2WCEA

Calcium-free (apo) s100a12
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
91
structure length
91
Chain Sequence
STKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISMVAIALKAAHYHTHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords PROTEIN S100-A12
publication title The Crystal Structures of Human S100A12 in Apo Form and in Complex with Zinc: New Insights Into S100A12 Oligomerisation.
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2wceA00
2JRFA 1Y1AA 2Y5IA 1WLMA 3CR5X 4N5XA 2NZ0A 1QX2A 1B4CA 1JF2A 5KTYA 1NX3A 5HYDA 2ZN8A 1DJXA 4A4CA 4QJ4B 5F6TA 1E8AA 2JZIA 2WNDA 1QVIY 4DIRA 3EVUA 4YRUA 1U5IA 2K8MB 1EXRA 5I2LA 3TS5C 1CFFA 3O6BA 4GGFC 2GGMA 2JQ6A 3FIAA 2LANA 2ISDA 4MVFA 1B8CA 1GQMA 2KI6C 2M3WA 1L2OB 1PRWA 2CBLA 2MJWB 4QJ3B 3LCPC 2BCAA 3QRXA 1NIWA 4XJKA 1CFPA 4GPLB 4MZJA 2KBIA 1CB1A 1WDCC 2LV7A 2MLEC 3VRPA 3KO0A 1UHHA 3PLFB 1K90D 1DGVA 2CCMA 1EJ3A 1TNQA 1SCMC 2L51A 2L98A 2LVKA 1NX2A 1SL9A 4PE0A 2JULA 5DKQA 4GFTA 1KFUS 3SG2A 3TDIA 2KYFA 1Y0VH 5JOLA 4NDCA 4PHJA 4R1EA 4PCWA 1CNPA 2LLSA 1BR4B 3NSLA 3PATA 1ZFSA 2JOJA 1F54A 4GBAA 1RTP1 1TCOB 1JC2A 5D7FA 1WRKA 1TRFA 1R6PA 3TS5B 1FI6A 1G33A 1AJ4A 3PALA 2JXLA 2GV5A 1MXEA 3CS1A 2M49B 1FW4A 5CSFA 5AXIA 1J7RA 2ZFDA 4DRWA 4PE7A 2AAOA 2KGRA 5FYXA 1UHIA 1NX0A 1QLKA 1QJTA 1MF8B 2EHBA 2LLUA 5K89A 1ZMZA 1YVLA 3GK1A 1SYMA 2ZNDA 3LLEA 4PDZA 1CFDA 1A75A 2L4HA 3BUMB 5IBWA 2H61A 1QX7A 1FF1A 5AERA 2BKIB 3SJSA 2NCOA 1SBJA 3OHMB 3CR4X 4YGDB 1QXPA 2TN4A 3CLNA 2BKHB 3I5GC 1C7VA 1GGZA 1LA3A 1RK9A 4M2PA 2LMTA 3DF0B 2KGBC 1H4BA 2BE6A 1DTLA 1AHRA 1A4PA 2NXQA 1DF0A 2HQWA 1LXFC 1A75B 5HKYA 4PHNA 4MBEA 3JVTB 2JXCA 2R2IA 5AEQA 3TZ1A 4DCKA 2KAXA 3A8RA 4JPZB 1LKJA 2G2BA 2LP3A 3A4UB 4HRGA 4MSPA 2JTTA 1KK8C 2F8PA 4OVNF 4Q04A 4QJ5B 1D1OA 2EGDA 2KI4C 3BUWB 1OZSA 5G08A 4N1FA 3M0WA 1XFWO 1S3PA 1RWYA 2LVVA 4PE4A 4YBHB 1MXLC 1FBVA 1M45A 1K94A 1TIZA 3AKAA 2MAZA 2SCPA 1CDLA 1MR8A 2A4JA 3NSIA 2M8UA 4XYNA 1IKUA 1KSMA 4WRIA 3I5FC 3OB2B 4WQ2A 1K93D 2ZNEA 1B8RA 1AP4A 4PE1A 1QIVA 1JWDA 2HF5A 1OOJA 5DKNA 3WHUB 3IQQA 1CDNA 2M1KB 3O2PA 2WORA 1S5GZ 3RM1A 2KQ6A 3CR2A 1CMFA 2OPOA 4GUKA 1NWDA 4PHMA 4ZCVA 1SKTA 3CZTX 3TUYC 2PALA 2LMVA 3DVKA 1F8HA 1ZOTB 2P6BB 2QACA 1DMOA 1KK8B 1B7TY 1KK7Z 3PFVA 2L0PA 2LAPA 2K2FA 5ER5A 3BXKA 4L9MA 2OTGB 3SG6A 2I94A 1PSBA 5I2OA 1OMVA 1EG4A 1UWOA 2F2OA 3ICBA 2MHHA 1YRUB 1Y6WA 1KWOC 1G8IA 1QLSA 4U8DA 1IRJA 3EK8A 3SG5A 4WQ3A 1SL8A 3EK7A 5HKZA 2JT0A 3I5FB 2E6WA 4MEWA 3SG3A 1OE9B 2F3YA 3SG7A 2KSPA 1CDPA 1Y1UA 1UHNA 2CXJA 1K8UA 3LL8B 1A03A 2HQ8A 3C1VA 4NQGA 1QV1A 3GK2A 2WCEA 2ZRTA 3D10A 1CDMA 2L5XB 2LM5A 4ORCB 4OKHA 4GGFA 4ORAB 3TUYB 1KFXL 1N65A 2JTZA 1EL4A 2M1UA 1UP5A 1DGUA 2V53A 2BBNA 2KQYA 1RECA 3RLZA 4D1EA 2EC6C 1V1GA 2KBMA 4I5LB 1CM4A 1IG5A 4MN0A 1LVCD 1XFVO 2Y1NA 3BYAA 3KHEA 4BY4A 1BF5A 1PVAA 4HSZA 1BU3A 3VGOA 1KK7Y 5I8NA 2BL0C 3IF7A 2GGZA 4OR9B 1KWOB 1TCFA 1BLQA 2OS8C 1JFKA 3BUXB 1ZUZA 4N1GA 1XFZO 2Q91A 5HLOA 1TNXA 2PRUA 2I7AA 1OMDA 3NXAA 4ICBA 1XK4C 3DF0A 1WDCB 2JU0A 1K9PA 1ALWA 1L7ZA 2E30A 3CWGA 1F4QA 2K2AA 2LMUA 1KQMC 1SK6D 2HETA 1SCMB 3GOFA 4P5OE 2M29A 5D69A 4M2OA 1IQ3A 1UURA 1BOCA 3NSOA 3TDZA 1TTXA 1IWQA 1WRZA 1WY9A 3LK0A 2EC6B 1M39A 2LVIA 1F4OA 1KCYA 1PULA 2JPTA 3I5HC 2BE4A 1S6CA 3CGAA 4NDDA 5ER4X 2JNXA 4I5NB 1YURA 5JJGA 3BUNB 3BUOB 2G9BA 3SIBA 3GK4X 4AOMA 1BODA 2OS8B 2NLNA 4YGBB 4YGCB 2JT3A 1DJZA 2KHNA 2LNKA 1OSAA 3E3RA 3KEVA 2PVBA 2BCXA 1QS7A 1YUSA 3EVVA 1QIWA 3ZNIA 3AAJA 1F55A 4C0JA 1DJYA 2NCPA 1DT7B 1B1GA 1Y1XA 3F45A 1ZACA 4GGNA 1BR1B 2FCDA 2LC5A 1J7OA 3WHTB 4MZLA 2BCBA 1FI5A 1XFUO 1J7QA 3WNXB 1B9AA 1DJIA 1PALA 1YUUA 2Y1MA 1YX8A 2M97A 2AMIA 3I5IC 3MSEB 2PMYA 5J3XA 3I5GB 1Q80A 3D0YB 2AUCA 3VRRA 3EVRA 1N0YA 4BY5A 5HKWA 3H4SE 2JC2A 4DUQA 3OX5A 1DVIA 1SL7A 5GQQC 1AUIB 1DJWA 2MLFC 1X02A 2MRDA 1DJHA 2RGIA 4CLNA 1QATA 1K9UA 1XVJA 3OB1B 2F3ZA 2K7CA 5HLVA 2JWWA 1BMOA 3IQOA 1TNPA 2I2RE 2L2EA 2PASA 1CFCA 2KI4B 1XFXO 3AKBA 1NUBA 2L50A 1A29A 3SG4A 1YTZC 1MHOA 1KFUL 1M31A 3DVEA 3O4YA 2FCEA 1R2UA 1ALVA 3PSRA 2LUXA 4OV2A 4FQOA 4CPVA 3EK4A 1OZOA 1S6IA 2KAYA 4I5KA 1EG3A 1JBAA 2K0JA 1SMGA 2BBMA 3FWBA 1XO5A 4ORBB 5AFPA 3AAKA 1V1FA 1OQPA 2MA2A 4USLA 3KF9A 1BT6A 2WCFA 2ZRSA 1B8LA 3KPXA 4AQIA 3BOWB 1K9KA 5CSJA 2FOTA 1S26D 1S6JA 5CSNA 2VRGA 1S5GY 2KDHA 2F2PA 1RFJA 2O5GA 1F71A 3JTDC 1SR6C 4MLWA 1MQ1A 4IL1A 1CLMA 1J1EA 3EKJA 1F70A 2LUCA 4TNCA 3O78A 2LCPA 2HPSA 1OMRA 5DKRA 2SASA 5KSZA 1GJYA 4CFQA 1AK8A 3FS7A 1SY9A 1CM1A 2F33A 1IGVA 2K7OA 2Q4UA 4UPGA 1QASA 2LLTA 4JQ0D 1FPWA 1U5IB 1KQVA 1NX1A 1YRTB 3HX4A 2M0RA 5BPJA 3NSKA 1NYAA 1SCVA 2KFGA 1AJ5A 1LINA 4XJKB 1H8BA 1VRKA 1JUOA 1YX7A 1HT9A 3OP0A 2JT8A 1IJ5A 1J1DA 1MUXA 1SPYA 2K7DA 2WCBA 1N2DA 1WRLA 3DVJA 3JVTC 3TDUA 1QTXA 2H61C 1SR6B 1WLZA 3JTDB 5PALA 2KOTA 2O60A 1MWNA 3LK1A 5I2QA 3FWCA 4GAOA 5B8IB 1XK4A 4JWQA 1XA5A 2LHIA 4C0KA 1W7IB 1NPQA 3VRNA 1KFXS 1CKKA 1B47A 2BL0B 4YGEB 3PN7C 3BQ3A 1NSHA 2KYCA 1C07A 2LE9B 2D8NA 3VROA 2PSRA 3SIAA 2KAVA 1NCZA 1K95A 1NCYA 1KSOA 4OCIA 1GGWA 2K7BA 1BG1A 1S1EA 2CNPA 2KFHA 2ZKMX 1UHKA 2CT9A 3D0YA 2M7LA 1PK0D 2JNFA 1G4YR 3CTNA 3ZWHA 4I5JA 2LP2A 1TN4A 2KNEA 2I18A 1UHJA 1YVHA 1BJFA 1NCXA 1KQMB 2M9GA 1YR5A 2LVJA 4MRXA 1K2HA 3PM8A 1RROA 4MRYA 4A4BA 4GNKB 4HRHA 1B7TZ 1HQVA 1K96A 4ZCUA 1QV0A 1RJVA 4AQJA 2K61A 1JF0A 2KFFA 4FTGA 1A2XA 2COLB 1J55A 1SRAA 1SW8A 3I5HB 5AANA 1NP8A 1DJGA 1EH2A 3DD4A 4YI9A 1AVSA 3DVMA 4PALA 1QX5B 1XYDA 2MBXA 4CIDA 1QVIZ 4M2QA 5CPVA 2OTGC 1M63B 1M46A 3PN7B 1DF0B 1YUTA 1C7WA 1TOPA 4F0ZB 2WOSA 3WXAA 4C0LA 2Y4QA 2CTNA 3VRQA 2BECA 1LA0A 5KU1A 2KI6D 3K21A 2L4IA 1CTRA 2FJUB 4E68A 1CMGA 2QPTA 4HREE 1JFJA 2H2KA 1L2OC 3OX6A 1SNLA 1S36A 4P2YB 4ETOA 2WC8A 2IS9A 2ZN9A 1PVBA 4PHKA 1ODBA 4YI8A 1IQ5A 1JSAA 1CLLA 4MZKA 1UUSA 4YGAA 1CLBA 4DS7A 2M7NA 3BOWA 3HCMA 4CFRA 2DOQA 3EKHA 3I5IB 1TNWA 1XFYO 1IJ6A 1PSRA 1J7PA 1W7JB 2B1UA 5TNCA 4NDBA 1IH0A 2LHLA 5CSIA
chains in the Genus database with same CATH superfamily
2JRFA 3R1PA 1Y1AA 2Y5IA 1WLMA 3CR5X 4N5XA 1OOGA 5D3OA 2NZ0A 1QX2A 1B4CA 1JF2A 5KTYA 1NX3A 5HYDA 2ZN8A 1DJXA 4A4CA 4QJ4B 5F6TA 1E8AA 2JZIA 2WNDA 1QVIY 4DIRA 3EVUA 4YRUA 1U5IA 2K8MB 1EXRA 5I2LA 3TS5C 1CFFA 3O6BA 4GGFC 2GGMA 2JQ6A 3FIAA 2LANA 2ISDA 2QDIA 1B8CA 1GQMA 2KI6C 2M3WA 1L2OB 1PRWA 4MVFA 2CBLA 2MJWB 4QJ3B 3LCPC 2BCAA 3QRXA 1NIWA 4XJKA 1CFPA 4GPLB 4MZJA 2KBIA 1CB1A 1WDCC 2LV7A 2MLEC 3VRPA 3KO0A 1UHHA 3DY9A 3PLFB 3R1OA 1K90D 1DGVA 2CCMA 1EJ3A 1TNQA 1SCMC 2L51A 2L98A 2LVKA 1NX2A 1SL9A 4PE0A 2YGUA 2JULA 5DKQA 4GFTA 1KFUS 3SG2A 3TDIA 2KYFA 1Y0VH 5FI7A 5JOLA 4NDCA 4PHJA 4R1EA 4PCWA 1CNPA 2LLSA 1BR4B 3NSLA 3PATA 3S0EA 1ZFSA 2JOJA 1F54A 4GBAA 1RTP1 1TCOB 1JC2A 5D7FA 1WRKA 1TRFA 1R6PA 1BODA 3PM2A 3TS5B 1FI6A 1G33A 1AJ4A 3PALA 2JXLA 2GV5A 1MXEA 3CS1A 2M49B 1FW4A 5CSFA 5AXIA 1J7RA 2ZFDA 4DRWA 2L5YA 4PE7A 2AAOA 2KGRA 3EG5B 5FYXA 3S0FA 1UHIA 1NX0A 1QLKA 1QJTA 1MF8B 2EHBA 2LLUA 5K89A 1ZMZA 1YVLA 3K1EA 3B6XA 3GK1A 1SYMA 2ZNDA 3SS4A 3LLEA 4PDZA 1CFDA 1A75A 2L4HA 3BUMB 5IBWA 3CZ2A 4INWA 2H61A 1QX7A 1FF1A 5AERA 2BKIB 3FE8A 2NCOA 3SJSA 1IIOA 1SBJA 3OHMB 3CR4X 4YGDB 1QXPA 2TN4A 3CLNA 2BKHB 3I5GC 1C7VA 1GGZA 1LA3A 1RK9A 4M2PA 3CABA 2LMTA 3DF0B 2KGBC 1H4BA 5EL2A 2BE6A 1ORGA 2JPOA 1DTLA 1AHRA 1OW4A 1A4PA 2NXQA 1DF0A 2HQWA 1LXFC 1A75B 5HKYA 4PHNA 4MBEA 3JVTB 2JXCA 2R2IA 5AEQA 3TZ1A 4DCKA 1XFRA 2KAXA 2KPHA 3A8RA 4JPZB 3OGNA 1LKJA 2G2BA 2LP3A 3A4UB 4HRGA 4MSPA 2JTTA 1KK8C 2F8PA 1OOIX 4OVNF 4Q04A 4QJ5B 1D1OA 2EGDA 2KI4C 3BUWB 1OZSA 5G08A 4N1FA 3M0WA 1XFWO 1S3PA 1RWYA 2LVVA 4PE4A 4YBHB 1MXLC 1FBVA 1SSEB 1M45A 3B87A 1K94A 1TIZA 2WCHA 2MAZA 3AKAA 2SCPA 1CDLA 1MR8A 2A4JA 3NSIA 2M8UA 4XYNA 3NHTA 1KSMA 4WRIA 3DZTA 3I5FC 3OB2B 4WQ2A 1IKUA 1K93D 2ZNEA 1B8RA 5AANA 1AP4A 2H8VA 4PE1A 1QIVA 1JWDA 2HF5A 1OOJA 5DKNA 3WHUB 3IQQA 1CDNA 2M1KB 3R72A 3O2PA 2WORA 1S5GZ 3RM1A 2KQ6A 3CR2A 1CMFA 2OPOA 4GUKA 1NWDA 2K60A 4IJ7A 4PHMA 4ZCVA 1DC1A 1SKTA 3CZTX 3TUYC 2PALA 2LMVA 3DVKA 1F8HA 3L4LA 1ZOTB 2P6BB 2QACA 1DMOA 1KK8B 1B7TY 1KK7Z 3PFVA 1Z4HA 1C3YA 2L0PA 2LAPA 2K2FA 5ER5A 2WCKA 3BXKA 4L9MA 2OTGB 3SG6A 2I94A 1PSBA 5I2OA 2PQLA 1OMVA 1EG4A 1UWOA 2F2OA 3ICBA 2MHHA 3VB1A 1YRUB 1Y6WA 3S0AA 1KWOC 1G8IA 1QLSA 4U8DA 1IRJA 3EK8A 3SG5A 4WQ3A 1SL8A 3EK7A 5HKZA 2JT0A 3I5FB 2E6WA 4MEWA 3SG3A 1OE9B 2F3YA 3SG7A 1TUJA 2KSPA 1CDPA 1Y1UA 1UHNA 2CXJA 1K8UA 3LL8B 1A03A 2HQ8A 3C1VA 4NQGA 1QV1A 3GK2A 2WCEA 2ZRTA 3D10A 3FE6A 1CDMA 2WCMA 2L5XB 2LM5A 3L47A 2PYQA 4ORCB 4OKHA 2BNXA 4GGFA 4ORAB 1KFXL 1N65A 3TUYB 2JTZA 1EL4A 2M1UA 3D78A 1UP5A 1DGUA 2KLDA 2V53A 2BBNA 2KQYA 1RECA 3RLZA 4D1EA 2EC6C 1V1GA 2KBMA 4I5LB 1CM4A 1IG5A 4MN0A 1LVCD 1XFVO 2Y1NA 3BYAA 3KHEA 4BY4A 1BF5A 1PVAA 4HSZA 1BU3A 2ERBA 3VGOA 1KK7Y 3D73A 5I8NA 2BL0C 3IF7A 2GGZA 4OR9B 1KWOB 1TCFA 1BLQA 2OS8C 1JFKA 3BUXB 1ZUZA 4N1GA 1XFZO 2Q91A 4PT1A 3CZ1A 5HLOA 1TNXA 2PRUA 2I7AA 2WC6A 1OMDA 3NXAA 3L4AA 4ICBA 2L2CA 1XK4C 5HL1A 3DF0A 1WDCB 2JU0A 1K9PA 1ALWA 1L7ZA 2E30A 3CWGA 1F4QA 2K2AA 2LMUA 1KQMC 1SK6D 2HETA 1SCMB 3GOFA 4P5OE 2M29A 5D69A 4M2OA 1IQ3A 2QEVA 1UURA 1BOCA 3NSOA 3TDZA 1TTXA 1IWQA 1WRZA 1WY9A 3LK0A 2EC6B 1M39A 2LVIA 1F4OA 1KCYA 1PULA 2JPTA 3I5HC 2BE4A 2KLEA 1S6CA 3CGAA 4NDDA 5ER4X 2JNXA 4I5NB 1YURA 3D76A 5JJGA 3BUNB 3BUOB 3D74A 2G9BA 3SIBA 3GK4X 4AOMA 5I94A 2OS8B 2NLNA 4YGBB 4YGCB 2JT3A 1DJZA 2KHNA 2LNKA 1OSAA 3E3RA 3KEVA 2PVBA 2BCXA 4JKTA 1QS7A 1YUSA 3EVVA 1QIWA 2P70A 3AAJA 3ZNIA 1F55A 4C0JA 1DJYA 2NCPA 4F7FA 1DT7B 1Y1XA 1B1GA 1DELA 3F45A 1ZACA 4GGNA 1BR1B 2FCDA 2LC5A 1J7OA 3WHTB 1LS8A 4MZLA 2BCBA 1FI5A 1XFUO 1J7QA 3NHIA 3WNXB 1B9AA 1DJIA 1PALA 1YUUA 2Y1MA 3O4XA 1YX8A 3DYEA 2M97A 2AMIA 2BAPA 3I5IC 3MSEB 2PMYA 3UNWA 5J3XA 3I5GB 1Q80A 3D0YB 2AUCA 3VRRA 1DQEA 1N0YA 3EVRA 4FQTA 4BY5A 5HKWA 3H4SE 3SS3A 2JC2A 3BFAA 3OX5A 1DVIA 1SL7A 5GQQC 4DUQA 5FI2A 1AUIB 1DJWA 3R1VA 2MLFC 1X02A 2MRDA 1DJHA 2RGIA 4CLNA 1QATA 1T14A 1K9UA 1XVJA 3OB1B 1GM0A 2WC5A 2F3ZA 2K7CA 2QEOA 5HLVA 2JWWA 1BMOA 3IQOA 1TNPA 2I2RE 2L2EA 2PASA 3CZ0A 1CFCA 4INXA 2KI4B 3N7HA 1XFXO 3AKBA 1NUBA 1DEKA 2L50A 4JD9A 1A29A 3PJIA 1YTZC 3SG4A 1MHOA 1KFUL 1M31A 3DVEA 3O4YA 3Q8IA 2FCEA 1R2UA 1ALVA 3PSRA 2LUXA 4OV2A 5FI6A 4FQOA 4CPVA 3BFBA 3EK4A 1OZOA 1P28A 1S6IA 2KAYA 4I5KA 1EG3A 1JBAA 3B88A 2K0JA 1SMGA 1TWOA 2BBMA 2P71A 1XO5A 3FWBA 3NGVA 4ORBB 3AAKA 5AFPA 1V1FA 2WCLA 3D75A 5DICA 1OQPA 2MA2A 4USLA 1QWVA 1TUZA 3KF9A 1BT6A 2WCFA 2ZRSA 1B8LA 3KPXA 4AQIA 3BOWB 1K9KA 5CSJA 2FOTA 1S26D 3S0GA 1S6JA 5CSNA 2VRGA 1S5GY 2KDHA 2F2PA 1RFJA 2O5GA 3DXLA 3JTDC 1Z2CB 1SR6C 1F71A 4MLWA 1MQ1A 4IL1A 1CLMA 1J1EA 3EKJA 1F70A 2LUCA 4TNCA 3O78A 2LCPA 2HPSA 4KYNA 1OMRA 5DKRA 2SASA 3CDNA 5KSZA 1GJYA 4CFQA 1AK8A 3FS7A 1SY9A 1CM1A 2F33A 1IGVA 2K7OA 2Q4UA 4UPGA 3IVTA 1QASA 2LLTA 4JQ0D 1FPWA 1U5IB 1KQVA 1NX1A 1YRTB 3HX4A 2M0RA 5BPJA 3NSKA 1NYAA 1SCVA 2KFGA 1AJ5A 1LINA 4XJKB 1H8BA 3S0BA 1VRKA 1JUOA 1YX7A 1HT9A 3OP0A 3QMEA 2JT8A 3B7AA 1IJ5A 1J1DA 1MUXA 1SPYA 2K7DA 2WCBA 1N2DA 1WRLA 3DVJA 3JVTC 3TDUA 3V2LA 1QTXA 2H61C 1SR6B 1WLZA 3JTDB 5PALA 2KOTA 2O60A 1MWNA 3LK1A 5I2QA 3BJHA 3FWCA 4GAOA 5B8IB 1XK4A 3S0DA 4JWQA 1XA5A 2QEBA 2LHIA 3OBVA 4C0KA 1W7IB 1NPQA 3VRNA 1KFXS 1CKKA 1B47A 2BL0B 4YGEB 2GTEA 3PN7C 3BQ3A 1NSHA 2KYCA 1C07A 2LE9B 2D8NA 3VROA 2PSRA 3SIAA 2FJYA 1NCZA 2KAVA 1K95A 1NCYA 1KSOA 1OOHA 1OOFA 4OCIA 1GGWA 2K7BA 1BG1A 1S1EA 2CNPA 2KFHA 2ZKMX 1UHKA 3BFHA 2CT9A 3D0YA 4OZDA 2M7LA 1PK0D 2JNFA 1G4YR 3CTNA 3ZWHA 4I5JA 2LP2A 1TN4A 2KNEA 2I18A 1UHJA 1YVHA 1BJFA 1NCXA 1KQMB 2M9GA 1YR5A 2LVJA 4MRXA 1K2HA 3CYZA 3PM8A 1RROA 3UO9A 3RZSA 4MRYA 4A4BA 2QEHA 4GNKB 4HRHA 1B7TZ 1HQVA 1K96A 4ZCUA 1QV0A 1RJVA 4AQJA 2K61A 1JF0A 2KFFA 2WCJA 1A2XA 2COLB 1SW8A 1J55A 1SRAA 3I5HB 4FTGA 1NP8A 1DJGA 1EH2A 3DD4A 4YI9A 1AVSA 1C3ZA 3DVMA 4PALA 1QX5B 1XYDA 2MBXA 4CIDA 1QVIZ 4M2QA 5CPVA 2OTGC 1M63B 1M46A 3PN7B 1DF0B 1YUTA 1C7WA 1TOPA 4F0ZB 2WOSA 3WXAA 4C0LA 2Y4QA 2CTNA 3VRQA 2BECA 1LA0A 5KU1A 2KI6D 3K21A 2L4IA 1CTRA 2FJUB 4E68A 3FE9A 1CMGA 2QPTA 4HREE 1JFJA 2H2KA 1L2OC 3OX6A 1SNLA 1S36A 4P2YB 4ETOA 2WC8A 3B86A 2IS9A 3D77A 2ZN9A 1PVBA 4PHKA 1W9ZA 1ODBA 4YI8A 1IQ5A 1JSAA 1CLLA 4MZKA 1UUSA 4YGAA 3SS5A 1CLBA 4DS7A 2M7NA 3BOWA 3HCMA 4CFRA 2DOQA 3EKHA 3I5IB 1TNWA 1XFYO 1IJ6A 1PSRA 1J7PA 1W7JB 2B1UA 5TNCA 4NDBA 1IH0A 2LHLA 5CSIA
chains in the Genus database with same CATH topology
2JRFA 1Y1AA 2Y5IA 1WLMA 3CR5X 4N5XA 2NZ0A 1QX2A 1B4CA 1JF2A 5KTYA 1NX3A 5HYDA 2ZN8A 1DJXA 4A4CA 4QJ4B 5F6TA 1E8AA 2JZIA 2WNDA 1QVIY 4DIRA 3EVUA 4YRUA 1U5IA 2K8MB 1EXRA 5I2LA 3TS5C 1CFFA 3O6BA 4GGFC 2GGMA 2JQ6A 3FIAA 2LANA 2ISDA 4MVFA 1B8CA 1GQMA 2KI6C 2M3WA 1L2OB 1PRWA 2CBLA 2MJWB 4QJ3B 3LCPC 2BCAA 3QRXA 1NIWA 4XJKA 1CFPA 4GPLB 4MZJA 2KBIA 1CB1A 1WDCC 2LV7A 2MLEC 3VRPA 3KO0A 1UHHA 3PLFB 1K90D 1DGVA 2CCMA 1EJ3A 1TNQA 1SCMC 2L51A 2L98A 2LVKA 1NX2A 1SL9A 4PE0A 2JULA 5DKQA 4GFTA 1KFUS 3SG2A 3TDIA 2KYFA 1Y0VH 5JOLA 4NDCA 4PHJA 4R1EA 4PCWA 1CNPA 2LLSA 1BR4B 3NSLA 3PATA 1ZFSA 2JOJA 1F54A 4GBAA 1RTP1 1TCOB 1JC2A 5D7FA 1WRKA 1TRFA 1R6PA 3TS5B 1FI6A 1G33A 1AJ4A 3PALA 2JXLA 2GV5A 1MXEA 3CS1A 2M49B 1FW4A 5CSFA 5AXIA 1J7RA 2ZFDA 4DRWA 4PE7A 2AAOA 2KGRA 5FYXA 1UHIA 1NX0A 1QLKA 1QJTA 1MF8B 2EHBA 2LLUA 5K89A 1ZMZA 1YVLA 3GK1A 1SYMA 2ZNDA 3LLEA 4PDZA 1CFDA 1A75A 2L4HA 3BUMB 5IBWA 2H61A 1QX7A 1FF1A 5AERA 2BKIB 3SJSA 2NCOA 1SBJA 3OHMB 3CR4X 4YGDB 1QXPA 2TN4A 3CLNA 2BKHB 3I5GC 1C7VA 1GGZA 1LA3A 1RK9A 4M2PA 2LMTA 3DF0B 2KGBC 1H4BA 2BE6A 1DTLA 1AHRA 1A4PA 2NXQA 1DF0A 2HQWA 1LXFC 1A75B 5HKYA 4PHNA 4MBEA 3JVTB 2JXCA 2R2IA 5AEQA 3TZ1A 4DCKA 2KAXA 3A8RA 4JPZB 1LKJA 2G2BA 2LP3A 3A4UB 4HRGA 4MSPA 2JTTA 1KK8C 2F8PA 4OVNF 4Q04A 4QJ5B 1D1OA 2EGDA 2KI4C 3BUWB 1OZSA 5G08A 4N1FA 3M0WA 1XFWO 1S3PA 1RWYA 2LVVA 4PE4A 4YBHB 1MXLC 1FBVA 1M45A 1K94A 1TIZA 3AKAA 2MAZA 2SCPA 1CDLA 1MR8A 2A4JA 3NSIA 2M8UA 4XYNA 1IKUA 1KSMA 4WRIA 3I5FC 3OB2B 4WQ2A 1K93D 2ZNEA 1B8RA 1AP4A 4PE1A 1QIVA 1JWDA 2HF5A 1OOJA 5DKNA 3WHUB 3IQQA 1CDNA 2M1KB 3O2PA 2WORA 1S5GZ 3RM1A 2KQ6A 3CR2A 1CMFA 2OPOA 4GUKA 1NWDA 4PHMA 4ZCVA 1SKTA 3CZTX 3TUYC 2PALA 2LMVA 3DVKA 1F8HA 1ZOTB 2P6BB 2QACA 1DMOA 1KK8B 1B7TY 1KK7Z 3PFVA 2L0PA 2LAPA 2K2FA 5ER5A 3BXKA 4L9MA 2OTGB 3SG6A 2I94A 1PSBA 5I2OA 1OMVA 1EG4A 1UWOA 2F2OA 3ICBA 2MHHA 1YRUB 1Y6WA 1KWOC 1G8IA 1QLSA 4U8DA 1IRJA 3EK8A 3SG5A 4WQ3A 1SL8A 3EK7A 5HKZA 2JT0A 3I5FB 2E6WA 4MEWA 3SG3A 1OE9B 2F3YA 3SG7A 2KSPA 1CDPA 1Y1UA 1UHNA 2CXJA 1K8UA 3LL8B 1A03A 2HQ8A 3C1VA 4NQGA 1QV1A 3GK2A 2WCEA 2ZRTA 3D10A 1CDMA 2L5XB 2LM5A 4ORCB 4OKHA 4GGFA 4ORAB 3TUYB 1KFXL 1N65A 2JTZA 1EL4A 2M1UA 1UP5A 1DGUA 2V53A 2BBNA 2KQYA 1RECA 3RLZA 4D1EA 2EC6C 1V1GA 2KBMA 4I5LB 1CM4A 1IG5A 4MN0A 1LVCD 1XFVO 2Y1NA 3BYAA 3KHEA 4BY4A 1BF5A 1PVAA 4HSZA 1BU3A 3VGOA 1KK7Y 5I8NA 2BL0C 3IF7A 2GGZA 4OR9B 1KWOB 1TCFA 1BLQA 2OS8C 1JFKA 3BUXB 1ZUZA 4N1GA 1XFZO 2Q91A 5HLOA 1TNXA 2PRUA 2I7AA 1OMDA 3NXAA 4ICBA 1XK4C 3DF0A 1WDCB 2JU0A 1K9PA 1ALWA 1L7ZA 2E30A 3CWGA 1F4QA 2K2AA 2LMUA 1KQMC 1SK6D 2HETA 1SCMB 3GOFA 4P5OE 2M29A 5D69A 4M2OA 1IQ3A 1UURA 1BOCA 3NSOA 3TDZA 1TTXA 1IWQA 1WRZA 1WY9A 3LK0A 2EC6B 1M39A 2LVIA 1F4OA 1KCYA 1PULA 2JPTA 3I5HC 2BE4A 1S6CA 3CGAA 4NDDA 5ER4X 2JNXA 4I5NB 1YURA 5JJGA 3BUNB 3BUOB 2G9BA 3SIBA 3GK4X 4AOMA 1BODA 2OS8B 2NLNA 4YGBB 4YGCB 2JT3A 1DJZA 2KHNA 2LNKA 1OSAA 3E3RA 3KEVA 2PVBA 2BCXA 1QS7A 1YUSA 3EVVA 1QIWA 3ZNIA 3AAJA 1F55A 4C0JA 1DJYA 2NCPA 1DT7B 1B1GA 1Y1XA 3F45A 1ZACA 4GGNA 1BR1B 2FCDA 2LC5A 1J7OA 3WHTB 4MZLA 2BCBA 1FI5A 1XFUO 1J7QA 3WNXB 1B9AA 1DJIA 1PALA 1YUUA 2Y1MA 1YX8A 2M97A 2AMIA 3I5IC 3MSEB 2PMYA 5J3XA 3I5GB 1Q80A 3D0YB 2AUCA 3VRRA 3EVRA 1N0YA 4BY5A 5HKWA 3H4SE 2JC2A 4DUQA 3OX5A 1DVIA 1SL7A 5GQQC 1AUIB 1DJWA 2MLFC 1X02A 2MRDA 1DJHA 2RGIA 4CLNA 1QATA 1K9UA 1XVJA 3OB1B 2F3ZA 2K7CA 5HLVA 2JWWA 1BMOA 3IQOA 1TNPA 2I2RE 2L2EA 2PASA 1CFCA 2KI4B 1XFXO 3AKBA 1NUBA 2L50A 1A29A 3SG4A 1YTZC 1MHOA 1KFUL 1M31A 3DVEA 3O4YA 2FCEA 1R2UA 1ALVA 3PSRA 2LUXA 4OV2A 4FQOA 4CPVA 3EK4A 1OZOA 1S6IA 2KAYA 4I5KA 1EG3A 1JBAA 2K0JA 1SMGA 2BBMA 3FWBA 1XO5A 4ORBB 5AFPA 3AAKA 1V1FA 1OQPA 2MA2A 4USLA 3KF9A 1BT6A 2WCFA 2ZRSA 1B8LA 3KPXA 4AQIA 3BOWB 1K9KA 5CSJA 2FOTA 1S26D 1S6JA 5CSNA 2VRGA 1S5GY 2KDHA 2F2PA 1RFJA 2O5GA 1F71A 3JTDC 1SR6C 4MLWA 1MQ1A 4IL1A 1CLMA 1J1EA 3EKJA 1F70A 2LUCA 4TNCA 3O78A 2LCPA 2HPSA 1OMRA 5DKRA 2SASA 5KSZA 1GJYA 4CFQA 1AK8A 3FS7A 1SY9A 1CM1A 2F33A 1IGVA 2K7OA 2Q4UA 4UPGA 1QASA 2LLTA 4JQ0D 1FPWA 1U5IB 1KQVA 1NX1A 1YRTB 3HX4A 2M0RA 5BPJA 3NSKA 1NYAA 1SCVA 2KFGA 1AJ5A 1LINA 4XJKB 1H8BA 1VRKA 1JUOA 1YX7A 1HT9A 3OP0A 2JT8A 1IJ5A 1J1DA 1MUXA 1SPYA 2K7DA 2WCBA 1N2DA 1WRLA 3DVJA 3JVTC 3TDUA 1QTXA 2H61C 1SR6B 1WLZA 3JTDB 5PALA 2KOTA 2O60A 1MWNA 3LK1A 5I2QA 3FWCA 4GAOA 5B8IB 1XK4A 4JWQA 1XA5A 2LHIA 4C0KA 1W7IB 1NPQA 3VRNA 1KFXS 1CKKA 1B47A 2BL0B 4YGEB 3PN7C 3BQ3A 1NSHA 2KYCA 1C07A 2LE9B 2D8NA 3VROA 2PSRA 3SIAA 2KAVA 1NCZA 1K95A 1NCYA 1KSOA 4OCIA 1GGWA 2K7BA 1BG1A 1S1EA 2CNPA 2KFHA 2ZKMX 1UHKA 2CT9A 3D0YA 2M7LA 1PK0D 2JNFA 1G4YR 3CTNA 3ZWHA 4I5JA 2LP2A 1TN4A 2KNEA 2I18A 1UHJA 1YVHA 1BJFA 1NCXA 1KQMB 2M9GA 1YR5A 2LVJA 4MRXA 1K2HA 3PM8A 1RROA 4MRYA 4A4BA 4GNKB 4HRHA 1B7TZ 1HQVA 1K96A 4ZCUA 1QV0A 1RJVA 4AQJA 2K61A 1JF0A 2KFFA 4FTGA 1A2XA 2COLB 1J55A 1SRAA 1SW8A 3I5HB 5AANA 1NP8A 1DJGA 1EH2A 3DD4A 4YI9A 1AVSA 3DVMA 4PALA 1QX5B 1XYDA 2MBXA 4CIDA 1QVIZ 4M2QA 5CPVA 2OTGC 1M63B 1M46A 3PN7B 1DF0B 1YUTA 1C7WA 1TOPA 4F0ZB 2WOSA 3WXAA 4C0LA 2Y4QA 2CTNA 3VRQA 2BECA 1LA0A 5KU1A 2KI6D 3K21A 2L4IA 1CTRA 2FJUB 4E68A 1CMGA 2QPTA 4HREE 1JFJA 2H2KA 1L2OC 3OX6A 1SNLA 1S36A 4P2YB 4ETOA 2WC8A 2IS9A 2ZN9A 1PVBA 4PHKA 1ODBA 4YI8A 1IQ5A 1JSAA 1CLLA 4MZKA 1UUSA 4YGAA 1CLBA 4DS7A 2M7NA 3BOWA 3HCMA 4CFRA 2DOQA 3EKHA 3I5IB 1TNWA 1XFYO 1IJ6A 1PSRA 1J7PA 1W7JB 2B1UA 5TNCA 4NDBA 1IH0A 2LHLA 5CSIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JRF A;  1Y1A A;  2Y5I A;  1WLM A;  3CR5 X;  4N5X A;  2NZ0 A;  1QX2 A;  1B4C A;  1JF2 A;  5KTY A;  1NX3 A;  5HYD A;  2ZN8 A;  1DJX A;  4A4C A;  4QJ4 B;  5F6T A;  1E8A A;  2JZI A;  2WND A;  1QVI Y;  4DIR A;  3EVU A;  4YRU A;  1U5I A;  2K8M B;  1EXR A;  5I2L A;  3TS5 C;  1CFF A;  3O6B A;  4GGF C;  2GGM A;  2JQ6 A;  3FIA A;  2LAN A;  2ISD A;  4MVF A;  1B8C A;  1GQM A;  2KI6 C;  2M3W A;  1L2O B;  1PRW A;  2CBL A;  2MJW B;  4QJ3 B;  3LCP C;  2BCA A;  3QRX A;  1NIW A;  4XJK A;  1CFP A;  4GPL B;  4MZJ A;  2KBI A;  1CB1 A;  1WDC C;  2LV7 A;  2MLE C;  3VRP A;  3KO0 A;  1UHH A;  3PLF B;  1K90 D;  1DGV A;  2CCM A;  1EJ3 A;  1TNQ A;  1SCM C;  2L51 A;  2L98 A;  2LVK A;  1NX2 A;  1SL9 A;  4PE0 A;  2JUL A;  5DKQ A;  4GFT A;  1KFU S;  3SG2 A;  3TDI A;  2KYF A;  1Y0V H;  5JOL A;  4NDC A;  4PHJ A;  4R1E A;  4PCW A;  1CNP A;  2LLS A;  1BR4 B;  3NSL A;  3PAT A;  1ZFS A;  2JOJ A;  1F54 A;  4GBA A;  1RTP 1;  1TCO B;  1JC2 A;  5D7F A;  1WRK A;  1TRF A;  1R6P A;  3TS5 B;  1FI6 A;  1G33 A;  1AJ4 A;  3PAL A;  2JXL A;  2GV5 A;  1MXE A;  3CS1 A;  2M49 B;  1FW4 A;  5CSF A;  5AXI A;  1J7R A;  2ZFD A;  4DRW A;  4PE7 A;  2AAO A;  2KGR A;  5FYX A;  1UHI A;  1NX0 A;  1QLK A;  1QJT A;  1MF8 B;  2EHB A;  2LLU A;  5K89 A;  1ZMZ A;  1YVL A;  3GK1 A;  1SYM A;  2ZND A;  3LLE A;  4PDZ A;  1CFD A;  1A75 A;  2L4H A;  3BUM B;  5IBW A;  2H61 A;  1QX7 A;  1FF1 A;  5AER A;  2BKI B;  3SJS A;  2NCO A;  1SBJ A;  3OHM B;  3CR4 X;  4YGD B;  1QXP A;  2TN4 A;  3CLN A;  2BKH B;  3I5G C;  1C7V A;  1GGZ A;  1LA3 A;  1RK9 A;  4M2P A;  2LMT A;  3DF0 B;  2KGB C;  1H4B A;  2BE6 A;  1DTL A;  1AHR A;  1A4P A;  2NXQ A;  1DF0 A;  2HQW A;  1LXF C;  1A75 B;  5HKY A;  4PHN A;  4MBE A;  3JVT B;  2JXC A;  2R2I A;  5AEQ A;  3TZ1 A;  4DCK A;  2KAX A;  3A8R A;  4JPZ B;  1LKJ A;  2G2B A;  2LP3 A;  3A4U B;  4HRG A;  4MSP A;  2JTT A;  1KK8 C;  2F8P A;  4OVN F;  4Q04 A;  4QJ5 B;  1D1O A;  2EGD A;  2KI4 C;  3BUW B;  1OZS A;  5G08 A;  4N1F A;  3M0W A;  1XFW O;  1S3P A;  1RWY A;  2LVV A;  4PE4 A;  4YBH B;  1MXL C;  1FBV A;  1M45 A;  1K94 A;  1TIZ A;  3AKA A;  2MAZ A;  2SCP A;  1CDL A;  1MR8 A;  2A4J A;  3NSI A;  2M8U A;  4XYN A;  1IKU A;  1KSM A;  4WRI A;  3I5F C;  3OB2 B;  4WQ2 A;  1K93 D;  2ZNE A;  1B8R A;  1AP4 A;  4PE1 A;  1QIV A;  1JWD A;  2HF5 A;  1OOJ A;  5DKN A;  3WHU B;  3IQQ A;  1CDN A;  2M1K B;  3O2P A;  2WOR A;  1S5G Z;  3RM1 A;  2KQ6 A;  3CR2 A;  1CMF A;  2OPO A;  4GUK A;  1NWD A;  4PHM A;  4ZCV A;  1SKT A;  3CZT X;  3TUY C;  2PAL A;  2LMV A;  3DVK A;  1F8H A;  1ZOT B;  2P6B B;  2QAC A;  1DMO A;  1KK8 B;  1B7T Y;  1KK7 Z;  3PFV A;  2L0P A;  2LAP A;  2K2F A;  5ER5 A;  3BXK A;  4L9M A;  2OTG B;  3SG6 A;  2I94 A;  1PSB A;  5I2O A;  1OMV A;  1EG4 A;  1UWO A;  2F2O A;  3ICB A;  2MHH A;  1YRU B;  1Y6W A;  1KWO C;  1G8I A;  1QLS A;  4U8D A;  1IRJ A;  3EK8 A;  3SG5 A;  4WQ3 A;  1SL8 A;  3EK7 A;  5HKZ A;  2JT0 A;  3I5F B;  2E6W A;  4MEW A;  3SG3 A;  1OE9 B;  2F3Y A;  3SG7 A;  2KSP A;  1CDP A;  1Y1U A;  1UHN A;  2CXJ A;  1K8U A;  3LL8 B;  1A03 A;  2HQ8 A;  3C1V A;  4NQG A;  1QV1 A;  3GK2 A;  2WCE A;  2ZRT A;  3D10 A;  1CDM A;  2L5X B;  2LM5 A;  4ORC B;  4OKH A;  4GGF A;  4ORA B;  3TUY B;  1KFX L;  1N65 A;  2JTZ A;  1EL4 A;  2M1U A;  1UP5 A;  1DGU A;  2V53 A;  2BBN A;  2KQY A;  1REC A;  3RLZ A;  4D1E A;  2EC6 C;  1V1G A;  2KBM A;  4I5L B;  1CM4 A;  1IG5 A;  4MN0 A;  1LVC D;  1XFV O;  2Y1N A;  3BYA A;  3KHE A;  4BY4 A;  1BF5 A;  1PVA A;  4HSZ A;  1BU3 A;  3VGO A;  1KK7 Y;  5I8N A;  2BL0 C;  3IF7 A;  2GGZ A;  4OR9 B;  1KWO B;  1TCF A;  1BLQ A;  2OS8 C;  1JFK A;  3BUX B;  1ZUZ A;  4N1G A;  1XFZ O;  2Q91 A;  5HLO A;  1TNX A;  2PRU A;  2I7A A;  1OMD A;  3NXA A;  4ICB A;  1XK4 C;  3DF0 A;  1WDC B;  2JU0 A;  1K9P A;  1ALW A;  1L7Z A;  2E30 A;  3CWG A;  1F4Q A;  2K2A A;  2LMU A;  1KQM C;  1SK6 D;  2HET A;  1SCM B;  3GOF A;  4P5O E;  2M29 A;  5D69 A;  4M2O A;  1IQ3 A;  1UUR A;  1BOC A;  3NSO A;  3TDZ A;  1TTX A;  1IWQ A;  1WRZ A;  1WY9 A;  3LK0 A;  2EC6 B;  1M39 A;  2LVI A;  1F4O A;  1KCY A;  1PUL A;  2JPT A;  3I5H C;  2BE4 A;  1S6C A;  3CGA A;  4NDD A;  5ER4 X;  2JNX A;  4I5N B;  1YUR A;  5JJG A;  3BUN B;  3BUO B;  2G9B A;  3SIB A;  3GK4 X;  4AOM A;  1BOD A;  2OS8 B;  2NLN A;  4YGB B;  4YGC B;  2JT3 A;  1DJZ A;  2KHN A;  2LNK A;  1OSA A;  3E3R A;  3KEV A;  2PVB A;  2BCX A;  1QS7 A;  1YUS A;  3EVV A;  1QIW A;  3ZNI A;  3AAJ A;  1F55 A;  4C0J A;  1DJY A;  2NCP A;  1DT7 B;  1B1G A;  1Y1X A;  3F45 A;  1ZAC A;  4GGN A;  1BR1 B;  2FCD A;  2LC5 A;  1J7O A;  3WHT B;  4MZL A;  2BCB A;  1FI5 A;  1XFU O;  1J7Q A;  3WNX B;  1B9A A;  1DJI A;  1PAL A;  1YUU A;  2Y1M A;  1YX8 A;  2M97 A;  2AMI A;  3I5I C;  3MSE B;  2PMY A;  5J3X A;  3I5G B;  1Q80 A;  3D0Y B;  2AUC A;  3VRR A;  3EVR A;  1N0Y A;  4BY5 A;  5HKW A;  3H4S E;  2JC2 A;  4DUQ A;  3OX5 A;  1DVI A;  1SL7 A;  5GQQ C;  1AUI B;  1DJW A;  2MLF C;  1X02 A;  2MRD A;  1DJH A;  2RGI A;  4CLN A;  1QAT A;  1K9U A;  1XVJ A;  3OB1 B;  2F3Z A;  2K7C A;  5HLV A;  2JWW A;  1BMO A;  3IQO A;  1TNP A;  2I2R E;  2L2E A;  2PAS A;  1CFC A;  2KI4 B;  1XFX O;  3AKB A;  1NUB A;  2L50 A;  1A29 A;  3SG4 A;  1YTZ C;  1MHO A;  1KFU L;  1M31 A;  3DVE A;  3O4Y A;  2FCE A;  1R2U A;  1ALV A;  3PSR A;  2LUX A;  4OV2 A;  4FQO A;  4CPV A;  3EK4 A;  1OZO A;  1S6I A;  2KAY A;  4I5K A;  1EG3 A;  1JBA A;  2K0J A;  1SMG A;  2BBM A;  3FWB A;  1XO5 A;  4ORB B;  5AFP A;  3AAK A;  1V1F A;  1OQP A;  2MA2 A;  4USL A;  3KF9 A;  1BT6 A;  2WCF A;  2ZRS A;  1B8L A;  3KPX A;  4AQI A;  3BOW B;  1K9K A;  5CSJ A;  2FOT A;  1S26 D;  1S6J A;  5CSN A;  2VRG A;  1S5G Y;  2KDH A;  2F2P A;  1RFJ A;  2O5G A;  1F71 A;  3JTD C;  1SR6 C;  4MLW A;  1MQ1 A;  4IL1 A;  1CLM A;  1J1E A;  3EKJ A;  1F70 A;  2LUC A;  4TNC A;  3O78 A;  2LCP A;  2HPS A;  1OMR A;  5DKR A;  2SAS A;  5KSZ A;  1GJY A;  4CFQ A;  1AK8 A;  3FS7 A;  1SY9 A;  1CM1 A;  2F33 A;  1IGV A;  2K7O A;  2Q4U A;  4UPG A;  1QAS A;  2LLT A;  4JQ0 D;  1FPW A;  1U5I B;  1KQV A;  1NX1 A;  1YRT B;  3HX4 A;  2M0R A;  5BPJ A;  3NSK A;  1NYA A;  1SCV A;  2KFG A;  1AJ5 A;  1LIN A;  4XJK B;  1H8B A;  1VRK A;  1JUO A;  1YX7 A;  1HT9 A;  3OP0 A;  2JT8 A;  1IJ5 A;  1J1D A;  1MUX A;  1SPY A;  2K7D A;  2WCB A;  1N2D A;  1WRL A;  3DVJ A;  3JVT C;  3TDU A;  1QTX A;  2H61 C;  1SR6 B;  1WLZ A;  3JTD B;  5PAL A;  2KOT A;  2O60 A;  1MWN A;  3LK1 A;  5I2Q A;  3FWC A;  4GAO A;  5B8I B;  1XK4 A;  4JWQ A;  1XA5 A;  2LHI A;  4C0K A;  1W7I B;  1NPQ A;  3VRN A;  1KFX S;  1CKK A;  1B47 A;  2BL0 B;  4YGE B;  3PN7 C;  3BQ3 A;  1NSH A;  2KYC A;  1C07 A;  2LE9 B;  2D8N A;  3VRO A;  2PSR A;  3SIA A;  2KAV A;  1NCZ A;  1K95 A;  1NCY A;  1KSO A;  4OCI A;  1GGW A;  2K7B A;  1BG1 A;  1S1E A;  2CNP A;  2KFH A;  2ZKM X;  1UHK A;  2CT9 A;  3D0Y A;  2M7L A;  1PK0 D;  2JNF A;  1G4Y R;  3CTN A;  3ZWH A;  4I5J A;  2LP2 A;  1TN4 A;  2KNE A;  2I18 A;  1UHJ A;  1YVH A;  1BJF A;  1NCX A;  1KQM B;  2M9G A;  1YR5 A;  2LVJ A;  4MRX A;  1K2H A;  3PM8 A;  1RRO A;  4MRY A;  4A4B A;  4GNK B;  4HRH A;  1B7T Z;  1HQV A;  1K96 A;  4ZCU A;  1QV0 A;  1RJV A;  4AQJ A;  2K61 A;  1JF0 A;  2KFF A;  4FTG A;  1A2X A;  2COL B;  1J55 A;  1SRA A;  1SW8 A;  3I5H B;  5AAN A;  1NP8 A;  1DJG A;  1EH2 A;  3DD4 A;  4YI9 A;  1AVS A;  3DVM A;  4PAL A;  1QX5 B;  1XYD A;  2MBX A;  4CID A;  1QVI Z;  4M2Q A;  5CPV A;  2OTG C;  1M63 B;  1M46 A;  3PN7 B;  1DF0 B;  1YUT A;  1C7W A;  1TOP A;  4F0Z B;  2WOS A;  3WXA A;  4C0L A;  2Y4Q A;  2CTN A;  3VRQ A;  2BEC A;  1LA0 A;  5KU1 A;  2KI6 D;  3K21 A;  2L4I A;  1CTR A;  2FJU B;  4E68 A;  1CMG A;  2QPT A;  4HRE E;  1JFJ A;  2H2K A;  1L2O C;  3OX6 A;  1SNL A;  1S36 A;  4P2Y B;  4ETO A;  2WC8 A;  2IS9 A;  2ZN9 A;  1PVB A;  4PHK A;  1ODB A;  4YI8 A;  1IQ5 A;  1JSA A;  1CLL A;  4MZK A;  1UUS A;  4YGA A;  1CLB A;  4DS7 A;  2M7N A;  3BOW A;  3HCM A;  4CFR A;  2DOQ A;  3EKH A;  3I5I B;  1TNW A;  1XFY O;  1IJ6 A;  1PSR A;  1J7P A;  1W7J B;  2B1U A;  5TNC A;  4NDB A;  1IH0 A;  2LHL A;  5CSI A; 
#chains in the Genus database with same CATH topology
 2JRF A;  3R1P A;  1Y1A A;  2Y5I A;  1WLM A;  3CR5 X;  4N5X A;  1OOG A;  5D3O A;  2NZ0 A;  1QX2 A;  1B4C A;  1JF2 A;  5KTY A;  1NX3 A;  5HYD A;  2ZN8 A;  1DJX A;  4A4C A;  4QJ4 B;  5F6T A;  1E8A A;  2JZI A;  2WND A;  1QVI Y;  4DIR A;  3EVU A;  4YRU A;  1U5I A;  2K8M B;  1EXR A;  5I2L A;  3TS5 C;  1CFF A;  3O6B A;  4GGF C;  2GGM A;  2JQ6 A;  3FIA A;  2LAN A;  2ISD A;  2QDI A;  1B8C A;  1GQM A;  2KI6 C;  2M3W A;  1L2O B;  1PRW A;  4MVF A;  2CBL A;  2MJW B;  4QJ3 B;  3LCP C;  2BCA A;  3QRX A;  1NIW A;  4XJK A;  1CFP A;  4GPL B;  4MZJ A;  2KBI A;  1CB1 A;  1WDC C;  2LV7 A;  2MLE C;  3VRP A;  3KO0 A;  1UHH A;  3DY9 A;  3PLF B;  3R1O A;  1K90 D;  1DGV A;  2CCM A;  1EJ3 A;  1TNQ A;  1SCM C;  2L51 A;  2L98 A;  2LVK A;  1NX2 A;  1SL9 A;  4PE0 A;  2YGU A;  2JUL A;  5DKQ A;  4GFT A;  1KFU S;  3SG2 A;  3TDI A;  2KYF A;  1Y0V H;  5FI7 A;  5JOL A;  4NDC A;  4PHJ A;  4R1E A;  4PCW A;  1CNP A;  2LLS A;  1BR4 B;  3NSL A;  3PAT A;  3S0E A;  1ZFS A;  2JOJ A;  1F54 A;  4GBA A;  1RTP 1;  1TCO B;  1JC2 A;  5D7F A;  1WRK A;  1TRF A;  1R6P A;  1BOD A;  3PM2 A;  3TS5 B;  1FI6 A;  1G33 A;  1AJ4 A;  3PAL A;  2JXL A;  2GV5 A;  1MXE A;  3CS1 A;  2M49 B;  1FW4 A;  5CSF A;  5AXI A;  1J7R A;  2ZFD A;  4DRW A;  2L5Y A;  4PE7 A;  2AAO A;  2KGR A;  3EG5 B;  5FYX A;  3S0F A;  1UHI A;  1NX0 A;  1QLK A;  1QJT A;  1MF8 B;  2EHB A;  2LLU A;  5K89 A;  1ZMZ A;  1YVL A;  3K1E A;  3B6X A;  3GK1 A;  1SYM A;  2ZND A;  3SS4 A;  3LLE A;  4PDZ A;  1CFD A;  1A75 A;  2L4H A;  3BUM B;  5IBW A;  3CZ2 A;  4INW A;  2H61 A;  1QX7 A;  1FF1 A;  5AER A;  2BKI B;  3FE8 A;  2NCO A;  3SJS A;  1IIO A;  1SBJ A;  3OHM B;  3CR4 X;  4YGD B;  1QXP A;  2TN4 A;  3CLN A;  2BKH B;  3I5G C;  1C7V A;  1GGZ A;  1LA3 A;  1RK9 A;  4M2P A;  3CAB A;  2LMT A;  3DF0 B;  2KGB C;  1H4B A;  5EL2 A;  2BE6 A;  1ORG A;  2JPO A;  1DTL A;  1AHR A;  1OW4 A;  1A4P A;  2NXQ A;  1DF0 A;  2HQW A;  1LXF C;  1A75 B;  5HKY A;  4PHN A;  4MBE A;  3JVT B;  2JXC A;  2R2I A;  5AEQ A;  3TZ1 A;  4DCK A;  1XFR A;  2KAX A;  2KPH A;  3A8R A;  4JPZ B;  3OGN A;  1LKJ A;  2G2B A;  2LP3 A;  3A4U B;  4HRG A;  4MSP A;  2JTT A;  1KK8 C;  2F8P A;  1OOI X;  4OVN F;  4Q04 A;  4QJ5 B;  1D1O A;  2EGD A;  2KI4 C;  3BUW B;  1OZS A;  5G08 A;  4N1F A;  3M0W A;  1XFW O;  1S3P A;  1RWY A;  2LVV A;  4PE4 A;  4YBH B;  1MXL C;  1FBV A;  1SSE B;  1M45 A;  3B87 A;  1K94 A;  1TIZ A;  2WCH A;  2MAZ A;  3AKA A;  2SCP A;  1CDL A;  1MR8 A;  2A4J A;  3NSI A;  2M8U A;  4XYN A;  3NHT A;  1KSM A;  4WRI A;  3DZT A;  3I5F C;  3OB2 B;  4WQ2 A;  1IKU A;  1K93 D;  2ZNE A;  1B8R A;  5AAN A;  1AP4 A;  2H8V A;  4PE1 A;  1QIV A;  1JWD A;  2HF5 A;  1OOJ A;  5DKN A;  3WHU B;  3IQQ A;  1CDN A;  2M1K B;  3R72 A;  3O2P A;  2WOR A;  1S5G Z;  3RM1 A;  2KQ6 A;  3CR2 A;  1CMF A;  2OPO A;  4GUK A;  1NWD A;  2K60 A;  4IJ7 A;  4PHM A;  4ZCV A;  1DC1 A;  1SKT A;  3CZT X;  3TUY C;  2PAL A;  2LMV A;  3DVK A;  1F8H A;  3L4L A;  1ZOT B;  2P6B B;  2QAC A;  1DMO A;  1KK8 B;  1B7T Y;  1KK7 Z;  3PFV A;  1Z4H A;  1C3Y A;  2L0P A;  2LAP A;  2K2F A;  5ER5 A;  2WCK A;  3BXK A;  4L9M A;  2OTG B;  3SG6 A;  2I94 A;  1PSB A;  5I2O A;  2PQL A;  1OMV A;  1EG4 A;  1UWO A;  2F2O A;  3ICB A;  2MHH A;  3VB1 A;  1YRU B;  1Y6W A;  3S0A A;  1KWO C;  1G8I A;  1QLS A;  4U8D A;  1IRJ A;  3EK8 A;  3SG5 A;  4WQ3 A;  1SL8 A;  3EK7 A;  5HKZ A;  2JT0 A;  3I5F B;  2E6W A;  4MEW A;  3SG3 A;  1OE9 B;  2F3Y A;  3SG7 A;  1TUJ A;  2KSP A;  1CDP A;  1Y1U A;  1UHN A;  2CXJ A;  1K8U A;  3LL8 B;  1A03 A;  2HQ8 A;  3C1V A;  4NQG A;  1QV1 A;  3GK2 A;  2WCE A;  2ZRT A;  3D10 A;  3FE6 A;  1CDM A;  2WCM A;  2L5X B;  2LM5 A;  3L47 A;  2PYQ A;  4ORC B;  4OKH A;  2BNX A;  4GGF A;  4ORA B;  1KFX L;  1N65 A;  3TUY B;  2JTZ A;  1EL4 A;  2M1U A;  3D78 A;  1UP5 A;  1DGU A;  2KLD A;  2V53 A;  2BBN A;  2KQY A;  1REC A;  3RLZ A;  4D1E A;  2EC6 C;  1V1G A;  2KBM A;  4I5L B;  1CM4 A;  1IG5 A;  4MN0 A;  1LVC D;  1XFV O;  2Y1N A;  3BYA A;  3KHE A;  4BY4 A;  1BF5 A;  1PVA A;  4HSZ A;  1BU3 A;  2ERB A;  3VGO A;  1KK7 Y;  3D73 A;  5I8N A;  2BL0 C;  3IF7 A;  2GGZ A;  4OR9 B;  1KWO B;  1TCF A;  1BLQ A;  2OS8 C;  1JFK A;  3BUX B;  1ZUZ A;  4N1G A;  1XFZ O;  2Q91 A;  4PT1 A;  3CZ1 A;  5HLO A;  1TNX A;  2PRU A;  2I7A A;  2WC6 A;  1OMD A;  3NXA A;  3L4A A;  4ICB A;  2L2C A;  1XK4 C;  5HL1 A;  3DF0 A;  1WDC B;  2JU0 A;  1K9P A;  1ALW A;  1L7Z A;  2E30 A;  3CWG A;  1F4Q A;  2K2A A;  2LMU A;  1KQM C;  1SK6 D;  2HET A;  1SCM B;  3GOF A;  4P5O E;  2M29 A;  5D69 A;  4M2O A;  1IQ3 A;  2QEV A;  1UUR A;  1BOC A;  3NSO A;  3TDZ A;  1TTX A;  1IWQ A;  1WRZ A;  1WY9 A;  3LK0 A;  2EC6 B;  1M39 A;  2LVI A;  1F4O A;  1KCY A;  1PUL A;  2JPT A;  3I5H C;  2BE4 A;  2KLE A;  1S6C A;  3CGA A;  4NDD A;  5ER4 X;  2JNX A;  4I5N B;  1YUR A;  3D76 A;  5JJG A;  3BUN B;  3BUO B;  3D74 A;  2G9B A;  3SIB A;  3GK4 X;  4AOM A;  5I94 A;  2OS8 B;  2NLN A;  4YGB B;  4YGC B;  2JT3 A;  1DJZ A;  2KHN A;  2LNK A;  1OSA A;  3E3R A;  3KEV A;  2PVB A;  2BCX A;  4JKT A;  1QS7 A;  1YUS A;  3EVV A;  1QIW A;  2P70 A;  3AAJ A;  3ZNI A;  1F55 A;  4C0J A;  1DJY A;  2NCP A;  4F7F A;  1DT7 B;  1Y1X A;  1B1G A;  1DEL A;  3F45 A;  1ZAC A;  4GGN A;  1BR1 B;  2FCD A;  2LC5 A;  1J7O A;  3WHT B;  1LS8 A;  4MZL A;  2BCB A;  1FI5 A;  1XFU O;  1J7Q A;  3NHI A;  3WNX B;  1B9A A;  1DJI A;  1PAL A;  1YUU A;  2Y1M A;  3O4X A;  1YX8 A;  3DYE A;  2M97 A;  2AMI A;  2BAP A;  3I5I C;  3MSE B;  2PMY A;  3UNW A;  5J3X A;  3I5G B;  1Q80 A;  3D0Y B;  2AUC A;  3VRR A;  1DQE A;  1N0Y A;  3EVR A;  4FQT A;  4BY5 A;  5HKW A;  3H4S E;  3SS3 A;  2JC2 A;  3BFA A;  3OX5 A;  1DVI A;  1SL7 A;  5GQQ C;  4DUQ A;  5FI2 A;  1AUI B;  1DJW A;  3R1V A;  2MLF C;  1X02 A;  2MRD A;  1DJH A;  2RGI A;  4CLN A;  1QAT A;  1T14 A;  1K9U A;  1XVJ A;  3OB1 B;  1GM0 A;  2WC5 A;  2F3Z A;  2K7C A;  2QEO A;  5HLV A;  2JWW A;  1BMO A;  3IQO A;  1TNP A;  2I2R E;  2L2E A;  2PAS A;  3CZ0 A;  1CFC A;  4INX A;  2KI4 B;  3N7H A;  1XFX O;  3AKB A;  1NUB A;  1DEK A;  2L50 A;  4JD9 A;  1A29 A;  3PJI A;  1YTZ C;  3SG4 A;  1MHO A;  1KFU L;  1M31 A;  3DVE A;  3O4Y A;  3Q8I A;  2FCE A;  1R2U A;  1ALV A;  3PSR A;  2LUX A;  4OV2 A;  5FI6 A;  4FQO A;  4CPV A;  3BFB A;  3EK4 A;  1OZO A;  1P28 A;  1S6I A;  2KAY A;  4I5K A;  1EG3 A;  1JBA A;  3B88 A;  2K0J A;  1SMG A;  1TWO A;  2BBM A;  2P71 A;  1XO5 A;  3FWB A;  3NGV A;  4ORB B;  3AAK A;  5AFP A;  1V1F A;  2WCL A;  3D75 A;  5DIC A;  1OQP A;  2MA2 A;  4USL A;  1QWV A;  1TUZ A;  3KF9 A;  1BT6 A;  2WCF A;  2ZRS A;  1B8L A;  3KPX A;  4AQI A;  3BOW B;  1K9K A;  5CSJ A;  2FOT A;  1S26 D;  3S0G A;  1S6J A;  5CSN A;  2VRG A;  1S5G Y;  2KDH A;  2F2P A;  1RFJ A;  2O5G A;  3DXL A;  3JTD C;  1Z2C B;  1SR6 C;  1F71 A;  4MLW A;  1MQ1 A;  4IL1 A;  1CLM A;  1J1E A;  3EKJ A;  1F70 A;  2LUC A;  4TNC A;  3O78 A;  2LCP A;  2HPS A;  4KYN A;  1OMR A;  5DKR A;  2SAS A;  3CDN A;  5KSZ A;  1GJY A;  4CFQ A;  1AK8 A;  3FS7 A;  1SY9 A;  1CM1 A;  2F33 A;  1IGV A;  2K7O A;  2Q4U A;  4UPG A;  3IVT A;  1QAS A;  2LLT A;  4JQ0 D;  1FPW A;  1U5I B;  1KQV A;  1NX1 A;  1YRT B;  3HX4 A;  2M0R A;  5BPJ A;  3NSK A;  1NYA A;  1SCV A;  2KFG A;  1AJ5 A;  1LIN A;  4XJK B;  1H8B A;  3S0B A;  1VRK A;  1JUO A;  1YX7 A;  1HT9 A;  3OP0 A;  3QME A;  2JT8 A;  3B7A A;  1IJ5 A;  1J1D A;  1MUX A;  1SPY A;  2K7D A;  2WCB A;  1N2D A;  1WRL A;  3DVJ A;  3JVT C;  3TDU A;  3V2L A;  1QTX A;  2H61 C;  1SR6 B;  1WLZ A;  3JTD B;  5PAL A;  2KOT A;  2O60 A;  1MWN A;  3LK1 A;  5I2Q A;  3BJH A;  3FWC A;  4GAO A;  5B8I B;  1XK4 A;  3S0D A;  4JWQ A;  1XA5 A;  2QEB A;  2LHI A;  3OBV A;  4C0K A;  1W7I B;  1NPQ A;  3VRN A;  1KFX S;  1CKK A;  1B47 A;  2BL0 B;  4YGE B;  2GTE A;  3PN7 C;  3BQ3 A;  1NSH A;  2KYC A;  1C07 A;  2LE9 B;  2D8N A;  3VRO A;  2PSR A;  3SIA A;  2FJY A;  1NCZ A;  2KAV A;  1K95 A;  1NCY A;  1KSO A;  1OOH A;  1OOF A;  4OCI A;  1GGW A;  2K7B A;  1BG1 A;  1S1E A;  2CNP A;  2KFH A;  2ZKM X;  1UHK A;  3BFH A;  2CT9 A;  3D0Y A;  4OZD A;  2M7L A;  1PK0 D;  2JNF A;  1G4Y R;  3CTN A;  3ZWH A;  4I5J A;  2LP2 A;  1TN4 A;  2KNE A;  2I18 A;  1UHJ A;  1YVH A;  1BJF A;  1NCX A;  1KQM B;  2M9G A;  1YR5 A;  2LVJ A;  4MRX A;  1K2H A;  3CYZ A;  3PM8 A;  1RRO A;  3UO9 A;  3RZS A;  4MRY A;  4A4B A;  2QEH A;  4GNK B;  4HRH A;  1B7T Z;  1HQV A;  1K96 A;  4ZCU A;  1QV0 A;  1RJV A;  4AQJ A;  2K61 A;  1JF0 A;  2KFF A;  2WCJ A;  1A2X A;  2COL B;  1SW8 A;  1J55 A;  1SRA A;  3I5H B;  4FTG A;  1NP8 A;  1DJG A;  1EH2 A;  3DD4 A;  4YI9 A;  1AVS A;  1C3Z A;  3DVM A;  4PAL A;  1QX5 B;  1XYD A;  2MBX A;  4CID A;  1QVI Z;  4M2Q A;  5CPV A;  2OTG C;  1M63 B;  1M46 A;  3PN7 B;  1DF0 B;  1YUT A;  1C7W A;  1TOP A;  4F0Z B;  2WOS A;  3WXA A;  4C0L A;  2Y4Q A;  2CTN A;  3VRQ A;  2BEC A;  1LA0 A;  5KU1 A;  2KI6 D;  3K21 A;  2L4I A;  1CTR A;  2FJU B;  4E68 A;  3FE9 A;  1CMG A;  2QPT A;  4HRE E;  1JFJ A;  2H2K A;  1L2O C;  3OX6 A;  1SNL A;  1S36 A;  4P2Y B;  4ETO A;  2WC8 A;  3B86 A;  2IS9 A;  3D77 A;  2ZN9 A;  1PVB A;  4PHK A;  1W9Z A;  1ODB A;  4YI8 A;  1IQ5 A;  1JSA A;  1CLL A;  4MZK A;  1UUS A;  4YGA A;  3SS5 A;  1CLB A;  4DS7 A;  2M7N A;  3BOW A;  3HCM A;  4CFR A;  2DOQ A;  3EKH A;  3I5I B;  1TNW A;  1XFY O;  1IJ6 A;  1PSR A;  1J7P A;  1W7J B;  2B1U A;  5TNC A;  4NDB A;  1IH0 A;  2LHL A;  5CSI A; 
#chains in the Genus database with same CATH homology
 2JRF A;  1Y1A A;  2Y5I A;  1WLM A;  3CR5 X;  4N5X A;  2NZ0 A;  1QX2 A;  1B4C A;  1JF2 A;  5KTY A;  1NX3 A;  5HYD A;  2ZN8 A;  1DJX A;  4A4C A;  4QJ4 B;  5F6T A;  1E8A A;  2JZI A;  2WND A;  1QVI Y;  4DIR A;  3EVU A;  4YRU A;  1U5I A;  2K8M B;  1EXR A;  5I2L A;  3TS5 C;  1CFF A;  3O6B A;  4GGF C;  2GGM A;  2JQ6 A;  3FIA A;  2LAN A;  2ISD A;  4MVF A;  1B8C A;  1GQM A;  2KI6 C;  2M3W A;  1L2O B;  1PRW A;  2CBL A;  2MJW B;  4QJ3 B;  3LCP C;  2BCA A;  3QRX A;  1NIW A;  4XJK A;  1CFP A;  4GPL B;  4MZJ A;  2KBI A;  1CB1 A;  1WDC C;  2LV7 A;  2MLE C;  3VRP A;  3KO0 A;  1UHH A;  3PLF B;  1K90 D;  1DGV A;  2CCM A;  1EJ3 A;  1TNQ A;  1SCM C;  2L51 A;  2L98 A;  2LVK A;  1NX2 A;  1SL9 A;  4PE0 A;  2JUL A;  5DKQ A;  4GFT A;  1KFU S;  3SG2 A;  3TDI A;  2KYF A;  1Y0V H;  5JOL A;  4NDC A;  4PHJ A;  4R1E A;  4PCW A;  1CNP A;  2LLS A;  1BR4 B;  3NSL A;  3PAT A;  1ZFS A;  2JOJ A;  1F54 A;  4GBA A;  1RTP 1;  1TCO B;  1JC2 A;  5D7F A;  1WRK A;  1TRF A;  1R6P A;  3TS5 B;  1FI6 A;  1G33 A;  1AJ4 A;  3PAL A;  2JXL A;  2GV5 A;  1MXE A;  3CS1 A;  2M49 B;  1FW4 A;  5CSF A;  5AXI A;  1J7R A;  2ZFD A;  4DRW A;  4PE7 A;  2AAO A;  2KGR A;  5FYX A;  1UHI A;  1NX0 A;  1QLK A;  1QJT A;  1MF8 B;  2EHB A;  2LLU A;  5K89 A;  1ZMZ A;  1YVL A;  3GK1 A;  1SYM A;  2ZND A;  3LLE A;  4PDZ A;  1CFD A;  1A75 A;  2L4H A;  3BUM B;  5IBW A;  2H61 A;  1QX7 A;  1FF1 A;  5AER A;  2BKI B;  3SJS A;  2NCO A;  1SBJ A;  3OHM B;  3CR4 X;  4YGD B;  1QXP A;  2TN4 A;  3CLN A;  2BKH B;  3I5G C;  1C7V A;  1GGZ A;  1LA3 A;  1RK9 A;  4M2P A;  2LMT A;  3DF0 B;  2KGB C;  1H4B A;  2BE6 A;  1DTL A;  1AHR A;  1A4P A;  2NXQ A;  1DF0 A;  2HQW A;  1LXF C;  1A75 B;  5HKY A;  4PHN A;  4MBE A;  3JVT B;  2JXC A;  2R2I A;  5AEQ A;  3TZ1 A;  4DCK A;  2KAX A;  3A8R A;  4JPZ B;  1LKJ A;  2G2B A;  2LP3 A;  3A4U B;  4HRG A;  4MSP A;  2JTT A;  1KK8 C;  2F8P A;  4OVN F;  4Q04 A;  4QJ5 B;  1D1O A;  2EGD A;  2KI4 C;  3BUW B;  1OZS A;  5G08 A;  4N1F A;  3M0W A;  1XFW O;  1S3P A;  1RWY A;  2LVV A;  4PE4 A;  4YBH B;  1MXL C;  1FBV A;  1M45 A;  1K94 A;  1TIZ A;  3AKA A;  2MAZ A;  2SCP A;  1CDL A;  1MR8 A;  2A4J A;  3NSI A;  2M8U A;  4XYN A;  1IKU A;  1KSM A;  4WRI A;  3I5F C;  3OB2 B;  4WQ2 A;  1K93 D;  2ZNE A;  1B8R A;  1AP4 A;  4PE1 A;  1QIV A;  1JWD A;  2HF5 A;  1OOJ A;  5DKN A;  3WHU B;  3IQQ A;  1CDN A;  2M1K B;  3O2P A;  2WOR A;  1S5G Z;  3RM1 A;  2KQ6 A;  3CR2 A;  1CMF A;  2OPO A;  4GUK A;  1NWD A;  4PHM A;  4ZCV A;  1SKT A;  3CZT X;  3TUY C;  2PAL A;  2LMV A;  3DVK A;  1F8H A;  1ZOT B;  2P6B B;  2QAC A;  1DMO A;  1KK8 B;  1B7T Y;  1KK7 Z;  3PFV A;  2L0P A;  2LAP A;  2K2F A;  5ER5 A;  3BXK A;  4L9M A;  2OTG B;  3SG6 A;  2I94 A;  1PSB A;  5I2O A;  1OMV A;  1EG4 A;  1UWO A;  2F2O A;  3ICB A;  2MHH A;  1YRU B;  1Y6W A;  1KWO C;  1G8I A;  1QLS A;  4U8D A;  1IRJ A;  3EK8 A;  3SG5 A;  4WQ3 A;  1SL8 A;  3EK7 A;  5HKZ A;  2JT0 A;  3I5F B;  2E6W A;  4MEW A;  3SG3 A;  1OE9 B;  2F3Y A;  3SG7 A;  2KSP A;  1CDP A;  1Y1U A;  1UHN A;  2CXJ A;  1K8U A;  3LL8 B;  1A03 A;  2HQ8 A;  3C1V A;  4NQG A;  1QV1 A;  3GK2 A;  2WCE A;  2ZRT A;  3D10 A;  1CDM A;  2L5X B;  2LM5 A;  4ORC B;  4OKH A;  4GGF A;  4ORA B;  3TUY B;  1KFX L;  1N65 A;  2JTZ A;  1EL4 A;  2M1U A;  1UP5 A;  1DGU A;  2V53 A;  2BBN A;  2KQY A;  1REC A;  3RLZ A;  4D1E A;  2EC6 C;  1V1G A;  2KBM A;  4I5L B;  1CM4 A;  1IG5 A;  4MN0 A;  1LVC D;  1XFV O;  2Y1N A;  3BYA A;  3KHE A;  4BY4 A;  1BF5 A;  1PVA A;  4HSZ A;  1BU3 A;  3VGO A;  1KK7 Y;  5I8N A;  2BL0 C;  3IF7 A;  2GGZ A;  4OR9 B;  1KWO B;  1TCF A;  1BLQ A;  2OS8 C;  1JFK A;  3BUX B;  1ZUZ A;  4N1G A;  1XFZ O;  2Q91 A;  5HLO A;  1TNX A;  2PRU A;  2I7A A;  1OMD A;  3NXA A;  4ICB A;  1XK4 C;  3DF0 A;  1WDC B;  2JU0 A;  1K9P A;  1ALW A;  1L7Z A;  2E30 A;  3CWG A;  1F4Q A;  2K2A A;  2LMU A;  1KQM C;  1SK6 D;  2HET A;  1SCM B;  3GOF A;  4P5O E;  2M29 A;  5D69 A;  4M2O A;  1IQ3 A;  1UUR A;  1BOC A;  3NSO A;  3TDZ A;  1TTX A;  1IWQ A;  1WRZ A;  1WY9 A;  3LK0 A;  2EC6 B;  1M39 A;  2LVI A;  1F4O A;  1KCY A;  1PUL A;  2JPT A;  3I5H C;  2BE4 A;  1S6C A;  3CGA A;  4NDD A;  5ER4 X;  2JNX A;  4I5N B;  1YUR A;  5JJG A;  3BUN B;  3BUO B;  2G9B A;  3SIB A;  3GK4 X;  4AOM A;  1BOD A;  2OS8 B;  2NLN A;  4YGB B;  4YGC B;  2JT3 A;  1DJZ A;  2KHN A;  2LNK A;  1OSA A;  3E3R A;  3KEV A;  2PVB A;  2BCX A;  1QS7 A;  1YUS A;  3EVV A;  1QIW A;  3ZNI A;  3AAJ A;  1F55 A;  4C0J A;  1DJY A;  2NCP A;  1DT7 B;  1B1G A;  1Y1X A;  3F45 A;  1ZAC A;  4GGN A;  1BR1 B;  2FCD A;  2LC5 A;  1J7O A;  3WHT B;  4MZL A;  2BCB A;  1FI5 A;  1XFU O;  1J7Q A;  3WNX B;  1B9A A;  1DJI A;  1PAL A;  1YUU A;  2Y1M A;  1YX8 A;  2M97 A;  2AMI A;  3I5I C;  3MSE B;  2PMY A;  5J3X A;  3I5G B;  1Q80 A;  3D0Y B;  2AUC A;  3VRR A;  3EVR A;  1N0Y A;  4BY5 A;  5HKW A;  3H4S E;  2JC2 A;  4DUQ A;  3OX5 A;  1DVI A;  1SL7 A;  5GQQ C;  1AUI B;  1DJW A;  2MLF C;  1X02 A;  2MRD A;  1DJH A;  2RGI A;  4CLN A;  1QAT A;  1K9U A;  1XVJ A;  3OB1 B;  2F3Z A;  2K7C A;  5HLV A;  2JWW A;  1BMO A;  3IQO A;  1TNP A;  2I2R E;  2L2E A;  2PAS A;  1CFC A;  2KI4 B;  1XFX O;  3AKB A;  1NUB A;  2L50 A;  1A29 A;  3SG4 A;  1YTZ C;  1MHO A;  1KFU L;  1M31 A;  3DVE A;  3O4Y A;  2FCE A;  1R2U A;  1ALV A;  3PSR A;  2LUX A;  4OV2 A;  4FQO A;  4CPV A;  3EK4 A;  1OZO A;  1S6I A;  2KAY A;  4I5K A;  1EG3 A;  1JBA A;  2K0J A;  1SMG A;  2BBM A;  3FWB A;  1XO5 A;  4ORB B;  5AFP A;  3AAK A;  1V1F A;  1OQP A;  2MA2 A;  4USL A;  3KF9 A;  1BT6 A;  2WCF A;  2ZRS A;  1B8L A;  3KPX A;  4AQI A;  3BOW B;  1K9K A;  5CSJ A;  2FOT A;  1S26 D;  1S6J A;  5CSN A;  2VRG A;  1S5G Y;  2KDH A;  2F2P A;  1RFJ A;  2O5G A;  1F71 A;  3JTD C;  1SR6 C;  4MLW A;  1MQ1 A;  4IL1 A;  1CLM A;  1J1E A;  3EKJ A;  1F70 A;  2LUC A;  4TNC A;  3O78 A;  2LCP A;  2HPS A;  1OMR A;  5DKR A;  2SAS A;  5KSZ A;  1GJY A;  4CFQ A;  1AK8 A;  3FS7 A;  1SY9 A;  1CM1 A;  2F33 A;  1IGV A;  2K7O A;  2Q4U A;  4UPG A;  1QAS A;  2LLT A;  4JQ0 D;  1FPW A;  1U5I B;  1KQV A;  1NX1 A;  1YRT B;  3HX4 A;  2M0R A;  5BPJ A;  3NSK A;  1NYA A;  1SCV A;  2KFG A;  1AJ5 A;  1LIN A;  4XJK B;  1H8B A;  1VRK A;  1JUO A;  1YX7 A;  1HT9 A;  3OP0 A;  2JT8 A;  1IJ5 A;  1J1D A;  1MUX A;  1SPY A;  2K7D A;  2WCB A;  1N2D A;  1WRL A;  3DVJ A;  3JVT C;  3TDU A;  1QTX A;  2H61 C;  1SR6 B;  1WLZ A;  3JTD B;  5PAL A;  2KOT A;  2O60 A;  1MWN A;  3LK1 A;  5I2Q A;  3FWC A;  4GAO A;  5B8I B;  1XK4 A;  4JWQ A;  1XA5 A;  2LHI A;  4C0K A;  1W7I B;  1NPQ A;  3VRN A;  1KFX S;  1CKK A;  1B47 A;  2BL0 B;  4YGE B;  3PN7 C;  3BQ3 A;  1NSH A;  2KYC A;  1C07 A;  2LE9 B;  2D8N A;  3VRO A;  2PSR A;  3SIA A;  2KAV A;  1NCZ A;  1K95 A;  1NCY A;  1KSO A;  4OCI A;  1GGW A;  2K7B A;  1BG1 A;  1S1E A;  2CNP A;  2KFH A;  2ZKM X;  1UHK A;  2CT9 A;  3D0Y A;  2M7L A;  1PK0 D;  2JNF A;  1G4Y R;  3CTN A;  3ZWH A;  4I5J A;  2LP2 A;  1TN4 A;  2KNE A;  2I18 A;  1UHJ A;  1YVH A;  1BJF A;  1NCX A;  1KQM B;  2M9G A;  1YR5 A;  2LVJ A;  4MRX A;  1K2H A;  3PM8 A;  1RRO A;  4MRY A;  4A4B A;  4GNK B;  4HRH A;  1B7T Z;  1HQV A;  1K96 A;  4ZCU A;  1QV0 A;  1RJV A;  4AQJ A;  2K61 A;  1JF0 A;  2KFF A;  4FTG A;  1A2X A;  2COL B;  1J55 A;  1SRA A;  1SW8 A;  3I5H B;  5AAN A;  1NP8 A;  1DJG A;  1EH2 A;  3DD4 A;  4YI9 A;  1AVS A;  3DVM A;  4PAL A;  1QX5 B;  1XYD A;  2MBX A;  4CID A;  1QVI Z;  4M2Q A;  5CPV A;  2OTG C;  1M63 B;  1M46 A;  3PN7 B;  1DF0 B;  1YUT A;  1C7W A;  1TOP A;  4F0Z B;  2WOS A;  3WXA A;  4C0L A;  2Y4Q A;  2CTN A;  3VRQ A;  2BEC A;  1LA0 A;  5KU1 A;  2KI6 D;  3K21 A;  2L4I A;  1CTR A;  2FJU B;  4E68 A;  1CMG A;  2QPT A;  4HRE E;  1JFJ A;  2H2K A;  1L2O C;  3OX6 A;  1SNL A;  1S36 A;  4P2Y B;  4ETO A;  2WC8 A;  2IS9 A;  2ZN9 A;  1PVB A;  4PHK A;  1ODB A;  4YI8 A;  1IQ5 A;  1JSA A;  1CLL A;  4MZK A;  1UUS A;  4YGA A;  1CLB A;  4DS7 A;  2M7N A;  3BOW A;  3HCM A;  4CFR A;  2DOQ A;  3EKH A;  3I5I B;  1TNW A;  1XFY O;  1IJ6 A;  1PSR A;  1J7P A;  1W7J B;  2B1U A;  5TNC A;  4NDB A;  1IH0 A;  2LHL A;  5CSI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...