2YGUA

Crystal structure of fire ant venom allergen, sol i 2
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
117
structure length
117
Chain Sequence
DNKELKIIRKDVAECLRTLPKCGNQPDDPLARVDVWHCAMAKRGVYDNPDPAVIKERSMKMCTKIITDPANVENCKKVASRCVDRETQGPKSNRQKAVNIIGCALRAGVAETTVLAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Allergen
molecule keywords VENOM ALLERGEN 2
publication title Crystal Structure of Sol I 2, a Major Allergen from Fire Ant Venom
pubmed doi rcsb
source organism Solenopsis invicta
total genus 42
structure length 117
sequence length 117
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-04-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.190 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Recoverin; domain 1 2yguA00
2YGUA
chains in the Genus database with same CATH superfamily
1SPYA 1DJHA 2M1UA 1RFJA 2F33A 3SG3A 1MXLC 1OOHA 2BCAA 5F6TA 1BF5A 5GQQC 1NX1A 3CS1A 1AJ5A 2WC8A 1YUTA 2SASA 1JFJA 1QWVA 1XA5A 4FQOA 4GGFA 1UHNA 3FWCA 1CLLA 2R2IA 2P6BB 2JZIA 1K9PA 2F8PA 4C0JA 5FYXA 2Y1NA 1BU3A 3I5IC 1WDCB 3VB1A 1FF1A 1X02A 3DF0B 3B6XA 2LMVA 2GGZA 2KGBC 1OW4A 3WHUB 1AUIB 3L47A 1DTLA 3D74A 3TUYB 2HQWA 2WCJA 4CPVA 4CFRA 1IQ5A 2KI6C 1QATA 1ALVA 1TOPA 2KFGA 1F70A 1YVHA 1K93D 1CB1A 4MRXA 2LMTA 3L4LA 4XJKA 1KQMB 3A4UB 2K2FA 4INWA 4N1FA 1RROA 1FBVA 1QLSA 2LHLA 2MAZA 2K7DA 1B7TY 2CTNA 4PHNA 2A4JA 2WORA 3R72A 1QS7A 1SKTA 1YUSA 1CM1A 1SCVA 1KK8B 4JKTA 4YGBB 4QJ5B 1M39A 1TRFA 3PSRA 1UHKA 1OSAA 3RZSA 1C3ZA 1DF0A 3M0WA 3O2PA 1KK7Y 2GTEA 4P2YB 2JULA 1B7TZ 5D3OA 1SL7A 1YX7A 1ZUZA 2M29A 4I5LB 2M7LA 1F55A 1UURA 5FI7A 2BECA 3BFBA 1B1GA 1YX8A 5DICA 1XFYO 1Y6WA 3SJSA 1DJXA 2H61A 1ODBA 3I5HC 1Z4HA 2VRGA 1B9AA 1NYAA 3DVMA 1WLZA 1MWNA 2I18A 1K90D 2L4HA 2TN4A 2QPTA 4YGDB 1N2DA 4FQTA 1F54A 1RK9A 3NHIA 3DYEA 1NX0A 1OMRA 1AHRA 4MZKA 5CSIA 1NPQA 2PQLA 1SY9A 3GK4X 4PHKA 3RLZA 3O6BA 1WRKA 3CDNA 2PASA 2ZNEA 3S0GA 2BKHB 3LLEA 5HYDA 1SW8A 2Q91A 3CR5X 1LA0A 1Q80A 2KFFA 3PLFB 4N5XA 3R1VA 2BE6A 4U8DA 2KFHA 4A4CA 1DJWA 1YVLA 2JQ6A 1BR4B 1RTP1 3I5FC 3JTDB 2OS8B 5D7FA 1B47A 3VRRA 2CBLA 2JPOA 3SS4A 1WRZA 1NCZA 1YURA 3VRPA 1WY9A 3JTDC 1Y1XA 2WC6A 1K2HA 1PULA 3K21A 1SBJA 2ERBA 2M7NA 2MLEC 3OX6A 3SS5A 1J7OA 3KO0A 5TNCA 2ZKMX 1QJTA 3NGVA 4PE0A 3S0DA 3TDUA 1PVBA 1OMDA 5DKNA 1XO5A 3WHTB 4OV2A 3QMEA 3AAKA 1OOIX 3EVVA 1KFXS 2P71A 4HSZA 1PRWA 3VRNA 1TUJA 3BQ3A 1N65A 3AAJA 3BUXB 4BY4A 3O78A 3EK7A 3SIBA 1YR5A 4JQ0D 1JSAA 3LCPC 1F8HA 1QX5B 4WQ3A 4DCKA 2JTTA 1IJ5A 1MUXA 5HKYA 1KSOA 2QEVA 3JVTC 4CIDA 1KFUS 1OOGA 1NX2A 1PSBA 1Y1UA 3EKJA 3NSOA 2PVBA 2NLNA 4ETOA 5AXIA 3KF9A 1CDPA 2I7AA 5ER5A 5J3XA 1B8RA 2MA2A 1N0YA 1KCYA 1SR6B 4NDCA 2M8UA 3BJHA 4HREE 1LA3A 3CZ0A 1B8CA 3B88A 3BFAA 1ORGA 1TWOA 1DEKA 3DVJA 1C3YA 4PDZA 1EG3A 1SR6C 1GJYA 2KAYA 2Y5IA 3D75A 2LVJA 1M45A 4INXA 2OPOA 4YBHB 3R1OA 1F71A 1K8UA 1XYDA 1S5GZ 1TTXA 3PATA 1DQEA 3S0BA 3VRQA 3WXAA 4I5JA 2K8MB 1LXFC 2KLDA 1G8IA 1C07A 1Y0VH 2BCXA 1SRAA 2Y4QA 3BFHA 2LANA 2KYCA 1R6PA 3KHEA 3PM2A 2JT0A 1S1EA 3I5IB 2GV5A 4FTGA 3OHMB 4M2PA 3D0YB 4HRGA 3SG4A 1NP8A 1U5IB 1XK4A 1K95A 1QX7A 2AMIA 3DZTA 2KYFA 3FE6A 1IIOA 2BL0C 2JXCA 3C1VA 3F45A 3CABA 3NSIA 4D1EA 1C7VA 2M49B 2CT9A 3LK0A 2KBIA 4MVFA 2K60A 1E8AA 3TDZA 3SG2A 1HT9A 2JRFA 1DJIA 4YGEB 1TCFA 1S6CA 3CTNA 3GOFA 2GGMA 1JBAA 2M97A 1SSEB 1TNXA 2NCOA 2EGDA 1YRTB 2PSRA 3B87A 4GNKB 1JWDA 5AFPA 4OVNF 1DELA 1MF8B 3D73A 3DD4A 3O4XA 1NX3A 2ISDA 1SL9A 1TNWA 1EL4A 2RGIA 2QACA 3I5HB 1NCXA 2LAPA 3FE9A 1DJGA 1KFUL 2IS9A 4GGFC 1CLBA 2LM5A 1XK4C 4YI8A 2LVIA 4P5OE 2LLTA 2K0JA 1KK7Z 1NWDA 1TN4A 3S0EA 3V2LA 5I8NA 1EG4A 2CNPA 1CTRA 4UPGA 2L51A 2FJYA 3BOWA 3OP0A 1S36A 2L98A 1CNPA 1SK6D 5AEQA 4N1GA 4PE4A 4XJKB 2LLUA 4ICBA 1ZOTB 2LNKA 4R1EA 1R2UA 2CXJA 2MJWB 3CLNA 1FW4A 4A4BA 5I2LA 4MZJA 1XFRA 1J1DA 1QV1A 3FE8A 1JC2A 1J55A 1DVIA 3EK4A 3EK8A 3I5FB 1A75A 4MLWA 3IQQA 3IVTA 5K89A 2ZNDA 2WCBA 1DMOA 1A2XA 1L2OC 2L4IA 2ZFDA 5KSZA 1DJYA 1JF0A 1DF0B 1OZOA 2D8NA 2LE9B 2PALA 1FI5A 1BJFA 1W7IB 2MHHA 2PRUA 1P28A 2LP2A 1B8LA 1M63B 2JWWA 1CFFA 4TNCA 1MR8A 2QEHA 5BPJA 3PN7C 4YGAA 4QJ3B 2L2EA 2LP3A 4AOMA 1SCMB 5I94A 2H61C 1W9ZA 4I5KA 3SG6A 3WNXB 4E68A 1XFZO 4MBEA 3BUNB 2K7BA 3TZ1A 5HLOA 1CDMA 1SCMC 1QVIY 1G33A 1GM0A 2JT3A 3GK2A 1DGVA 4NDBA 1K96A 1QX2A 2L0PA 4GAOA 3E3RA 3VROA 1OE9B 2PMYA 3SS3A 2JC2A 1M46A 3JVTB 1QVIZ 1DT7B 1CDNA 1S26D 3IF7A 4C0KA 1RWYA 1JFKA 2JPTA 1QLKA 3PFVA 4DRWA 4WQ2A 2MBXA 1UP5A 4C0LA 1XFXO 1BLQA 2KPHA 5HL1A 1Z2CB 1CFDA 3H4SE 1IQ3A 1IWQA 1XFVO 2ZN8A 1K94A 4CLNA 1LS8A 3LK1A 3RM1A 3TDIA 1J1EA 2FOTA 1YUUA 3CZ2A 1BG1A 3BUOB 2F3ZA 3DY9A 4MSPA 1IG5A 2BBMA 3AKBA 4ORAB 5I2QA 1J7PA 1S6JA 2AUCA 1CLMA 2LHIA 2JNXA 3I5GB 4GBAA 1TNQA 2WCLA 4PHMA 4ZCVA 4OZDA 2O60A 1F4OA 2K7CA 4F0ZB 5B8IB 1GGWA 3D10A 4YGCB 1BOCA 3I5GC 1WLMA 2WCMA 1SMGA 1OZSA 2QEOA 3B7AA 1AP4A 3K1EA 3DXLA 3DF0A 1B4CA 5I2OA 4DUQA 2BL0B 1AVSA 2H8VA 3FWBA 2E6WA 1OMVA 2OTGB 1TIZA 1UHJA 3CR4X 1QTXA 1S3PA 1WRLA 5D69A 4DS7A 1SL8A 1BMOA 3NHTA 3CZ1A 2NZ0A 2KQ6A 2LUXA 2OTGC 1H8BA 3SIAA 4ORCB 1ZFSA 2EC6C 1J7RA 2LV7A 1RJVA 1YRUB 4MN0A 5G08A 2KHNA 3SG5A 1HQVA 2JXLA 4M2QA 3IQOA 2KAXA 1A29A 3TUYC 4L9MA 2COLB 4XYNA 1QV0A 1L7ZA 5HKZA 3S0FA 1FI6A 1GGZA 2L50A 2NCPA 3O4YA 2LC5A 1IH0A 4MZLA 2KI4B 3Q8IA 1W7JB 1KFXL 1MQ1A 3OB2B 4PE1A 1OQPA 5CSJA 2LLSA 3CZTX 1CMGA 2JNFA 4WRIA 2EHBA 2HF5A 4NQGA 4YRUA 4BY5A 4M2OA 5FI2A 1QIWA 2KI4C 3OBVA 5HLVA 2FJUB 1NUBA 2KLEA 3BUMB 1WDCC 3BXKA 3L4AA 2KDHA 2KNEA 2LMUA 3HX4A 1BT6A 3OB1B 1A4PA 5AANA 3ZNIA 1UHIA 5ER4X 4AQJA 3EKHA 2QDIA 4GFTA 3ZWHA 2KBMA 2WOSA 3NSKA 2ZN9A 4JD9A 4USLA 2KGRA 3CYZA 1S6IA 4AQIA 3DVKA 3S0AA 1IJ6A 1TCOB 1XVJA 1TNPA 1KQMC 2Y1MA 1UHHA 1CFPA 1YTZC 2QEBA 3LL8B 3BUWB 1DJZA 1UUSA 2BCBA 1L2OB 2BE4A 2K2AA 3DVEA 1K9KA 4HRHA 2BBNA 4Q04A 5KU1A 1NCYA 2KOTA 1BODA 1KK8C 1ZMZA 1V1FA 4F7FA 1VRKA 4OCIA 1XFWO 2K61A 2E30A 4MEWA 3UNWA 3FS7A 5CPVA 1F4QA 1NSHA 3D77A 1DC1A 1AK8A 2PYQA 4GGNA 2LVVA 4KYNA 1PALA 2FCEA 5HKWA 2P70A 3D78A 1EJ3A 3MSEB 1IKUA 3PN7B 3PM8A 2JOJA 5DKRA 1K9UA 3OGNA 4IJ7A 1LINA 1ALWA 3HCMA 4OR9B 1CMFA 2B1UA 2FCDA 5FI6A 1D1OA 4PHJA 2CCMA 2O5GA 3R1PA 4MRYA 3CWGA 1AJ4A 4YI9A 3A8RA 2WCHA 2WC5A 3BOWB 1MHOA 2WCKA 1LVCD 1XFUO 5KTYA 3PJIA 3ICBA 5JOLA 4IL1A 2I2RE 2LUCA 4ZCUA 1T14A 1Y1AA 2G2BA 2DOQA 2HQ8A 3GK1A 1EXRA 1JF2A 4PT1A 2KAVA 1A75B 2ZRSA 1G4YR 3CGAA 1C7WA 5IBWA 1SNLA 2YGUA 5CSNA 2OS8C 2WCFA 3B86A 2L5XB 1LKJA 1V1GA 2KQYA 5CSFA 3N7HA 4JPZB 2BKIB 2WCEA 2MRDA 1DGUA 2JT8A 4PE7A 4CFQA 3OX5A 1IRJA 4QJ4B 3D76A 3KEVA 5JJGA 4JWQA 1RECA 1CFCA 1CDLA 3FIAA 1QXPA 1QIVA 1TUZA 2LVKA 1FPWA 3QRXA 1PVAA 1A03A 1M31A 3BYAA 2ZRTA 5EL2A 2G9BA 2LCPA 1IGVA 2M3WA 1EH2A 2F2PA 2KSPA 3CR2A 1OOFA 1SYMA 1BR1B 2HETA 1MXEA 2K7OA 3EVRA 1KWOB 2AAOA 1H4BA 2I94A 5AERA 3NSLA 3EG5B 2HPSA 2BAPA 1CM4A 4NDDA 2KI6D 2JU0A 1GQMA 3AKAA 5PALA 1KWOC 3EVUA 3D0YA 1KQVA 1OOJA 2JTZA 1PSRA 1U5IA 1UWOA 4OKHA 2M0RA 4PCWA 3NXAA 1CKKA 2WNDA 2H2KA 2F2OA 3UO9A 2V53A 3TS5B 4DIRA 1S5GY 2M9GA 1J7QA 2L5YA 5DKQA 1NIWA 1ZACA 2MLFC 1QASA 3KPXA 4GUKA 2EC6B 2F3YA 2M1KB 2Q4UA 3TS5C 3PALA 4PALA 1JUOA 4I5NB 4GPLB 3SG7A 3VGOA 2L2CA 1PK0D 2SCPA 2NXQA 4ORBB 1KSMA 2BNXA
chains in the Genus database with same CATH topology
1Z4HA 4GBAA 3SS4A 2YGUA 3EG5B 2BAPA 4I5JA 2KLDA 4IJ7A 3SS5A 5FI6A 5HL1A 1Z2CB 3PM2A 5I94A 4I5KA 1W9ZA 3KEVA 1DELA 4JKTA 3UO9A 3O4XA 2L5YA 5FI2A 1DEKA 3OBVA 2KLEA 5D3OA 3IVTA 4I5LB 5FI7A 2K60A 4GAOA 4MEWA 3UNWA 4I5NB 1DC1A 4KYNA 3SS3A 2BNXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YGU A; 
#chains in the Genus database with same CATH topology
 1SPY A;  1DJH A;  2M1U A;  1RFJ A;  2F33 A;  3SG3 A;  1MXL C;  1OOH A;  2BCA A;  5F6T A;  1BF5 A;  5GQQ C;  1NX1 A;  3CS1 A;  1AJ5 A;  2WC8 A;  1YUT A;  2SAS A;  1JFJ A;  1QWV A;  1XA5 A;  4FQO A;  4GGF A;  1UHN A;  3FWC A;  1CLL A;  2R2I A;  2P6B B;  2JZI A;  1K9P A;  2F8P A;  4C0J A;  5FYX A;  2Y1N A;  1BU3 A;  3I5I C;  1WDC B;  3VB1 A;  1FF1 A;  1X02 A;  3DF0 B;  3B6X A;  2LMV A;  2GGZ A;  2KGB C;  1OW4 A;  3WHU B;  1AUI B;  3L47 A;  1DTL A;  3D74 A;  3TUY B;  2HQW A;  2WCJ A;  4CPV A;  4CFR A;  1IQ5 A;  2KI6 C;  1QAT A;  1ALV A;  1TOP A;  2KFG A;  1F70 A;  1YVH A;  1K93 D;  1CB1 A;  4MRX A;  2LMT A;  3L4L A;  4XJK A;  1KQM B;  3A4U B;  2K2F A;  4INW A;  4N1F A;  1RRO A;  1FBV A;  1QLS A;  2LHL A;  2MAZ A;  2K7D A;  1B7T Y;  2CTN A;  4PHN A;  2A4J A;  2WOR A;  3R72 A;  1QS7 A;  1SKT A;  1YUS A;  1CM1 A;  1SCV A;  1KK8 B;  4JKT A;  4YGB B;  4QJ5 B;  1M39 A;  1TRF A;  3PSR A;  1UHK A;  1OSA A;  3RZS A;  1C3Z A;  1DF0 A;  3M0W A;  3O2P A;  1KK7 Y;  2GTE A;  4P2Y B;  2JUL A;  1B7T Z;  5D3O A;  1SL7 A;  1YX7 A;  1ZUZ A;  2M29 A;  4I5L B;  2M7L A;  1F55 A;  1UUR A;  5FI7 A;  2BEC A;  3BFB A;  1B1G A;  1YX8 A;  5DIC A;  1XFY O;  1Y6W A;  3SJS A;  1DJX A;  2H61 A;  1ODB A;  3I5H C;  1Z4H A;  2VRG A;  1B9A A;  1NYA A;  3DVM A;  1WLZ A;  1MWN A;  2I18 A;  1K90 D;  2L4H A;  2TN4 A;  2QPT A;  4YGD B;  1N2D A;  4FQT A;  1F54 A;  1RK9 A;  3NHI A;  3DYE A;  1NX0 A;  1OMR A;  1AHR A;  4MZK A;  5CSI A;  1NPQ A;  2PQL A;  1SY9 A;  3GK4 X;  4PHK A;  3RLZ A;  3O6B A;  1WRK A;  3CDN A;  2PAS A;  2ZNE A;  3S0G A;  2BKH B;  3LLE A;  5HYD A;  1SW8 A;  2Q91 A;  3CR5 X;  1LA0 A;  1Q80 A;  2KFF A;  3PLF B;  4N5X A;  3R1V A;  2BE6 A;  4U8D A;  2KFH A;  4A4C A;  1DJW A;  1YVL A;  2JQ6 A;  1BR4 B;  1RTP 1;  3I5F C;  3JTD B;  2OS8 B;  5D7F A;  1B47 A;  3VRR A;  2CBL A;  2JPO A;  3SS4 A;  1WRZ A;  1NCZ A;  1YUR A;  3VRP A;  1WY9 A;  3JTD C;  1Y1X A;  2WC6 A;  1K2H A;  1PUL A;  3K21 A;  1SBJ A;  2ERB A;  2M7N A;  2MLE C;  3OX6 A;  3SS5 A;  1J7O A;  3KO0 A;  5TNC A;  2ZKM X;  1QJT A;  3NGV A;  4PE0 A;  3S0D A;  3TDU A;  1PVB A;  1OMD A;  5DKN A;  1XO5 A;  3WHT B;  4OV2 A;  3QME A;  3AAK A;  1OOI X;  3EVV A;  1KFX S;  2P71 A;  4HSZ A;  1PRW A;  3VRN A;  1TUJ A;  3BQ3 A;  1N65 A;  3AAJ A;  3BUX B;  4BY4 A;  3O78 A;  3EK7 A;  3SIB A;  1YR5 A;  4JQ0 D;  1JSA A;  3LCP C;  1F8H A;  1QX5 B;  4WQ3 A;  4DCK A;  2JTT A;  1IJ5 A;  1MUX A;  5HKY A;  1KSO A;  2QEV A;  3JVT C;  4CID A;  1KFU S;  1OOG A;  1NX2 A;  1PSB A;  1Y1U A;  3EKJ A;  3NSO A;  2PVB A;  2NLN A;  4ETO A;  5AXI A;  3KF9 A;  1CDP A;  2I7A A;  5ER5 A;  5J3X A;  1B8R A;  2MA2 A;  1N0Y A;  1KCY A;  1SR6 B;  4NDC A;  2M8U A;  3BJH A;  4HRE E;  1LA3 A;  3CZ0 A;  1B8C A;  3B88 A;  3BFA A;  1ORG A;  1TWO A;  1DEK A;  3DVJ A;  1C3Y A;  4PDZ A;  1EG3 A;  1SR6 C;  1GJY A;  2KAY A;  2Y5I A;  3D75 A;  2LVJ A;  1M45 A;  4INX A;  2OPO A;  4YBH B;  3R1O A;  1F71 A;  1K8U A;  1XYD A;  1S5G Z;  1TTX A;  3PAT A;  1DQE A;  3S0B A;  3VRQ A;  3WXA A;  4I5J A;  2K8M B;  1LXF C;  2KLD A;  1G8I A;  1C07 A;  1Y0V H;  2BCX A;  1SRA A;  2Y4Q A;  3BFH A;  2LAN A;  2KYC A;  1R6P A;  3KHE A;  3PM2 A;  2JT0 A;  1S1E A;  3I5I B;  2GV5 A;  4FTG A;  3OHM B;  4M2P A;  3D0Y B;  4HRG A;  3SG4 A;  1NP8 A;  1U5I B;  1XK4 A;  1K95 A;  1QX7 A;  2AMI A;  3DZT A;  2KYF A;  3FE6 A;  1IIO A;  2BL0 C;  2JXC A;  3C1V A;  3F45 A;  3CAB A;  3NSI A;  4D1E A;  1C7V A;  2M49 B;  2CT9 A;  3LK0 A;  2KBI A;  4MVF A;  2K60 A;  1E8A A;  3TDZ A;  3SG2 A;  1HT9 A;  2JRF A;  1DJI A;  4YGE B;  1TCF A;  1S6C A;  3CTN A;  3GOF A;  2GGM A;  1JBA A;  2M97 A;  1SSE B;  1TNX A;  2NCO A;  2EGD A;  1YRT B;  2PSR A;  3B87 A;  4GNK B;  1JWD A;  5AFP A;  4OVN F;  1DEL A;  1MF8 B;  3D73 A;  3DD4 A;  3O4X A;  1NX3 A;  2ISD A;  1SL9 A;  1TNW A;  1EL4 A;  2RGI A;  2QAC A;  3I5H B;  1NCX A;  2LAP A;  3FE9 A;  1DJG A;  1KFU L;  2IS9 A;  4GGF C;  1CLB A;  2LM5 A;  1XK4 C;  4YI8 A;  2LVI A;  4P5O E;  2LLT A;  2K0J A;  1KK7 Z;  1NWD A;  1TN4 A;  3S0E A;  3V2L A;  5I8N A;  1EG4 A;  2CNP A;  1CTR A;  4UPG A;  2L51 A;  2FJY A;  3BOW A;  3OP0 A;  1S36 A;  2L98 A;  1CNP A;  1SK6 D;  5AEQ A;  4N1G A;  4PE4 A;  4XJK B;  2LLU A;  4ICB A;  1ZOT B;  2LNK A;  4R1E A;  1R2U A;  2CXJ A;  2MJW B;  3CLN A;  1FW4 A;  4A4B A;  5I2L A;  4MZJ A;  1XFR A;  1J1D A;  1QV1 A;  3FE8 A;  1JC2 A;  1J55 A;  1DVI A;  3EK4 A;  3EK8 A;  3I5F B;  1A75 A;  4MLW A;  3IQQ A;  3IVT A;  5K89 A;  2ZND A;  2WCB A;  1DMO A;  1A2X A;  1L2O C;  2L4I A;  2ZFD A;  5KSZ A;  1DJY A;  1JF0 A;  1DF0 B;  1OZO A;  2D8N A;  2LE9 B;  2PAL A;  1FI5 A;  1BJF A;  1W7I B;  2MHH A;  2PRU A;  1P28 A;  2LP2 A;  1B8L A;  1M63 B;  2JWW A;  1CFF A;  4TNC A;  1MR8 A;  2QEH A;  5BPJ A;  3PN7 C;  4YGA A;  4QJ3 B;  2L2E A;  2LP3 A;  4AOM A;  1SCM B;  5I94 A;  2H61 C;  1W9Z A;  4I5K A;  3SG6 A;  3WNX B;  4E68 A;  1XFZ O;  4MBE A;  3BUN B;  2K7B A;  3TZ1 A;  5HLO A;  1CDM A;  1SCM C;  1QVI Y;  1G33 A;  1GM0 A;  2JT3 A;  3GK2 A;  1DGV A;  4NDB A;  1K96 A;  1QX2 A;  2L0P A;  4GAO A;  3E3R A;  3VRO A;  1OE9 B;  2PMY A;  3SS3 A;  2JC2 A;  1M46 A;  3JVT B;  1QVI Z;  1DT7 B;  1CDN A;  1S26 D;  3IF7 A;  4C0K A;  1RWY A;  1JFK A;  2JPT A;  1QLK A;  3PFV A;  4DRW A;  4WQ2 A;  2MBX A;  1UP5 A;  4C0L A;  1XFX O;  1BLQ A;  2KPH A;  5HL1 A;  1Z2C B;  1CFD A;  3H4S E;  1IQ3 A;  1IWQ A;  1XFV O;  2ZN8 A;  1K94 A;  4CLN A;  1LS8 A;  3LK1 A;  3RM1 A;  3TDI A;  1J1E A;  2FOT A;  1YUU A;  3CZ2 A;  1BG1 A;  3BUO B;  2F3Z A;  3DY9 A;  4MSP A;  1IG5 A;  2BBM A;  3AKB A;  4ORA B;  5I2Q A;  1J7P A;  1S6J A;  2AUC A;  1CLM A;  2LHI A;  2JNX A;  3I5G B;  4GBA A;  1TNQ A;  2WCL A;  4PHM A;  4ZCV A;  4OZD A;  2O60 A;  1F4O A;  2K7C A;  4F0Z B;  5B8I B;  1GGW A;  3D10 A;  4YGC B;  1BOC A;  3I5G C;  1WLM A;  2WCM A;  1SMG A;  1OZS A;  2QEO A;  3B7A A;  1AP4 A;  3K1E A;  3DXL A;  3DF0 A;  1B4C A;  5I2O A;  4DUQ A;  2BL0 B;  1AVS A;  2H8V A;  3FWB A;  2E6W A;  1OMV A;  2OTG B;  1TIZ A;  1UHJ A;  3CR4 X;  1QTX A;  1S3P A;  1WRL A;  5D69 A;  4DS7 A;  1SL8 A;  1BMO A;  3NHT A;  3CZ1 A;  2NZ0 A;  2KQ6 A;  2LUX A;  2OTG C;  1H8B A;  3SIA A;  4ORC B;  1ZFS A;  2EC6 C;  1J7R A;  2LV7 A;  1RJV A;  1YRU B;  4MN0 A;  5G08 A;  2KHN A;  3SG5 A;  1HQV A;  2JXL A;  4M2Q A;  3IQO A;  2KAX A;  1A29 A;  3TUY C;  4L9M A;  2COL B;  4XYN A;  1QV0 A;  1L7Z A;  5HKZ A;  3S0F A;  1FI6 A;  1GGZ A;  2L50 A;  2NCP A;  3O4Y A;  2LC5 A;  1IH0 A;  4MZL A;  2KI4 B;  3Q8I A;  1W7J B;  1KFX L;  1MQ1 A;  3OB2 B;  4PE1 A;  1OQP A;  5CSJ A;  2LLS A;  3CZT X;  1CMG A;  2JNF A;  4WRI A;  2EHB A;  2HF5 A;  4NQG A;  4YRU A;  4BY5 A;  4M2O A;  5FI2 A;  1QIW A;  2KI4 C;  3OBV A;  5HLV A;  2FJU B;  1NUB A;  2KLE A;  3BUM B;  1WDC C;  3BXK A;  3L4A A;  2KDH A;  2KNE A;  2LMU A;  3HX4 A;  1BT6 A;  3OB1 B;  1A4P A;  5AAN A;  3ZNI A;  1UHI A;  5ER4 X;  4AQJ A;  3EKH A;  2QDI A;  4GFT A;  3ZWH A;  2KBM A;  2WOS A;  3NSK A;  2ZN9 A;  4JD9 A;  4USL A;  2KGR A;  3CYZ A;  1S6I A;  4AQI A;  3DVK A;  3S0A A;  1IJ6 A;  1TCO B;  1XVJ A;  1TNP A;  1KQM C;  2Y1M A;  1UHH A;  1CFP A;  1YTZ C;  2QEB A;  3LL8 B;  3BUW B;  1DJZ A;  1UUS A;  2BCB A;  1L2O B;  2BE4 A;  2K2A A;  3DVE A;  1K9K A;  4HRH A;  2BBN A;  4Q04 A;  5KU1 A;  1NCY A;  2KOT A;  1BOD A;  1KK8 C;  1ZMZ A;  1V1F A;  4F7F A;  1VRK A;  4OCI A;  1XFW O;  2K61 A;  2E30 A;  4MEW A;  3UNW A;  3FS7 A;  5CPV A;  1F4Q A;  1NSH A;  3D77 A;  1DC1 A;  1AK8 A;  2PYQ A;  4GGN A;  2LVV A;  4KYN A;  1PAL A;  2FCE A;  5HKW A;  2P70 A;  3D78 A;  1EJ3 A;  3MSE B;  1IKU A;  3PN7 B;  3PM8 A;  2JOJ A;  5DKR A;  1K9U A;  3OGN A;  4IJ7 A;  1LIN A;  1ALW A;  3HCM A;  4OR9 B;  1CMF A;  2B1U A;  2FCD A;  5FI6 A;  1D1O A;  4PHJ A;  2CCM A;  2O5G A;  3R1P A;  4MRY A;  3CWG A;  1AJ4 A;  4YI9 A;  3A8R A;  2WCH A;  2WC5 A;  3BOW B;  1MHO A;  2WCK A;  1LVC D;  1XFU O;  5KTY A;  3PJI A;  3ICB A;  5JOL A;  4IL1 A;  2I2R E;  2LUC A;  4ZCU A;  1T14 A;  1Y1A A;  2G2B A;  2DOQ A;  2HQ8 A;  3GK1 A;  1EXR A;  1JF2 A;  4PT1 A;  2KAV A;  1A75 B;  2ZRS A;  1G4Y R;  3CGA A;  1C7W A;  5IBW A;  1SNL A;  2YGU A;  5CSN A;  2OS8 C;  2WCF A;  3B86 A;  2L5X B;  1LKJ A;  1V1G A;  2KQY A;  5CSF A;  3N7H A;  4JPZ B;  2BKI B;  2WCE A;  2MRD A;  1DGU A;  2JT8 A;  4PE7 A;  4CFQ A;  3OX5 A;  1IRJ A;  4QJ4 B;  3D76 A;  3KEV A;  5JJG A;  4JWQ A;  1REC A;  1CFC A;  1CDL A;  3FIA A;  1QXP A;  1QIV A;  1TUZ A;  2LVK A;  1FPW A;  3QRX A;  1PVA A;  1A03 A;  1M31 A;  3BYA A;  2ZRT A;  5EL2 A;  2G9B A;  2LCP A;  1IGV A;  2M3W A;  1EH2 A;  2F2P A;  2KSP A;  3CR2 A;  1OOF A;  1SYM A;  1BR1 B;  2HET A;  1MXE A;  2K7O A;  3EVR A;  1KWO B;  2AAO A;  1H4B A;  2I94 A;  5AER A;  3NSL A;  3EG5 B;  2HPS A;  2BAP A;  1CM4 A;  4NDD A;  2KI6 D;  2JU0 A;  1GQM A;  3AKA A;  5PAL A;  1KWO C;  3EVU A;  3D0Y A;  1KQV A;  1OOJ A;  2JTZ A;  1PSR A;  1U5I A;  1UWO A;  4OKH A;  2M0R A;  4PCW A;  3NXA A;  1CKK A;  2WND A;  2H2K A;  2F2O A;  3UO9 A;  2V53 A;  3TS5 B;  4DIR A;  1S5G Y;  2M9G A;  1J7Q A;  2L5Y A;  5DKQ A;  1NIW A;  1ZAC A;  2MLF C;  1QAS A;  3KPX A;  4GUK A;  2EC6 B;  2F3Y A;  2M1K B;  2Q4U A;  3TS5 C;  3PAL A;  4PAL A;  1JUO A;  4I5N B;  4GPL B;  3SG7 A;  3VGO A;  2L2C A;  1PK0 D;  2SCP A;  2NXQ A;  4ORB B;  1KSM A;  2BNX A; 
#chains in the Genus database with same CATH homology
 1Z4H A;  4GBA A;  3SS4 A;  2YGU A;  3EG5 B;  2BAP A;  4I5J A;  2KLD A;  4IJ7 A;  3SS5 A;  5FI6 A;  5HL1 A;  1Z2C B;  3PM2 A;  5I94 A;  4I5K A;  1W9Z A;  3KEV A;  1DEL A;  4JKT A;  3UO9 A;  3O4X A;  2L5Y A;  5FI2 A;  1DEK A;  3OBV A;  2KLE A;  5D3O A;  3IVT A;  4I5L B;  5FI7 A;  2K60 A;  4GAO A;  4MEW A;  3UNW A;  4I5N B;  1DC1 A;  4KYN A;  3SS3 A;  2BNX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...