2WCEA

Calcium-free (apo) s100a12
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
91
structure length
91
Chain Sequence
STKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISMVAIALKAAHYHTHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN S100-A12
publication title The Crystal Structures of Human S100A12 in Apo Form and in Complex with Zinc: New Insights Into S100A12 Oligomerisation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 34
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2wceA00
3EK7A 4I5KA 1CLLA 5IBWA 1JSAA 1FI5A 1R6PA 4FQOA 1M63B 1SK6D 3PFVA 1QIVA 3CLNA 4U8DA 1A29A 1CDMA 2BL0C 4DUQA 1GGWA 4PE1A 1Y1AA 1XFVO 2Y1NA 2H2KA 1MWNA 3FIAA 1K9PA 1OZSA 1KSOA 4MEWA 3VRQA 1YUSA 3TS5C 4PHNA 1OMRA 1UHKA 3DVKA 1EG4A 1AVSA 3D0YA 1L7ZA 5ER5A 2LLUA 1K2HA 1KFXL 3BXKA 5AANA 2M7LA 3OHMB 1QV1A 5D69A 1KK7Y 2F2PA 3JTDC 1YX7A 2EC6B 2JPTA 4HRGA 1NX1A 1DT7B 2L51A 2FCDA 1KQMB 3SIAA 3D0YB 3F45A 1SCVA 1B9AA 2CXJA 1KK8C 2OS8B 2M9GA 4M2PA 3TS5B 4DIRA 2K61A 1NX3A 1JF0A 2RGIA 4R1EA 5F6TA 1RFJA 3KO0A 1LKJA 5I2OA 2Q4UA 2QACA 1E8AA 1BJFA 1W7JB 4N5XA 4PCWA 4Q04A 3GK4X 1XK4C 1CLBA 1ZMZA 1C07A 1K93D 2LM5A 1TNWA 4QJ3B 1ZOTB 4AQJA 2K7BA 1GJYA 1Y1XA 3DD4A 3CZTX 2JT3A 1OMVA 1OSAA 2MJWB 5KSZA 1EG3A 2LMVA 3I5FB 4PHMA 1SBJA 2KDHA 3KPXA 5J3XA 4OR9B 2LVJA 1SRAA 2ZFDA 1CNPA 1CDLA 1XFUO 1MXEA 1TNXA 2JC2A 1RTP1 3VRRA 4MZJA 4PHKA 1SCMB 2M97A 1YX8A 1K96A 4M2QA 4GGFC 5HKZA 2KGBC 1CFDA 2PSRA 3WNXB 4DRWA 5DKNA 3BQ3A 4D1EA 1DJIA 1K9KA 5AFPA 3CWGA 4UPGA 3KHEA 2Y4QA 1TTXA 2M49B 1Y0VH 4JQ0D 2I94A 1RECA 2KI4B 3SG4A 2E30A 2LCPA 5PALA 1RJVA 3PATA 1KCYA 2JULA 3VGOA 1M45A 2NCPA 3CGAA 2BECA 1W7IB 2CTNA 3K21A 1SMGA 2JQ6A 5HKYA 1FF1A 2HQWA 4YGDB 2IS9A 1X02A 4QJ4B 2L4HA 4N1FA 4NQGA 5HKWA 1XA5A 1S6CA 2I2RE 3FS7A 2F3YA 2M1KB 2AAOA 1Q80A 3WHUB 1F8HA 3DVMA 4M2OA 4PDZA 3EVRA 3SG5A 2KAYA 3SJSA 2KYCA 5JJGA 4HSZA 3QRXA 5JOLA 1HT9A 1DGUA 1IQ5A 1CDNA 2KBMA 3VRNA 4N1GA 2KAVA 3OP0A 1CDPA 3HCMA 2HF5A 2LUXA 1AJ5A 2TN4A 3ICBA 4BY4A 1B1GA 1CMGA 2LVKA 2QPTA 3IF7A 1TCFA 2KI6C 1YTZC 2KHNA 3GK1A 2D8NA 3LK0A 3CR5X 4MSPA 1DVIA 1QX5B 2H61C 1NCZA 3AAKA 3PSRA 4C0LA 2ZRTA 1SW8A 1Y6WA 2LLSA 2CCMA 5DKRA 3NSKA 2PALA 2ZRSA 1RROA 1R2UA 2KNEA 3AAJA 3DVEA 1IH0A 2FOTA 2HPSA 1QATA 1JF2A 3HX4A 1S6JA 4E68A 2K7CA 2JRFA 4L9MA 3NXAA 3EK4A 4OVNF 3PN7B 3M0WA 1QVIY 4PE4A 1PVBA 1QS7A 2V53A 1CLMA 1QIWA 2OPOA 1IWQA 1QJTA 4GBAA 2WCEA 4GNKB 2K2FA 3OB2B 2LVVA 1YVHA 5KTYA 4ORBB 3CR2A 4P5OE 2NZ0A 3A4UB 3VRPA 1NUBA 2O5GA 2L98A 3DVJA 2BL0B 3DF0A 2K7DA 1M31A 2M1UA 1N65A 2SASA 2MRDA 4YGAA 3E3RA 1S36A 2CT9A 1YRUB 1N2DA 2BBMA 1G33A 3EKHA 1IJ5A 1JC2A 1KWOC 1B8CA 4F0ZB 1B4CA 1S6IA 1S3PA 3DF0B 3PM8A 3RLZA 2OTGC 2JOJA 1IJ6A 3EVUA 3FWCA 4MZLA 4MBEA 3PALA 3I5GC 2EGDA 1DGVA 1KK7Z 2LE9B 2PRUA 3KF9A 1V1GA 3JTDB 3JVTC 2BCBA 5HYDA 2WCBA 1PSRA 4DS7A 2NXQA 2GGMA 2ZKMX 4WRIA 2Y1MA 1FW4A 1S1EA 4ORAB 1D1OA 2R2IA 3FWBA 1ODBA 1PULA 2F3ZA 5KU1A 3BUMB 1XK4A 2O60A 3PLFB 1KK8B 1BLQA 1S5GY 2KOTA 1YURA 4MVFA 3TZ1A 3SIBA 1WDCC 3TDUA 3SG6A 1PRWA 2KFFA 1FBVA 1K9UA 1OE9B 1UHNA 2LP2A 5CSNA 1CM4A 1WLMA 4MRYA 1A75A 4FTGA 3BUWB 1F54A 2K7OA 1K8UA 2MAZA 2JWWA 5FYXA 1DF0A 1YUTA 3LLEA 1WY9A 1XFXO 2F8PA 1OZOA 1KSMA 4WQ2A 2JXCA 1NCYA 1M39A 1JWDA 1SKTA 1A75B 1KFUS 3H4SE 1RK9A 2PASA 1WRZA 2LHLA 1DJWA 1QXPA 2L50A 2KQYA 1DF0B 1NX2A 1ALWA 1CB1A 1LXFC 4GGFA 4C0KA 1B8RA 4A4CA 1EJ3A 3EKJA 1J7OA 1SR6C 1VRKA 4YGEB 1PVAA 1NX0A 1NCXA 1BR4B 2GGZA 3WXAA 1H8BA 1XYDA 3TDZA 1C7VA 1FPWA 4WQ3A 1UHHA 1AHRA 2AUCA 2CBLA 2FCEA 3I5IC 2ISDA 2MHHA 1UHJA 2BCAA 4GAOA 3IQOA 4YGBB 1A4PA 3I5HC 1DJYA 3SG7A 3SG2A 3OX5A 4PHJA 1SL7A 2JTTA 3O6BA 2LMTA 2A4JA 1QASA 3GK2A 3NSIA 1EH2A 1L2OC 1XFYO 2KI6D 2LP3A 4OCIA 3SG3A 1ZACA 2ZN8A 4MLWA 1A2XA 2WNDA 4MRXA 1SYMA 1UHIA 2VRGA 1F70A 2BE4A 1PK0D 2MLEC 1YVLA 1PSBA 2GV5A 2M0RA 1KFUL 1J7RA 2JTZA 1AP4A 1K90D 2G9BA 1J55A 3VROA 1G4YR 3MSEB 1QTXA 2BCXA 2LV7A 2HETA 3BOWB 1S26D 1CTRA 1TN4A 2P6BB 3TUYC 1QX7A 2K8MB 1IRJA 2H61A 4GPLB 2LMUA 3RM1A 4OV2A 2LVIA 5I2LA 5I2QA 4A4BA 1XVJA 2KGRA 1TOPA 3KEVA 4HREE 2LLTA 5CSFA 1GGZA 2F33A 5GQQC 1DJHA 1QLSA 4GGNA 1AK8A 2I18A 2KYFA 1DMOA 4AOMA 2L2EA 1XO5A 1C7WA 1B7TY 1LA0A 3OB1B 1CM1A 3GOFA 1NPQA 1K95A 1SL8A 1TIZA 1JFKA 3CTNA 5CSIA 4JWQA 1KQVA 1QX2A 2B1UA 2CNPA 1MR8A 2L0PA 1QVIZ 3LK1A 3O78A 2M29A 4GUKA 4YI9A 1A03A 1B7TZ 4MN0A 1ZUZA 2K2AA 3AKAA 2EC6C 1B8LA 2WC8A 1KQMC 2KFHA 1TNPA 3AKBA 4XYNA 4ETOA 1F4OA 3BUNB 3A8RA 1J1EA 3BUOB 2OS8C 4CIDA 5D7FA 1M46A 2MLFC 4DCKA 1F4QA 2HQ8A 1IQ3A 3NSOA 1CFCA 2NLNA 2KBIA 4PALA 4PE7A 1TCOB 1CKKA 2JT0A 3BUXB 1XFWO 1IKUA 4IL1A 1KWOB 4BY5A 4HRHA 2BKHB 2WOSA 5G08A 4CFQA 1NWDA 1TNQA 2AMIA 2KQ6A 3NSLA 1JBAA 2BKIB 2KAXA 2L4IA 2M3WA 2JZIA 2OTGB 3ZNIA 1NIWA 1F71A 2LANA 1OQPA 3I5GB 1UURA 1YRTB 1YUUA 2M8UA 3I5FC 4ZCUA 2NCOA 1F55A 4I5NB 2JT8A 1LINA 1BG1A 1HQVA 1MQ1A 3JVTB 3EK8A 2BBNA 1LA3A 1OMDA 1SPYA 1TRFA 1UP5A 1SCMC 1S5GZ 1G8IA 4NDDA 4MZKA 1BF5A 5HLOA 1BMOA 5CSJA 2K0JA 4JPZB 1WLZA 5AEQA 1WDCB 1EXRA 3LL8B 5AERA 1JFJA 1XFZO 1JUOA 2FJUB 2DOQA 2KFGA 1H4BA 1J1DA 5CPVA 3CR4X 2M7NA 2WCFA 2ZNEA 2JNFA 1AUIB 4ORCB 2COLB 2ZN9A 1CFFA 4NDBA 2EHBA 4GFTA 2MBXA 4I5JA 2WORA 2KI4C 1ALVA 1MF8B 5K89A 1IGVA 4OKHA 2Q91A 2JU0A 3CS1A 5BPJA 2Y5IA 3LCPC 1B47A 1MUXA 2BE6A 1NSHA 1CFPA 4TNCA 1DJGA 1K94A 2LAPA 1LVCD 1N0YA 3ZWHA 1AJ4A 4YBHB 1SL9A 1ZFSA 2MA2A 1IG5A 1BT6A 1SR6B 1UUSA 2PMYA 3OX6A 1MXLC 1NP8A 4QJ5B 1DJXA 3BYAA 2LUCA 4AQIA 1BU3A 2SCPA 5I8NA 1SY9A 5AXIA 1DJZA 3O4YA 4ZCVA 3BOWA 1BODA 5TNCA 3I5IB 2LHIA 1EL4A 1J7QA 2I7AA 4P2YB 1V1FA 3I5HB 1QLKA 5ER4X 3TDIA 2JXLA 2L5XB 2KSPA 1OOJA 2F2OA 1NYAA 4YRUA 4NDCA 1FI6A 1Y1UA 1UWOA 2ZNDA 1L2OB 1YR5A 1U5IA 4I5LB 4YI8A 1RWYA 2LNKA 1QV0A 3IQQA 4PE0A 1GQMA 5HLVA 3D10A 1J7PA 1WRLA 4XJKA 1PALA 4ICBA 2G2BA 1U5IB 2E6WA 1SNLA 3O2PA 4USLA 5B8IB 3C1VA 4YGCB 1KFXS 3PN7C 3WHTB 2PVBA 1MHOA 2LC5A 4CLNA 1BOCA 3TUYB 1BR1B 4XJKB 4CFRA 5DKQA 4C0JA 3EVVA 1CMFA 2JNXA 4CPVA 1DTLA 1WRKA
chains in the Genus database with same CATH superfamily
3EK7A 2L5YA 4I5KA 1CLLA 5IBWA 1JSAA 3S0GA 1FI5A 1R6PA 4FQOA 1M63B 3N7HA 1SK6D 3PFVA 1QIVA 1DELA 3CLNA 4U8DA 1A29A 1CDMA 2BL0C 1SSEB 4DUQA 3UNWA 1GGWA 4PE1A 1Y1AA 1XFVO 3BFBA 2Y1NA 2H2KA 1DC1A 1MWNA 3FIAA 1K9PA 1OZSA 1KSOA 3CZ0A 5D3OA 4MEWA 3VRQA 1YUSA 3TS5C 4PHNA 1OMRA 1UHKA 3DVKA 1EG4A 1AVSA 3D0YA 1L7ZA 5ER5A 2LLUA 1K2HA 1KFXL 3BXKA 5AANA 2M7LA 3OHMB 1QV1A 3QMEA 5D69A 1KK7Y 2F2PA 3JTDC 1YX7A 2EC6B 2JPTA 4HRGA 1NX1A 1DT7B 2L51A 2FCDA 1KQMB 3SIAA 3D0YB 3F45A 1SCVA 1B9AA 2CXJA 1KK8C 2OS8B 2M9GA 4M2PA 3TS5B 4DIRA 2K61A 1NX3A 1JF0A 2RGIA 4R1EA 5F6TA 1RFJA 3KO0A 1LKJA 1OOIX 2Q4UA 5I2OA 3S0FA 2QACA 1E8AA 3DZTA 1BJFA 1W7JB 4N5XA 4PCWA 4Q04A 3GK4X 1XK4C 1CLBA 1ZMZA 1C07A 1K93D 2LM5A 1TNWA 4QJ3B 1ZOTB 4AQJA 2K7BA 1GJYA 1Y1XA 3DD4A 3CZTX 3PJIA 2JT3A 1OMVA 1OSAA 2MJWB 5KSZA 1EG3A 3D76A 2LMVA 3I5FB 4PHMA 1SBJA 2KDHA 3KPXA 5J3XA 4OR9B 2LVJA 1SRAA 2ZFDA 1CNPA 1CDLA 1XFUO 1MXEA 1TNXA 2JC2A 3CZ1A 1RTP1 3VRRA 4MZJA 4PHKA 1SCMB 2M97A 2WCLA 1YX8A 1K96A 4M2QA 4GGFC 5HKZA 2KGBC 1Z4HA 1CFDA 2PSRA 3WNXB 3IVTA 5DKNA 3BQ3A 4DRWA 3DYEA 4D1EA 1DJIA 1K9KA 5AFPA 3CWGA 4UPGA 3KHEA 3Q8IA 2Y4QA 1TTXA 2M49B 1Y0VH 4JQ0D 2I94A 1RECA 2KI4B 3SG4A 2E30A 2LCPA 5PALA 1RJVA 3PATA 1KCYA 2JULA 3VGOA 1M45A 1T14A 2NCPA 3CGAA 2BECA 1W7IB 2CTNA 3FE9A 1SMGA 2JQ6A 3K21A 5HKYA 1FF1A 2HQWA 5HL1A 4YGDB 2IS9A 1X02A 4QJ4B 2L4HA 4FQTA 4N1FA 4NQGA 5HKWA 1XA5A 1S6CA 3L4LA 2I2RE 3BJHA 2F3YA 2M1KB 3FS7A 2AAOA 1Q80A 3O4XA 3WHUB 1F8HA 3DVMA 4M2OA 4PDZA 3EVRA 3SG5A 2KAYA 3SJSA 2KYCA 5JJGA 4HSZA 1C3YA 3QRXA 5JOLA 1HT9A 1DGUA 1IQ5A 2PYQA 2WCMA 3B87A 1CDNA 2H8VA 2KBMA 3SS3A 3VRNA 4N1GA 2KAVA 3OP0A 3PM2A 1CDPA 3HCMA 2HF5A 2LUXA 1AJ5A 2TN4A 3ICBA 4BY4A 1B1GA 1CMGA 2LVKA 2QPTA 3IF7A 1TCFA 2KI6C 1YTZC 2KHNA 3GK1A 2D8NA 3LK0A 3CR5X 4MSPA 1DVIA 1QX5B 2H61C 1NCZA 3AAKA 3PSRA 3R1VA 1DEKA 1SW8A 1Y6WA 2LLSA 2CCMA 2ZRTA 2P70A 5DKRA 3NSKA 2PALA 2ZRSA 1RROA 1R2UA 3V2LA 2KNEA 3AAJA 3DVEA 2QEHA 2FOTA 2HPSA 1IH0A 1QATA 1JF2A 3HX4A 1S6JA 4E68A 2K7CA 3BFAA 2JRFA 4L9MA 3NXAA 3EK4A 4OVNF 3PN7B 2L2CA 3M0WA 1QVIY 4PE4A 1OOHA 1PVBA 1QS7A 2V53A 1CLMA 1QIWA 2OPOA 1IWQA 1QJTA 4GBAA 2WCEA 4GNKB 2K2FA 3OB2B 2FJYA 4JKTA 2LVVA 3NHTA 1YVHA 5KTYA 4ORBB 3CR2A 4P5OE 2NZ0A 3A4UB 5FI6A 3S0AA 3VRPA 5FI2A 1NUBA 4IJ7A 2O5GA 2L98A 3DVJA 2BL0B 3DF0A 2K7DA 1M31A 2M1UA 3RZSA 1N65A 2SASA 2MRDA 4YGAA 3E3RA 1S36A 2CT9A 1YRUB 1N2DA 2BBMA 1G33A 3EKHA 1IJ5A 1JC2A 1KWOC 1B8CA 4F0ZB 1B4CA 1S6IA 1S3PA 3DF0B 3PM8A 3RLZA 2OTGC 2JOJA 5I94A 1IJ6A 2WC5A 3EVUA 3FWCA 4MZLA 3D77A 4MBEA 3PALA 3I5GC 4INWA 2KLDA 2EGDA 1DGVA 1KK7Z 2LE9B 2PRUA 3KF9A 1V1GA 3JTDB 3JVTC 2BCBA 5HYDA 2WCBA 1PSRA 4DS7A 2NXQA 2GGMA 2ZKMX 4WRIA 2Y1MA 1FW4A 1S1EA 4ORAB 3S0BA 1D1OA 2R2IA 3FWBA 1ODBA 1PULA 2F3ZA 5KU1A 3BUMB 1XK4A 2O60A 3PLFB 1KK8B 1BLQA 1S5GY 2KOTA 1YURA 4MVFA 3TZ1A 3SIBA 1WDCC 1Z2CB 3TDUA 3SG6A 1PRWA 2KFFA 1FBVA 1K9UA 1OE9B 1UHNA 2LP2A 5CSNA 2KLEA 1CM4A 1WLMA 4MRYA 1A75A 4FTGA 1OOGA 3BUWB 1F54A 2K7OA 1K8UA 2MAZA 2JWWA 5FYXA 1DF0A 1YUTA 3LLEA 1WY9A 1XFXO 2F8PA 1OZOA 1OW4A 1KSMA 4WQ2A 2JXCA 1NCYA 1M39A 3R1PA 1SKTA 1JWDA 1A75B 1KFUS 3H4SE 1RK9A 2PASA 1WRZA 2LHLA 1DJWA 1QXPA 1LS8A 2L50A 2KQYA 1DF0B 1NX2A 1ALWA 1CB1A 1LXFC 4GGFA 4C0KA 1B8RA 4A4CA 3NGVA 1EJ3A 3EKJA 1J7OA 1GM0A 1SR6C 1VRKA 4YGEB 1PVAA 1NX0A 1NCXA 1BR4B 3OGNA 2GGZA 3WXAA 1H8BA 1P28A 1XYDA 3TDZA 2GTEA 1C7VA 1FPWA 4WQ3A 1UHHA 1AHRA 2AUCA 2CBLA 2FCEA 3I5IC 2ISDA 2MHHA 1UHJA 2BCAA 4GAOA 3IQOA 4YGBB 1A4PA 3I5HC 1DJYA 3NHIA 3SG7A 3SG2A 3OX5A 4PHJA 1SL7A 2JTTA 3O6BA 2WCHA 2LMTA 2A4JA 1QASA 3FE6A 3GK2A 3NSIA 1EH2A 1L2OC 1XFYO 2KI6D 2LP3A 3K1EA 4OCIA 3SG3A 1ZACA 2ZN8A 4MLWA 1A2XA 2WNDA 4MRXA 1SYMA 1UHIA 2QEVA 2VRGA 1F70A 1ORGA 1PK0D 2BE4A 2MLEC 1YVLA 1PSBA 2GV5A 2M0RA 1KFUL 1J7RA 2JTZA 1AP4A 1K90D 2G9BA 1J55A 3VROA 1G4YR 3MSEB 1QTXA 2BCXA 2LV7A 2HETA 2WC6A 3BOWB 5DICA 1S26D 1CTRA 1TN4A 2P6BB 3TUYC 1QX7A 2K8MB 1IRJA 2H61A 4GPLB 2LMUA 3RM1A 4OV2A 2LVIA 1QWVA 5I2LA 5I2QA 4A4BA 1XVJA 2KGRA 1TOPA 3KEVA 4HREE 2LLTA 3D75A 5CSFA 1GGZA 2F33A 5GQQC 3SS4A 1DJHA 1QLSA 4GGNA 1AK8A 3EG5B 2I18A 2KYFA 1DMOA 4AOMA 2L2EA 4F7FA 1XO5A 1C7WA 1B7TY 1LA0A 3OB1B 1CM1A 3GOFA 1NPQA 1K95A 1SL8A 1TIZA 1JFKA 3CTNA 5CSIA 4JWQA 1KQVA 3OBVA 1XFRA 1QX2A 2QEOA 2B1UA 2CNPA 2WCJA 1MR8A 2L0PA 1QVIZ 3LK1A 3O78A 3VB1A 2M29A 4GUKA 4YI9A 4OZDA 1A03A 1B7TZ 4MN0A 1ZUZA 2K2AA 3AKAA 3FE8A 2EC6C 1B8LA 2WC8A 1KQMC 2KFHA 1TNPA 3AKBA 4XYNA 4ETOA 1F4OA 3BUNB 3A8RA 1J1EA 3BUOB 2OS8C 4CIDA 3L4AA 5D7FA 1M46A 2MLFC 4DCKA 1F4QA 2HQ8A 1TUJA 3NSOA 1IQ3A 1CFCA 2NLNA 2KBIA 2WCKA 3B86A 1TCOB 4PALA 2JT0A 4PE7A 1CKKA 3BUXB 1XFWO 1IKUA 4IL1A 1KWOB 4BY5A 4HRHA 2BKHB 2WOSA 5G08A 4CFQA 1NWDA 1TNQA 2AMIA 4C0LA 2KQ6A 3CABA 3NSLA 1JBAA 2BKIB 2KAXA 2L4IA 2M3WA 2JZIA 2OTGB 2K60A 5EL2A 1TUZA 3ZNIA 1NIWA 2BNXA 1F71A 2LANA 1OQPA 1C3ZA 3I5GB 1UURA 1YRTB 1YUUA 2M8UA 3I5FC 4ZCUA 2NCOA 1F55A 4I5NB 2JT8A 1LINA 1BG1A 1HQVA 3B7AA 1MQ1A 3JVTB 2ERBA 3EK8A 2BBNA 1LA3A 1OMDA 1SPYA 2BAPA 3L47A 1TRFA 3DXLA 1UP5A 1SCMC 1S5GZ 1G8IA 4NDDA 2JPOA 3DY9A 4MZKA 5HLOA 1BMOA 5CSJA 2K0JA 1BF5A 4JPZB 1WLZA 5AEQA 1WDCB 1EXRA 3LL8B 3S0EA 5AERA 1JFJA 1XFZO 1JUOA 2FJUB 2DOQA 2KFGA 1OOFA 1H4BA 2P71A 1J1DA 5CPVA 3CR4X 2M7NA 2WCFA 5FI7A 2ZNEA 2JNFA 1AUIB 4ORCB 2COLB 2ZN9A 1CFFA 4NDBA 2EHBA 4GFTA 2MBXA 4I5JA 3R1OA 2WORA 2KI4C 1ALVA 1MF8B 5K89A 1IGVA 4OKHA 2Q91A 2JU0A 3CS1A 5BPJA 2Y5IA 3LCPC 1B47A 1MUXA 2BE6A 1NSHA 3CYZA 2KPHA 1CFPA 4TNCA 1DJGA 1K94A 2LAPA 1LVCD 1N0YA 3ZWHA 1AJ4A 3S0DA 4YBHB 1SL9A 1ZFSA 2MA2A 1IG5A 1BT6A 1SR6B 1UUSA 2PMYA 3OX6A 1MXLC 1NP8A 3D74A 4QJ5B 1DJXA 3BYAA 2LUCA 4AQIA 1BU3A 2SCPA 5I8NA 1SY9A 5AXIA 1DJZA 3O4YA 4ZCVA 3BOWA 1BODA 5TNCA 3I5IB 2LHIA 1EL4A 1J7QA 2I7AA 4P2YB 1V1FA 3I5HB 1QLKA 5ER4X 3TDIA 2JXLA 2QEBA 2L5XB 1DQEA 2KSPA 1OOJA 2QDIA 2F2OA 1NYAA 3SS5A 4YRUA 4NDCA 1TWOA 1FI6A 1Y1UA 1UWOA 2ZNDA 1L2OB 1YR5A 1IIOA 1U5IA 4I5LB 3D78A 4YI8A 3B88A 2PQLA 1RWYA 3UO9A 1W9ZA 2LNKA 1QV0A 3IQQA 4PE0A 1GQMA 5HLVA 3D10A 1J7PA 1WRLA 3D73A 4XJKA 1PALA 4ICBA 3CZ2A 2G2BA 1U5IB 2E6WA 1SNLA 2YGUA 3BFHA 3O2PA 4JD9A 4USLA 5B8IB 3C1VA 4YGCB 1KFXS 3R72A 3PN7C 4PT1A 3CDNA 2PVBA 1MHOA 2LC5A 4INXA 3WHTB 3TUYB 4CLNA 1BOCA 1BR1B 3B6XA 4XJKB 5DKQA 4CFRA 4C0JA 3EVVA 1CMFA 2JNXA 4KYNA 4CPVA 1DTLA 1WRKA
chains in the Genus database with same CATH topology
3EK7A 4I5KA 1CLLA 5IBWA 1JSAA 1FI5A 1R6PA 4FQOA 1M63B 1SK6D 3PFVA 1QIVA 3CLNA 4U8DA 1A29A 1CDMA 2BL0C 4DUQA 1GGWA 4PE1A 1Y1AA 1XFVO 2Y1NA 2H2KA 1MWNA 3FIAA 1K9PA 1OZSA 1KSOA 4MEWA 3VRQA 1YUSA 3TS5C 4PHNA 1OMRA 1UHKA 3DVKA 1EG4A 1AVSA 3D0YA 1L7ZA 5ER5A 2LLUA 1K2HA 1KFXL 3BXKA 5AANA 2M7LA 3OHMB 1QV1A 5D69A 1KK7Y 2F2PA 3JTDC 1YX7A 2EC6B 2JPTA 4HRGA 1NX1A 1DT7B 2L51A 2FCDA 1KQMB 3SIAA 3D0YB 3F45A 1SCVA 1B9AA 2CXJA 1KK8C 2OS8B 2M9GA 4M2PA 3TS5B 4DIRA 2K61A 1NX3A 1JF0A 2RGIA 4R1EA 5F6TA 1RFJA 3KO0A 1LKJA 5I2OA 2Q4UA 2QACA 1E8AA 1BJFA 1W7JB 4N5XA 4PCWA 4Q04A 3GK4X 1XK4C 1CLBA 1ZMZA 1C07A 1K93D 2LM5A 1TNWA 4QJ3B 1ZOTB 4AQJA 2K7BA 1GJYA 1Y1XA 3DD4A 3CZTX 2JT3A 1OMVA 1OSAA 2MJWB 5KSZA 1EG3A 2LMVA 3I5FB 4PHMA 1SBJA 2KDHA 3KPXA 5J3XA 4OR9B 2LVJA 1SRAA 2ZFDA 1CNPA 1CDLA 1XFUO 1MXEA 1TNXA 2JC2A 1RTP1 3VRRA 4MZJA 4PHKA 1SCMB 2M97A 1YX8A 1K96A 4M2QA 4GGFC 5HKZA 2KGBC 1CFDA 2PSRA 3WNXB 4DRWA 5DKNA 3BQ3A 4D1EA 1DJIA 1K9KA 5AFPA 3CWGA 4UPGA 3KHEA 2Y4QA 1TTXA 2M49B 1Y0VH 4JQ0D 2I94A 1RECA 2KI4B 3SG4A 2E30A 2LCPA 5PALA 1RJVA 3PATA 1KCYA 2JULA 3VGOA 1M45A 2NCPA 3CGAA 2BECA 1W7IB 2CTNA 3K21A 1SMGA 2JQ6A 5HKYA 1FF1A 2HQWA 4YGDB 2IS9A 1X02A 4QJ4B 2L4HA 4N1FA 4NQGA 5HKWA 1XA5A 1S6CA 2I2RE 3FS7A 2F3YA 2M1KB 2AAOA 1Q80A 3WHUB 1F8HA 3DVMA 4M2OA 4PDZA 3EVRA 3SG5A 2KAYA 3SJSA 2KYCA 5JJGA 4HSZA 3QRXA 5JOLA 1HT9A 1DGUA 1IQ5A 1CDNA 2KBMA 3VRNA 4N1GA 2KAVA 3OP0A 1CDPA 3HCMA 2HF5A 2LUXA 1AJ5A 2TN4A 3ICBA 4BY4A 1B1GA 1CMGA 2LVKA 2QPTA 3IF7A 1TCFA 2KI6C 1YTZC 2KHNA 3GK1A 2D8NA 3LK0A 3CR5X 4MSPA 1DVIA 1QX5B 2H61C 1NCZA 3AAKA 3PSRA 4C0LA 2ZRTA 1SW8A 1Y6WA 2LLSA 2CCMA 5DKRA 3NSKA 2PALA 2ZRSA 1RROA 1R2UA 2KNEA 3AAJA 3DVEA 1IH0A 2FOTA 2HPSA 1QATA 1JF2A 3HX4A 1S6JA 4E68A 2K7CA 2JRFA 4L9MA 3NXAA 3EK4A 4OVNF 3PN7B 3M0WA 1QVIY 4PE4A 1PVBA 1QS7A 2V53A 1CLMA 1QIWA 2OPOA 1IWQA 1QJTA 4GBAA 2WCEA 4GNKB 2K2FA 3OB2B 2LVVA 1YVHA 5KTYA 4ORBB 3CR2A 4P5OE 2NZ0A 3A4UB 3VRPA 1NUBA 2O5GA 2L98A 3DVJA 2BL0B 3DF0A 2K7DA 1M31A 2M1UA 1N65A 2SASA 2MRDA 4YGAA 3E3RA 1S36A 2CT9A 1YRUB 1N2DA 2BBMA 1G33A 3EKHA 1IJ5A 1JC2A 1KWOC 1B8CA 4F0ZB 1B4CA 1S6IA 1S3PA 3DF0B 3PM8A 3RLZA 2OTGC 2JOJA 1IJ6A 3EVUA 3FWCA 4MZLA 4MBEA 3PALA 3I5GC 2EGDA 1DGVA 1KK7Z 2LE9B 2PRUA 3KF9A 1V1GA 3JTDB 3JVTC 2BCBA 5HYDA 2WCBA 1PSRA 4DS7A 2NXQA 2GGMA 2ZKMX 4WRIA 2Y1MA 1FW4A 1S1EA 4ORAB 1D1OA 2R2IA 3FWBA 1ODBA 1PULA 2F3ZA 5KU1A 3BUMB 1XK4A 2O60A 3PLFB 1KK8B 1BLQA 1S5GY 2KOTA 1YURA 4MVFA 3TZ1A 3SIBA 1WDCC 3TDUA 3SG6A 1PRWA 2KFFA 1FBVA 1K9UA 1OE9B 1UHNA 2LP2A 5CSNA 1CM4A 1WLMA 4MRYA 1A75A 4FTGA 3BUWB 1F54A 2K7OA 1K8UA 2MAZA 2JWWA 5FYXA 1DF0A 1YUTA 3LLEA 1WY9A 1XFXO 2F8PA 1OZOA 1KSMA 4WQ2A 2JXCA 1NCYA 1M39A 1JWDA 1SKTA 1A75B 1KFUS 3H4SE 1RK9A 2PASA 1WRZA 2LHLA 1DJWA 1QXPA 2L50A 2KQYA 1DF0B 1NX2A 1ALWA 1CB1A 1LXFC 4GGFA 4C0KA 1B8RA 4A4CA 1EJ3A 3EKJA 1J7OA 1SR6C 1VRKA 4YGEB 1PVAA 1NX0A 1NCXA 1BR4B 2GGZA 3WXAA 1H8BA 1XYDA 3TDZA 1C7VA 1FPWA 4WQ3A 1UHHA 1AHRA 2AUCA 2CBLA 2FCEA 3I5IC 2ISDA 2MHHA 1UHJA 2BCAA 4GAOA 3IQOA 4YGBB 1A4PA 3I5HC 1DJYA 3SG7A 3SG2A 3OX5A 4PHJA 1SL7A 2JTTA 3O6BA 2LMTA 2A4JA 1QASA 3GK2A 3NSIA 1EH2A 1L2OC 1XFYO 2KI6D 2LP3A 4OCIA 3SG3A 1ZACA 2ZN8A 4MLWA 1A2XA 2WNDA 4MRXA 1SYMA 1UHIA 2VRGA 1F70A 2BE4A 1PK0D 2MLEC 1YVLA 1PSBA 2GV5A 2M0RA 1KFUL 1J7RA 2JTZA 1AP4A 1K90D 2G9BA 1J55A 3VROA 1G4YR 3MSEB 1QTXA 2BCXA 2LV7A 2HETA 3BOWB 1S26D 1CTRA 1TN4A 2P6BB 3TUYC 1QX7A 2K8MB 1IRJA 2H61A 4GPLB 2LMUA 3RM1A 4OV2A 2LVIA 5I2LA 5I2QA 4A4BA 1XVJA 2KGRA 1TOPA 3KEVA 4HREE 2LLTA 5CSFA 1GGZA 2F33A 5GQQC 1DJHA 1QLSA 4GGNA 1AK8A 2I18A 2KYFA 1DMOA 4AOMA 2L2EA 1XO5A 1C7WA 1B7TY 1LA0A 3OB1B 1CM1A 3GOFA 1NPQA 1K95A 1SL8A 1TIZA 1JFKA 3CTNA 5CSIA 4JWQA 1KQVA 1QX2A 2B1UA 2CNPA 1MR8A 2L0PA 1QVIZ 3LK1A 3O78A 2M29A 4GUKA 4YI9A 1A03A 1B7TZ 4MN0A 1ZUZA 2K2AA 3AKAA 2EC6C 1B8LA 2WC8A 1KQMC 2KFHA 1TNPA 3AKBA 4XYNA 4ETOA 1F4OA 3BUNB 3A8RA 1J1EA 3BUOB 2OS8C 4CIDA 5D7FA 1M46A 2MLFC 4DCKA 1F4QA 2HQ8A 1IQ3A 3NSOA 1CFCA 2NLNA 2KBIA 4PALA 4PE7A 1TCOB 1CKKA 2JT0A 3BUXB 1XFWO 1IKUA 4IL1A 1KWOB 4BY5A 4HRHA 2BKHB 2WOSA 5G08A 4CFQA 1NWDA 1TNQA 2AMIA 2KQ6A 3NSLA 1JBAA 2BKIB 2KAXA 2L4IA 2M3WA 2JZIA 2OTGB 3ZNIA 1NIWA 1F71A 2LANA 1OQPA 3I5GB 1UURA 1YRTB 1YUUA 2M8UA 3I5FC 4ZCUA 2NCOA 1F55A 4I5NB 2JT8A 1LINA 1BG1A 1HQVA 1MQ1A 3JVTB 3EK8A 2BBNA 1LA3A 1OMDA 1SPYA 1TRFA 1UP5A 1SCMC 1S5GZ 1G8IA 4NDDA 4MZKA 1BF5A 5HLOA 1BMOA 5CSJA 2K0JA 4JPZB 1WLZA 5AEQA 1WDCB 1EXRA 3LL8B 5AERA 1JFJA 1XFZO 1JUOA 2FJUB 2DOQA 2KFGA 1H4BA 1J1DA 5CPVA 3CR4X 2M7NA 2WCFA 2ZNEA 2JNFA 1AUIB 4ORCB 2COLB 2ZN9A 1CFFA 4NDBA 2EHBA 4GFTA 2MBXA 4I5JA 2WORA 2KI4C 1ALVA 1MF8B 5K89A 1IGVA 4OKHA 2Q91A 2JU0A 3CS1A 5BPJA 2Y5IA 3LCPC 1B47A 1MUXA 2BE6A 1NSHA 1CFPA 4TNCA 1DJGA 1K94A 2LAPA 1LVCD 1N0YA 3ZWHA 1AJ4A 4YBHB 1SL9A 1ZFSA 2MA2A 1IG5A 1BT6A 1SR6B 1UUSA 2PMYA 3OX6A 1MXLC 1NP8A 4QJ5B 1DJXA 3BYAA 2LUCA 4AQIA 1BU3A 2SCPA 5I8NA 1SY9A 5AXIA 1DJZA 3O4YA 4ZCVA 3BOWA 1BODA 5TNCA 3I5IB 2LHIA 1EL4A 1J7QA 2I7AA 4P2YB 1V1FA 3I5HB 1QLKA 5ER4X 3TDIA 2JXLA 2L5XB 2KSPA 1OOJA 2F2OA 1NYAA 4YRUA 4NDCA 1FI6A 1Y1UA 1UWOA 2ZNDA 1L2OB 1YR5A 1U5IA 4I5LB 4YI8A 1RWYA 2LNKA 1QV0A 3IQQA 4PE0A 1GQMA 5HLVA 3D10A 1J7PA 1WRLA 4XJKA 1PALA 4ICBA 2G2BA 1U5IB 2E6WA 1SNLA 3O2PA 4USLA 5B8IB 3C1VA 4YGCB 1KFXS 3PN7C 3WHTB 2PVBA 1MHOA 2LC5A 4CLNA 1BOCA 3TUYB 1BR1B 4XJKB 4CFRA 5DKQA 4C0JA 3EVVA 1CMFA 2JNXA 4CPVA 1DTLA 1WRKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EK7 A;  4I5K A;  1CLL A;  5IBW A;  1JSA A;  1FI5 A;  1R6P A;  4FQO A;  1M63 B;  1SK6 D;  3PFV A;  1QIV A;  3CLN A;  4U8D A;  1A29 A;  1CDM A;  2BL0 C;  4DUQ A;  1GGW A;  4PE1 A;  1Y1A A;  1XFV O;  2Y1N A;  2H2K A;  1MWN A;  3FIA A;  1K9P A;  1OZS A;  1KSO A;  4MEW A;  3VRQ A;  1YUS A;  3TS5 C;  4PHN A;  1OMR A;  1UHK A;  3DVK A;  1EG4 A;  1AVS A;  3D0Y A;  1L7Z A;  5ER5 A;  2LLU A;  1K2H A;  1KFX L;  3BXK A;  5AAN A;  2M7L A;  3OHM B;  1QV1 A;  5D69 A;  1KK7 Y;  2F2P A;  3JTD C;  1YX7 A;  2EC6 B;  2JPT A;  4HRG A;  1NX1 A;  1DT7 B;  2L51 A;  2FCD A;  1KQM B;  3SIA A;  3D0Y B;  3F45 A;  1SCV A;  1B9A A;  2CXJ A;  1KK8 C;  2OS8 B;  2M9G A;  4M2P A;  3TS5 B;  4DIR A;  2K61 A;  1NX3 A;  1JF0 A;  2RGI A;  4R1E A;  5F6T A;  1RFJ A;  3KO0 A;  1LKJ A;  5I2O A;  2Q4U A;  2QAC A;  1E8A A;  1BJF A;  1W7J B;  4N5X A;  4PCW A;  4Q04 A;  3GK4 X;  1XK4 C;  1CLB A;  1ZMZ A;  1C07 A;  1K93 D;  2LM5 A;  1TNW A;  4QJ3 B;  1ZOT B;  4AQJ A;  2K7B A;  1GJY A;  1Y1X A;  3DD4 A;  3CZT X;  2JT3 A;  1OMV A;  1OSA A;  2MJW B;  5KSZ A;  1EG3 A;  2LMV A;  3I5F B;  4PHM A;  1SBJ A;  2KDH A;  3KPX A;  5J3X A;  4OR9 B;  2LVJ A;  1SRA A;  2ZFD A;  1CNP A;  1CDL A;  1XFU O;  1MXE A;  1TNX A;  2JC2 A;  1RTP 1;  3VRR A;  4MZJ A;  4PHK A;  1SCM B;  2M97 A;  1YX8 A;  1K96 A;  4M2Q A;  4GGF C;  5HKZ A;  2KGB C;  1CFD A;  2PSR A;  3WNX B;  4DRW A;  5DKN A;  3BQ3 A;  4D1E A;  1DJI A;  1K9K A;  5AFP A;  3CWG A;  4UPG A;  3KHE A;  2Y4Q A;  1TTX A;  2M49 B;  1Y0V H;  4JQ0 D;  2I94 A;  1REC A;  2KI4 B;  3SG4 A;  2E30 A;  2LCP A;  5PAL A;  1RJV A;  3PAT A;  1KCY A;  2JUL A;  3VGO A;  1M45 A;  2NCP A;  3CGA A;  2BEC A;  1W7I B;  2CTN A;  3K21 A;  1SMG A;  2JQ6 A;  5HKY A;  1FF1 A;  2HQW A;  4YGD B;  2IS9 A;  1X02 A;  4QJ4 B;  2L4H A;  4N1F A;  4NQG A;  5HKW A;  1XA5 A;  1S6C A;  2I2R E;  3FS7 A;  2F3Y A;  2M1K B;  2AAO A;  1Q80 A;  3WHU B;  1F8H A;  3DVM A;  4M2O A;  4PDZ A;  3EVR A;  3SG5 A;  2KAY A;  3SJS A;  2KYC A;  5JJG A;  4HSZ A;  3QRX A;  5JOL A;  1HT9 A;  1DGU A;  1IQ5 A;  1CDN A;  2KBM A;  3VRN A;  4N1G A;  2KAV A;  3OP0 A;  1CDP A;  3HCM A;  2HF5 A;  2LUX A;  1AJ5 A;  2TN4 A;  3ICB A;  4BY4 A;  1B1G A;  1CMG A;  2LVK A;  2QPT A;  3IF7 A;  1TCF A;  2KI6 C;  1YTZ C;  2KHN A;  3GK1 A;  2D8N A;  3LK0 A;  3CR5 X;  4MSP A;  1DVI A;  1QX5 B;  2H61 C;  1NCZ A;  3AAK A;  3PSR A;  4C0L A;  2ZRT A;  1SW8 A;  1Y6W A;  2LLS A;  2CCM A;  5DKR A;  3NSK A;  2PAL A;  2ZRS A;  1RRO A;  1R2U A;  2KNE A;  3AAJ A;  3DVE A;  1IH0 A;  2FOT A;  2HPS A;  1QAT A;  1JF2 A;  3HX4 A;  1S6J A;  4E68 A;  2K7C A;  2JRF A;  4L9M A;  3NXA A;  3EK4 A;  4OVN F;  3PN7 B;  3M0W A;  1QVI Y;  4PE4 A;  1PVB A;  1QS7 A;  2V53 A;  1CLM A;  1QIW A;  2OPO A;  1IWQ A;  1QJT A;  4GBA A;  2WCE A;  4GNK B;  2K2F A;  3OB2 B;  2LVV A;  1YVH A;  5KTY A;  4ORB B;  3CR2 A;  4P5O E;  2NZ0 A;  3A4U B;  3VRP A;  1NUB A;  2O5G A;  2L98 A;  3DVJ A;  2BL0 B;  3DF0 A;  2K7D A;  1M31 A;  2M1U A;  1N65 A;  2SAS A;  2MRD A;  4YGA A;  3E3R A;  1S36 A;  2CT9 A;  1YRU B;  1N2D A;  2BBM A;  1G33 A;  3EKH A;  1IJ5 A;  1JC2 A;  1KWO C;  1B8C A;  4F0Z B;  1B4C A;  1S6I A;  1S3P A;  3DF0 B;  3PM8 A;  3RLZ A;  2OTG C;  2JOJ A;  1IJ6 A;  3EVU A;  3FWC A;  4MZL A;  4MBE A;  3PAL A;  3I5G C;  2EGD A;  1DGV A;  1KK7 Z;  2LE9 B;  2PRU A;  3KF9 A;  1V1G A;  3JTD B;  3JVT C;  2BCB A;  5HYD A;  2WCB A;  1PSR A;  4DS7 A;  2NXQ A;  2GGM A;  2ZKM X;  4WRI A;  2Y1M A;  1FW4 A;  1S1E A;  4ORA B;  1D1O A;  2R2I A;  3FWB A;  1ODB A;  1PUL A;  2F3Z A;  5KU1 A;  3BUM B;  1XK4 A;  2O60 A;  3PLF B;  1KK8 B;  1BLQ A;  1S5G Y;  2KOT A;  1YUR A;  4MVF A;  3TZ1 A;  3SIB A;  1WDC C;  3TDU A;  3SG6 A;  1PRW A;  2KFF A;  1FBV A;  1K9U A;  1OE9 B;  1UHN A;  2LP2 A;  5CSN A;  1CM4 A;  1WLM A;  4MRY A;  1A75 A;  4FTG A;  3BUW B;  1F54 A;  2K7O A;  1K8U A;  2MAZ A;  2JWW A;  5FYX A;  1DF0 A;  1YUT A;  3LLE A;  1WY9 A;  1XFX O;  2F8P A;  1OZO A;  1KSM A;  4WQ2 A;  2JXC A;  1NCY A;  1M39 A;  1JWD A;  1SKT A;  1A75 B;  1KFU S;  3H4S E;  1RK9 A;  2PAS A;  1WRZ A;  2LHL A;  1DJW A;  1QXP A;  2L50 A;  2KQY A;  1DF0 B;  1NX2 A;  1ALW A;  1CB1 A;  1LXF C;  4GGF A;  4C0K A;  1B8R A;  4A4C A;  1EJ3 A;  3EKJ A;  1J7O A;  1SR6 C;  1VRK A;  4YGE B;  1PVA A;  1NX0 A;  1NCX A;  1BR4 B;  2GGZ A;  3WXA A;  1H8B A;  1XYD A;  3TDZ A;  1C7V A;  1FPW A;  4WQ3 A;  1UHH A;  1AHR A;  2AUC A;  2CBL A;  2FCE A;  3I5I C;  2ISD A;  2MHH A;  1UHJ A;  2BCA A;  4GAO A;  3IQO A;  4YGB B;  1A4P A;  3I5H C;  1DJY A;  3SG7 A;  3SG2 A;  3OX5 A;  4PHJ A;  1SL7 A;  2JTT A;  3O6B A;  2LMT A;  2A4J A;  1QAS A;  3GK2 A;  3NSI A;  1EH2 A;  1L2O C;  1XFY O;  2KI6 D;  2LP3 A;  4OCI A;  3SG3 A;  1ZAC A;  2ZN8 A;  4MLW A;  1A2X A;  2WND A;  4MRX A;  1SYM A;  1UHI A;  2VRG A;  1F70 A;  2BE4 A;  1PK0 D;  2MLE C;  1YVL A;  1PSB A;  2GV5 A;  2M0R A;  1KFU L;  1J7R A;  2JTZ A;  1AP4 A;  1K90 D;  2G9B A;  1J55 A;  3VRO A;  1G4Y R;  3MSE B;  1QTX A;  2BCX A;  2LV7 A;  2HET A;  3BOW B;  1S26 D;  1CTR A;  1TN4 A;  2P6B B;  3TUY C;  1QX7 A;  2K8M B;  1IRJ A;  2H61 A;  4GPL B;  2LMU A;  3RM1 A;  4OV2 A;  2LVI A;  5I2L A;  5I2Q A;  4A4B A;  1XVJ A;  2KGR A;  1TOP A;  3KEV A;  4HRE E;  2LLT A;  5CSF A;  1GGZ A;  2F33 A;  5GQQ C;  1DJH A;  1QLS A;  4GGN A;  1AK8 A;  2I18 A;  2KYF A;  1DMO A;  4AOM A;  2L2E A;  1XO5 A;  1C7W A;  1B7T Y;  1LA0 A;  3OB1 B;  1CM1 A;  3GOF A;  1NPQ A;  1K95 A;  1SL8 A;  1TIZ A;  1JFK A;  3CTN A;  5CSI A;  4JWQ A;  1KQV A;  1QX2 A;  2B1U A;  2CNP A;  1MR8 A;  2L0P A;  1QVI Z;  3LK1 A;  3O78 A;  2M29 A;  4GUK A;  4YI9 A;  1A03 A;  1B7T Z;  4MN0 A;  1ZUZ A;  2K2A A;  3AKA A;  2EC6 C;  1B8L A;  2WC8 A;  1KQM C;  2KFH A;  1TNP A;  3AKB A;  4XYN A;  4ETO A;  1F4O A;  3BUN B;  3A8R A;  1J1E A;  3BUO B;  2OS8 C;  4CID A;  5D7F A;  1M46 A;  2MLF C;  4DCK A;  1F4Q A;  2HQ8 A;  1IQ3 A;  3NSO A;  1CFC A;  2NLN A;  2KBI A;  4PAL A;  4PE7 A;  1TCO B;  1CKK A;  2JT0 A;  3BUX B;  1XFW O;  1IKU A;  4IL1 A;  1KWO B;  4BY5 A;  4HRH A;  2BKH B;  2WOS A;  5G08 A;  4CFQ A;  1NWD A;  1TNQ A;  2AMI A;  2KQ6 A;  3NSL A;  1JBA A;  2BKI B;  2KAX A;  2L4I A;  2M3W A;  2JZI A;  2OTG B;  3ZNI A;  1NIW A;  1F71 A;  2LAN A;  1OQP A;  3I5G B;  1UUR A;  1YRT B;  1YUU A;  2M8U A;  3I5F C;  4ZCU A;  2NCO A;  1F55 A;  4I5N B;  2JT8 A;  1LIN A;  1BG1 A;  1HQV A;  1MQ1 A;  3JVT B;  3EK8 A;  2BBN A;  1LA3 A;  1OMD A;  1SPY A;  1TRF A;  1UP5 A;  1SCM C;  1S5G Z;  1G8I A;  4NDD A;  4MZK A;  1BF5 A;  5HLO A;  1BMO A;  5CSJ A;  2K0J A;  4JPZ B;  1WLZ A;  5AEQ A;  1WDC B;  1EXR A;  3LL8 B;  5AER A;  1JFJ A;  1XFZ O;  1JUO A;  2FJU B;  2DOQ A;  2KFG A;  1H4B A;  1J1D A;  5CPV A;  3CR4 X;  2M7N A;  2WCF A;  2ZNE A;  2JNF A;  1AUI B;  4ORC B;  2COL B;  2ZN9 A;  1CFF A;  4NDB A;  2EHB A;  4GFT A;  2MBX A;  4I5J A;  2WOR A;  2KI4 C;  1ALV A;  1MF8 B;  5K89 A;  1IGV A;  4OKH A;  2Q91 A;  2JU0 A;  3CS1 A;  5BPJ A;  2Y5I A;  3LCP C;  1B47 A;  1MUX A;  2BE6 A;  1NSH A;  1CFP A;  4TNC A;  1DJG A;  1K94 A;  2LAP A;  1LVC D;  1N0Y A;  3ZWH A;  1AJ4 A;  4YBH B;  1SL9 A;  1ZFS A;  2MA2 A;  1IG5 A;  1BT6 A;  1SR6 B;  1UUS A;  2PMY A;  3OX6 A;  1MXL C;  1NP8 A;  4QJ5 B;  1DJX A;  3BYA A;  2LUC A;  4AQI A;  1BU3 A;  2SCP A;  5I8N A;  1SY9 A;  5AXI A;  1DJZ A;  3O4Y A;  4ZCV A;  3BOW A;  1BOD A;  5TNC A;  3I5I B;  2LHI A;  1EL4 A;  1J7Q A;  2I7A A;  4P2Y B;  1V1F A;  3I5H B;  1QLK A;  5ER4 X;  3TDI A;  2JXL A;  2L5X B;  2KSP A;  1OOJ A;  2F2O A;  1NYA A;  4YRU A;  4NDC A;  1FI6 A;  1Y1U A;  1UWO A;  2ZND A;  1L2O B;  1YR5 A;  1U5I A;  4I5L B;  4YI8 A;  1RWY A;  2LNK A;  1QV0 A;  3IQQ A;  4PE0 A;  1GQM A;  5HLV A;  3D10 A;  1J7P A;  1WRL A;  4XJK A;  1PAL A;  4ICB A;  2G2B A;  1U5I B;  2E6W A;  1SNL A;  3O2P A;  4USL A;  5B8I B;  3C1V A;  4YGC B;  1KFX S;  3PN7 C;  3WHT B;  2PVB A;  1MHO A;  2LC5 A;  4CLN A;  1BOC A;  3TUY B;  1BR1 B;  4XJK B;  4CFR A;  5DKQ A;  4C0J A;  3EVV A;  1CMF A;  2JNX A;  4CPV A;  1DTL A;  1WRK A; 
#chains in the Genus database with same CATH topology
 3EK7 A;  2L5Y A;  4I5K A;  1CLL A;  5IBW A;  1JSA A;  3S0G A;  1FI5 A;  1R6P A;  4FQO A;  1M63 B;  3N7H A;  1SK6 D;  3PFV A;  1QIV A;  1DEL A;  3CLN A;  4U8D A;  1A29 A;  1CDM A;  2BL0 C;  1SSE B;  4DUQ A;  3UNW A;  1GGW A;  4PE1 A;  1Y1A A;  1XFV O;  3BFB A;  2Y1N A;  2H2K A;  1DC1 A;  1MWN A;  3FIA A;  1K9P A;  1OZS A;  1KSO A;  3CZ0 A;  5D3O A;  4MEW A;  3VRQ A;  1YUS A;  3TS5 C;  4PHN A;  1OMR A;  1UHK A;  3DVK A;  1EG4 A;  1AVS A;  3D0Y A;  1L7Z A;  5ER5 A;  2LLU A;  1K2H A;  1KFX L;  3BXK A;  5AAN A;  2M7L A;  3OHM B;  1QV1 A;  3QME A;  5D69 A;  1KK7 Y;  2F2P A;  3JTD C;  1YX7 A;  2EC6 B;  2JPT A;  4HRG A;  1NX1 A;  1DT7 B;  2L51 A;  2FCD A;  1KQM B;  3SIA A;  3D0Y B;  3F45 A;  1SCV A;  1B9A A;  2CXJ A;  1KK8 C;  2OS8 B;  2M9G A;  4M2P A;  3TS5 B;  4DIR A;  2K61 A;  1NX3 A;  1JF0 A;  2RGI A;  4R1E A;  5F6T A;  1RFJ A;  3KO0 A;  1LKJ A;  1OOI X;  2Q4U A;  5I2O A;  3S0F A;  2QAC A;  1E8A A;  3DZT A;  1BJF A;  1W7J B;  4N5X A;  4PCW A;  4Q04 A;  3GK4 X;  1XK4 C;  1CLB A;  1ZMZ A;  1C07 A;  1K93 D;  2LM5 A;  1TNW A;  4QJ3 B;  1ZOT B;  4AQJ A;  2K7B A;  1GJY A;  1Y1X A;  3DD4 A;  3CZT X;  3PJI A;  2JT3 A;  1OMV A;  1OSA A;  2MJW B;  5KSZ A;  1EG3 A;  3D76 A;  2LMV A;  3I5F B;  4PHM A;  1SBJ A;  2KDH A;  3KPX A;  5J3X A;  4OR9 B;  2LVJ A;  1SRA A;  2ZFD A;  1CNP A;  1CDL A;  1XFU O;  1MXE A;  1TNX A;  2JC2 A;  3CZ1 A;  1RTP 1;  3VRR A;  4MZJ A;  4PHK A;  1SCM B;  2M97 A;  2WCL A;  1YX8 A;  1K96 A;  4M2Q A;  4GGF C;  5HKZ A;  2KGB C;  1Z4H A;  1CFD A;  2PSR A;  3WNX B;  3IVT A;  5DKN A;  3BQ3 A;  4DRW A;  3DYE A;  4D1E A;  1DJI A;  1K9K A;  5AFP A;  3CWG A;  4UPG A;  3KHE A;  3Q8I A;  2Y4Q A;  1TTX A;  2M49 B;  1Y0V H;  4JQ0 D;  2I94 A;  1REC A;  2KI4 B;  3SG4 A;  2E30 A;  2LCP A;  5PAL A;  1RJV A;  3PAT A;  1KCY A;  2JUL A;  3VGO A;  1M45 A;  1T14 A;  2NCP A;  3CGA A;  2BEC A;  1W7I B;  2CTN A;  3FE9 A;  1SMG A;  2JQ6 A;  3K21 A;  5HKY A;  1FF1 A;  2HQW A;  5HL1 A;  4YGD B;  2IS9 A;  1X02 A;  4QJ4 B;  2L4H A;  4FQT A;  4N1F A;  4NQG A;  5HKW A;  1XA5 A;  1S6C A;  3L4L A;  2I2R E;  3BJH A;  2F3Y A;  2M1K B;  3FS7 A;  2AAO A;  1Q80 A;  3O4X A;  3WHU B;  1F8H A;  3DVM A;  4M2O A;  4PDZ A;  3EVR A;  3SG5 A;  2KAY A;  3SJS A;  2KYC A;  5JJG A;  4HSZ A;  1C3Y A;  3QRX A;  5JOL A;  1HT9 A;  1DGU A;  1IQ5 A;  2PYQ A;  2WCM A;  3B87 A;  1CDN A;  2H8V A;  2KBM A;  3SS3 A;  3VRN A;  4N1G A;  2KAV A;  3OP0 A;  3PM2 A;  1CDP A;  3HCM A;  2HF5 A;  2LUX A;  1AJ5 A;  2TN4 A;  3ICB A;  4BY4 A;  1B1G A;  1CMG A;  2LVK A;  2QPT A;  3IF7 A;  1TCF A;  2KI6 C;  1YTZ C;  2KHN A;  3GK1 A;  2D8N A;  3LK0 A;  3CR5 X;  4MSP A;  1DVI A;  1QX5 B;  2H61 C;  1NCZ A;  3AAK A;  3PSR A;  3R1V A;  1DEK A;  1SW8 A;  1Y6W A;  2LLS A;  2CCM A;  2ZRT A;  2P70 A;  5DKR A;  3NSK A;  2PAL A;  2ZRS A;  1RRO A;  1R2U A;  3V2L A;  2KNE A;  3AAJ A;  3DVE A;  2QEH A;  2FOT A;  2HPS A;  1IH0 A;  1QAT A;  1JF2 A;  3HX4 A;  1S6J A;  4E68 A;  2K7C A;  3BFA A;  2JRF A;  4L9M A;  3NXA A;  3EK4 A;  4OVN F;  3PN7 B;  2L2C A;  3M0W A;  1QVI Y;  4PE4 A;  1OOH A;  1PVB A;  1QS7 A;  2V53 A;  1CLM A;  1QIW A;  2OPO A;  1IWQ A;  1QJT A;  4GBA A;  2WCE A;  4GNK B;  2K2F A;  3OB2 B;  2FJY A;  4JKT A;  2LVV A;  3NHT A;  1YVH A;  5KTY A;  4ORB B;  3CR2 A;  4P5O E;  2NZ0 A;  3A4U B;  5FI6 A;  3S0A A;  3VRP A;  5FI2 A;  1NUB A;  4IJ7 A;  2O5G A;  2L98 A;  3DVJ A;  2BL0 B;  3DF0 A;  2K7D A;  1M31 A;  2M1U A;  3RZS A;  1N65 A;  2SAS A;  2MRD A;  4YGA A;  3E3R A;  1S36 A;  2CT9 A;  1YRU B;  1N2D A;  2BBM A;  1G33 A;  3EKH A;  1IJ5 A;  1JC2 A;  1KWO C;  1B8C A;  4F0Z B;  1B4C A;  1S6I A;  1S3P A;  3DF0 B;  3PM8 A;  3RLZ A;  2OTG C;  2JOJ A;  5I94 A;  1IJ6 A;  2WC5 A;  3EVU A;  3FWC A;  4MZL A;  3D77 A;  4MBE A;  3PAL A;  3I5G C;  4INW A;  2KLD A;  2EGD A;  1DGV A;  1KK7 Z;  2LE9 B;  2PRU A;  3KF9 A;  1V1G A;  3JTD B;  3JVT C;  2BCB A;  5HYD A;  2WCB A;  1PSR A;  4DS7 A;  2NXQ A;  2GGM A;  2ZKM X;  4WRI A;  2Y1M A;  1FW4 A;  1S1E A;  4ORA B;  3S0B A;  1D1O A;  2R2I A;  3FWB A;  1ODB A;  1PUL A;  2F3Z A;  5KU1 A;  3BUM B;  1XK4 A;  2O60 A;  3PLF B;  1KK8 B;  1BLQ A;  1S5G Y;  2KOT A;  1YUR A;  4MVF A;  3TZ1 A;  3SIB A;  1WDC C;  1Z2C B;  3TDU A;  3SG6 A;  1PRW A;  2KFF A;  1FBV A;  1K9U A;  1OE9 B;  1UHN A;  2LP2 A;  5CSN A;  2KLE A;  1CM4 A;  1WLM A;  4MRY A;  1A75 A;  4FTG A;  1OOG A;  3BUW B;  1F54 A;  2K7O A;  1K8U A;  2MAZ A;  2JWW A;  5FYX A;  1DF0 A;  1YUT A;  3LLE A;  1WY9 A;  1XFX O;  2F8P A;  1OZO A;  1OW4 A;  1KSM A;  4WQ2 A;  2JXC A;  1NCY A;  1M39 A;  3R1P A;  1SKT A;  1JWD A;  1A75 B;  1KFU S;  3H4S E;  1RK9 A;  2PAS A;  1WRZ A;  2LHL A;  1DJW A;  1QXP A;  1LS8 A;  2L50 A;  2KQY A;  1DF0 B;  1NX2 A;  1ALW A;  1CB1 A;  1LXF C;  4GGF A;  4C0K A;  1B8R A;  4A4C A;  3NGV A;  1EJ3 A;  3EKJ A;  1J7O A;  1GM0 A;  1SR6 C;  1VRK A;  4YGE B;  1PVA A;  1NX0 A;  1NCX A;  1BR4 B;  3OGN A;  2GGZ A;  3WXA A;  1H8B A;  1P28 A;  1XYD A;  3TDZ A;  2GTE A;  1C7V A;  1FPW A;  4WQ3 A;  1UHH A;  1AHR A;  2AUC A;  2CBL A;  2FCE A;  3I5I C;  2ISD A;  2MHH A;  1UHJ A;  2BCA A;  4GAO A;  3IQO A;  4YGB B;  1A4P A;  3I5H C;  1DJY A;  3NHI A;  3SG7 A;  3SG2 A;  3OX5 A;  4PHJ A;  1SL7 A;  2JTT A;  3O6B A;  2WCH A;  2LMT A;  2A4J A;  1QAS A;  3FE6 A;  3GK2 A;  3NSI A;  1EH2 A;  1L2O C;  1XFY O;  2KI6 D;  2LP3 A;  3K1E A;  4OCI A;  3SG3 A;  1ZAC A;  2ZN8 A;  4MLW A;  1A2X A;  2WND A;  4MRX A;  1SYM A;  1UHI A;  2QEV A;  2VRG A;  1F70 A;  1ORG A;  1PK0 D;  2BE4 A;  2MLE C;  1YVL A;  1PSB A;  2GV5 A;  2M0R A;  1KFU L;  1J7R A;  2JTZ A;  1AP4 A;  1K90 D;  2G9B A;  1J55 A;  3VRO A;  1G4Y R;  3MSE B;  1QTX A;  2BCX A;  2LV7 A;  2HET A;  2WC6 A;  3BOW B;  5DIC A;  1S26 D;  1CTR A;  1TN4 A;  2P6B B;  3TUY C;  1QX7 A;  2K8M B;  1IRJ A;  2H61 A;  4GPL B;  2LMU A;  3RM1 A;  4OV2 A;  2LVI A;  1QWV A;  5I2L A;  5I2Q A;  4A4B A;  1XVJ A;  2KGR A;  1TOP A;  3KEV A;  4HRE E;  2LLT A;  3D75 A;  5CSF A;  1GGZ A;  2F33 A;  5GQQ C;  3SS4 A;  1DJH A;  1QLS A;  4GGN A;  1AK8 A;  3EG5 B;  2I18 A;  2KYF A;  1DMO A;  4AOM A;  2L2E A;  4F7F A;  1XO5 A;  1C7W A;  1B7T Y;  1LA0 A;  3OB1 B;  1CM1 A;  3GOF A;  1NPQ A;  1K95 A;  1SL8 A;  1TIZ A;  1JFK A;  3CTN A;  5CSI A;  4JWQ A;  1KQV A;  3OBV A;  1XFR A;  1QX2 A;  2QEO A;  2B1U A;  2CNP A;  2WCJ A;  1MR8 A;  2L0P A;  1QVI Z;  3LK1 A;  3O78 A;  3VB1 A;  2M29 A;  4GUK A;  4YI9 A;  4OZD A;  1A03 A;  1B7T Z;  4MN0 A;  1ZUZ A;  2K2A A;  3AKA A;  3FE8 A;  2EC6 C;  1B8L A;  2WC8 A;  1KQM C;  2KFH A;  1TNP A;  3AKB A;  4XYN A;  4ETO A;  1F4O A;  3BUN B;  3A8R A;  1J1E A;  3BUO B;  2OS8 C;  4CID A;  3L4A A;  5D7F A;  1M46 A;  2MLF C;  4DCK A;  1F4Q A;  2HQ8 A;  1TUJ A;  3NSO A;  1IQ3 A;  1CFC A;  2NLN A;  2KBI A;  2WCK A;  3B86 A;  1TCO B;  4PAL A;  2JT0 A;  4PE7 A;  1CKK A;  3BUX B;  1XFW O;  1IKU A;  4IL1 A;  1KWO B;  4BY5 A;  4HRH A;  2BKH B;  2WOS A;  5G08 A;  4CFQ A;  1NWD A;  1TNQ A;  2AMI A;  4C0L A;  2KQ6 A;  3CAB A;  3NSL A;  1JBA A;  2BKI B;  2KAX A;  2L4I A;  2M3W A;  2JZI A;  2OTG B;  2K60 A;  5EL2 A;  1TUZ A;  3ZNI A;  1NIW A;  2BNX A;  1F71 A;  2LAN A;  1OQP A;  1C3Z A;  3I5G B;  1UUR A;  1YRT B;  1YUU A;  2M8U A;  3I5F C;  4ZCU A;  2NCO A;  1F55 A;  4I5N B;  2JT8 A;  1LIN A;  1BG1 A;  1HQV A;  3B7A A;  1MQ1 A;  3JVT B;  2ERB A;  3EK8 A;  2BBN A;  1LA3 A;  1OMD A;  1SPY A;  2BAP A;  3L47 A;  1TRF A;  3DXL A;  1UP5 A;  1SCM C;  1S5G Z;  1G8I A;  4NDD A;  2JPO A;  3DY9 A;  4MZK A;  5HLO A;  1BMO A;  5CSJ A;  2K0J A;  1BF5 A;  4JPZ B;  1WLZ A;  5AEQ A;  1WDC B;  1EXR A;  3LL8 B;  3S0E A;  5AER A;  1JFJ A;  1XFZ O;  1JUO A;  2FJU B;  2DOQ A;  2KFG A;  1OOF A;  1H4B A;  2P71 A;  1J1D A;  5CPV A;  3CR4 X;  2M7N A;  2WCF A;  5FI7 A;  2ZNE A;  2JNF A;  1AUI B;  4ORC B;  2COL B;  2ZN9 A;  1CFF A;  4NDB A;  2EHB A;  4GFT A;  2MBX A;  4I5J A;  3R1O A;  2WOR A;  2KI4 C;  1ALV A;  1MF8 B;  5K89 A;  1IGV A;  4OKH A;  2Q91 A;  2JU0 A;  3CS1 A;  5BPJ A;  2Y5I A;  3LCP C;  1B47 A;  1MUX A;  2BE6 A;  1NSH A;  3CYZ A;  2KPH A;  1CFP A;  4TNC A;  1DJG A;  1K94 A;  2LAP A;  1LVC D;  1N0Y A;  3ZWH A;  1AJ4 A;  3S0D A;  4YBH B;  1SL9 A;  1ZFS A;  2MA2 A;  1IG5 A;  1BT6 A;  1SR6 B;  1UUS A;  2PMY A;  3OX6 A;  1MXL C;  1NP8 A;  3D74 A;  4QJ5 B;  1DJX A;  3BYA A;  2LUC A;  4AQI A;  1BU3 A;  2SCP A;  5I8N A;  1SY9 A;  5AXI A;  1DJZ A;  3O4Y A;  4ZCV A;  3BOW A;  1BOD A;  5TNC A;  3I5I B;  2LHI A;  1EL4 A;  1J7Q A;  2I7A A;  4P2Y B;  1V1F A;  3I5H B;  1QLK A;  5ER4 X;  3TDI A;  2JXL A;  2QEB A;  2L5X B;  1DQE A;  2KSP A;  1OOJ A;  2QDI A;  2F2O A;  1NYA A;  3SS5 A;  4YRU A;  4NDC A;  1TWO A;  1FI6 A;  1Y1U A;  1UWO A;  2ZND A;  1L2O B;  1YR5 A;  1IIO A;  1U5I A;  4I5L B;  3D78 A;  4YI8 A;  3B88 A;  2PQL A;  1RWY A;  3UO9 A;  1W9Z A;  2LNK A;  1QV0 A;  3IQQ A;  4PE0 A;  1GQM A;  5HLV A;  3D10 A;  1J7P A;  1WRL A;  3D73 A;  4XJK A;  1PAL A;  4ICB A;  3CZ2 A;  2G2B A;  1U5I B;  2E6W A;  1SNL A;  2YGU A;  3BFH A;  3O2P A;  4JD9 A;  4USL A;  5B8I B;  3C1V A;  4YGC B;  1KFX S;  3R72 A;  3PN7 C;  4PT1 A;  3CDN A;  2PVB A;  1MHO A;  2LC5 A;  4INX A;  3WHT B;  3TUY B;  4CLN A;  1BOC A;  1BR1 B;  3B6X A;  4XJK B;  5DKQ A;  4CFR A;  4C0J A;  3EVV A;  1CMF A;  2JNX A;  4KYN A;  4CPV A;  1DTL A;  1WRK A; 
#chains in the Genus database with same CATH homology
 3EK7 A;  4I5K A;  1CLL A;  5IBW A;  1JSA A;  1FI5 A;  1R6P A;  4FQO A;  1M63 B;  1SK6 D;  3PFV A;  1QIV A;  3CLN A;  4U8D A;  1A29 A;  1CDM A;  2BL0 C;  4DUQ A;  1GGW A;  4PE1 A;  1Y1A A;  1XFV O;  2Y1N A;  2H2K A;  1MWN A;  3FIA A;  1K9P A;  1OZS A;  1KSO A;  4MEW A;  3VRQ A;  1YUS A;  3TS5 C;  4PHN A;  1OMR A;  1UHK A;  3DVK A;  1EG4 A;  1AVS A;  3D0Y A;  1L7Z A;  5ER5 A;  2LLU A;  1K2H A;  1KFX L;  3BXK A;  5AAN A;  2M7L A;  3OHM B;  1QV1 A;  5D69 A;  1KK7 Y;  2F2P A;  3JTD C;  1YX7 A;  2EC6 B;  2JPT A;  4HRG A;  1NX1 A;  1DT7 B;  2L51 A;  2FCD A;  1KQM B;  3SIA A;  3D0Y B;  3F45 A;  1SCV A;  1B9A A;  2CXJ A;  1KK8 C;  2OS8 B;  2M9G A;  4M2P A;  3TS5 B;  4DIR A;  2K61 A;  1NX3 A;  1JF0 A;  2RGI A;  4R1E A;  5F6T A;  1RFJ A;  3KO0 A;  1LKJ A;  5I2O A;  2Q4U A;  2QAC A;  1E8A A;  1BJF A;  1W7J B;  4N5X A;  4PCW A;  4Q04 A;  3GK4 X;  1XK4 C;  1CLB A;  1ZMZ A;  1C07 A;  1K93 D;  2LM5 A;  1TNW A;  4QJ3 B;  1ZOT B;  4AQJ A;  2K7B A;  1GJY A;  1Y1X A;  3DD4 A;  3CZT X;  2JT3 A;  1OMV A;  1OSA A;  2MJW B;  5KSZ A;  1EG3 A;  2LMV A;  3I5F B;  4PHM A;  1SBJ A;  2KDH A;  3KPX A;  5J3X A;  4OR9 B;  2LVJ A;  1SRA A;  2ZFD A;  1CNP A;  1CDL A;  1XFU O;  1MXE A;  1TNX A;  2JC2 A;  1RTP 1;  3VRR A;  4MZJ A;  4PHK A;  1SCM B;  2M97 A;  1YX8 A;  1K96 A;  4M2Q A;  4GGF C;  5HKZ A;  2KGB C;  1CFD A;  2PSR A;  3WNX B;  4DRW A;  5DKN A;  3BQ3 A;  4D1E A;  1DJI A;  1K9K A;  5AFP A;  3CWG A;  4UPG A;  3KHE A;  2Y4Q A;  1TTX A;  2M49 B;  1Y0V H;  4JQ0 D;  2I94 A;  1REC A;  2KI4 B;  3SG4 A;  2E30 A;  2LCP A;  5PAL A;  1RJV A;  3PAT A;  1KCY A;  2JUL A;  3VGO A;  1M45 A;  2NCP A;  3CGA A;  2BEC A;  1W7I B;  2CTN A;  3K21 A;  1SMG A;  2JQ6 A;  5HKY A;  1FF1 A;  2HQW A;  4YGD B;  2IS9 A;  1X02 A;  4QJ4 B;  2L4H A;  4N1F A;  4NQG A;  5HKW A;  1XA5 A;  1S6C A;  2I2R E;  3FS7 A;  2F3Y A;  2M1K B;  2AAO A;  1Q80 A;  3WHU B;  1F8H A;  3DVM A;  4M2O A;  4PDZ A;  3EVR A;  3SG5 A;  2KAY A;  3SJS A;  2KYC A;  5JJG A;  4HSZ A;  3QRX A;  5JOL A;  1HT9 A;  1DGU A;  1IQ5 A;  1CDN A;  2KBM A;  3VRN A;  4N1G A;  2KAV A;  3OP0 A;  1CDP A;  3HCM A;  2HF5 A;  2LUX A;  1AJ5 A;  2TN4 A;  3ICB A;  4BY4 A;  1B1G A;  1CMG A;  2LVK A;  2QPT A;  3IF7 A;  1TCF A;  2KI6 C;  1YTZ C;  2KHN A;  3GK1 A;  2D8N A;  3LK0 A;  3CR5 X;  4MSP A;  1DVI A;  1QX5 B;  2H61 C;  1NCZ A;  3AAK A;  3PSR A;  4C0L A;  2ZRT A;  1SW8 A;  1Y6W A;  2LLS A;  2CCM A;  5DKR A;  3NSK A;  2PAL A;  2ZRS A;  1RRO A;  1R2U A;  2KNE A;  3AAJ A;  3DVE A;  1IH0 A;  2FOT A;  2HPS A;  1QAT A;  1JF2 A;  3HX4 A;  1S6J A;  4E68 A;  2K7C A;  2JRF A;  4L9M A;  3NXA A;  3EK4 A;  4OVN F;  3PN7 B;  3M0W A;  1QVI Y;  4PE4 A;  1PVB A;  1QS7 A;  2V53 A;  1CLM A;  1QIW A;  2OPO A;  1IWQ A;  1QJT A;  4GBA A;  2WCE A;  4GNK B;  2K2F A;  3OB2 B;  2LVV A;  1YVH A;  5KTY A;  4ORB B;  3CR2 A;  4P5O E;  2NZ0 A;  3A4U B;  3VRP A;  1NUB A;  2O5G A;  2L98 A;  3DVJ A;  2BL0 B;  3DF0 A;  2K7D A;  1M31 A;  2M1U A;  1N65 A;  2SAS A;  2MRD A;  4YGA A;  3E3R A;  1S36 A;  2CT9 A;  1YRU B;  1N2D A;  2BBM A;  1G33 A;  3EKH A;  1IJ5 A;  1JC2 A;  1KWO C;  1B8C A;  4F0Z B;  1B4C A;  1S6I A;  1S3P A;  3DF0 B;  3PM8 A;  3RLZ A;  2OTG C;  2JOJ A;  1IJ6 A;  3EVU A;  3FWC A;  4MZL A;  4MBE A;  3PAL A;  3I5G C;  2EGD A;  1DGV A;  1KK7 Z;  2LE9 B;  2PRU A;  3KF9 A;  1V1G A;  3JTD B;  3JVT C;  2BCB A;  5HYD A;  2WCB A;  1PSR A;  4DS7 A;  2NXQ A;  2GGM A;  2ZKM X;  4WRI A;  2Y1M A;  1FW4 A;  1S1E A;  4ORA B;  1D1O A;  2R2I A;  3FWB A;  1ODB A;  1PUL A;  2F3Z A;  5KU1 A;  3BUM B;  1XK4 A;  2O60 A;  3PLF B;  1KK8 B;  1BLQ A;  1S5G Y;  2KOT A;  1YUR A;  4MVF A;  3TZ1 A;  3SIB A;  1WDC C;  3TDU A;  3SG6 A;  1PRW A;  2KFF A;  1FBV A;  1K9U A;  1OE9 B;  1UHN A;  2LP2 A;  5CSN A;  1CM4 A;  1WLM A;  4MRY A;  1A75 A;  4FTG A;  3BUW B;  1F54 A;  2K7O A;  1K8U A;  2MAZ A;  2JWW A;  5FYX A;  1DF0 A;  1YUT A;  3LLE A;  1WY9 A;  1XFX O;  2F8P A;  1OZO A;  1KSM A;  4WQ2 A;  2JXC A;  1NCY A;  1M39 A;  1JWD A;  1SKT A;  1A75 B;  1KFU S;  3H4S E;  1RK9 A;  2PAS A;  1WRZ A;  2LHL A;  1DJW A;  1QXP A;  2L50 A;  2KQY A;  1DF0 B;  1NX2 A;  1ALW A;  1CB1 A;  1LXF C;  4GGF A;  4C0K A;  1B8R A;  4A4C A;  1EJ3 A;  3EKJ A;  1J7O A;  1SR6 C;  1VRK A;  4YGE B;  1PVA A;  1NX0 A;  1NCX A;  1BR4 B;  2GGZ A;  3WXA A;  1H8B A;  1XYD A;  3TDZ A;  1C7V A;  1FPW A;  4WQ3 A;  1UHH A;  1AHR A;  2AUC A;  2CBL A;  2FCE A;  3I5I C;  2ISD A;  2MHH A;  1UHJ A;  2BCA A;  4GAO A;  3IQO A;  4YGB B;  1A4P A;  3I5H C;  1DJY A;  3SG7 A;  3SG2 A;  3OX5 A;  4PHJ A;  1SL7 A;  2JTT A;  3O6B A;  2LMT A;  2A4J A;  1QAS A;  3GK2 A;  3NSI A;  1EH2 A;  1L2O C;  1XFY O;  2KI6 D;  2LP3 A;  4OCI A;  3SG3 A;  1ZAC A;  2ZN8 A;  4MLW A;  1A2X A;  2WND A;  4MRX A;  1SYM A;  1UHI A;  2VRG A;  1F70 A;  2BE4 A;  1PK0 D;  2MLE C;  1YVL A;  1PSB A;  2GV5 A;  2M0R A;  1KFU L;  1J7R A;  2JTZ A;  1AP4 A;  1K90 D;  2G9B A;  1J55 A;  3VRO A;  1G4Y R;  3MSE B;  1QTX A;  2BCX A;  2LV7 A;  2HET A;  3BOW B;  1S26 D;  1CTR A;  1TN4 A;  2P6B B;  3TUY C;  1QX7 A;  2K8M B;  1IRJ A;  2H61 A;  4GPL B;  2LMU A;  3RM1 A;  4OV2 A;  2LVI A;  5I2L A;  5I2Q A;  4A4B A;  1XVJ A;  2KGR A;  1TOP A;  3KEV A;  4HRE E;  2LLT A;  5CSF A;  1GGZ A;  2F33 A;  5GQQ C;  1DJH A;  1QLS A;  4GGN A;  1AK8 A;  2I18 A;  2KYF A;  1DMO A;  4AOM A;  2L2E A;  1XO5 A;  1C7W A;  1B7T Y;  1LA0 A;  3OB1 B;  1CM1 A;  3GOF A;  1NPQ A;  1K95 A;  1SL8 A;  1TIZ A;  1JFK A;  3CTN A;  5CSI A;  4JWQ A;  1KQV A;  1QX2 A;  2B1U A;  2CNP A;  1MR8 A;  2L0P A;  1QVI Z;  3LK1 A;  3O78 A;  2M29 A;  4GUK A;  4YI9 A;  1A03 A;  1B7T Z;  4MN0 A;  1ZUZ A;  2K2A A;  3AKA A;  2EC6 C;  1B8L A;  2WC8 A;  1KQM C;  2KFH A;  1TNP A;  3AKB A;  4XYN A;  4ETO A;  1F4O A;  3BUN B;  3A8R A;  1J1E A;  3BUO B;  2OS8 C;  4CID A;  5D7F A;  1M46 A;  2MLF C;  4DCK A;  1F4Q A;  2HQ8 A;  1IQ3 A;  3NSO A;  1CFC A;  2NLN A;  2KBI A;  4PAL A;  4PE7 A;  1TCO B;  1CKK A;  2JT0 A;  3BUX B;  1XFW O;  1IKU A;  4IL1 A;  1KWO B;  4BY5 A;  4HRH A;  2BKH B;  2WOS A;  5G08 A;  4CFQ A;  1NWD A;  1TNQ A;  2AMI A;  2KQ6 A;  3NSL A;  1JBA A;  2BKI B;  2KAX A;  2L4I A;  2M3W A;  2JZI A;  2OTG B;  3ZNI A;  1NIW A;  1F71 A;  2LAN A;  1OQP A;  3I5G B;  1UUR A;  1YRT B;  1YUU A;  2M8U A;  3I5F C;  4ZCU A;  2NCO A;  1F55 A;  4I5N B;  2JT8 A;  1LIN A;  1BG1 A;  1HQV A;  1MQ1 A;  3JVT B;  3EK8 A;  2BBN A;  1LA3 A;  1OMD A;  1SPY A;  1TRF A;  1UP5 A;  1SCM C;  1S5G Z;  1G8I A;  4NDD A;  4MZK A;  1BF5 A;  5HLO A;  1BMO A;  5CSJ A;  2K0J A;  4JPZ B;  1WLZ A;  5AEQ A;  1WDC B;  1EXR A;  3LL8 B;  5AER A;  1JFJ A;  1XFZ O;  1JUO A;  2FJU B;  2DOQ A;  2KFG A;  1H4B A;  1J1D A;  5CPV A;  3CR4 X;  2M7N A;  2WCF A;  2ZNE A;  2JNF A;  1AUI B;  4ORC B;  2COL B;  2ZN9 A;  1CFF A;  4NDB A;  2EHB A;  4GFT A;  2MBX A;  4I5J A;  2WOR A;  2KI4 C;  1ALV A;  1MF8 B;  5K89 A;  1IGV A;  4OKH A;  2Q91 A;  2JU0 A;  3CS1 A;  5BPJ A;  2Y5I A;  3LCP C;  1B47 A;  1MUX A;  2BE6 A;  1NSH A;  1CFP A;  4TNC A;  1DJG A;  1K94 A;  2LAP A;  1LVC D;  1N0Y A;  3ZWH A;  1AJ4 A;  4YBH B;  1SL9 A;  1ZFS A;  2MA2 A;  1IG5 A;  1BT6 A;  1SR6 B;  1UUS A;  2PMY A;  3OX6 A;  1MXL C;  1NP8 A;  4QJ5 B;  1DJX A;  3BYA A;  2LUC A;  4AQI A;  1BU3 A;  2SCP A;  5I8N A;  1SY9 A;  5AXI A;  1DJZ A;  3O4Y A;  4ZCV A;  3BOW A;  1BOD A;  5TNC A;  3I5I B;  2LHI A;  1EL4 A;  1J7Q A;  2I7A A;  4P2Y B;  1V1F A;  3I5H B;  1QLK A;  5ER4 X;  3TDI A;  2JXL A;  2L5X B;  2KSP A;  1OOJ A;  2F2O A;  1NYA A;  4YRU A;  4NDC A;  1FI6 A;  1Y1U A;  1UWO A;  2ZND A;  1L2O B;  1YR5 A;  1U5I A;  4I5L B;  4YI8 A;  1RWY A;  2LNK A;  1QV0 A;  3IQQ A;  4PE0 A;  1GQM A;  5HLV A;  3D10 A;  1J7P A;  1WRL A;  4XJK A;  1PAL A;  4ICB A;  2G2B A;  1U5I B;  2E6W A;  1SNL A;  3O2P A;  4USL A;  5B8I B;  3C1V A;  4YGC B;  1KFX S;  3PN7 C;  3WHT B;  2PVB A;  1MHO A;  2LC5 A;  4CLN A;  1BOC A;  3TUY B;  1BR1 B;  4XJK B;  4CFR A;  5DKQ A;  4C0J A;  3EVV A;  1CMF A;  2JNX A;  4CPV A;  1DTL A;  1WRK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...