2YGUA

Crystal structure of fire ant venom allergen, sol i 2
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
117
structure length
117
Chain Sequence
b'DNKELKIIRKDVAECLRTLPKCGNQPDDPLARVDVWHCAMAKRGVYDNPDPAVIKERSMKMCTKIITDPANVENCKKVASRCVDRETQGPKSNRQKAVNIIGCALRAGVAETTVLAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VENOM ALLERGEN 2
publication title Crystal Structure of Sol I 2, a Major Allergen from Fire Ant Venom
pubmed doi rcsb
source organism Solenopsis invicta
molecule tags Allergen
total genus 42
structure length 117
sequence length 117
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-04-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.190 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Recoverin; domain 1 2yguA00
2YGUA
chains in the Genus database with same CATH superfamily
5KSZA 2WORA 2P70A 1C7WA 2BAPA 3SS4A 5CSIA 3TUYC 3OHMB 1SCMC 3IQQA 1SL8A 3BYAA 3IF7A 4DCKA 2M97A 1PVBA 2EGDA 2PASA 1PULA 4INWA 2BECA 4ICBA 4N5XA 1KK7Z 1KK8C 2JTZA 1F8HA 2EHBA 3EKHA 5JJGA 5I2QA 1QX7A 2DOQA 1EG3A 2KLEA 4MRYA 1KFXS 3BUMB 1N65A 2COLB 1S1EA 1T14A 1JF2A 4HRHA 3EG5B 1CTRA 2V53A 2HF5A 2KHNA 2L5XB 1Z4HA 2BE6A 4MZKA 4OCIA 1NUBA 4CLNA 1A2XA 2M1UA 1AJ4A 1SR6C 5J3XA 5TNCA 1Z2CB 1C7VA 1F55A 4OV2A 1QLKA 3SS5A 2O60A 2LMVA 1SPYA 1NX3A 2NCOA 4PE1A 3TS5B 2D8NA 3QRXA 2ZKMX 1CFCA 3D0YB 4CPVA 1B8RA 1KSOA 1Q80A 1J7RA 1IG5A 4QJ4B 1DJHA 1KQMB 2BNXA 2M29A 3AAJA 1DTLA 2GGZA 4HRGA 2HQWA 1NCXA 3JVTB 4JQ0D 2JNXA 2L4HA 3S0EA 2Q91A 1S6IA 2JT8A 1CNPA 2CNPA 4M2QA 2L2CA 4PALA 5DKNA 1BR4B 1WY9A 3BFBA 1SMGA 4JKTA 1G4YR 4D1EA 2KAYA 1DC1A 1CDMA 5HLOA 3BFHA 3D0YA 1MF8B 3HCMA 2YGUA 4NQGA 1JC2A 2ZRSA 3DXLA 2BE4A 1WDCC 2ZRTA 2KNEA 1IRJA 1DJGA 1FW4A 2BL0C 3OGNA 4NDDA 1S36A 1PSBA 2F2OA 1M39A 2WCLA 1BT6A 2KBMA 4YI8A 3FIAA 4CIDA 1TUJA 4YGEB 4AQJA 3VROA 1QASA 1XFZO 1TRFA 3DVKA 3TS5C 1MXLC 4DIRA 1KFUL 1M45A 2K2AA 3AKBA 5HKWA 1F4OA 1K90D 1NX1A 3OP0A 3S0FA 2NZ0A 4JD9A 2PRUA 1DJIA 2H61A 1KQMC 3CR2A 2L98A 3I5GC 4ORAB 5HKZA 5FI7A 3JVTC 1YVLA 4WQ3A 1RK9A 4FQOA 4GGNA 1DJXA 2JNFA 2PSRA 2MJWB 3D73A 1UURA 4I5NB 3NSIA 4JPZB 3DF0A 4YBHB 2ZN9A 1LA3A 3CTNA 2JOJA 2LAPA 4GPLB 3PN7C 4F0ZB 1JUOA 2H2KA 1YTZC 3PFVA 1YR5A 2LV7A 1SBJA 2OPOA 2QEHA 1JFJA 2JWWA 4MSPA 2H61C 2LVVA 2I7AA 2KI4B 1DQEA 3SG5A 5PALA 2B1UA 1B8LA 3E3RA 3WXAA 2HETA 1DMOA 1MHOA 4PE7A 1B47A 1NP8A 1YVHA 1J7QA 3MSEB 3JTDB 1QVIY 5BPJA 2K7DA 4JWQA 4OVNF 2NCPA 1A75A 4R1EA 1OMRA 1SY9A 2JZIA 4AQIA 2R2IA 1MR8A 1NX0A 3D76A 1XO5A 2GV5A 1SK6D 1EG4A 2RGIA 1K9KA 2LMUA 3S0GA 1OMDA 1PK0D 1L2OB 3CABA 3KHEA 3VRQA 3WNXB 5I94A 1XFUO 2L4IA 2PALA 3FWBA 1VRKA 2NXQA 2K7BA 2JT3A 3L47A 4PE0A 1IQ3A 2M49B 3DVMA 2QEOA 3A4UB 2M7LA 1UHNA 2KGRA 1BMOA 1DF0B 2KI4C 3SS3A 1NX2A 1CLMA 3B7AA 2JXLA 2BCAA 1SSEB 2ZNDA 1TNQA 4I5LB 3R1OA 3OX6A 1TCFA 2KFFA 1CLBA 1ORGA 3OB1B 4YGCB 1QVIZ 1J1EA 2LM5A 2CXJA 1KWOB 2QACA 1ALWA 4USLA 2KPHA 2BKIB 1XFVO 1N2DA 4PT1A 2M9GA 1JFKA 1K96A 2WCBA 3PM8A 1L2OC 2L5YA 5JOLA 1SYMA 1UP5A 3OX5A 3BUOB 2ZFDA 4ORBB 1XFYO 3KF9A 5D69A 2FOTA 4C0LA 1DJYA 1G8IA 5KU1A 2KYFA 4GGFA 1B7TY 2JU0A 4ZCVA 3RZSA 1QATA 3SG6A 4AOMA 3O4YA 1YUTA 2JPOA 3OB2B 1BF5A 1AHRA 4IJ7A 1K2HA 4INXA 1TNXA 3OBVA 2PVBA 3CR5X 5I8NA 2KI6C 2F33A 5D7FA 3BOWB 1CB1A 3D10A 2P71A 1S6JA 4BY4A 3NGVA 2FJUB 1BU3A 2LC5A 2K61A 2JULA 1KWOC 3SJSA 1EXRA 4GGFC 1CMGA 1OE9B 5I2OA 3O4XA 3V2LA 2G9BA 5HLVA 2K2FA 5AFPA 1MWNA 1ZACA 2L51A 3PLFB 1FI5A 1KCYA 2I94A 1G33A 1QLSA 2EC6B 1QS7A 2LCPA 3BOWA 4M2OA 3CWGA 3NSLA 2I18A 1Y1UA 3LLEA 3SG2A 1H4BA 2SASA 1SRAA 3CDNA 3CZTX 1EJ3A 1XA5A 1K95A 3B6XA 2KQYA 3VGOA 4C0JA 1W7JB 3UNWA 3VB1A 2WOSA 2KLDA 3SG3A 3FE8A 1ALVA 2AUCA 3NSOA 3O6BA 1B1GA 1NCZA 2Y5IA 1J55A 4M2PA 1N0YA 4MRXA 2LE9B 2M3WA 4E68A 1BOCA 3NHTA 1QX2A 5DICA 2BCXA 4ORCB 1LS8A 4DRWA 1NYAA 2P6BB 4TNCA 2EC6C 1NPQA 3NHIA 2WCEA 1PSRA 1P28A 2CCMA 2KFHA 4GAOA 3BUNB 2BBMA 4YGBB 2Y1MA 2KBIA 2JTTA 2CBLA 2H8VA 1QV1A 1CDLA 2E30A 1MQ1A 2FCEA 3L4LA 3PJIA 3R1VA 3WHTB 3GK1A 1LA0A 2KOTA 3TZ1A 1LVCD 4UPGA 1DT7B 1E8AA 1TUZA 1OOFA 4XJKB 2WCKA 3WHUB 1RFJA 2LLUA 1PVAA 4CFRA 5CSNA 2LLSA 1CMFA 1CLLA 2K7OA 1KSMA 3IQOA 5CSJA 2K0JA 1GJYA 1XFRA 1S5GY 1OZSA 2LUXA 4XJKA 1JSAA 1UHHA 1FBVA 1U5IB 1F70A 1XFXO 1DELA 1NIWA 4FTGA 2JC2A 3EVUA 4WQ2A 2BCBA 1SW8A 2M7NA 2LLTA 1XK4A 4XYNA 1AVSA 3EVRA 1F71A 2K8MB 1S26D 2PMYA 1YUUA 4NDBA 1YURA 4GFTA 3QMEA 1F54A 4PDZA 2QPTA 1U5IA 1J1DA 2HQ8A 5ER5A 1CM4A 1PALA 4DS7A 2MRDA 3RLZA 2ZNEA 1RROA 1RWYA 3K1EA 1SKTA 1CFFA 1KFXL 1XK4C 4HSZA 2LHIA 4MZLA 4OZDA 3EK4A 1B8CA 1NSHA 1GM0A 1S6CA 1V1GA 1IWQA 2I2RE 2M0RA 2F8PA 3R1PA 1OW4A 3SG4A 3UO9A 1QWVA 1A03A 1KFUS 1YX8A 3I5IB 3JTDC 1D1OA 1X02A 5G08A 2AMIA 1K9PA 2AAOA 1NWDA 2LANA 3BFAA 2FJYA 2Y1NA 1LXFC 3S0AA 1DF0A 3PATA 3EKJA 1RTP1 1J7PA 1OOHA 2JQ6A 3VRNA 3ZNIA 1K94A 4PHMA 4L9MA 1ZOTB 2MAZA 3AAKA 2OS8B 5D3OA 1R6PA 4QJ3B 2MLEC 1L7ZA 4IL1A 2OTGB 1KK7Y 4FQTA 1HQVA 5FYXA 2ISDA 5DKQA 3FWCA 4KYNA 1KK8B 2Y4QA 1B4CA 1DGVA 2JPTA 1J7OA 5KTYA 1QIWA 2M8UA 4OKHA 1MXEA 1OOIX 1LINA 3LL8B 2HPSA 2QEBA 3S0BA 2JT0A 1BG1A 1OSAA 1K93D 4MN0A 4A4CA 3D78A 2LMTA 1A29A 5CPVA 1WRKA 3CYZA 3SIAA 1W7IB 2WC6A 2LVIA 3FE6A 1SL9A 1ZMZA 2TN4A 5AXIA 2CTNA 1IGVA 3LK0A 3BUWB 3NXAA 4N1FA 2LNKA 2OS8C 2WCFA 1FI6A 1IQ5A 4QJ5B 1ZFSA 1QIVA 2OTGC 5GQQC 1FF1A 1IKUA 3DD4A 3AKAA 5B8IB 1BLQA 5HKYA 3O78A 1K9UA 4ZCUA 2BKHB 2F2PA 1B7TZ 1XYDA 3O2PA 3C1VA 5FI2A 2PYQA 3K21A 1CM1A 3EK8A 3F45A 1WDCB 3PSRA 2WC5A 1GGZA 2BL0B 4YGAA 4BY5A 4CFQA 3BJHA 5CSFA 4MVFA 1XFWO 1BODA 3I5FB 1XVJA 1QV0A 2KGBC 1C3ZA 1Y0VH 3EVVA 2M1KB 4MEWA 2KYCA 1FPWA 4PHJA 3A8RA 3BQ3A 3DY9A 2KSPA 2ZN8A 3I5GB 2LP2A 3VRRA 1OQPA 1YRTB 2LHLA 1WRZA 4PE4A 1UWOA 4WRIA 1V1FA 1TNPA 3TDIA 5FI6A 1S3PA 4Q04A 2FCDA 4ETOA 1KQVA 1HT9A 3PN7B 4YI9A 3IVTA 2MA2A 3KO0A 2KDHA 1NCYA 2L50A 4YRUA 1TNWA 2QDIA 2MBXA 3CS1A 1BR1B 1YUSA 4P5OE 3B86A 4N1GA 1UUSA 2IS9A 5HL1A 1IJ6A 1TWOA 4PHNA 1DEKA 2WCJA 3I5FC 3EK7A 3L4AA 1UHIA 2LP3A 3DF0B 4GNKB 3D74A 1DGUA 3PALA 2E6WA 3BUXB 1AUIB 3GOFA 1OZOA 2CT9A 1OOGA 1EH2A 1OMVA 1QTXA 2L2EA 2G2BA 2K7CA 1A4PA 1EL4A 2A4JA 1B9AA 1M46A 2QEVA 4MZJA 1TCOB 1IIOA 4A4BA 2LVKA 1CKKA 1F4QA 1ODBA 1TOPA 3DZTA 1JBAA 2GGMA 4P2YB 5AANA 1JWDA 1SL7A 4GBAA 1A75B 3ICBA 1C07A 2KQ6A 3GK4X 4GUKA 1UHJA 4NDCA 1WRLA 1WLMA 5IBWA 1AP4A 2MLFC 3R72A 3ZWHA 4F7FA 3B88A 4MBEA 4C0KA 2LUCA 1RECA 4PHKA 4U8DA 1JF0A 4I5KA 1K8UA 2F3YA 2JXCA 3M0WA 1C3YA 1WLZA 1DJWA 4HREE 1CFDA 1TN4A 3GK2A 2NLNA 3D77A 1CDNA 2MHHA 5K89A 4DUQA 1AK8A 3BXKA 5ER4X 2KAVA 2KI6D 2F3ZA 3CZ2A 1QX5B 1Y1XA 3CZ0A 3S0DA 1BJFA 1Y1AA 1YX7A 3I5HB 5I2LA 1UHKA 2ERBA 2WCMA 1Y6WA 1S5GZ 1YRUB 2KAXA 3LCPC 2BBNA 3TDZA 3CLNA 1IH0A 1ZUZA 1CDPA 2PQLA 2GTEA 2VRGA 1M63B 3CGAA 3HX4A 2WC8A 3RM1A 1RJVA 2WNDA 3SIBA 1GGWA 2O5GA 3Q8IA 2SCPA 4MLWA 4OR9B 5F6TA 3TUYB 1H8BA 1SCMB 5AERA 3LK1A 1TTXA 1R2UA 2LVJA 3CR4X 3FS7A 3DYEA 3B87A 3CZ1A 1DJZA 3D75A 3H4SE 5EL2A 1MUXA 1SCVA 3TDUA 1M31A 1QXPA 3SG7A 1TIZA 4PCWA 5AEQA 1PRWA 3FE9A 5HYDA 1LKJA 3KEVA 3DVJA 3VRPA 1CFPA 3NSKA 2Q4UA 1OOJA 3I5HC 2JRFA 3DVEA 2L0PA 1GQMA 1W9ZA 3N7HA 1QJTA 3PM2A 3I5IC 1SNLA 2KFGA 1IJ5A 1SR6B 4YGDB 4I5JA 1AJ5A 5DKRA 2K60A 1DVIA 2WCHA 3KPXA
chains in the Genus database with same CATH topology
1DEKA 1Z2CB 4MEWA 2BAPA 5D3OA 3SS4A 4I5KA 3SS5A 2K60A 4KYNA 3SS3A 2BNXA 4GAOA 4I5LB 4IJ7A 5FI6A 3UO9A 3OBVA 5FI7A 3KEVA 1DELA 2KLEA 4JKTA 5FI2A 1DC1A 3IVTA 3UNWA 1W9ZA 4I5NB 2KLDA 3EG5B 3PM2A 5I94A 2YGUA 4GBAA 1Z4HA 4I5JA 2L5YA 3O4XA 5HL1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YGU A; 
#chains in the Genus database with same CATH topology
 5KSZ A;  2WOR A;  2P70 A;  1C7W A;  2BAP A;  3SS4 A;  5CSI A;  3TUY C;  3OHM B;  1SCM C;  3IQQ A;  1SL8 A;  3BYA A;  3IF7 A;  4DCK A;  2M97 A;  1PVB A;  2EGD A;  2PAS A;  1PUL A;  4INW A;  2BEC A;  4ICB A;  4N5X A;  1KK7 Z;  1KK8 C;  2JTZ A;  1F8H A;  2EHB A;  3EKH A;  5JJG A;  5I2Q A;  1QX7 A;  2DOQ A;  1EG3 A;  2KLE A;  4MRY A;  1KFX S;  3BUM B;  1N65 A;  2COL B;  1S1E A;  1T14 A;  1JF2 A;  4HRH A;  3EG5 B;  1CTR A;  2V53 A;  2HF5 A;  2KHN A;  2L5X B;  1Z4H A;  2BE6 A;  4MZK A;  4OCI A;  1NUB A;  4CLN A;  1A2X A;  2M1U A;  1AJ4 A;  1SR6 C;  5J3X A;  5TNC A;  1Z2C B;  1C7V A;  1F55 A;  4OV2 A;  1QLK A;  3SS5 A;  2O60 A;  2LMV A;  1SPY A;  1NX3 A;  2NCO A;  4PE1 A;  3TS5 B;  2D8N A;  3QRX A;  2ZKM X;  1CFC A;  3D0Y B;  4CPV A;  1B8R A;  1KSO A;  1Q80 A;  1J7R A;  1IG5 A;  4QJ4 B;  1DJH A;  1KQM B;  2BNX A;  2M29 A;  3AAJ A;  1DTL A;  2GGZ A;  4HRG A;  2HQW A;  1NCX A;  3JVT B;  4JQ0 D;  2JNX A;  2L4H A;  3S0E A;  2Q91 A;  1S6I A;  2JT8 A;  1CNP A;  2CNP A;  4M2Q A;  2L2C A;  4PAL A;  5DKN A;  1BR4 B;  1WY9 A;  3BFB A;  1SMG A;  4JKT A;  1G4Y R;  4D1E A;  2KAY A;  1DC1 A;  1CDM A;  5HLO A;  3BFH A;  3D0Y A;  1MF8 B;  3HCM A;  2YGU A;  4NQG A;  1JC2 A;  2ZRS A;  3DXL A;  2BE4 A;  1WDC C;  2ZRT A;  2KNE A;  1IRJ A;  1DJG A;  1FW4 A;  2BL0 C;  3OGN A;  4NDD A;  1S36 A;  1PSB A;  2F2O A;  1M39 A;  2WCL A;  1BT6 A;  2KBM A;  4YI8 A;  3FIA A;  4CID A;  1TUJ A;  4YGE B;  4AQJ A;  3VRO A;  1QAS A;  1XFZ O;  1TRF A;  3DVK A;  3TS5 C;  1MXL C;  4DIR A;  1KFU L;  1M45 A;  2K2A A;  3AKB A;  5HKW A;  1F4O A;  1K90 D;  1NX1 A;  3OP0 A;  3S0F A;  2NZ0 A;  4JD9 A;  2PRU A;  1DJI A;  2H61 A;  1KQM C;  3CR2 A;  2L98 A;  3I5G C;  4ORA B;  5HKZ A;  5FI7 A;  3JVT C;  1YVL A;  4WQ3 A;  1RK9 A;  4FQO A;  4GGN A;  1DJX A;  2JNF A;  2PSR A;  2MJW B;  3D73 A;  1UUR A;  4I5N B;  3NSI A;  4JPZ B;  3DF0 A;  4YBH B;  2ZN9 A;  1LA3 A;  3CTN A;  2JOJ A;  2LAP A;  4GPL B;  3PN7 C;  4F0Z B;  1JUO A;  2H2K A;  1YTZ C;  3PFV A;  1YR5 A;  2LV7 A;  1SBJ A;  2OPO A;  2QEH A;  1JFJ A;  2JWW A;  4MSP A;  2H61 C;  2LVV A;  2I7A A;  2KI4 B;  1DQE A;  3SG5 A;  5PAL A;  2B1U A;  1B8L A;  3E3R A;  3WXA A;  2HET A;  1DMO A;  1MHO A;  4PE7 A;  1B47 A;  1NP8 A;  1YVH A;  1J7Q A;  3MSE B;  3JTD B;  1QVI Y;  5BPJ A;  2K7D A;  4JWQ A;  4OVN F;  2NCP A;  1A75 A;  4R1E A;  1OMR A;  1SY9 A;  2JZI A;  4AQI A;  2R2I A;  1MR8 A;  1NX0 A;  3D76 A;  1XO5 A;  2GV5 A;  1SK6 D;  1EG4 A;  2RGI A;  1K9K A;  2LMU A;  3S0G A;  1OMD A;  1PK0 D;  1L2O B;  3CAB A;  3KHE A;  3VRQ A;  3WNX B;  5I94 A;  1XFU O;  2L4I A;  2PAL A;  3FWB A;  1VRK A;  2NXQ A;  2K7B A;  2JT3 A;  3L47 A;  4PE0 A;  1IQ3 A;  2M49 B;  3DVM A;  2QEO A;  3A4U B;  2M7L A;  1UHN A;  2KGR A;  1BMO A;  1DF0 B;  2KI4 C;  3SS3 A;  1NX2 A;  1CLM A;  3B7A A;  2JXL A;  2BCA A;  1SSE B;  2ZND A;  1TNQ A;  4I5L B;  3R1O A;  3OX6 A;  1TCF A;  2KFF A;  1CLB A;  1ORG A;  3OB1 B;  4YGC B;  1QVI Z;  1J1E A;  2LM5 A;  2CXJ A;  1KWO B;  2QAC A;  1ALW A;  4USL A;  2KPH A;  2BKI B;  1XFV O;  1N2D A;  4PT1 A;  2M9G A;  1JFK A;  1K96 A;  2WCB A;  3PM8 A;  1L2O C;  2L5Y A;  5JOL A;  1SYM A;  1UP5 A;  3OX5 A;  3BUO B;  2ZFD A;  4ORB B;  1XFY O;  3KF9 A;  5D69 A;  2FOT A;  4C0L A;  1DJY A;  1G8I A;  5KU1 A;  2KYF A;  4GGF A;  1B7T Y;  2JU0 A;  4ZCV A;  3RZS A;  1QAT A;  3SG6 A;  4AOM A;  3O4Y A;  1YUT A;  2JPO A;  3OB2 B;  1BF5 A;  1AHR A;  4IJ7 A;  1K2H A;  4INX A;  1TNX A;  3OBV A;  2PVB A;  3CR5 X;  5I8N A;  2KI6 C;  2F33 A;  5D7F A;  3BOW B;  1CB1 A;  3D10 A;  2P71 A;  1S6J A;  4BY4 A;  3NGV A;  2FJU B;  1BU3 A;  2LC5 A;  2K61 A;  2JUL A;  1KWO C;  3SJS A;  1EXR A;  4GGF C;  1CMG A;  1OE9 B;  5I2O A;  3O4X A;  3V2L A;  2G9B A;  5HLV A;  2K2F A;  5AFP A;  1MWN A;  1ZAC A;  2L51 A;  3PLF B;  1FI5 A;  1KCY A;  2I94 A;  1G33 A;  1QLS A;  2EC6 B;  1QS7 A;  2LCP A;  3BOW A;  4M2O A;  3CWG A;  3NSL A;  2I18 A;  1Y1U A;  3LLE A;  3SG2 A;  1H4B A;  2SAS A;  1SRA A;  3CDN A;  3CZT X;  1EJ3 A;  1XA5 A;  1K95 A;  3B6X A;  2KQY A;  3VGO A;  4C0J A;  1W7J B;  3UNW A;  3VB1 A;  2WOS A;  2KLD A;  3SG3 A;  3FE8 A;  1ALV A;  2AUC A;  3NSO A;  3O6B A;  1B1G A;  1NCZ A;  2Y5I A;  1J55 A;  4M2P A;  1N0Y A;  4MRX A;  2LE9 B;  2M3W A;  4E68 A;  1BOC A;  3NHT A;  1QX2 A;  5DIC A;  2BCX A;  4ORC B;  1LS8 A;  4DRW A;  1NYA A;  2P6B B;  4TNC A;  2EC6 C;  1NPQ A;  3NHI A;  2WCE A;  1PSR A;  1P28 A;  2CCM A;  2KFH A;  4GAO A;  3BUN B;  2BBM A;  4YGB B;  2Y1M A;  2KBI A;  2JTT A;  2CBL A;  2H8V A;  1QV1 A;  1CDL A;  2E30 A;  1MQ1 A;  2FCE A;  3L4L A;  3PJI A;  3R1V A;  3WHT B;  3GK1 A;  1LA0 A;  2KOT A;  3TZ1 A;  1LVC D;  4UPG A;  1DT7 B;  1E8A A;  1TUZ A;  1OOF A;  4XJK B;  2WCK A;  3WHU B;  1RFJ A;  2LLU A;  1PVA A;  4CFR A;  5CSN A;  2LLS A;  1CMF A;  1CLL A;  2K7O A;  1KSM A;  3IQO A;  5CSJ A;  2K0J A;  1GJY A;  1XFR A;  1S5G Y;  1OZS A;  2LUX A;  4XJK A;  1JSA A;  1UHH A;  1FBV A;  1U5I B;  1F70 A;  1XFX O;  1DEL A;  1NIW A;  4FTG A;  2JC2 A;  3EVU A;  4WQ2 A;  2BCB A;  1SW8 A;  2M7N A;  2LLT A;  1XK4 A;  4XYN A;  1AVS A;  3EVR A;  1F71 A;  2K8M B;  1S26 D;  2PMY A;  1YUU A;  4NDB A;  1YUR A;  4GFT A;  3QME A;  1F54 A;  4PDZ A;  2QPT A;  1U5I A;  1J1D A;  2HQ8 A;  5ER5 A;  1CM4 A;  1PAL A;  4DS7 A;  2MRD A;  3RLZ A;  2ZNE A;  1RRO A;  1RWY A;  3K1E A;  1SKT A;  1CFF A;  1KFX L;  1XK4 C;  4HSZ A;  2LHI A;  4MZL A;  4OZD A;  3EK4 A;  1B8C A;  1NSH A;  1GM0 A;  1S6C A;  1V1G A;  1IWQ A;  2I2R E;  2M0R A;  2F8P A;  3R1P A;  1OW4 A;  3SG4 A;  3UO9 A;  1QWV A;  1A03 A;  1KFU S;  1YX8 A;  3I5I B;  3JTD C;  1D1O A;  1X02 A;  5G08 A;  2AMI A;  1K9P A;  2AAO A;  1NWD A;  2LAN A;  3BFA A;  2FJY A;  2Y1N A;  1LXF C;  3S0A A;  1DF0 A;  3PAT A;  3EKJ A;  1RTP 1;  1J7P A;  1OOH A;  2JQ6 A;  3VRN A;  3ZNI A;  1K94 A;  4PHM A;  4L9M A;  1ZOT B;  2MAZ A;  3AAK A;  2OS8 B;  5D3O A;  1R6P A;  4QJ3 B;  2MLE C;  1L7Z A;  4IL1 A;  2OTG B;  1KK7 Y;  4FQT A;  1HQV A;  5FYX A;  2ISD A;  5DKQ A;  3FWC A;  4KYN A;  1KK8 B;  2Y4Q A;  1B4C A;  1DGV A;  2JPT A;  1J7O A;  5KTY A;  1QIW A;  2M8U A;  4OKH A;  1MXE A;  1OOI X;  1LIN A;  3LL8 B;  2HPS A;  2QEB A;  3S0B A;  2JT0 A;  1BG1 A;  1OSA A;  1K93 D;  4MN0 A;  4A4C A;  3D78 A;  2LMT A;  1A29 A;  5CPV A;  1WRK A;  3CYZ A;  3SIA A;  1W7I B;  2WC6 A;  2LVI A;  3FE6 A;  1SL9 A;  1ZMZ A;  2TN4 A;  5AXI A;  2CTN A;  1IGV A;  3LK0 A;  3BUW B;  3NXA A;  4N1F A;  2LNK A;  2OS8 C;  2WCF A;  1FI6 A;  1IQ5 A;  4QJ5 B;  1ZFS A;  1QIV A;  2OTG C;  5GQQ C;  1FF1 A;  1IKU A;  3DD4 A;  3AKA A;  5B8I B;  1BLQ A;  5HKY A;  3O78 A;  1K9U A;  4ZCU A;  2BKH B;  2F2P A;  1B7T Z;  1XYD A;  3O2P A;  3C1V A;  5FI2 A;  2PYQ A;  3K21 A;  1CM1 A;  3EK8 A;  3F45 A;  1WDC B;  3PSR A;  2WC5 A;  1GGZ A;  2BL0 B;  4YGA A;  4BY5 A;  4CFQ A;  3BJH A;  5CSF A;  4MVF A;  1XFW O;  1BOD A;  3I5F B;  1XVJ A;  1QV0 A;  2KGB C;  1C3Z A;  1Y0V H;  3EVV A;  2M1K B;  4MEW A;  2KYC A;  1FPW A;  4PHJ A;  3A8R A;  3BQ3 A;  3DY9 A;  2KSP A;  2ZN8 A;  3I5G B;  2LP2 A;  3VRR A;  1OQP A;  1YRT B;  2LHL A;  1WRZ A;  4PE4 A;  1UWO A;  4WRI A;  1V1F A;  1TNP A;  3TDI A;  5FI6 A;  1S3P A;  4Q04 A;  2FCD A;  4ETO A;  1KQV A;  1HT9 A;  3PN7 B;  4YI9 A;  3IVT A;  2MA2 A;  3KO0 A;  2KDH A;  1NCY A;  2L50 A;  4YRU A;  1TNW A;  2QDI A;  2MBX A;  3CS1 A;  1BR1 B;  1YUS A;  4P5O E;  3B86 A;  4N1G A;  1UUS A;  2IS9 A;  5HL1 A;  1IJ6 A;  1TWO A;  4PHN A;  1DEK A;  2WCJ A;  3I5F C;  3EK7 A;  3L4A A;  1UHI A;  2LP3 A;  3DF0 B;  4GNK B;  3D74 A;  1DGU A;  3PAL A;  2E6W A;  3BUX B;  1AUI B;  3GOF A;  1OZO A;  2CT9 A;  1OOG A;  1EH2 A;  1OMV A;  1QTX A;  2L2E A;  2G2B A;  2K7C A;  1A4P A;  1EL4 A;  2A4J A;  1B9A A;  1M46 A;  2QEV A;  4MZJ A;  1TCO B;  1IIO A;  4A4B A;  2LVK A;  1CKK A;  1F4Q A;  1ODB A;  1TOP A;  3DZT A;  1JBA A;  2GGM A;  4P2Y B;  5AAN A;  1JWD A;  1SL7 A;  4GBA A;  1A75 B;  3ICB A;  1C07 A;  2KQ6 A;  3GK4 X;  4GUK A;  1UHJ A;  4NDC A;  1WRL A;  1WLM A;  5IBW A;  1AP4 A;  2MLF C;  3R72 A;  3ZWH A;  4F7F A;  3B88 A;  4MBE A;  4C0K A;  2LUC A;  1REC A;  4PHK A;  4U8D A;  1JF0 A;  4I5K A;  1K8U A;  2F3Y A;  2JXC A;  3M0W A;  1C3Y A;  1WLZ A;  1DJW A;  4HRE E;  1CFD A;  1TN4 A;  3GK2 A;  2NLN A;  3D77 A;  1CDN A;  2MHH A;  5K89 A;  4DUQ A;  1AK8 A;  3BXK A;  5ER4 X;  2KAV A;  2KI6 D;  2F3Z A;  3CZ2 A;  1QX5 B;  1Y1X A;  3CZ0 A;  3S0D A;  1BJF A;  1Y1A A;  1YX7 A;  3I5H B;  5I2L A;  1UHK A;  2ERB A;  2WCM A;  1Y6W A;  1S5G Z;  1YRU B;  2KAX A;  3LCP C;  2BBN A;  3TDZ A;  3CLN A;  1IH0 A;  1ZUZ A;  1CDP A;  2PQL A;  2GTE A;  2VRG A;  1M63 B;  3CGA A;  3HX4 A;  2WC8 A;  3RM1 A;  1RJV A;  2WND A;  3SIB A;  1GGW A;  2O5G A;  3Q8I A;  2SCP A;  4MLW A;  4OR9 B;  5F6T A;  3TUY B;  1H8B A;  1SCM B;  5AER A;  3LK1 A;  1TTX A;  1R2U A;  2LVJ A;  3CR4 X;  3FS7 A;  3DYE A;  3B87 A;  3CZ1 A;  1DJZ A;  3D75 A;  3H4S E;  5EL2 A;  1MUX A;  1SCV A;  3TDU A;  1M31 A;  1QXP A;  3SG7 A;  1TIZ A;  4PCW A;  5AEQ A;  1PRW A;  3FE9 A;  5HYD A;  1LKJ A;  3KEV A;  3DVJ A;  3VRP A;  1CFP A;  3NSK A;  2Q4U A;  1OOJ A;  3I5H C;  2JRF A;  3DVE A;  2L0P A;  1GQM A;  1W9Z A;  3N7H A;  1QJT A;  3PM2 A;  3I5I C;  1SNL A;  2KFG A;  1IJ5 A;  1SR6 B;  4YGD B;  4I5J A;  1AJ5 A;  5DKR A;  2K60 A;  1DVI A;  2WCH A;  3KPX A; 
#chains in the Genus database with same CATH homology
 1DEK A;  1Z2C B;  4MEW A;  2BAP A;  5D3O A;  3SS4 A;  4I5K A;  3SS5 A;  2K60 A;  4KYN A;  3SS3 A;  2BNX A;  4GAO A;  4I5L B;  4IJ7 A;  5FI6 A;  3UO9 A;  3OBV A;  5FI7 A;  3KEV A;  1DEL A;  2KLE A;  4JKT A;  5FI2 A;  1DC1 A;  3IVT A;  3UNW A;  1W9Z A;  4I5N B;  2KLD A;  3EG5 B;  3PM2 A;  5I94 A;  2YGU A;  4GBA A;  1Z4H A;  4I5J A;  2L5Y A;  3O4X A;  5HL1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...