2YGUA

Crystal structure of fire ant venom allergen, sol i 2
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
117
structure length
117
Chain Sequence
DNKELKIIRKDVAECLRTLPKCGNQPDDPLARVDVWHCAMAKRGVYDNPDPAVIKERSMKMCTKIITDPANVENCKKVASRCVDRETQGPKSNRQKAVNIIGCALRAGVAETTVLAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VENOM ALLERGEN 2
publication title Crystal Structure of Sol I 2, a Major Allergen from Fire Ant Venom
pubmed doi rcsb
source organism Solenopsis invicta
molecule tags Allergen
total genus 42
structure length 117
sequence length 117
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-04-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.190 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Recoverin; domain 1 2yguA00
2YGUA
chains in the Genus database with same CATH superfamily
1IJ6A 1DELA 1ZACA 2FJUB 3EK4A 3NSOA 1L2OB 2KYCA 2JT8A 3S0BA 1RROA 2JXCA 1DJGA 3AAJA 2JZIA 3SJSA 3PM2A 4WQ3A 3CR5X 3CTNA 4ORCB 1DT7B 2KQYA 1RK9A 4I5JA 2MA2A 1SY9A 4HRGA 5I8NA 3AKBA 1M63B 1Y6WA 1OMDA 1J7QA 2K7BA 2F2PA 2JULA 1B8RA 2HF5A 3TDIA 1F54A 4QJ5B 1PVAA 1QWVA 1YUUA 1SL8A 2IS9A 3L4LA 1C3ZA 1K95A 3B7AA 2WOSA 2CTNA 1UHNA 5HYDA 3S0FA 1XFRA 3SS3A 3TDUA 1B8CA 4OKHA 3IVTA 1GGZA 4XYNA 1WRLA 1SNLA 3VB1A 2MJWB 4GFTA 2JC2A 2BCBA 1OOIX 2D8NA 2EHBA 5GQQC 2ZRTA 3CDNA 1SL9A 1SSEB 3BOWB 4HSZA 2MLEC 1K96A 1NCYA 1JF0A 2KPHA 3SG6A 2QPTA 1B7TZ 2FJYA 1OOGA 2PRUA 3A4UB 4D1EA 1D1OA 1NYAA 2MBXA 1W7IB 1KFUL 1SW8A 2K0JA 4KYNA 1JWDA 1LA3A 2QACA 1OZSA 2KOTA 1KSMA 4OVNF 4FQOA 4M2QA 3H4SE 1S3PA 1CFFA 2KI6D 2WCJA 3F45A 1K9KA 1XK4A 3BFHA 2PYQA 3OB1B 1OQPA 5ER4X 1CKKA 3NHIA 3DF0B 2LLTA 1YX7A 4FTGA 1CDMA 2SASA 4PE0A 1X02A 1GQMA 1RTP1 3NSIA 3CZ0A 2L98A 1GJYA 4N5XA 5EL2A 1N0YA 3BUNB 3PALA 2KNEA 3BXKA 2K2AA 5AEQA 2JWWA 4CLNA 1KQMC 3TUYC 4GAOA 1CMGA 4C0KA 5HLVA 3SS5A 2EC6C 3HX4A 1N2DA 3D74A 1TRFA 3UNWA 3ZWHA 1HT9A 1MQ1A 5KSZA 4MZKA 4YRUA 1UUSA 4PHMA 1PVBA 4YGBB 3NGVA 3V2LA 1G4YR 1T14A 3SIBA 1OOJA 1ALVA 3R72A 4PE1A 1XFZO 1SK6D 1QLSA 1J1EA 1Z4HA 4AOMA 1LVCD 5JJGA 2I94A 4PHKA 3DYEA 4OZDA 2KLDA 3GK2A 1OMRA 3NHTA 3R1OA 1G8IA 4CFRA 5HKWA 2VRGA 4A4CA 5J3XA 5DKQA 2LVKA 1YVLA 1SMGA 1RJVA 2K7CA 1XFYO 1DJYA 5CSJA 2WCMA 2BE4A 5CSIA 3LL8B 5I2LA 1OOHA 1MWNA 2NZ0A 4C0JA 4GGFA 5HL1A 2E6WA 2LNKA 3GOFA 2PMYA 2LCPA 1QXPA 2P6BB 2K7DA 4YGCB 4DCKA 2F8PA 4OV2A 1NSHA 1NPQA 1M39A 5JOLA 2KAXA 3PATA 3M0WA 4ORBB 2L2CA 1UHIA 2M3WA 2LANA 3D0YB 1QIVA 3EKJA 1BODA 1J7PA 3OGNA 2ZN9A 4DRWA 1AHRA 3BFBA 1TOPA 3OX6A 4PALA 4JQ0D 3SG3A 1KFUS 2MRDA 1K2HA 1DVIA 3SG5A 2ZRSA 2MLFC 4USLA 1NCZA 1KQMB 2L5YA 3TUYB 5KU1A 2EC6B 3K1EA 2LLSA 5F6TA 2KI4C 1QV1A 1NWDA 5FYXA 2V53A 1XO5A 2ZKMX 1RECA 3CYZA 2LVJA 3EG5B 3S0EA 3S0GA 3I5GC 1B8LA 1SCMB 3KHEA 3VROA 3I5HC 1QLKA 2L2EA 1GM0A 1A4PA 1YRUB 1EJ3A 2LMTA 4AQJA 3PFVA 2I18A 2KFGA 3AAKA 1V1FA 1DC1A 2A4JA 2G2BA 1CFPA 2LMUA 1BU3A 4BY5A 2BECA 1HQVA 3PN7C 2JU0A 4P2YB 3OHMB 1XA5A 1QVIY 3KPXA 2JTTA 3SS4A 2L4IA 5D3OA 1TTXA 3QMEA 3WHUB 4GPLB 2LVVA 3EVVA 3SG4A 2K60A 3IQQA 3SIAA 1CLBA 1E8AA 1XFUO 2M7NA 1AJ4A 3GK1A 1B7TY 1S5GY 2JPTA 3JTDC 4C0LA 3ICBA 4MLWA 4IJ7A 4R1EA 3OB2B 3QRXA 1XFVO 2L4HA 2Y5IA 3CZ1A 2WCLA 2QEHA 2JPOA 3DVJA 4PHJA 5ER5A 1QVIZ 2COLB 3TZ1A 2QEBA 4AQIA 1BT6A 1FW4A 4N1GA 2CNPA 1DJWA 1UHJA 3VGOA 2KI4B 2H61A 1M31A 2LP2A 2K2FA 3PSRA 3IF7A 1BR1B 2KGRA 3I5GB 2K8MB 1S5GZ 1YUSA 5DKRA 1NP8A 1FPWA 1DJZA 2AMIA 2ZN8A 2O60A 3I5HB 1SRAA 3RZSA 3TS5C 3BUWB 2M7LA 4MEWA 2KI6C 1FF1A 2GGZA 1IG5A 2HPSA 1PK0D 4MZLA 4YI8A 2CBLA 2PVBA 1B47A 3BJHA 2WCBA 3B88A 1RWYA 2OTGC 1V1GA 2B1UA 1OOFA 2L0PA 2Y1MA 3PN7B 3DY9A 4HREE 1IH0A 1OMVA 1TNQA 1JFKA 1SKTA 2BL0C 1YTZC 4ZCVA 3PM8A 5IBWA 1Q80A 1S26D 2WCEA 1XYDA 1CM1A 1BOCA 2Q4UA 1XFXO 1DQEA 1F4OA 2KFFA 1CM4A 1A75A 1WRKA 2OPOA 3K21A 1BG1A 1XK4C 1GGWA 4A4BA 4OCIA 5KTYA 1CLLA 1VRKA 3AKAA 3BUXB 3EK8A 3JTDB 1TWOA 1WLZA 1IGVA 1CTRA 1U5IA 3LCPC 4DIRA 1AUIB 3TDZA 4NDCA 4ZCUA 5I2QA 5I94A 2ISDA 2ZNEA 2LLUA 2O5GA 3LK0A 1C7VA 2JRFA 2PSRA 1TN4A 2K7OA 1TNXA 3FWCA 2KAYA 1B9AA 1FI5A 5HKYA 1R6PA 4ORAB 4MN0A 1SCVA 3PJIA 1ZUZA 3NSKA 5AERA 1DJIA 1MF8B 2JTZA 3NXAA 1F8HA 1AP4A 1DF0A 1BR4B 3D73A 1PSBA 5CSNA 5HLOA 1CDNA 3D75A 1F55A 1DJHA 3O4YA 2I2RE 1LKJA 1N65A 3I5IC 3KF9A 3TS5B 1S6CA 5D7FA 1L7ZA 2AUCA 2LC5A 2KGBC 3S0AA 1JUOA 1YUTA 1QS7A 1WLMA 1ODBA 2HQ8A 2MAZA 2OTGB 2Y4QA 2M29A 3WHTB 1K94A 2GV5A 1YRTB 2KBIA 2LV7A 3KO0A 1Y1XA 1NX2A 4GGFC 1MXLC 2BL0B 1JSAA 2WC6A 2WCFA 1IWQA 1KWOC 3CS1A 2PASA 3BYAA 2SCPA 2H8VA 5FI6A 5TNCA 2KFHA 1TIZA 3DVMA 4TNCA 3BUMB 3LK1A 3LLEA 2F3YA 4JWQA 1WDCC 3MSEB 1FI6A 3UO9A 2JOJA 2JT3A 3DXLA 4HRHA 1IQ3A 2M0RA 4YI9A 5AXIA 4NQGA 3D76A 4E68A 1RFJA 1QTXA 5D69A 3O78A 4F0ZB 1SL7A 3JVTC 1K8UA 1DGVA 1A75B 1EL4A 1SBJA 2I7AA 3D10A 3OBVA 1B1GA 2LHIA 3EVUA 1ORGA 2JNFA 2HQWA 1DTLA 5DKNA 1KSOA 1CDPA 4QJ4B 1M46A 4P5OE 1IRJA 1ZOTB 2BAPA 4PE4A 1C7WA 1NX0A 4FQTA 1ZFSA 2G9BA 1NCXA 1ZMZA 1G33A 3DF0A 2WCHA 1MHOA 3B87A 1IIOA 1J7RA 2H2KA 3I5IB 2TN4A 3DD4A 2F2OA 2JT0A 1YR5A 2ERBA 1IKUA 3DVKA 1XFWO 1H4BA 1A03A 1DGUA 2NLNA 2Q91A 3N7HA 2KQ6A 3A8RA 1F70A 2BBMA 2LM5A 2OS8C 5G08A 4QJ3B 1SYMA 1KWOB 4L9MA 3BFAA 1K93D 1QASA 3VRPA 1UURA 2CCMA 5FI7A 4XJKA 4MVFA 4OR9B 1OZOA 1WDCB 3HCMA 3I5FC 3FE9A 4UPGA 2CXJA 1QX2A 1UHKA 4M2PA 1K90D 1EH2A 3GK4X 1TCFA 2RGIA 1S6IA 4YBHB 2KYFA 5I2OA 2WNDA 5AFPA 1J55A 2LUXA 4NDDA 4YGEB 2P70A 3O4XA 4F7FA 1S36A 5K89A 3EK7A 4WQ2A 2MHHA 2FCEA 3CR4X 3JVTB 1KFXL 1EXRA 1CB1A 1A29A 2H61C 4I5NB 4MRYA 4YGAA 1CDLA 2HETA 2BCAA 2NXQA 1OW4A 1EG3A 1KCYA 4PDZA 1S1EA 3C1VA 3CWGA 3FIAA 1PALA 2ZFDA 1JBAA 1KK7Y 1WY9A 4PCWA 2GGMA 2KLEA 3CGAA 4PE7A 2GTEA 2AAOA 1TNPA 4MSPA 5BPJA 2BCXA 1SR6C 2Y1NA 2ZNDA 3B86A 3D0YA 3VRNA 1C3YA 1R2UA 2M97A 4ETOA 1TNWA 3D78A 3R1VA 5CPVA 1YX8A 3KEVA 1A2XA 3FE8A 2LE9B 2F3ZA 1NX3A 3VRQA 2LHLA 3SG2A 1JF2A 3D77A 1F4QA 5PALA 2M1KB 2KDHA 1Y1AA 2L50A 3DZTA 1QV0A 3RM1A 3NSLA 1OE9B 2EGDA 2OS8B 1QX7A 1K9PA 2KHNA 1KK7Z 2WORA 3B6XA 3CZTX 4U8DA 3BQ3A 1AVSA 3S0DA 3L4AA 1ALWA 1QX5B 1CFDA 1C07A 1BMOA 1LXFC 3IQOA 1EG4A 2BNXA 3O6BA 1P28A 2M9GA 1B4CA 2K61A 1LINA 1BLQA 3CZ2A 3I5FB 2JQ6A 2LUCA 1PSRA 1W7JB 2KSPA 2YGUA 2KAVA 2QDIA 2NCPA 1LA0A 3WXAA 4DS7A 1IQ5A 2LVIA 1Z2CB 2M49B 2DOQA 4I5LB 1QIWA 3CABA 3SG7A 1SCMC 3L47A 4XJKB 5CSFA 2BE6A 2LMVA 3E3RA 3Q8IA 4CPVA 1JFJA 1LS8A 4I5KA 2FCDA 3EVRA 1KK8C 2WC5A 1NUBA 1S6JA 2WC8A 1DMOA 2LP3A 1IJ5A 5FI2A 1NIWA 1MR8A 1W9ZA 2P71A 1MUXA 4WRIA 1SPYA 1UHHA 2FOTA 2L51A 2M8UA 3CR2A 1KQVA 1L2OC 1UP5A 4CIDA 1QJTA 3PLFB 1OSAA 4MRXA 1SR6B 3ZNIA 3BUOB 1KFXS 1TUZA 2LAPA 1DEKA 1QATA 2CT9A 2PQLA 2JXLA 3EKHA 3OP0A 1PULA 1CFCA 1JC2A 1AJ5A 1WRZA 4PHNA 1M45A 2E30A 4Q04A 4GGNA 3RLZA 1F71A 4N1FA 1FBVA 4JKTA 5B8IB 1J7OA 2BKIB 2L5XB 3WNXB 4PT1A 4CFQA 4BY4A 1CLMA 4INXA 2F33A 5HKZA 3FS7A 1J1DA 3BOWA 1TCOB 1CNPA 3VRRA 4IL1A 3O2PA 2PALA 1CMFA 2KBMA 1YURA 2NCOA 4GNKB 4DUQA 1YVHA 1AK8A 2JNXA 1NX1A 1TUJA 3CLNA 4INWA 2QEOA 4GUKA 5DICA 2M1UA 1U5IB 1H8BA 2QEVA 4GBAA 4JPZB 1BJFA 3DVEA 3FWBA 3FE6A 3OX5A 2R2IA 1DJXA 4JD9A 2WCKA 1XVJA 3R1PA 4M2OA 4ICBA 4YGDB 2BKHB 4MBEA 1Y0VH 1KK8B 5AANA 1K9UA 2BBNA 1Y1UA 1PRWA 4MZJA 1MXEA 1UWOA 1DF0B 4NDBA 1BF5A
chains in the Genus database with same CATH topology
1DELA 3IVTA 2BNXA 3PM2A 5FI6A 5FI7A 2KLEA 2L5YA 2BAPA 2YGUA 3SS4A 5D3OA 1DEKA 4GAOA 4I5JA 3UO9A 3SS5A 4GBAA 5HL1A 3UNWA 2K60A 3EG5B 1Z2CB 3KEVA 4I5LB 3O4XA 4JKTA 4KYNA 4IJ7A 4MEWA 1Z4HA 4I5KA 2KLDA 3OBVA 4I5NB 3SS3A 5I94A 5FI2A 1W9ZA 1DC1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YGU A; 
#chains in the Genus database with same CATH topology
 1IJ6 A;  1DEL A;  1ZAC A;  2FJU B;  3EK4 A;  3NSO A;  1L2O B;  2KYC A;  2JT8 A;  3S0B A;  1RRO A;  2JXC A;  1DJG A;  3AAJ A;  2JZI A;  3SJS A;  3PM2 A;  4WQ3 A;  3CR5 X;  3CTN A;  4ORC B;  1DT7 B;  2KQY A;  1RK9 A;  4I5J A;  2MA2 A;  1SY9 A;  4HRG A;  5I8N A;  3AKB A;  1M63 B;  1Y6W A;  1OMD A;  1J7Q A;  2K7B A;  2F2P A;  2JUL A;  1B8R A;  2HF5 A;  3TDI A;  1F54 A;  4QJ5 B;  1PVA A;  1QWV A;  1YUU A;  1SL8 A;  2IS9 A;  3L4L A;  1C3Z A;  1K95 A;  3B7A A;  2WOS A;  2CTN A;  1UHN A;  5HYD A;  3S0F A;  1XFR A;  3SS3 A;  3TDU A;  1B8C A;  4OKH A;  3IVT A;  1GGZ A;  4XYN A;  1WRL A;  1SNL A;  3VB1 A;  2MJW B;  4GFT A;  2JC2 A;  2BCB A;  1OOI X;  2D8N A;  2EHB A;  5GQQ C;  2ZRT A;  3CDN A;  1SL9 A;  1SSE B;  3BOW B;  4HSZ A;  2MLE C;  1K96 A;  1NCY A;  1JF0 A;  2KPH A;  3SG6 A;  2QPT A;  1B7T Z;  2FJY A;  1OOG A;  2PRU A;  3A4U B;  4D1E A;  1D1O A;  1NYA A;  2MBX A;  1W7I B;  1KFU L;  1SW8 A;  2K0J A;  4KYN A;  1JWD A;  1LA3 A;  2QAC A;  1OZS A;  2KOT A;  1KSM A;  4OVN F;  4FQO A;  4M2Q A;  3H4S E;  1S3P A;  1CFF A;  2KI6 D;  2WCJ A;  3F45 A;  1K9K A;  1XK4 A;  3BFH A;  2PYQ A;  3OB1 B;  1OQP A;  5ER4 X;  1CKK A;  3NHI A;  3DF0 B;  2LLT A;  1YX7 A;  4FTG A;  1CDM A;  2SAS A;  4PE0 A;  1X02 A;  1GQM A;  1RTP 1;  3NSI A;  3CZ0 A;  2L98 A;  1GJY A;  4N5X A;  5EL2 A;  1N0Y A;  3BUN B;  3PAL A;  2KNE A;  3BXK A;  2K2A A;  5AEQ A;  2JWW A;  4CLN A;  1KQM C;  3TUY C;  4GAO A;  1CMG A;  4C0K A;  5HLV A;  3SS5 A;  2EC6 C;  3HX4 A;  1N2D A;  3D74 A;  1TRF A;  3UNW A;  3ZWH A;  1HT9 A;  1MQ1 A;  5KSZ A;  4MZK A;  4YRU A;  1UUS A;  4PHM A;  1PVB A;  4YGB B;  3NGV A;  3V2L A;  1G4Y R;  1T14 A;  3SIB A;  1OOJ A;  1ALV A;  3R72 A;  4PE1 A;  1XFZ O;  1SK6 D;  1QLS A;  1J1E A;  1Z4H A;  4AOM A;  1LVC D;  5JJG A;  2I94 A;  4PHK A;  3DYE A;  4OZD A;  2KLD A;  3GK2 A;  1OMR A;  3NHT A;  3R1O A;  1G8I A;  4CFR A;  5HKW A;  2VRG A;  4A4C A;  5J3X A;  5DKQ A;  2LVK A;  1YVL A;  1SMG A;  1RJV A;  2K7C A;  1XFY O;  1DJY A;  5CSJ A;  2WCM A;  2BE4 A;  5CSI A;  3LL8 B;  5I2L A;  1OOH A;  1MWN A;  2NZ0 A;  4C0J A;  4GGF A;  5HL1 A;  2E6W A;  2LNK A;  3GOF A;  2PMY A;  2LCP A;  1QXP A;  2P6B B;  2K7D A;  4YGC B;  4DCK A;  2F8P A;  4OV2 A;  1NSH A;  1NPQ A;  1M39 A;  5JOL A;  2KAX A;  3PAT A;  3M0W A;  4ORB B;  2L2C A;  1UHI A;  2M3W A;  2LAN A;  3D0Y B;  1QIV A;  3EKJ A;  1BOD A;  1J7P A;  3OGN A;  2ZN9 A;  4DRW A;  1AHR A;  3BFB A;  1TOP A;  3OX6 A;  4PAL A;  4JQ0 D;  3SG3 A;  1KFU S;  2MRD A;  1K2H A;  1DVI A;  3SG5 A;  2ZRS A;  2MLF C;  4USL A;  1NCZ A;  1KQM B;  2L5Y A;  3TUY B;  5KU1 A;  2EC6 B;  3K1E A;  2LLS A;  5F6T A;  2KI4 C;  1QV1 A;  1NWD A;  5FYX A;  2V53 A;  1XO5 A;  2ZKM X;  1REC A;  3CYZ A;  2LVJ A;  3EG5 B;  3S0E A;  3S0G A;  3I5G C;  1B8L A;  1SCM B;  3KHE A;  3VRO A;  3I5H C;  1QLK A;  2L2E A;  1GM0 A;  1A4P A;  1YRU B;  1EJ3 A;  2LMT A;  4AQJ A;  3PFV A;  2I18 A;  2KFG A;  3AAK A;  1V1F A;  1DC1 A;  2A4J A;  2G2B A;  1CFP A;  2LMU A;  1BU3 A;  4BY5 A;  2BEC A;  1HQV A;  3PN7 C;  2JU0 A;  4P2Y B;  3OHM B;  1XA5 A;  1QVI Y;  3KPX A;  2JTT A;  3SS4 A;  2L4I A;  5D3O A;  1TTX A;  3QME A;  3WHU B;  4GPL B;  2LVV A;  3EVV A;  3SG4 A;  2K60 A;  3IQQ A;  3SIA A;  1CLB A;  1E8A A;  1XFU O;  2M7N A;  1AJ4 A;  3GK1 A;  1B7T Y;  1S5G Y;  2JPT A;  3JTD C;  4C0L A;  3ICB A;  4MLW A;  4IJ7 A;  4R1E A;  3OB2 B;  3QRX A;  1XFV O;  2L4H A;  2Y5I A;  3CZ1 A;  2WCL A;  2QEH A;  2JPO A;  3DVJ A;  4PHJ A;  5ER5 A;  1QVI Z;  2COL B;  3TZ1 A;  2QEB A;  4AQI A;  1BT6 A;  1FW4 A;  4N1G A;  2CNP A;  1DJW A;  1UHJ A;  3VGO A;  2KI4 B;  2H61 A;  1M31 A;  2LP2 A;  2K2F A;  3PSR A;  3IF7 A;  1BR1 B;  2KGR A;  3I5G B;  2K8M B;  1S5G Z;  1YUS A;  5DKR A;  1NP8 A;  1FPW A;  1DJZ A;  2AMI A;  2ZN8 A;  2O60 A;  3I5H B;  1SRA A;  3RZS A;  3TS5 C;  3BUW B;  2M7L A;  4MEW A;  2KI6 C;  1FF1 A;  2GGZ A;  1IG5 A;  2HPS A;  1PK0 D;  4MZL A;  4YI8 A;  2CBL A;  2PVB A;  1B47 A;  3BJH A;  2WCB A;  3B88 A;  1RWY A;  2OTG C;  1V1G A;  2B1U A;  1OOF A;  2L0P A;  2Y1M A;  3PN7 B;  3DY9 A;  4HRE E;  1IH0 A;  1OMV A;  1TNQ A;  1JFK A;  1SKT A;  2BL0 C;  1YTZ C;  4ZCV A;  3PM8 A;  5IBW A;  1Q80 A;  1S26 D;  2WCE A;  1XYD A;  1CM1 A;  1BOC A;  2Q4U A;  1XFX O;  1DQE A;  1F4O A;  2KFF A;  1CM4 A;  1A75 A;  1WRK A;  2OPO A;  3K21 A;  1BG1 A;  1XK4 C;  1GGW A;  4A4B A;  4OCI A;  5KTY A;  1CLL A;  1VRK A;  3AKA A;  3BUX B;  3EK8 A;  3JTD B;  1TWO A;  1WLZ A;  1IGV A;  1CTR A;  1U5I A;  3LCP C;  4DIR A;  1AUI B;  3TDZ A;  4NDC A;  4ZCU A;  5I2Q A;  5I94 A;  2ISD A;  2ZNE A;  2LLU A;  2O5G A;  3LK0 A;  1C7V A;  2JRF A;  2PSR A;  1TN4 A;  2K7O A;  1TNX A;  3FWC A;  2KAY A;  1B9A A;  1FI5 A;  5HKY A;  1R6P A;  4ORA B;  4MN0 A;  1SCV A;  3PJI A;  1ZUZ A;  3NSK A;  5AER A;  1DJI A;  1MF8 B;  2JTZ A;  3NXA A;  1F8H A;  1AP4 A;  1DF0 A;  1BR4 B;  3D73 A;  1PSB A;  5CSN A;  5HLO A;  1CDN A;  3D75 A;  1F55 A;  1DJH A;  3O4Y A;  2I2R E;  1LKJ A;  1N65 A;  3I5I C;  3KF9 A;  3TS5 B;  1S6C A;  5D7F A;  1L7Z A;  2AUC A;  2LC5 A;  2KGB C;  3S0A A;  1JUO A;  1YUT A;  1QS7 A;  1WLM A;  1ODB A;  2HQ8 A;  2MAZ A;  2OTG B;  2Y4Q A;  2M29 A;  3WHT B;  1K94 A;  2GV5 A;  1YRT B;  2KBI A;  2LV7 A;  3KO0 A;  1Y1X A;  1NX2 A;  4GGF C;  1MXL C;  2BL0 B;  1JSA A;  2WC6 A;  2WCF A;  1IWQ A;  1KWO C;  3CS1 A;  2PAS A;  3BYA A;  2SCP A;  2H8V A;  5FI6 A;  5TNC A;  2KFH A;  1TIZ A;  3DVM A;  4TNC A;  3BUM B;  3LK1 A;  3LLE A;  2F3Y A;  4JWQ A;  1WDC C;  3MSE B;  1FI6 A;  3UO9 A;  2JOJ A;  2JT3 A;  3DXL A;  4HRH A;  1IQ3 A;  2M0R A;  4YI9 A;  5AXI A;  4NQG A;  3D76 A;  4E68 A;  1RFJ A;  1QTX A;  5D69 A;  3O78 A;  4F0Z B;  1SL7 A;  3JVT C;  1K8U A;  1DGV A;  1A75 B;  1EL4 A;  1SBJ A;  2I7A A;  3D10 A;  3OBV A;  1B1G A;  2LHI A;  3EVU A;  1ORG A;  2JNF A;  2HQW A;  1DTL A;  5DKN A;  1KSO A;  1CDP A;  4QJ4 B;  1M46 A;  4P5O E;  1IRJ A;  1ZOT B;  2BAP A;  4PE4 A;  1C7W A;  1NX0 A;  4FQT A;  1ZFS A;  2G9B A;  1NCX A;  1ZMZ A;  1G33 A;  3DF0 A;  2WCH A;  1MHO A;  3B87 A;  1IIO A;  1J7R A;  2H2K A;  3I5I B;  2TN4 A;  3DD4 A;  2F2O A;  2JT0 A;  1YR5 A;  2ERB A;  1IKU A;  3DVK A;  1XFW O;  1H4B A;  1A03 A;  1DGU A;  2NLN A;  2Q91 A;  3N7H A;  2KQ6 A;  3A8R A;  1F70 A;  2BBM A;  2LM5 A;  2OS8 C;  5G08 A;  4QJ3 B;  1SYM A;  1KWO B;  4L9M A;  3BFA A;  1K93 D;  1QAS A;  3VRP A;  1UUR A;  2CCM A;  5FI7 A;  4XJK A;  4MVF A;  4OR9 B;  1OZO A;  1WDC B;  3HCM A;  3I5F C;  3FE9 A;  4UPG A;  2CXJ A;  1QX2 A;  1UHK A;  4M2P A;  1K90 D;  1EH2 A;  3GK4 X;  1TCF A;  2RGI A;  1S6I A;  4YBH B;  2KYF A;  5I2O A;  2WND A;  5AFP A;  1J55 A;  2LUX A;  4NDD A;  4YGE B;  2P70 A;  3O4X A;  4F7F A;  1S36 A;  5K89 A;  3EK7 A;  4WQ2 A;  2MHH A;  2FCE A;  3CR4 X;  3JVT B;  1KFX L;  1EXR A;  1CB1 A;  1A29 A;  2H61 C;  4I5N B;  4MRY A;  4YGA A;  1CDL A;  2HET A;  2BCA A;  2NXQ A;  1OW4 A;  1EG3 A;  1KCY A;  4PDZ A;  1S1E A;  3C1V A;  3CWG A;  3FIA A;  1PAL A;  2ZFD A;  1JBA A;  1KK7 Y;  1WY9 A;  4PCW A;  2GGM A;  2KLE A;  3CGA A;  4PE7 A;  2GTE A;  2AAO A;  1TNP A;  4MSP A;  5BPJ A;  2BCX A;  1SR6 C;  2Y1N A;  2ZND A;  3B86 A;  3D0Y A;  3VRN A;  1C3Y A;  1R2U A;  2M97 A;  4ETO A;  1TNW A;  3D78 A;  3R1V A;  5CPV A;  1YX8 A;  3KEV A;  1A2X A;  3FE8 A;  2LE9 B;  2F3Z A;  1NX3 A;  3VRQ A;  2LHL A;  3SG2 A;  1JF2 A;  3D77 A;  1F4Q A;  5PAL A;  2M1K B;  2KDH A;  1Y1A A;  2L50 A;  3DZT A;  1QV0 A;  3RM1 A;  3NSL A;  1OE9 B;  2EGD A;  2OS8 B;  1QX7 A;  1K9P A;  2KHN A;  1KK7 Z;  2WOR A;  3B6X A;  3CZT X;  4U8D A;  3BQ3 A;  1AVS A;  3S0D A;  3L4A A;  1ALW A;  1QX5 B;  1CFD A;  1C07 A;  1BMO A;  1LXF C;  3IQO A;  1EG4 A;  2BNX A;  3O6B A;  1P28 A;  2M9G A;  1B4C A;  2K61 A;  1LIN A;  1BLQ A;  3CZ2 A;  3I5F B;  2JQ6 A;  2LUC A;  1PSR A;  1W7J B;  2KSP A;  2YGU A;  2KAV A;  2QDI A;  2NCP A;  1LA0 A;  3WXA A;  4DS7 A;  1IQ5 A;  2LVI A;  1Z2C B;  2M49 B;  2DOQ A;  4I5L B;  1QIW A;  3CAB A;  3SG7 A;  1SCM C;  3L47 A;  4XJK B;  5CSF A;  2BE6 A;  2LMV A;  3E3R A;  3Q8I A;  4CPV A;  1JFJ A;  1LS8 A;  4I5K A;  2FCD A;  3EVR A;  1KK8 C;  2WC5 A;  1NUB A;  1S6J A;  2WC8 A;  1DMO A;  2LP3 A;  1IJ5 A;  5FI2 A;  1NIW A;  1MR8 A;  1W9Z A;  2P71 A;  1MUX A;  4WRI A;  1SPY A;  1UHH A;  2FOT A;  2L51 A;  2M8U A;  3CR2 A;  1KQV A;  1L2O C;  1UP5 A;  4CID A;  1QJT A;  3PLF B;  1OSA A;  4MRX A;  1SR6 B;  3ZNI A;  3BUO B;  1KFX S;  1TUZ A;  2LAP A;  1DEK A;  1QAT A;  2CT9 A;  2PQL A;  2JXL A;  3EKH A;  3OP0 A;  1PUL A;  1CFC A;  1JC2 A;  1AJ5 A;  1WRZ A;  4PHN A;  1M45 A;  2E30 A;  4Q04 A;  4GGN A;  3RLZ A;  1F71 A;  4N1F A;  1FBV A;  4JKT A;  5B8I B;  1J7O A;  2BKI B;  2L5X B;  3WNX B;  4PT1 A;  4CFQ A;  4BY4 A;  1CLM A;  4INX A;  2F33 A;  5HKZ A;  3FS7 A;  1J1D A;  3BOW A;  1TCO B;  1CNP A;  3VRR A;  4IL1 A;  3O2P A;  2PAL A;  1CMF A;  2KBM A;  1YUR A;  2NCO A;  4GNK B;  4DUQ A;  1YVH A;  1AK8 A;  2JNX A;  1NX1 A;  1TUJ A;  3CLN A;  4INW A;  2QEO A;  4GUK A;  5DIC A;  2M1U A;  1U5I B;  1H8B A;  2QEV A;  4GBA A;  4JPZ B;  1BJF A;  3DVE A;  3FWB A;  3FE6 A;  3OX5 A;  2R2I A;  1DJX A;  4JD9 A;  2WCK A;  1XVJ A;  3R1P A;  4M2O A;  4ICB A;  4YGD B;  2BKH B;  4MBE A;  1Y0V H;  1KK8 B;  5AAN A;  1K9U A;  2BBN A;  1Y1U A;  1PRW A;  4MZJ A;  1MXE A;  1UWO A;  1DF0 B;  4NDB A;  1BF5 A; 
#chains in the Genus database with same CATH homology
 1DEL A;  3IVT A;  2BNX A;  3PM2 A;  5FI6 A;  5FI7 A;  2KLE A;  2L5Y A;  2BAP A;  2YGU A;  3SS4 A;  5D3O A;  1DEK A;  4GAO A;  4I5J A;  3UO9 A;  3SS5 A;  4GBA A;  5HL1 A;  3UNW A;  2K60 A;  3EG5 B;  1Z2C B;  3KEV A;  4I5L B;  3O4X A;  4JKT A;  4KYN A;  4IJ7 A;  4MEW A;  1Z4H A;  4I5K A;  2KLD A;  3OBV A;  4I5N B;  3SS3 A;  5I94 A;  5FI2 A;  1W9Z A;  1DC1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...