 3WNXB 1OZSA 3CGAA 2JTZA 1DTLA 4JPZB 2QPTA 5HKZA 5CSJA 2K7CA 3PM8A 2Y1MA 1KSMA 5CPVA 1K9UA 2KAXA 3HCMA 1DJGA 1LKJA 4OCIA 2LMTA 2KQ6A 2KYCA 4C0LA 3LLEA 4MBEA 2OTGB 1B9AA 2CCMA 2JQ6A 1KQMB 2OS8C 1W7JB 2OTGC 2COLB 1ODBA 2KI6C 4MZKA 4P5OE 4PE4A 3VRNA 1GJYA 2KDHA 1U5IA 4WQ2A 2JPTA 3OB1B 2JU0A 4YRUA 2MA2A 1S26D 1B47A 1G8IA 2V53A 2PSRA 4QJ5B 2F2OA 4ORAB 2MAZA 2NZ0A 4YGAA 1MXLC 2K0JA 2M9GA 2LVIA 2MJWB 1BR4B 2L50A 3EKHA 1S6CA 4AQJA 4GNKB 1AVSA 2ZRTA 1KK7Z 2A4JA 2KFGA 1TTXA 4QJ4B 1JC2A 2H2KA 5KU1A 5FYXA 1MHOA 2WOSA 5I2LA 3O2PA 1KFXL 2L2EA 1ALVA 2KI4C 1Q80A 1JSAA 3AAKA 1HQVA 1OQPA 1DJIA 3I5HB 1F55A 1FI5A 2SASA 1YUSA 3GOFA 2I18A 2KHNA 2LM5A 4MRXA 1WRKA 1WRZA 2KBIA 2KOTA 1IG5A 1GQMA 2PALA 1N2DA 5F6TA 2LVJA 1F70A 1WLMA 1XVJA 5HYDA 1CFCA 4C0KA 1SY9A 2GGMA 2MBXA 1CDMA 1UHJA 4NQGA 1DGUA 4CFQA 2D8NA 1MXEA 1K8UA 2JXLA 1MR8A 1NIWA 1XFYO 3OX6A 2F3ZA 1J55A 5JJGA 1NCYA 2F8PA 1KFUL 3OHMB 4N5XA 1K9PA 1QVIY 3GK4X 1DJXA 1NCZA 1MUXA 1Y1XA 4XJKB 2EC6C 3HX4A 4GGFC 3DF0A 1TNQA 2PRUA 4MN0A 1QATA 3CR2A 2DOQA 2NLNA 3PN7C 3I5GC 4YBHB 1CDNA 4PDZA 1S3PA 1NX0A 3KEVA 2LUCA 2I2RE 4MSPA 4P2YB 4ORCB 2LVVA 4F0ZB 1PRWA 1YX8A 2OPOA 1EXRA 2LLSA 1Y1UA 3FIAA 1G33A 1M45A 1F4QA 4YGEB 1ZMZA 2CBLA 4ICBA 1BR1B 4HRHA 1K95A 1S5GZ 1F71A 2Y5IA 1LINA 1DGVA 1PALA 2BCXA 4WRIA 2KAVA 1YVLA 1XFWO 3EK7A 4GGFA 1CLLA 1BLQA 4UPGA 2K7DA 4GGNA 3PATA 3C1VA 1D1OA 1YURA 5HLOA 2K7BA 3AAJA 1QTXA 1BF5A 3SJSA 1FI6A 2FOTA 1C07A 4NDDA 1BG1A 2KFHA 2HQ8A 1CFFA 4PHKA 3OX5A 5D69A 1QV0A 3MSEB 3QRXA 2M29A 3NSOA 4FQOA 3SG2A 1CMGA 2VRGA 1JWDA 3TDZA 3AKBA 1X02A 3TS5B 2L98A 4OKHA 1PSBA 1U5IB 1BMOA 3RLZA 1UWOA 1CMFA 1OMRA 1WDCB 4NDCA 2R2IA 2LLUA 3JVTC 3SG7A 4HSZA 1SR6B 2BKIB 3CS1A 5DKQA 1SL9A 2LHLA 1TOPA 3D10A 2BCAA 2G9BA 1OE9B 2I94A 3BQ3A 4DIRA 2SCPA 3BXKA 1DJWA 1CM1A 2BECA 2O5GA 2G2BA 3LCPC 2JNXA 3OB2B 4MLWA 3O78A 4U8DA 4YI9A 2OS8B 3TDUA 1KK7Y 4GUKA 2KAYA 2LVKA 2KQYA 1DJZA 5HKYA 1XA5A 1M63B 1UHKA 3TUYC 1S1EA 3WHUB 2E6WA 2CTNA 4HREE 1AUIB 1MWNA 3NSLA 1B4CA 1XO5A 2E30A 4NDBA 1DJYA 1YRUB 1BOCA 1DF0A 1ZOTB 4PE0A 1S6JA 1TCOB 1UHHA 1SKTA
chains in the Genus database with same CATH superfamily
2JT0A 3DYEA 5G08A 2M7NA 4PE1A 1GM0A 1KSOA 2K61A 4BY4A 4M2QA 3O4XA 3PJIA 1V1FA 1QX5B 1SL8A 2F33A 4PALA 5GQQC 3EVUA 1SNLA 1XFZO 2QACA 3BFHA 1UHIA 3F45A 2LC5A 3CR5X 3IF7A 5BPJA 2LHIA 1Y6WA 1SK6D 2KI4B 1QASA 2LLTA 3BOWA 4MVFA 3EK8A 2O60A 2MLEC 2HF5A 4E68A 3DVEA 3IVTA 3A8RA 2ERBA 1TN4A 1SPYA 3LK1A 3L4LA 2ZNEA 3LL8B 4WQ3A 2JZIA 5FI7A 4L9MA 1KWOB 3JTDC 1UUSA 3SIAA 3DF0B 1KWOC 3GK2A 4OVNF 2PASA 5CSFA 1EJ3A 4N1FA 1W7IB 1RECA 1H8BA 1SCMC 1GGZA 1PSRA 2K7OA 3KPXA 2GV5A 1NWDA 2L5XB 3B88A 3CZTX 1AJ5A 5HL1A 2HPSA 4D1EA 1CTRA 1V1GA 1CFPA 2M3WA 1IJ5A 1PVBA 1TNXA 2P6BB 5J3XA 2PMYA 1R6PA 1L2OC 3PSRA 3DD4A 1EG4A 1UHNA 1S5GY 4JWQA 1A75B 1JF0A 4ETOA 1A03A 2EC6B 1CKKA 2Q4UA 1B1GA 1C3ZA 3BFAA 3B87A 5CSNA 2KLEA 3KO0A 1OSAA 3PN7B 2M8UA 3I5GB 3BUOB 5TNCA 3RM1A 1K94A 2KNEA 4MZLA 2WCEA 2M0RA 5AFPA 1QIWA 2WCJA 1CM4A 5HLVA 3K21A 2MHHA 3BUNB 4ZCUA 1N0YA 1XYDA 1ALWA 2EHBA 2I7AA 1QX2A 1K2HA 3SG5A 2WCFA 3B7AA 3M0WA 3NSIA 4MEWA 4PHMA 1C7WA 5I2OA 2LMVA 1DJHA 1IJ6A 1NP8A 1SMGA 2LAPA 1QX7A 3FS7A 3VRRA 1OMVA 4HRGA 5CSIA 3CZ0A 1C7VA 2LUXA 1TWOA 3DY9A 4PHNA 1NUBA 3ZWHA 1IIOA 3EVRA 3UO9A 2JT8A 3NXAA 1BU3A 2LE9B 3BUXB 4GAOA 2GGZA 1LVCD 2M49B 3B86A 2QEOA 3R1VA 3SIBA 2BNXA 2LCPA 2CT9A 1UP5A 4I5NB 3O6BA 1Y1AA 1CDPA 1JF2A 1SSEB 3VRQA 1J7OA 3OP0A 4DUQA 4GFTA 2B1UA 2AAOA 1J1EA 1IRJA 2JXCA 3Q8IA 1YVHA 3R1PA 1NPQA 2JT3A 2LV7A 3FE8A 1G4YR 1AJ4A 1OW4A 1A29A 1N65A 1RFJA 1KFXS 2BL0C 2HETA 2JTTA 3D0YA 3BUWB 5EL2A 1TNWA 4ZCVA 2M7LA 5K89A 1J7PA 1F4OA 3JVTB 3CLNA 1DF0B 2EGDA 4USLA 5DKRA 1Z2CB 1B7TZ 3FWBA 1IGVA 2P70A 2WCLA 4M2OA 5AEQA 1NSHA 3WXAA 1LXFC 1NX3A 1DELA 2WCBA 3BJHA 1WLZA 1JFJA 4I5JA 4YGDB 3SG6A 2P71A 1AHRA 5ER4X 1CB1A 1MQ1A 2F2PA 2TN4A 1AK8A 3IQQA 3I5FC 4JQ0D 1YR5A 1BJFA 3DVJA 4A4CA 5AANA 1OOJA 1TIZA 2M1KB 1FW4A 1QWVA 3TDIA 2BBNA 1JUOA 3TUYB 3KF9A 3BOWB 1P28A 1OMDA 2WNDA 3I5IB 1RWYA 4JKTA 5AXIA 3E3RA 1TUZA 3I5IC 4QJ3B 2LNKA 1ZUZA 2ZN9A 3VGOA 1OOFA 1TNPA 1NYAA 3EK4A 4KYNA 1B8CA 1LA3A 1YUUA 1TCFA 3H4SE 2FCDA 5ER5A 2KGRA 4CIDA 1SW8A 4INWA 1Y0VH 3EG5B 1KFUS 2JRFA 1QJTA 1DVIA 1A2XA 1ZACA 3NHTA 2ZN8A 2BE4A 2JOJA 1B8LA 4DCKA 4XYNA 2LANA 1F54A 1EH2A 5I8NA 4R1EA 2FJUB 3CTNA 1SBJA 4ORBB 1KQMC 1XFUO 3D73A 3O4YA 3VROA 1K93D 3CYZA 1QXPA 1ZFSA 1B8RA 1DT7B 2F3YA 1DMOA 1Z4HA 4CPVA 4TNCA 2BCBA 1KK8B 3FE6A 2ZKMX 4N1GA 1KK8C 1OZOA 3DVMA 3JTDB 2KFFA 1VRKA 2HQWA 1IKUA 2H61C 1SCMB 2IS9A 3D76A 4Q04A 1IQ3A 1CLBA 2WC5A 5D3OA 1RK9A 3CDNA 2LP2A 1BT6A 2WORA 1FBVA 2LP3A 3OBVA 1S36A 1PULA 1NCXA 3VRPA 2WCHA 1H4BA 3WHTB 4DS7A 2BBMA 3L4AA 1M39A 1WY9A 4C0JA 3ICBA 3PFVA 5PALA 1HT9A 5I94A 2Y4QA 4GBAA 1XFVO 3R1OA 3I5HC 2FCEA 2ISDA 2RGIA 5AERA 4FQTA 1L2OB 3NGVA 2WC8A 2BKHB 4M2PA 2YGUA 3A4UB 2AMIA 4YI8A 4MRYA 3FE9A 4PE7A 1K96A 2LMUA 2H61A 1BODA 1F8HA 1QIVA 1TRFA 2ZFDA 5IBWA 2K8MB 5B8IB 1XFXO 3KHEA 3S0GA 2M97A 1UURA 2KSPA 2JPOA 4YGBB 1IWQA 2NCPA 1WRLA 2L4HA 3BUMB 4IL1A 4YGCB 4CFRA 4PHJA 1EL4A 1KQVA 2KLDA 3SG4A 1EG3A 2CXJA 1RROA 1QS7A 3CR4X 2L4IA 2CNPA 1M46A 3S0BA 5I2QA 2K2AA 1J7RA 1OOIX 1R2UA 2QEVA 3D0YB 2KPHA 3GK1A 1SYMA 4I5KA 1JFKA 2PQLA 1RTP1 1FPWA 4I5LB 1YUTA 1QLKA 2AUCA 4OR9B 2JWWA 4OV2A 3ZNIA 1YTZC 4AQIA 1GGWA 2PVBA 2JULA 3PALA 1LA0A 1B7TY 3SS5A 3BFBA 5KTYA 1K90D 3NSKA 1CDLA 4FTGA 4GPLB 3TZ1A 3PLFB 5KSZA 2K2FA 1XK4C 1QVIZ 3LK0A 1J1DA 1PVAA 2KI6D 1AP4A 3EKJA 3S0AA 5D7FA 3CWGA 1SL7A 2MLFC 1A75A 2NXQA 2BL0B 4XJKA 5DKNA 2BAPA 1J7QA 1NX2A 1YX7A 3IQOA 1IH0A 1CFDA 1E8AA 4A4BA 2QDIA 1FF1A 1M31A 2WC6A 1RJVA 5JOLA 1S6IA 1JBAA 2Y1NA 2MRDA 3AKAA 1DQEA 4CLNA 2M1UA 2ZRSA 1QLSA 2BE6A 1IQ5A 2Q91A 1SRAA 2QEHA 1ORGA 1MF8B 2JC2A 1K9KA 3SG3A 3DVKA 1CNPA 1XK4A 5HKWA 3S0DA 3I5FB 1YRTB 1A4PA 1SCVA 2KYFA 3TS5C 3FWCA 2KBMA 3BYAA 3EVVA 1L7ZA 1QV1A 1CLMA 1PK0D 1WDCC 4IJ7A 2L0PA 1NX1A 2JNFA 2KGBC 4PCWA 4AOMA 2ZNDA 2NCOA 2L51A 4MZJA 4BY5A 4DRWA 2K60A 1SR6C 3WNXB 3B6XA 1OZSA 3CGAA 2JTZA 3K1EA 5FI6A 1DTLA 4JPZB 2QPTA 5HKZA 5CSJA 2K7CA 3PM8A 2Y1MA 1KSMA 5CPVA 1K9UA 2KAXA 3HCMA 1DJGA 1LKJA 4OCIA 2LMTA 2KQ6A 2KYCA 4C0LA 3LLEA 4MBEA 2OTGB 1B9AA 2CCMA 2JQ6A 1KQMB 2OS8C 1W7JB 2OTGC 2COLB 1ODBA 2KI6C 4MZKA 4P5OE 4PE4A 5DICA 3VRNA 1GJYA 2KDHA 4INXA 1U5IA 4WQ2A 2JPTA 3OB1B 3R72A 2JU0A 4YRUA 2MA2A 1S26D 1B47A 1G8IA 2V53A 2PSRA 3CABA 4QJ5B 2F2OA 4ORAB 1C3YA 2MAZA 2NZ0A 4YGAA 1MXLC 2K0JA 2M9GA 2LVIA 2MJWB 1BR4B 2L50A 3D74A 4PT1A 3EKHA 1S6CA 4AQJA 4GNKB 1AVSA 2ZRTA 1KK7Z 2A4JA 2KFGA 3CZ2A 1TTXA 4QJ4B 1JC2A 2H2KA 3SS3A 5FYXA 5KU1A 1MHOA 2WOSA 5I2LA 3O2PA 1KFXL 5FI2A 3D75A 2L2EA 1ALVA 2KI4C 1Q80A 1JSAA 3AAKA 1HQVA 1OQPA 1DJIA 3I5HB 1F55A 1FI5A 2SASA 1YUSA 3NHIA 3GOFA 2I18A 3N7HA 2KHNA 2LM5A 4MRXA 1WRKA 1WRZA 2KBIA 3PM2A 3S0EA 2KOTA 1IG5A 2L2CA 1GQMA 2PALA 1N2DA 5F6TA 2LVJA 1F70A 3OGNA 1WLMA 1XVJA 5HYDA 1CFCA 4C0KA 1SY9A 2GGMA 2MBXA 3L47A 1CDMA 3D78A 1UHJA 4NQGA 1DGUA 2WCMA 4CFQA 2D8NA 1MXEA 1K8UA 2JXLA 1MR8A 1NIWA 1XFYO 3OX6A 2F3ZA 1J55A 5JJGA 1NCYA 2F8PA 1KFUL 3OHMB 4N5XA 1K9PA 1QVIY 3GK4X 3SS4A 1DJXA 1NCZA 3V2LA 1MUXA 1LS8A 1Y1XA 4XJKB 2EC6C 3HX4A 4GGFC 3DF0A 3UNWA 1TNQA 2PRUA 4MN0A 1QATA 3CR2A 2DOQA 2NLNA 3CZ1A 3PN7C 3I5GC 1OOGA 4YBHB 1CDNA 4PDZA 1S3PA 1NX0A 3KEVA 2LUCA 2I2RE 4MSPA 4P2YB 4ORCB 2LVVA 4F0ZB 1W9ZA 1PRWA 1YX8A 2OPOA 1EXRA 2LLSA 1Y1UA 3FIAA 1G33A 1M45A 1F4QA 3D77A 4YGEB 1ZMZA 2CBLA 4ICBA 1BR1B 1T14A 4HRHA 4OZDA 1K95A 1S5GZ 1F71A 2Y5IA 1LINA 1DGVA 1PALA 2GTEA 2BCXA 4WRIA 2KAVA 1KCYA 1YVLA 1XFWO 3EK7A 3VB1A 4GGFA 1CLLA 1BLQA 4JD9A 4UPGA 2K7DA 4GGNA 3PATA 3C1VA 1D1OA 1YURA 5HLOA 2K7BA 3RZSA 3AAJA 1QTXA 1BF5A 3SJSA 1FI6A 2FOTA 1C07A 4NDDA 1BG1A 2KFHA 2HQ8A 1CFFA 4PHKA 2L5YA 3OX5A 5D69A 2WCKA 1QV0A 3MSEB 3QRXA 2M29A 3NSOA 4FQOA 3SG2A 1CMGA 1DC1A 2VRGA 4F7FA 3TDZA 1JWDA 3AKBA 3QMEA 1X02A 3TS5B 2L98A 4OKHA 1PSBA 1U5IB 3DZTA 1BMOA 3RLZA 1UWOA 1CMFA 1OMRA 1WDCB 4NDCA 2FJYA 2R2IA 2LLUA 3JVTC 3SG7A 4HSZA 1SR6B 2BKIB 3CS1A 5DKQA 1OOHA 1SL9A 2LHLA 1TOPA 3D10A 2BCAA 2G9BA 1OE9B 2I94A 3BQ3A 4DIRA 2SCPA 3BXKA 1DJWA 1CM1A 2PYQA 2BECA 2O5GA 2G2BA 3LCPC 2JNXA 2H8VA 3OB2B 4MLWA 3O78A 4U8DA 4YI9A 2OS8B 3TDUA 1KK7Y 1DEKA 1TUJA 2KAYA 2LVKA 4GUKA 2KQYA 1DJZA 3DXLA 5HKYA 1XA5A 1M63B 1UHKA 3TUYC 1S1EA 3WHUB 2E6WA 2CTNA 4HREE 1AUIB 1XFRA 1MWNA 3NSLA 3S0FA 1XO5A 2QEBA 2E30A 4NDBA 1DJYA 1B4CA 1YRUB 1BOCA 1DF0A 1ZOTB 4PE0A 1S6JA 1TCOB 1UHHA 1SKTA
chains in the Genus database with same CATH topology
2JT0A 5G08A 2M7NA 4PE1A 1KSOA 2K61A 4BY4A 4M2QA 1V1FA 1QX5B 1SL8A 2F33A 4PALA 5GQQC 3EVUA 1SNLA 1XFZO 2QACA 1UHIA 3F45A 2LC5A 3CR5X 3IF7A 5BPJA 2LHIA 1Y6WA 1SK6D 2KI4B 1QASA 2LLTA 3BOWA 4MVFA 3EK8A 2O60A 2MLEC 2HF5A 4E68A 3DVEA 3A8RA 1TN4A 1SPYA 3LK1A 2ZNEA 3LL8B 4WQ3A 2JZIA 4L9MA 1KWOB 3JTDC 1UUSA 3SIAA 3DF0B 1KWOC 3GK2A 4OVNF 2PASA 5CSFA 1EJ3A 4N1FA 1W7IB 1RECA 1H8BA 1SCMC 1GGZA 1PSRA 2K7OA 3KPXA 2GV5A 1NWDA 2L5XB 3CZTX 1AJ5A 2HPSA 4D1EA 1CTRA 1V1GA 1CFPA 2M3WA 1IJ5A 1PVBA 1TNXA 2P6BB 5J3XA 2PMYA 1R6PA 1L2OC 3PSRA 3DD4A 1EG4A 1UHNA 1S5GY 4JWQA 1A75B 1JF0A 4ETOA 1A03A 2EC6B 1CKKA 2Q4UA 1B1GA 5CSNA 3KO0A 1OSAA 3PN7B 2M8UA 3I5GB 3BUOB 5TNCA 3RM1A 1K94A 2KNEA 4MZLA 2WCEA 2M0RA 5AFPA 1QIWA 1CM4A 5HLVA 3K21A 2MHHA 3BUNB 4ZCUA 1N0YA 1XYDA 1ALWA 2EHBA 2I7AA 1QX2A 1K2HA 3SG5A 2WCFA 3M0WA 3NSIA 4PHMA 4MEWA 5I2OA 1C7WA 2LMVA 1DJHA 1IJ6A 1NP8A 1SMGA 2LAPA 1QX7A 3FS7A 3VRRA 1OMVA 4HRGA 5CSIA 1C7VA 2LUXA 4PHNA 1NUBA 3ZWHA 3EVRA 2JT8A 3NXAA 1BU3A 2LE9B 3BUXB 4GAOA 2GGZA 1LVCD 2M49B 3SIBA 2LCPA 2CT9A 1UP5A 4I5NB 3O6BA 1Y1AA 1CDPA 1JF2A 3VRQA 1J7OA 3OP0A 4DUQA 4GFTA 2B1UA 2AAOA 1J1EA 1IRJA 2JXCA 1YVHA 1NPQA 2JT3A 2LV7A 1G4YR 1AJ4A 2HETA 1A29A 1N65A 1RFJA 1KFXS 2BL0C 2JTTA 3D0YA 4ZCVA 3BUWB 2M7LA 1TNWA 5K89A 1J7PA 1F4OA 3JVTB 3CLNA 1DF0B 2EGDA 4USLA 5DKRA 1B7TZ 5AEQA 3FWBA 1IGVA 4M2OA 1NSHA 3WXAA 1LXFC 1NX3A 2WCBA 1WLZA 1JFJA 4I5JA 4YGDB 3SG6A 1AHRA 5ER4X 1CB1A 1MQ1A 2F2PA 2TN4A 1AK8A 3IQQA 3I5FC 4JQ0D 1YR5A 1BJFA 3DVJA 4A4CA 5AANA 1OOJA 1TIZA 2M1KB 1FW4A 3TDIA 2BBNA 1JUOA 3TUYB 3KF9A 3BOWB 5AXIA 1OMDA 2WNDA 3I5IB 1RWYA 1IH0A 3E3RA 3I5IC 4QJ3B 2LNKA 1ZUZA 2ZN9A 3VGOA 1TNPA 1NYAA 3EK4A 1B8CA 1LA3A 1YUUA 1TCFA 3H4SE 2FCDA 5ER5A 2KGRA 4CIDA 1SW8A 1Y0VH 1KFUS 2JRFA 1QJTA 1DVIA 1A2XA 1ZACA 2ZN8A 2BE4A 2JOJA 1B8LA 4DCKA 4XYNA 2LANA 1F54A 1EH2A 5I8NA 4R1EA 2FJUB 3CTNA 1SBJA 4ORBB 1KQMC 1XFUO 3O4YA 3VROA 1K93D 1QXPA 1ZFSA 1B8RA 1DT7B 2F3YA 1DMOA 4CPVA 4TNCA 2BCBA 1KK8B 2ZKMX 4N1GA 1KK8C 1OZOA 3DVMA 3JTDB 2KFFA 1VRKA 2HQWA 1IKUA 2H61C 1SCMB 2IS9A 4Q04A 1IQ3A 1CLBA 1RK9A 2LP2A 1BT6A 2WORA 1FBVA 2LP3A 1S36A 1PULA 1NCXA 3VRPA 1H4BA 3WHTB 4DS7A 2BBMA 1M39A 1WY9A 4C0JA 3ICBA 3PFVA 5PALA 1HT9A 2Y4QA 4GBAA 1XFVO 3I5HC 2FCEA 2ISDA 2RGIA 5AERA 1L2OB 2WC8A 2BKHB 4M2PA 3A4UB 2AMIA 4YI8A 4MRYA 4PE7A 1K96A 2LMUA 2H61A 1BODA 1F8HA 1QIVA 1TRFA 2ZFDA 5IBWA 2K8MB 5B8IB 1XFXO 3KHEA 2M97A 1UURA 2KSPA 4YGBB 1IWQA 2NCPA 1WRLA 2L4HA 3BUMB 4IL1A 4YGCB 4CFRA 4PHJA 1EL4A 1KQVA 3SG4A 1EG3A 2CXJA 1RROA 1QS7A 3CR4X 2L4IA 2CNPA 1M46A 5I2QA 2K2AA 1J7RA 1R2UA 3D0YB 3GK1A 1SYMA 4I5KA 1JFKA 1RTP1 1FPWA 4I5LB 1YUTA 1QLKA 2AUCA 4OR9B 2JWWA 4OV2A 3ZNIA 1YTZC 4AQIA 1GGWA 2PVBA 2JULA 3PALA 1LA0A 1B7TY 5KTYA 1K90D 3NSKA 1CDLA 4FTGA 4GPLB 3TZ1A 3PLFB 5KSZA 2K2FA 1XK4C 1QVIZ 3LK0A 1J1DA 1PVAA 2KI6D 1AP4A 3EKJA 5D7FA 3CWGA 1SL7A 2MLFC 1A75A 2NXQA 2BL0B 4XJKA 5DKNA 1J7QA 1NX2A 1YX7A 3IQOA 1CFDA 1E8AA 4A4BA 1FF1A 1M31A 1RJVA 5JOLA 1S6IA 1JBAA 2Y1NA 2MRDA 3AKAA 4CLNA 2M1UA 2ZRSA 1QLSA 2BE6A 1IQ5A 2Q91A 1SRAA 1MF8B 2JC2A 1K9KA 3SG3A 3DVKA 1CNPA 1XK4A 5HKWA 3I5FB 1YRTB 1A4PA 1SCVA 2KYFA 3TS5C 3FWCA 2KBMA 3BYAA 3EVVA 1L7ZA 1QV1A 1CLMA 1PK0D 1WDCC 4AOMA 2L0PA 1NX1A 2JNFA 2KGBC 4PCWA 1KCYA 2ZNDA 2NCOA 2L51A 4MZJA 4BY5A 4DRWA 1SR6C 3WNXB 1OZSA 3CGAA 2JTZA 1DTLA 4JPZB 2QPTA 5HKZA 5CSJA 2K7CA 3PM8A 2Y1MA 1KSMA 5CPVA 1K9UA 2KAXA 3HCMA 1DJGA 1LKJA 4OCIA 2LMTA 2KQ6A 2KYCA 4C0LA 3LLEA 4MBEA 2OTGB 1B9AA 2CCMA 2JQ6A 1KQMB 2OS8C 1W7JB 2OTGC 2COLB 1ODBA 2KI6C 4MZKA 4P5OE 4PE4A 3VRNA 1GJYA 2KDHA 1U5IA 4WQ2A 2JPTA 3OB1B 2JU0A 4YRUA 2MA2A 1S26D 1B47A 1G8IA 2V53A 2PSRA 4QJ5B 2F2OA 4ORAB 2MAZA 2NZ0A 4YGAA 1MXLC 2K0JA 2M9GA 2LVIA 2MJWB 1BR4B 2L50A 3EKHA 1S6CA 4AQJA 4GNKB 1AVSA 2ZRTA 1KK7Z 2A4JA 2KFGA 1TTXA 4QJ4B 1JC2A 2H2KA 5KU1A 5FYXA 1MHOA 2WOSA 5I2LA 3O2PA 1KFXL 2L2EA 1ALVA 2KI4C 1Q80A 1JSAA 3AAKA 1HQVA 1OQPA 1DJIA 3I5HB 1F55A 1FI5A 2SASA 1YUSA 3GOFA 2I18A 2KHNA 2LM5A 4MRXA 1WRKA 1WRZA 2KBIA 2KOTA 1IG5A 1GQMA 2PALA 1N2DA 5F6TA 2LVJA 1F70A 1WLMA 1XVJA 5HYDA 1CFCA 4C0KA 1SY9A 2GGMA 2MBXA 1CDMA 1UHJA 4NQGA 1DGUA 4CFQA 2D8NA 1MXEA 1K8UA 2JXLA 1MR8A 1NIWA 1XFYO 3OX6A 2F3ZA 1J55A 5JJGA 1NCYA 2F8PA 1KFUL 3OHMB 4N5XA 1K9PA 1QVIY 3GK4X 1DJXA 1NCZA 1MUXA 1Y1XA 4XJKB 2EC6C 3HX4A 4GGFC 3DF0A 1TNQA 2PRUA 4MN0A 1QATA 3CR2A 2DOQA 2NLNA 3PN7C 3I5GC 4YBHB 1CDNA 4PDZA 1S3PA 1NX0A 3KEVA 2LUCA 2I2RE 4MSPA 4P2YB 4ORCB 2LVVA 4F0ZB 1PRWA 1YX8A 2OPOA 1EXRA 2LLSA 1Y1UA 3FIAA 1G33A 1M45A 1F4QA 4YGEB 1ZMZA 2CBLA 4ICBA 1BR1B 4HRHA 1K95A 1S5GZ 1F71A 2Y5IA 1LINA 1DGVA 1PALA 2BCXA 4WRIA 2KAVA 1YVLA 1XFWO 3EK7A 4GGFA 1CLLA 1BLQA 4UPGA 2K7DA 4GGNA 3PATA 3C1VA 1D1OA 1YURA 5HLOA 2K7BA 3AAJA 1QTXA 1BF5A 3SJSA 1FI6A 2FOTA 1C07A 4NDDA 1BG1A 2KFHA 2HQ8A 1CFFA 4PHKA 3OX5A 5D69A 1QV0A 3MSEB 3QRXA 2M29A 3NSOA 4FQOA 3SG2A 1CMGA 2VRGA 1JWDA 3TDZA 3AKBA 1X02A 3TS5B 2L98A 4OKHA 1PSBA 1U5IB 1BMOA 3RLZA 1UWOA 1CMFA 1OMRA 1WDCB 4NDCA 2R2IA 2LLUA 3JVTC 3SG7A 4HSZA 1SR6B 2BKIB 3CS1A 5DKQA 1SL9A 2LHLA 1TOPA 3D10A 2BCAA 2G9BA 1OE9B 2I94A 3BQ3A 4DIRA 2SCPA 3BXKA 1DJWA 1CM1A 2BECA 2O5GA 2G2BA 3LCPC 2JNXA 3OB2B 4MLWA 3O78A 4U8DA 4YI9A 2OS8B 3TDUA 1KK7Y 4GUKA 2KAYA 2LVKA 2KQYA 1DJZA 5HKYA 1XA5A 1M63B 1UHKA 3TUYC 1S1EA 3WHUB 2E6WA 2CTNA 4HREE 1AUIB 1MWNA 3NSLA 1B4CA 1XO5A 2E30A 4NDBA 1DJYA 1YRUB 1BOCA 1DF0A 1ZOTB 4PE0A 1S6JA 1TCOB 1UHHA 1SKTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JT0 A;  5G08 A;  2M7N A;  4PE1 A;  1KSO A;  2K61 A;  4BY4 A;  4M2Q A;  1V1F A;  1QX5 B;  1SL8 A;  2F33 A;  4PAL A;  5GQQ C;  3EVU A;  1SNL A;  1XFZ O;  2QAC A;  1UHI A;  3F45 A;  2LC5 A;  3CR5 X;  3IF7 A;  5BPJ A;  2LHI A;  1Y6W A;  1SK6 D;  2KI4 B;  1QAS A;  2LLT A;  3BOW A;  4MVF A;  3EK8 A;  2O60 A;  2MLE C;  2HF5 A;  4E68 A;  3DVE A;  3A8R A;  1TN4 A;  1SPY A;  3LK1 A;  2ZNE A;  3LL8 B;  4WQ3 A;  2JZI A;  4L9M A;  1KWO B;  3JTD C;  1UUS A;  3SIA A;  3DF0 B;  1KWO C;  3GK2 A;  4OVN F;  2PAS A;  5CSF A;  1EJ3 A;  4N1F A;  1W7I B;  1REC A;  1H8B A;  1SCM C;  1GGZ A;  1PSR A;  2K7O A;  3KPX A;  2GV5 A;  1NWD A;  2L5X B;  3CZT X;  1AJ5 A;  2HPS A;  4D1E A;  1CTR A;  1V1G A;  1CFP A;  2M3W A;  1IJ5 A;  1PVB A;  1TNX A;  2P6B B;  5J3X A;  2PMY A;  1R6P A;  1L2O C;  3PSR A;  3DD4 A;  1EG4 A;  1UHN A;  1S5G Y;  4JWQ A;  1A75 B;  1JF0 A;  4ETO A;  1A03 A;  2EC6 B;  1CKK A;  2Q4U A;  1B1G A;  5CSN A;  3KO0 A;  1OSA A;  3PN7 B;  2M8U A;  3I5G B;  3BUO B;  5TNC A;  3RM1 A;  1K94 A;  2KNE A;  4MZL A;  2WCE A;  2M0R A;  5AFP A;  1QIW A;  1CM4 A;  5HLV A;  3K21 A;  2MHH A;  3BUN B;  4ZCU A;  1N0Y A;  1XYD A;  1ALW A;  2EHB A;  2I7A A;  1QX2 A;  1K2H A;  3SG5 A;  2WCF A;  3M0W A;  3NSI A;  4PHM A;  4MEW A;  5I2O A;  1C7W A;  2LMV A;  1DJH A;  1IJ6 A;  1NP8 A;  1SMG A;  2LAP A;  1QX7 A;  3FS7 A;  3VRR A;  1OMV A;  4HRG A;  5CSI A;  1C7V A;  2LUX A;  4PHN A;  1NUB A;  3ZWH A;  3EVR A;  2JT8 A;  3NXA A;  1BU3 A;  2LE9 B;  3BUX B;  4GAO A;  2GGZ A;  1LVC D;  2M49 B;  3SIB A;  2LCP A;  2CT9 A;  1UP5 A;  4I5N B;  3O6B A;  1Y1A A;  1CDP A;  1JF2 A;  3VRQ A;  1J7O A;  3OP0 A;  4DUQ A;  4GFT A;  2B1U A;  2AAO A;  1J1E A;  1IRJ A;  2JXC A;  1YVH A;  1NPQ A;  2JT3 A;  2LV7 A;  1G4Y R;  1AJ4 A;  2HET A;  1A29 A;  1N65 A;  1RFJ A;  1KFX S;  2BL0 C;  2JTT A;  3D0Y A;  4ZCV A;  3BUW B;  2M7L A;  1TNW A;  5K89 A;  1J7P A;  1F4O A;  3JVT B;  3CLN A;  1DF0 B;  2EGD A;  4USL A;  5DKR A;  1B7T Z;  5AEQ A;  3FWB A;  1IGV A;  4M2O A;  1NSH A;  3WXA A;  1LXF C;  1NX3 A;  2WCB A;  1WLZ A;  1JFJ A;  4I5J A;  4YGD B;  3SG6 A;  1AHR A;  5ER4 X;  1CB1 A;  1MQ1 A;  2F2P A;  2TN4 A;  1AK8 A;  3IQQ A;  3I5F C;  4JQ0 D;  1YR5 A;  1BJF A;  3DVJ A;  4A4C A;  5AAN A;  1OOJ A;  1TIZ A;  2M1K B;  1FW4 A;  3TDI A;  2BBN A;  1JUO A;  3TUY B;  3KF9 A;  3BOW B;  5AXI A;  1OMD A;  2WND A;  3I5I B;  1RWY A;  1IH0 A;  3E3R A;  3I5I C;  4QJ3 B;  2LNK A;  1ZUZ A;  2ZN9 A;  3VGO A;  1TNP A;  1NYA A;  3EK4 A;  1B8C A;  1LA3 A;  1YUU A;  1TCF A;  3H4S E;  2FCD A;  5ER5 A;  2KGR A;  4CID A;  1SW8 A;  1Y0V H;  1KFU S;  2JRF A;  1QJT A;  1DVI A;  1A2X A;  1ZAC A;  2ZN8 A;  2BE4 A;  2JOJ A;  1B8L A;  4DCK A;  4XYN A;  2LAN A;  1F54 A;  1EH2 A;  5I8N A;  4R1E A;  2FJU B;  3CTN A;  1SBJ A;  4ORB B;  1KQM C;  1XFU O;  3O4Y A;  3VRO A;  1K93 D;  1QXP A;  1ZFS A;  1B8R A;  1DT7 B;  2F3Y A;  1DMO A;  4CPV A;  4TNC A;  2BCB A;  1KK8 B;  2ZKM X;  4N1G A;  1KK8 C;  1OZO A;  3DVM A;  3JTD B;  2KFF A;  1VRK A;  2HQW A;  1IKU A;  2H61 C;  1SCM B;  2IS9 A;  4Q04 A;  1IQ3 A;  1CLB A;  1RK9 A;  2LP2 A;  1BT6 A;  2WOR A;  1FBV A;  2LP3 A;  1S36 A;  1PUL A;  1NCX A;  3VRP A;  1H4B A;  3WHT B;  4DS7 A;  2BBM A;  1M39 A;  1WY9 A;  4C0J A;  3ICB A;  3PFV A;  5PAL A;  1HT9 A;  2Y4Q A;  4GBA A;  1XFV O;  3I5H C;  2FCE A;  2ISD A;  2RGI A;  5AER A;  1L2O B;  2WC8 A;  2BKH B;  4M2P A;  3A4U B;  2AMI A;  4YI8 A;  4MRY A;  4PE7 A;  1K96 A;  2LMU A;  2H61 A;  1BOD A;  1F8H A;  1QIV A;  1TRF A;  2ZFD A;  5IBW A;  2K8M B;  5B8I B;  1XFX O;  3KHE A;  2M97 A;  1UUR A;  2KSP A;  4YGB B;  1IWQ A;  2NCP A;  1WRL A;  2L4H A;  3BUM B;  4IL1 A;  4YGC B;  4CFR A;  4PHJ A;  1EL4 A;  1KQV A;  3SG4 A;  1EG3 A;  2CXJ A;  1RRO A;  1QS7 A;  3CR4 X;  2L4I A;  2CNP A;  1M46 A;  5I2Q A;  2K2A A;  1J7R A;  1R2U A;  3D0Y B;  3GK1 A;  1SYM A;  4I5K A;  1JFK A;  1RTP 1;  1FPW A;  4I5L B;  1YUT A;  1QLK A;  2AUC A;  4OR9 B;  2JWW A;  4OV2 A;  3ZNI A;  1YTZ C;  4AQI A;  1GGW A;  2PVB A;  2JUL A;  3PAL A;  1LA0 A;  1B7T Y;  5KTY A;  1K90 D;  3NSK A;  1CDL A;  4FTG A;  4GPL B;  3TZ1 A;  3PLF B;  5KSZ A;  2K2F A;  1XK4 C;  1QVI Z;  3LK0 A;  1J1D A;  1PVA A;  2KI6 D;  1AP4 A;  3EKJ A;  5D7F A;  3CWG A;  1SL7 A;  2MLF C;  1A75 A;  2NXQ A;  2BL0 B;  4XJK A;  5DKN A;  1J7Q A;  1NX2 A;  1YX7 A;  3IQO A;  1CFD A;  1E8A A;  4A4B A;  1FF1 A;  1M31 A;  1RJV A;  5JOL A;  1S6I A;  1JBA A;  2Y1N A;  2MRD A;  3AKA A;  4CLN A;  2M1U A;  2ZRS A;  1QLS A;  2BE6 A;  1IQ5 A;  2Q91 A;  1SRA A;  1MF8 B;  2JC2 A;  1K9K A;  3SG3 A;  3DVK A;  1CNP A;  1XK4 A;  5HKW A;  3I5F B;  1YRT B;  1A4P A;  1SCV A;  2KYF A;  3TS5 C;  3FWC A;  2KBM A;  3BYA A;  3EVV A;  1L7Z A;  1QV1 A;  1CLM A;  1PK0 D;  1WDC C;  4AOM A;  2L0P A;  1NX1 A;  2JNF A;  2KGB C;  4PCW A;  1KCY A;  2ZND A;  2NCO A;  2L51 A;  4MZJ A;  4BY5 A;  4DRW A;  1SR6 C;  3WNX B;  1OZS A;  3CGA A;  2JTZ A;  1DTL A;  4JPZ B;  2QPT A;  5HKZ A;  5CSJ A;  2K7C A;  3PM8 A;  2Y1M A;  1KSM A;  5CPV A;  1K9U A;  2KAX A;  3HCM A;  1DJG A;  1LKJ A;  4OCI A;  2LMT A;  2KQ6 A;  2KYC A;  4C0L A;  3LLE A;  4MBE A;  2OTG B;  1B9A A;  2CCM A;  2JQ6 A;  1KQM B;  2OS8 C;  1W7J B;  2OTG C;  2COL B;  1ODB A;  2KI6 C;  4MZK A;  4P5O E;  4PE4 A;  3VRN A;  1GJY A;  2KDH A;  1U5I A;  4WQ2 A;  2JPT A;  3OB1 B;  2JU0 A;  4YRU A;  2MA2 A;  1S26 D;  1B47 A;  1G8I A;  2V53 A;  2PSR A;  4QJ5 B;  2F2O A;  4ORA B;  2MAZ A;  2NZ0 A;  4YGA A;  1MXL C;  2K0J A;  2M9G A;  2LVI A;  2MJW B;  1BR4 B;  2L50 A;  3EKH A;  1S6C A;  4AQJ A;  4GNK B;  1AVS A;  2ZRT A;  1KK7 Z;  2A4J A;  2KFG A;  1TTX A;  4QJ4 B;  1JC2 A;  2H2K A;  5KU1 A;  5FYX A;  1MHO A;  2WOS A;  5I2L A;  3O2P A;  1KFX L;  2L2E A;  1ALV A;  2KI4 C;  1Q80 A;  1JSA A;  3AAK A;  1HQV A;  1OQP A;  1DJI A;  3I5H B;  1F55 A;  1FI5 A;  2SAS A;  1YUS A;  3GOF A;  2I18 A;  2KHN A;  2LM5 A;  4MRX A;  1WRK A;  1WRZ A;  2KBI A;  2KOT A;  1IG5 A;  1GQM A;  2PAL A;  1N2D A;  5F6T A;  2LVJ A;  1F70 A;  1WLM A;  1XVJ A;  5HYD A;  1CFC A;  4C0K A;  1SY9 A;  2GGM A;  2MBX A;  1CDM A;  1UHJ A;  4NQG A;  1DGU A;  4CFQ A;  2D8N A;  1MXE A;  1K8U A;  2JXL A;  1MR8 A;  1NIW A;  1XFY O;  3OX6 A;  2F3Z A;  1J55 A;  5JJG A;  1NCY A;  2F8P A;  1KFU L;  3OHM B;  4N5X A;  1K9P A;  1QVI Y;  3GK4 X;  1DJX A;  1NCZ A;  1MUX A;  1Y1X A;  4XJK B;  2EC6 C;  3HX4 A;  4GGF C;  3DF0 A;  1TNQ A;  2PRU A;  4MN0 A;  1QAT A;  3CR2 A;  2DOQ A;  2NLN A;  3PN7 C;  3I5G C;  4YBH B;  1CDN A;  4PDZ A;  1S3P A;  1NX0 A;  3KEV A;  2LUC A;  2I2R E;  4MSP A;  4P2Y B;  4ORC B;  2LVV A;  4F0Z B;  1PRW A;  1YX8 A;  2OPO A;  1EXR A;  2LLS A;  1Y1U A;  3FIA A;  1G33 A;  1M45 A;  1F4Q A;  4YGE B;  1ZMZ A;  2CBL A;  4ICB A;  1BR1 B;  4HRH A;  1K95 A;  1S5G Z;  1F71 A;  2Y5I A;  1LIN A;  1DGV A;  1PAL A;  2BCX A;  4WRI A;  2KAV A;  1YVL A;  1XFW O;  3EK7 A;  4GGF A;  1CLL A;  1BLQ A;  4UPG A;  2K7D A;  4GGN A;  3PAT A;  3C1V A;  1D1O A;  1YUR A;  5HLO A;  2K7B A;  3AAJ A;  1QTX A;  1BF5 A;  3SJS A;  1FI6 A;  2FOT A;  1C07 A;  4NDD A;  1BG1 A;  2KFH A;  2HQ8 A;  1CFF A;  4PHK A;  3OX5 A;  5D69 A;  1QV0 A;  3MSE B;  3QRX A;  2M29 A;  3NSO A;  4FQO A;  3SG2 A;  1CMG A;  2VRG A;  1JWD A;  3TDZ A;  3AKB A;  1X02 A;  3TS5 B;  2L98 A;  4OKH A;  1PSB A;  1U5I B;  1BMO A;  3RLZ A;  1UWO A;  1CMF A;  1OMR A;  1WDC B;  4NDC A;  2R2I A;  2LLU A;  3JVT C;  3SG7 A;  4HSZ A;  1SR6 B;  2BKI B;  3CS1 A;  5DKQ A;  1SL9 A;  2LHL A;  1TOP A;  3D10 A;  2BCA A;  2G9B A;  1OE9 B;  2I94 A;  3BQ3 A;  4DIR A;  2SCP A;  3BXK A;  1DJW A;  1CM1 A;  2BEC A;  2O5G A;  2G2B A;  3LCP C;  2JNX A;  3OB2 B;  4MLW A;  3O78 A;  4U8D A;  4YI9 A;  2OS8 B;  3TDU A;  1KK7 Y;  4GUK A;  2KAY A;  2LVK A;  2KQY A;  1DJZ A;  5HKY A;  1XA5 A;  1M63 B;  1UHK A;  3TUY C;  1S1E A;  3WHU B;  2E6W A;  2CTN A;  4HRE E;  1AUI B;  1MWN A;  3NSL A;  1B4C A;  1XO5 A;  2E30 A;  4NDB A;  1DJY A;  1YRU B;  1BOC A;  1DF0 A;  1ZOT B;  4PE0 A;  1S6J A;  1TCO B;  1UHH A;  1SKT A; 
#chains in the Genus database with same CATH topology
 2JT0 A;  3DYE A;  5G08 A;  2M7N A;  4PE1 A;  1GM0 A;  1KSO A;  2K61 A;  4BY4 A;  4M2Q A;  3O4X A;  3PJI A;  1V1F A;  1QX5 B;  1SL8 A;  2F33 A;  4PAL A;  5GQQ C;  3EVU A;  1SNL A;  1XFZ O;  2QAC A;  3BFH A;  1UHI A;  3F45 A;  2LC5 A;  3CR5 X;  3IF7 A;  5BPJ A;  2LHI A;  1Y6W A;  1SK6 D;  2KI4 B;  1QAS A;  2LLT A;  3BOW A;  4MVF A;  3EK8 A;  2O60 A;  2MLE C;  2HF5 A;  4E68 A;  3DVE A;  3IVT A;  3A8R A;  2ERB A;  1TN4 A;  1SPY A;  3LK1 A;  3L4L A;  2ZNE A;  3LL8 B;  4WQ3 A;  2JZI A;  5FI7 A;  4L9M A;  1KWO B;  3JTD C;  1UUS A;  3SIA A;  3DF0 B;  1KWO C;  3GK2 A;  4OVN F;  2PAS A;  5CSF A;  1EJ3 A;  4N1F A;  1W7I B;  1REC A;  1H8B A;  1SCM C;  1GGZ A;  1PSR A;  2K7O A;  3KPX A;  2GV5 A;  1NWD A;  2L5X B;  3B88 A;  3CZT X;  1AJ5 A;  5HL1 A;  2HPS A;  4D1E A;  1CTR A;  1V1G A;  1CFP A;  2M3W A;  1IJ5 A;  1PVB A;  1TNX A;  2P6B B;  5J3X A;  2PMY A;  1R6P A;  1L2O C;  3PSR A;  3DD4 A;  1EG4 A;  1UHN A;  1S5G Y;  4JWQ A;  1A75 B;  1JF0 A;  4ETO A;  1A03 A;  2EC6 B;  1CKK A;  2Q4U A;  1B1G A;  1C3Z A;  3BFA A;  3B87 A;  5CSN A;  2KLE A;  3KO0 A;  1OSA A;  3PN7 B;  2M8U A;  3I5G B;  3BUO B;  5TNC A;  3RM1 A;  1K94 A;  2KNE A;  4MZL A;  2WCE A;  2M0R A;  5AFP A;  1QIW A;  2WCJ A;  1CM4 A;  5HLV A;  3K21 A;  2MHH A;  3BUN B;  4ZCU A;  1N0Y A;  1XYD A;  1ALW A;  2EHB A;  2I7A A;  1QX2 A;  1K2H A;  3SG5 A;  2WCF A;  3B7A A;  3M0W A;  3NSI A;  4MEW A;  4PHM A;  1C7W A;  5I2O A;  2LMV A;  1DJH A;  1IJ6 A;  1NP8 A;  1SMG A;  2LAP A;  1QX7 A;  3FS7 A;  3VRR A;  1OMV A;  4HRG A;  5CSI A;  3CZ0 A;  1C7V A;  2LUX A;  1TWO A;  3DY9 A;  4PHN A;  1NUB A;  3ZWH A;  1IIO A;  3EVR A;  3UO9 A;  2JT8 A;  3NXA A;  1BU3 A;  2LE9 B;  3BUX B;  4GAO A;  2GGZ A;  1LVC D;  2M49 B;  3B86 A;  2QEO A;  3R1V A;  3SIB A;  2BNX A;  2LCP A;  2CT9 A;  1UP5 A;  4I5N B;  3O6B A;  1Y1A A;  1CDP A;  1JF2 A;  1SSE B;  3VRQ A;  1J7O A;  3OP0 A;  4DUQ A;  4GFT A;  2B1U A;  2AAO A;  1J1E A;  1IRJ A;  2JXC A;  3Q8I A;  1YVH A;  3R1P A;  1NPQ A;  2JT3 A;  2LV7 A;  3FE8 A;  1G4Y R;  1AJ4 A;  1OW4 A;  1A29 A;  1N65 A;  1RFJ A;  1KFX S;  2BL0 C;  2HET A;  2JTT A;  3D0Y A;  3BUW B;  5EL2 A;  1TNW A;  4ZCV A;  2M7L A;  5K89 A;  1J7P A;  1F4O A;  3JVT B;  3CLN A;  1DF0 B;  2EGD A;  4USL A;  5DKR A;  1Z2C B;  1B7T Z;  3FWB A;  1IGV A;  2P70 A;  2WCL A;  4M2O A;  5AEQ A;  1NSH A;  3WXA A;  1LXF C;  1NX3 A;  1DEL A;  2WCB A;  3BJH A;  1WLZ A;  1JFJ A;  4I5J A;  4YGD B;  3SG6 A;  2P71 A;  1AHR A;  5ER4 X;  1CB1 A;  1MQ1 A;  2F2P A;  2TN4 A;  1AK8 A;  3IQQ A;  3I5F C;  4JQ0 D;  1YR5 A;  1BJF A;  3DVJ A;  4A4C A;  5AAN A;  1OOJ A;  1TIZ A;  2M1K B;  1FW4 A;  1QWV A;  3TDI A;  2BBN A;  1JUO A;  3TUY B;  3KF9 A;  3BOW B;  1P28 A;  1OMD A;  2WND A;  3I5I B;  1RWY A;  4JKT A;  5AXI A;  3E3R A;  1TUZ A;  3I5I C;  4QJ3 B;  2LNK A;  1ZUZ A;  2ZN9 A;  3VGO A;  1OOF A;  1TNP A;  1NYA A;  3EK4 A;  4KYN A;  1B8C A;  1LA3 A;  1YUU A;  1TCF A;  3H4S E;  2FCD A;  5ER5 A;  2KGR A;  4CID A;  1SW8 A;  4INW A;  1Y0V H;  3EG5 B;  1KFU S;  2JRF A;  1QJT A;  1DVI A;  1A2X A;  1ZAC A;  3NHT A;  2ZN8 A;  2BE4 A;  2JOJ A;  1B8L A;  4DCK A;  4XYN A;  2LAN A;  1F54 A;  1EH2 A;  5I8N A;  4R1E A;  2FJU B;  3CTN A;  1SBJ A;  4ORB B;  1KQM C;  1XFU O;  3D73 A;  3O4Y A;  3VRO A;  1K93 D;  3CYZ A;  1QXP A;  1ZFS A;  1B8R A;  1DT7 B;  2F3Y A;  1DMO A;  1Z4H A;  4CPV A;  4TNC A;  2BCB A;  1KK8 B;  3FE6 A;  2ZKM X;  4N1G A;  1KK8 C;  1OZO A;  3DVM A;  3JTD B;  2KFF A;  1VRK A;  2HQW A;  1IKU A;  2H61 C;  1SCM B;  2IS9 A;  3D76 A;  4Q04 A;  1IQ3 A;  1CLB A;  2WC5 A;  5D3O A;  1RK9 A;  3CDN A;  2LP2 A;  1BT6 A;  2WOR A;  1FBV A;  2LP3 A;  3OBV A;  1S36 A;  1PUL A;  1NCX A;  3VRP A;  2WCH A;  1H4B A;  3WHT B;  4DS7 A;  2BBM A;  3L4A A;  1M39 A;  1WY9 A;  4C0J A;  3ICB A;  3PFV A;  5PAL A;  1HT9 A;  5I94 A;  2Y4Q A;  4GBA A;  1XFV O;  3R1O A;  3I5H C;  2FCE A;  2ISD A;  2RGI A;  5AER A;  4FQT A;  1L2O B;  3NGV A;  2WC8 A;  2BKH B;  4M2P A;  2YGU A;  3A4U B;  2AMI A;  4YI8 A;  4MRY A;  3FE9 A;  4PE7 A;  1K96 A;  2LMU A;  2H61 A;  1BOD A;  1F8H A;  1QIV A;  1TRF A;  2ZFD A;  5IBW A;  2K8M B;  5B8I B;  1XFX O;  3KHE A;  3S0G A;  2M97 A;  1UUR A;  2KSP A;  2JPO A;  4YGB B;  1IWQ A;  2NCP A;  1WRL A;  2L4H A;  3BUM B;  4IL1 A;  4YGC B;  4CFR A;  4PHJ A;  1EL4 A;  1KQV A;  2KLD A;  3SG4 A;  1EG3 A;  2CXJ A;  1RRO A;  1QS7 A;  3CR4 X;  2L4I A;  2CNP A;  1M46 A;  3S0B A;  5I2Q A;  2K2A A;  1J7R A;  1OOI X;  1R2U A;  2QEV A;  3D0Y B;  2KPH A;  3GK1 A;  1SYM A;  4I5K A;  1JFK A;  2PQL A;  1RTP 1;  1FPW A;  4I5L B;  1YUT A;  1QLK A;  2AUC A;  4OR9 B;  2JWW A;  4OV2 A;  3ZNI A;  1YTZ C;  4AQI A;  1GGW A;  2PVB A;  2JUL A;  3PAL A;  1LA0 A;  1B7T Y;  3SS5 A;  3BFB A;  5KTY A;  1K90 D;  3NSK A;  1CDL A;  4FTG A;  4GPL B;  3TZ1 A;  3PLF B;  5KSZ A;  2K2F A;  1XK4 C;  1QVI Z;  3LK0 A;  1J1D A;  1PVA A;  2KI6 D;  1AP4 A;  3EKJ A;  3S0A A;  5D7F A;  3CWG A;  1SL7 A;  2MLF C;  1A75 A;  2NXQ A;  2BL0 B;  4XJK A;  5DKN A;  2BAP A;  1J7Q A;  1NX2 A;  1YX7 A;  3IQO A;  1IH0 A;  1CFD A;  1E8A A;  4A4B A;  2QDI A;  1FF1 A;  1M31 A;  2WC6 A;  1RJV A;  5JOL A;  1S6I A;  1JBA A;  2Y1N A;  2MRD A;  3AKA A;  1DQE A;  4CLN A;  2M1U A;  2ZRS A;  1QLS A;  2BE6 A;  1IQ5 A;  2Q91 A;  1SRA A;  2QEH A;  1ORG A;  1MF8 B;  2JC2 A;  1K9K A;  3SG3 A;  3DVK A;  1CNP A;  1XK4 A;  5HKW A;  3S0D A;  3I5F B;  1YRT B;  1A4P A;  1SCV A;  2KYF A;  3TS5 C;  3FWC A;  2KBM A;  3BYA A;  3EVV A;  1L7Z A;  1QV1 A;  1CLM A;  1PK0 D;  1WDC C;  4IJ7 A;  2L0P A;  1NX1 A;  2JNF A;  2KGB C;  4PCW A;  4AOM A;  2ZND A;  2NCO A;  2L51 A;  4MZJ A;  4BY5 A;  4DRW A;  2K60 A;  1SR6 C;  3WNX B;  3B6X A;  1OZS A;  3CGA A;  2JTZ A;  3K1E A;  5FI6 A;  1DTL A;  4JPZ B;  2QPT A;  5HKZ A;  5CSJ A;  2K7C A;  3PM8 A;  2Y1M A;  1KSM A;  5CPV A;  1K9U A;  2KAX A;  3HCM A;  1DJG A;  1LKJ A;  4OCI A;  2LMT A;  2KQ6 A;  2KYC A;  4C0L A;  3LLE A;  4MBE A;  2OTG B;  1B9A A;  2CCM A;  2JQ6 A;  1KQM B;  2OS8 C;  1W7J B;  2OTG C;  2COL B;  1ODB A;  2KI6 C;  4MZK A;  4P5O E;  4PE4 A;  5DIC A;  3VRN A;  1GJY A;  2KDH A;  4INX A;  1U5I A;  4WQ2 A;  2JPT A;  3OB1 B;  3R72 A;  2JU0 A;  4YRU A;  2MA2 A;  1S26 D;  1B47 A;  1G8I A;  2V53 A;  2PSR A;  3CAB A;  4QJ5 B;  2F2O A;  4ORA B;  1C3Y A;  2MAZ A;  2NZ0 A;  4YGA A;  1MXL C;  2K0J A;  2M9G A;  2LVI A;  2MJW B;  1BR4 B;  2L50 A;  3D74 A;  4PT1 A;  3EKH A;  1S6C A;  4AQJ A;  4GNK B;  1AVS A;  2ZRT A;  1KK7 Z;  2A4J A;  2KFG A;  3CZ2 A;  1TTX A;  4QJ4 B;  1JC2 A;  2H2K A;  3SS3 A;  5FYX A;  5KU1 A;  1MHO A;  2WOS A;  5I2L A;  3O2P A;  1KFX L;  5FI2 A;  3D75 A;  2L2E A;  1ALV A;  2KI4 C;  1Q80 A;  1JSA A;  3AAK A;  1HQV A;  1OQP A;  1DJI A;  3I5H B;  1F55 A;  1FI5 A;  2SAS A;  1YUS A;  3NHI A;  3GOF A;  2I18 A;  3N7H A;  2KHN A;  2LM5 A;  4MRX A;  1WRK A;  1WRZ A;  2KBI A;  3PM2 A;  3S0E A;  2KOT A;  1IG5 A;  2L2C A;  1GQM A;  2PAL A;  1N2D A;  5F6T A;  2LVJ A;  1F70 A;  3OGN A;  1WLM A;  1XVJ A;  5HYD A;  1CFC A;  4C0K A;  1SY9 A;  2GGM A;  2MBX A;  3L47 A;  1CDM A;  3D78 A;  1UHJ A;  4NQG A;  1DGU A;  2WCM A;  4CFQ A;  2D8N A;  1MXE A;  1K8U A;  2JXL A;  1MR8 A;  1NIW A;  1XFY O;  3OX6 A;  2F3Z A;  1J55 A;  5JJG A;  1NCY A;  2F8P A;  1KFU L;  3OHM B;  4N5X A;  1K9P A;  1QVI Y;  3GK4 X;  3SS4 A;  1DJX A;  1NCZ A;  3V2L A;  1MUX A;  1LS8 A;  1Y1X A;  4XJK B;  2EC6 C;  3HX4 A;  4GGF C;  3DF0 A;  3UNW A;  1TNQ A;  2PRU A;  4MN0 A;  1QAT A;  3CR2 A;  2DOQ A;  2NLN A;  3CZ1 A;  3PN7 C;  3I5G C;  1OOG A;  4YBH B;  1CDN A;  4PDZ A;  1S3P A;  1NX0 A;  3KEV A;  2LUC A;  2I2R E;  4MSP A;  4P2Y B;  4ORC B;  2LVV A;  4F0Z B;  1W9Z A;  1PRW A;  1YX8 A;  2OPO A;  1EXR A;  2LLS A;  1Y1U A;  3FIA A;  1G33 A;  1M45 A;  1F4Q A;  3D77 A;  4YGE B;  1ZMZ A;  2CBL A;  4ICB A;  1BR1 B;  1T14 A;  4HRH A;  4OZD A;  1K95 A;  1S5G Z;  1F71 A;  2Y5I A;  1LIN A;  1DGV A;  1PAL A;  2GTE A;  2BCX A;  4WRI A;  2KAV A;  1KCY A;  1YVL A;  1XFW O;  3EK7 A;  3VB1 A;  4GGF A;  1CLL A;  1BLQ A;  4JD9 A;  4UPG A;  2K7D A;  4GGN A;  3PAT A;  3C1V A;  1D1O A;  1YUR A;  5HLO A;  2K7B A;  3RZS A;  3AAJ A;  1QTX A;  1BF5 A;  3SJS A;  1FI6 A;  2FOT A;  1C07 A;  4NDD A;  1BG1 A;  2KFH A;  2HQ8 A;  1CFF A;  4PHK A;  2L5Y A;  3OX5 A;  5D69 A;  2WCK A;  1QV0 A;  3MSE B;  3QRX A;  2M29 A;  3NSO A;  4FQO A;  3SG2 A;  1CMG A;  1DC1 A;  2VRG A;  4F7F A;  3TDZ A;  1JWD A;  3AKB A;  3QME A;  1X02 A;  3TS5 B;  2L98 A;  4OKH A;  1PSB A;  1U5I B;  3DZT A;  1BMO A;  3RLZ A;  1UWO A;  1CMF A;  1OMR A;  1WDC B;  4NDC A;  2FJY A;  2R2I A;  2LLU A;  3JVT C;  3SG7 A;  4HSZ A;  1SR6 B;  2BKI B;  3CS1 A;  5DKQ A;  1OOH A;  1SL9 A;  2LHL A;  1TOP A;  3D10 A;  2BCA A;  2G9B A;  1OE9 B;  2I94 A;  3BQ3 A;  4DIR A;  2SCP A;  3BXK A;  1DJW A;  1CM1 A;  2PYQ A;  2BEC A;  2O5G A;  2G2B A;  3LCP C;  2JNX A;  2H8V A;  3OB2 B;  4MLW A;  3O78 A;  4U8D A;  4YI9 A;  2OS8 B;  3TDU A;  1KK7 Y;  1DEK A;  1TUJ A;  2KAY A;  2LVK A;  4GUK A;  2KQY A;  1DJZ A;  3DXL A;  5HKY A;  1XA5 A;  1M63 B;  1UHK A;  3TUY C;  1S1E A;  3WHU B;  2E6W A;  2CTN A;  4HRE E;  1AUI B;  1XFR A;  1MWN A;  3NSL A;  3S0F A;  1XO5 A;  2QEB A;  2E30 A;  4NDB A;  1DJY A;  1B4C A;  1YRU B;  1BOC A;  1DF0 A;  1ZOT B;  4PE0 A;  1S6J A;  1TCO B;  1UHH A;  1SKT A; 
#chains in the Genus database with same CATH homology
 2JT0 A;  5G08 A;  2M7N A;  4PE1 A;  1KSO A;  2K61 A;  4BY4 A;  4M2Q A;  1V1F A;  1QX5 B;  1SL8 A;  2F33 A;  4PAL A;  5GQQ C;  3EVU A;  1SNL A;  1XFZ O;  2QAC A;  1UHI A;  3F45 A;  2LC5 A;  3CR5 X;  3IF7 A;  5BPJ A;  2LHI A;  1Y6W A;  1SK6 D;  2KI4 B;  1QAS A;  2LLT A;  3BOW A;  4MVF A;  3EK8 A;  2O60 A;  2MLE C;  2HF5 A;  4E68 A;  3DVE A;  3A8R A;  1TN4 A;  1SPY A;  3LK1 A;  2ZNE A;  3LL8 B;  4WQ3 A;  2JZI A;  4L9M A;  1KWO B;  3JTD C;  1UUS A;  3SIA A;  3DF0 B;  1KWO C;  3GK2 A;  4OVN F;  2PAS A;  5CSF A;  1EJ3 A;  4N1F A;  1W7I B;  1REC A;  1H8B A;  1SCM C;  1GGZ A;  1PSR A;  2K7O A;  3KPX A;  2GV5 A;  1NWD A;  2L5X B;  3CZT X;  1AJ5 A;  2HPS A;  4D1E A;  1CTR A;  1V1G A;  1CFP A;  2M3W A;  1IJ5 A;  1PVB A;  1TNX A;  2P6B B;  5J3X A;  2PMY A;  1R6P A;  1L2O C;  3PSR A;  3DD4 A;  1EG4 A;  1UHN A;  1S5G Y;  4JWQ A;  1A75 B;  1JF0 A;  4ETO A;  1A03 A;  2EC6 B;  1CKK A;  2Q4U A;  1B1G A;  5CSN A;  3KO0 A;  1OSA A;  3PN7 B;  2M8U A;  3I5G B;  3BUO B;  5TNC A;  3RM1 A;  1K94 A;  2KNE A;  4MZL A;  2WCE A;  2M0R A;  5AFP A;  1QIW A;  1CM4 A;  5HLV A;  3K21 A;  2MHH A;  3BUN B;  4ZCU A;  1N0Y A;  1XYD A;  1ALW A;  2EHB A;  2I7A A;  1QX2 A;  1K2H A;  3SG5 A;  2WCF A;  3M0W A;  3NSI A;  4PHM A;  4MEW A;  5I2O A;  1C7W A;  2LMV A;  1DJH A;  1IJ6 A;  1NP8 A;  1SMG A;  2LAP A;  1QX7 A;  3FS7 A;  3VRR A;  1OMV A;  4HRG A;  5CSI A;  1C7V A;  2LUX A;  4PHN A;  1NUB A;  3ZWH A;  3EVR A;  2JT8 A;  3NXA A;  1BU3 A;  2LE9 B;  3BUX B;  4GAO A;  2GGZ A;  1LVC D;  2M49 B;  3SIB A;  2LCP A;  2CT9 A;  1UP5 A;  4I5N B;  3O6B A;  1Y1A A;  1CDP A;  1JF2 A;  3VRQ A;  1J7O A;  3OP0 A;  4DUQ A;  4GFT A;  2B1U A;  2AAO A;  1J1E A;  1IRJ A;  2JXC A;  1YVH A;  1NPQ A;  2JT3 A;  2LV7 A;  1G4Y R;  1AJ4 A;  2HET A;  1A29 A;  1N65 A;  1RFJ A;  1KFX S;  2BL0 C;  2JTT A;  3D0Y A;  4ZCV A;  3BUW B;  2M7L A;  1TNW A;  5K89 A;  1J7P A;  1F4O A;  3JVT B;  3CLN A;  1DF0 B;  2EGD A;  4USL A;  5DKR A;  1B7T Z;  5AEQ A;  3FWB A;  1IGV A;  4M2O A;  1NSH A;  3WXA A;  1LXF C;  1NX3 A;  2WCB A;  1WLZ A;  1JFJ A;  4I5J A;  4YGD B;  3SG6 A;  1AHR A;  5ER4 X;  1CB1 A;  1MQ1 A;  2F2P A;  2TN4 A;  1AK8 A;  3IQQ A;  3I5F C;  4JQ0 D;  1YR5 A;  1BJF A;  3DVJ A;  4A4C A;  5AAN A;  1OOJ A;  1TIZ A;  2M1K B;  1FW4 A;  3TDI A;  2BBN A;  1JUO A;  3TUY B;  3KF9 A;  3BOW B;  5AXI A;  1OMD A;  2WND A;  3I5I B;  1RWY A;  1IH0 A;  3E3R A;  3I5I C;  4QJ3 B;  2LNK A;  1ZUZ A;  2ZN9 A;  3VGO A;  1TNP A;  1NYA A;  3EK4 A;  1B8C A;  1LA3 A;  1YUU A;  1TCF A;  3H4S E;  2FCD A;  5ER5 A;  2KGR A;  4CID A;  1SW8 A;  1Y0V H;  1KFU S;  2JRF A;  1QJT A;  1DVI A;  1A2X A;  1ZAC A;  2ZN8 A;  2BE4 A;  2JOJ A;  1B8L A;  4DCK A;  4XYN A;  2LAN A;  1F54 A;  1EH2 A;  5I8N A;  4R1E A;  2FJU B;  3CTN A;  1SBJ A;  4ORB B;  1KQM C;  1XFU O;  3O4Y A;  3VRO A;  1K93 D;  1QXP A;  1ZFS A;  1B8R A;  1DT7 B;  2F3Y A;  1DMO A;  4CPV A;  4TNC A;  2BCB A;  1KK8 B;  2ZKM X;  4N1G A;  1KK8 C;  1OZO A;  3DVM A;  3JTD B;  2KFF A;  1VRK A;  2HQW A;  1IKU A;  2H61 C;  1SCM B;  2IS9 A;  4Q04 A;  1IQ3 A;  1CLB A;  1RK9 A;  2LP2 A;  1BT6 A;  2WOR A;  1FBV A;  2LP3 A;  1S36 A;  1PUL A;  1NCX A;  3VRP A;  1H4B A;  3WHT B;  4DS7 A;  2BBM A;  1M39 A;  1WY9 A;  4C0J A;  3ICB A;  3PFV A;  5PAL A;  1HT9 A;  2Y4Q A;  4GBA A;  1XFV O;  3I5H C;  2FCE A;  2ISD A;  2RGI A;  5AER A;  1L2O B;  2WC8 A;  2BKH B;  4M2P A;  3A4U B;  2AMI A;  4YI8 A;  4MRY A;  4PE7 A;  1K96 A;  2LMU A;  2H61 A;  1BOD A;  1F8H A;  1QIV A;  1TRF A;  2ZFD A;  5IBW A;  2K8M B;  5B8I B;  1XFX O;  3KHE A;  2M97 A;  1UUR A;  2KSP A;  4YGB B;  1IWQ A;  2NCP A;  1WRL A;  2L4H A;  3BUM B;  4IL1 A;  4YGC B;  4CFR A;  4PHJ A;  1EL4 A;  1KQV A;  3SG4 A;  1EG3 A;  2CXJ A;  1RRO A;  1QS7 A;  3CR4 X;  2L4I A;  2CNP A;  1M46 A;  5I2Q A;  2K2A A;  1J7R A;  1R2U A;  3D0Y B;  3GK1 A;  1SYM A;  4I5K A;  1JFK A;  1RTP 1;  1FPW A;  4I5L B;  1YUT A;  1QLK A;  2AUC A;  4OR9 B;  2JWW A;  4OV2 A;  3ZNI A;  1YTZ C;  4AQI A;  1GGW A;  2PVB A;  2JUL A;  3PAL A;  1LA0 A;  1B7T Y;  5KTY A;  1K90 D;  3NSK A;  1CDL A;  4FTG A;  4GPL B;  3TZ1 A;  3PLF B;  5KSZ A;  2K2F A;  1XK4 C;  1QVI Z;  3LK0 A;  1J1D A;  1PVA A;  2KI6 D;  1AP4 A;  3EKJ A;  5D7F A;  3CWG A;  1SL7 A;  2MLF C;  1A75 A;  2NXQ A;  2BL0 B;  4XJK A;  5DKN A;  1J7Q A;  1NX2 A;  1YX7 A;  3IQO A;  1CFD A;  1E8A A;  4A4B A;  1FF1 A;  1M31 A;  1RJV A;  5JOL A;  1S6I A;  1JBA A;  2Y1N A;  2MRD A;  3AKA A;  4CLN A;  2M1U A;  2ZRS A;  1QLS A;  2BE6 A;  1IQ5 A;  2Q91 A;  1SRA A;  1MF8 B;  2JC2 A;  1K9K A;  3SG3 A;  3DVK A;  1CNP A;  1XK4 A;  5HKW A;  3I5F B;  1YRT B;  1A4P A;  1SCV A;  2KYF A;  3TS5 C;  3FWC A;  2KBM A;  3BYA A;  3EVV A;  1L7Z A;  1QV1 A;  1CLM A;  1PK0 D;  1WDC C;  4AOM A;  2L0P A;  1NX1 A;  2JNF A;  2KGB C;  4PCW A;  1KCY A;  2ZND A;  2NCO A;  2L51 A;  4MZJ A;  4BY5 A;  4DRW A;  1SR6 C;  3WNX B;  1OZS A;  3CGA A;  2JTZ A;  1DTL A;  4JPZ B;  2QPT A;  5HKZ A;  5CSJ A;  2K7C A;  3PM8 A;  2Y1M A;  1KSM A;  5CPV A;  1K9U A;  2KAX A;  3HCM A;  1DJG A;  1LKJ A;  4OCI A;  2LMT A;  2KQ6 A;  2KYC A;  4C0L A;  3LLE A;  4MBE A;  2OTG B;  1B9A A;  2CCM A;  2JQ6 A;  1KQM B;  2OS8 C;  1W7J B;  2OTG C;  2COL B;  1ODB A;  2KI6 C;  4MZK A;  4P5O E;  4PE4 A;  3VRN A;  1GJY A;  2KDH A;  1U5I A;  4WQ2 A;  2JPT A;  3OB1 B;  2JU0 A;  4YRU A;  2MA2 A;  1S26 D;  1B47 A;  1G8I A;  2V53 A;  2PSR A;  4QJ5 B;  2F2O A;  4ORA B;  2MAZ A;  2NZ0 A;  4YGA A;  1MXL C;  2K0J A;  2M9G A;  2LVI A;  2MJW B;  1BR4 B;  2L50 A;  3EKH A;  1S6C A;  4AQJ A;  4GNK B;  1AVS A;  2ZRT A;  1KK7 Z;  2A4J A;  2KFG A;  1TTX A;  4QJ4 B;  1JC2 A;  2H2K A;  5KU1 A;  5FYX A;  1MHO A;  2WOS A;  5I2L A;  3O2P A;  1KFX L;  2L2E A;  1ALV A;  2KI4 C;  1Q80 A;  1JSA A;  3AAK A;  1HQV A;  1OQP A;  1DJI A;  3I5H B;  1F55 A;  1FI5 A;  2SAS A;  1YUS A;  3GOF A;  2I18 A;  2KHN A;  2LM5 A;  4MRX A;  1WRK A;  1WRZ A;  2KBI A;  2KOT A;  1IG5 A;  1GQM A;  2PAL A;  1N2D A;  5F6T A;  2LVJ A;  1F70 A;  1WLM A;  1XVJ A;  5HYD A;  1CFC A;  4C0K A;  1SY9 A;  2GGM A;  2MBX A;  1CDM A;  1UHJ A;  4NQG A;  1DGU A;  4CFQ A;  2D8N A;  1MXE A;  1K8U A;  2JXL A;  1MR8 A;  1NIW A;  1XFY O;  3OX6 A;  2F3Z A;  1J55 A;  5JJG A;  1NCY A;  2F8P A;  1KFU L;  3OHM B;  4N5X A;  1K9P A;  1QVI Y;  3GK4 X;  1DJX A;  1NCZ A;  1MUX A;  1Y1X A;  4XJK B;  2EC6 C;  3HX4 A;  4GGF C;  3DF0 A;  1TNQ A;  2PRU A;  4MN0 A;  1QAT A;  3CR2 A;  2DOQ A;  2NLN A;  3PN7 C;  3I5G C;  4YBH B;  1CDN A;  4PDZ A;  1S3P A;  1NX0 A;  3KEV A;  2LUC A;  2I2R E;  4MSP A;  4P2Y B;  4ORC B;  2LVV A;  4F0Z B;  1PRW A;  1YX8 A;  2OPO A;  1EXR A;  2LLS A;  1Y1U A;  3FIA A;  1G33 A;  1M45 A;  1F4Q A;  4YGE B;  1ZMZ A;  2CBL A;  4ICB A;  1BR1 B;  4HRH A;  1K95 A;  1S5G Z;  1F71 A;  2Y5I A;  1LIN A;  1DGV A;  1PAL A;  2BCX A;  4WRI A;  2KAV A;  1YVL A;  1XFW O;  3EK7 A;  4GGF A;  1CLL A;  1BLQ A;  4UPG A;  2K7D A;  4GGN A;  3PAT A;  3C1V A;  1D1O A;  1YUR A;  5HLO A;  2K7B A;  3AAJ A;  1QTX A;  1BF5 A;  3SJS A;  1FI6 A;  2FOT A;  1C07 A;  4NDD A;  1BG1 A;  2KFH A;  2HQ8 A;  1CFF A;  4PHK A;  3OX5 A;  5D69 A;  1QV0 A;  3MSE B;  3QRX A;  2M29 A;  3NSO A;  4FQO A;  3SG2 A;  1CMG A;  2VRG A;  1JWD A;  3TDZ A;  3AKB A;  1X02 A;  3TS5 B;  2L98 A;  4OKH A;  1PSB A;  1U5I B;  1BMO A;  3RLZ A;  1UWO A;  1CMF A;  1OMR A;  1WDC B;  4NDC A;  2R2I A;  2LLU A;  3JVT C;  3SG7 A;  4HSZ A;  1SR6 B;  2BKI B;  3CS1 A;  5DKQ A;  1SL9 A;  2LHL A;  1TOP A;  3D10 A;  2BCA A;  2G9B A;  1OE9 B;  2I94 A;  3BQ3 A;  4DIR A;  2SCP A;  3BXK A;  1DJW A;  1CM1 A;  2BEC A;  2O5G A;  2G2B A;  3LCP C;  2JNX A;  3OB2 B;  4MLW A;  3O78 A;  4U8D A;  4YI9 A;  2OS8 B;  3TDU A;  1KK7 Y;  4GUK A;  2KAY A;  2LVK A;  2KQY A;  1DJZ A;  5HKY A;  1XA5 A;  1M63 B;  1UHK A;  3TUY C;  1S1E A;  3WHU B;  2E6W A;  2CTN A;  4HRE E;  1AUI B;  1MWN A;  3NSL A;  1B4C A;  1XO5 A;  2E30 A;  4NDB A;  1DJY A;  1YRU B;  1BOC A;  1DF0 A;  1ZOT B;  4PE0 A;  1S6J A;  1TCO B;  1UHH A;  1SKT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...