5DKQA

Crystal structure of calcium-loaded s100b bound to sbi4214
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
91
structure length
91
Chain Sequence
MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFFEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Small Molecule Inhibitors of Ca(2+)-S100B Reveal Two Protein Conformations.
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein/inhibitor
molecule keywords Protein S100-B
total genus 31
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2015-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5dkqA00
4PHNA 2KFFA 1GQMA 1F71A 1QLSA 2BCAA 4WQ3A 3PATA 1CDMA 1DTLA 2ZKMX 2O5GA 1IH0A 5HKYA 2M8UA 1GGZA 1TRFA 2R2IA 5D7FA 1KWOB 1G33A 1AK8A 2ZN9A 1A29A 1NX3A 1TNQA 1U5IB 3HCMA 3DVEA 1RTP1 2ZRSA 2EC6B 1SR6B 2WNDA 1AHRA 4L9MA 3I5IC 1QXPA 4E68A 1FPWA 1ZFSA 1CFPA 2LLTA 1N2DA 2LMVA 1NSHA 5CPVA 1PVAA 1NYAA 1S26D 5HKZA 1WRKA 2KAVA 1JSAA 1HT9A 1SK6D 4YI8A 1CLLA 1YURA 1A75A 1BMOA 1F4OA 4XYNA 1QX7A 1TCOB 4OVNF 5ER4X 2I7AA 1GGWA 4GAOA 4MLWA 1AP4A 2Y4QA 3O2PA 1RROA 3EVVA 1RK9A 2LANA 1CB1A 2LM5A 2G2BA 3EVRA 4HRHA 4XJKB 1QVIZ 1IRJA 3GK1A 4FQOA 1KK7Y 5HKWA 1SPYA 2M1UA 3GOFA 4PALA 4MSPA 2MA2A 2M7LA 2L2EA 1JWDA 2L5XB 3SG2A 2KI6D 2JNFA 5HLOA 2K8MB 1WLMA 1S6CA 3A4UB 1OZSA 1CFCA 3NSKA 2JT0A 1WRZA 3E3RA 1J7OA 1YRTB 1SCMC 1JBAA 4NQGA 1RECA 1KQMB 5B8IB 4I5NB 1QX2A 5DKNA 2BE6A 1KK8B 2KQ6A 1J7PA 2LP2A 4YGCB 1K95A 4M2QA 1F54A 1MWNA 2EHBA 1M31A 2LP3A 1ALVA 4YGEB 4JWQA 3A8RA 4M2PA 2BBNA 1W7IB 2MLEC 5CSNA 2GGZA 2JPTA 1MF8B 3BOWB 4ORBB 5CSFA 4MZJA 2LVJA 1YX7A 5KSZA 1BODA 2TN4A 1KK8C 2FJUB 3CR5X 4ORAB 1H4BA 2PMYA 4GGFA 1BF5A 2BKIB 2WCFA 2AMIA 2HF5A 3O78A 1KFUL 4TNCA 3PSRA 1VRKA 4CFRA 4MRYA 2P6BB 3D0YB 5I2LA 3SIAA 1ALWA 2JC2A 2F33A 1WDCB 3PLFB 1R6PA 2PRUA 1B8LA 4JPZB 4AQJA 2D8NA 1B7TZ 3WHUB 1QLKA 1QS7A 3ZNIA 3SG3A 1AVSA 3D10A 2CBLA 2I18A 3TS5B 4MVFA 4MZKA 4I5KA 1LINA 4DS7A 1S3PA 2L98A 4BY4A 4A4CA 1K96A 2JT3A 2I94A 4NDBA 1PSBA 2I2RE 2ZRTA 1PULA 2K2FA 4C0JA 4ZCVA 1SL7A 2KI4C 1KCYA 3GK4X 1PRWA 2L4HA 1XFXO 5DKQA 4PDZA 3WNXB 5AERA 2KFHA 1CLBA 1K8UA 1J55A 1LVCD 5J3XA 2K7OA 1HQVA 2CNPA 5JOLA 1CMGA 1EH2A 1TNPA 3WHTB 4CFQA 1SBJA 2KNEA 1J1DA 1FW4A 2K7DA 2F2PA 3VRPA 4DIRA 3TDUA 1SKTA 1X02A 2A4JA 3DVKA 1YRUB 2JXCA 2M3WA 2LLUA 3LLEA 2JOJA 4JQ0D 3RLZA 2Y1MA 3LCPC 1DF0B 1BR4B 1CLMA 1BU3A 2M97A 4PHMA 2LUXA 2M9GA 4PHKA 3FWCA 2HQ8A 2LAPA 2FCDA 4MZLA 1UP5A 2HETA 3KEVA 3JVTC 5BPJA 3AKAA 1QIWA 1E8AA 2WC8A 5KU1A 1EL4A 1WRLA 1RJVA 2HQWA 1SL8A 1MHOA 2AAOA 1F4QA 5AEQA 1QV1A 1XK4C 2KYFA 2BECA 4DCKA 1IWQA 2Q4UA 1DGUA 2WORA 2LLSA 2M49B 1J1EA 1SMGA 2K7BA 1UURA 1XK4A 3OX5A 3TS5C 1NWDA 3WXAA 1IQ3A 1MUXA 5I2OA 1K9KA 1SR6C 4ETOA 4CPVA 3CZTX 1OSAA 1JF2A 1QX5B 2LHIA 4OR9B 3SG5A 1U5IA 2L4IA 2FCEA 3BUXB 4OKHA 2LVVA 3DVMA 1NIWA 4N1FA 2LV7A 1NCYA 1KFXS 1RFJA 1TIZA 4UPGA 1QV0A 3DVJA 3M0WA 1DF0A 3OB2B 2COLB 4FTGA 3NSOA 1SCVA 4DRWA 1DJZA 1M63B 3OB1B 4D1EA 1CKKA 1A4PA 1L2OB 1MXEA 2MJWB 2KQYA 4YGBB 1CM1A 2MBXA 2BCXA 4GPLB 3SG4A 3TUYB 1IJ5A 4F0ZB 1DJXA 1GJYA 1Y1XA 1XO5A 2WOSA 1Y0VH 4YI9A 5G08A 2KGRA 1A2XA 1XFWO 4C0LA 3LK0A 5AFPA 1J7RA 4PE1A 1WY9A 5KTYA 1AJ4A 3DD4A 1Q80A 1JC2A 1BT6A 1Y6WA 5HYDA 4YBHB 1SRAA 2SCPA 1UHJA 4ICBA 1NP8A 3TUYC 2CT9A 2JWWA 5HLVA 2KBIA 4I5JA 1ZMZA 1NX1A 1ZACA 1V1FA 1EG3A 1SY9A 1UHHA 1TTXA 3CTNA 4P5OE 2V53A 1XFVO 4I5LB 2ZFDA 1XFYO 1K9PA 2ISDA 1CFDA 1K2HA 2BBMA 2CTNA 1KK7Z 3PN7C 1ODBA 3LK1A 1B8CA 1BJFA 3BUWB 1J7QA 4CIDA 1B47A 1KSMA 2LE9B 2PVBA 1R2UA 4HSZA 4N1GA 1W7JB 3QRXA 4ZCUA 1CFFA 2F3YA 1G8IA 2ZNEA 3BOWA 3EKJA 1DGVA 3DF0A 4DUQA 1Y1AA 1WDCC 4NDDA 2BE4A 2K0JA 5ER5A 4C0KA 4YGAA 2E6WA 3CLNA 4GNKB 1B7TY 2OTGB 1N65A 1DJWA 1UHIA 1AUIB 2WCEA 2LNKA 2EC6C 3IQOA 2NLNA 2PALA 3LL8B 2JT8A 3EK4A 5AXIA 5PALA 1TNXA 1LXFC 1YX8A 2L0PA 2KI4B 3BYAA 3BUNB 4YRUA 2JQ6A 3I5FC 1BOCA 1NX0A 3HX4A 1SCMB 5CSJA 2NCOA 1CDNA 1LA3A 1EJ3A 2KAXA 2OS8B 2KSPA 1MR8A 1YUUA 3AKBA 4Q04A 4R1EA 2EGDA 1QIVA 1XFUO 1QJTA 3NSLA 3GK2A 5CSIA 1NX2A 2IS9A 1K94A 1QASA 1DMOA 2OPOA 1UWOA 1MQ1A 2K61A 2Q91A 5FYXA 2VRGA 2NZ0A 1XYDA 3VRNA 3TZ1A 1K90D 1K9UA 3K21A 3MSEB 2FOTA 1TOPA 2MLFC 5AANA 2AUCA 3KHEA 5TNCA 3NXAA 3O6BA 4BY5A 4QJ5B 1S5GY 4WQ2A 1BR1B 3EK7A 1S1EA 3SG6A 3BUOB 2KYCA 2M29A 4QJ3B 4ORCB 1IJ6A 1PVBA 2JTTA 1PK0D 1B1GA 1IKUA 3DF0B 3FIAA 1C7VA 4QJ4B 1KWOC 1JF0A 3AAJA 3BUMB 4AOMA 2ZNDA 3FS7A 3I5HB 4MEWA 1QTXA 1IQ5A 2LMUA 1YVLA 2KOTA 1A75B 4WRIA 2F3ZA 4OV2A 3BXKA 2QACA 2H61A 4PE0A 1C07A 2LCPA 2M1KB 1EXRA 1FI5A 2NXQA 1KSOA 2JZIA 1OZOA 2KGBC 2LMTA 2K7CA 4M2OA 2BL0C 1DJHA 2JXLA 2RGIA 1LKJA 1NUBA 3I5HC 1B8RA 2KDHA 2MHHA 1NPQA 4XJKA 2H61C 3NSIA 1UUSA 2BCBA 3CR4X 3TDIA 3VRQA 2BKHB 1OMDA 3KPXA 1QATA 3JTDC 1TNWA 3CS1A 1XFZO 3PALA 1KFXL 2JRFA 1BLQA 1Y1UA 1JUOA 4NDCA 3I5GB 4PCWA 1B9AA 2WCBA 2G9BA 2BL0B 2PSRA 3ICBA 1QVIY 1CM4A 4MRXA 2JTZA 2LVIA 2L51A 1DVIA 1SW8A 4AQIA 1YUTA 3CWGA 2Y5IA 3OHMB 3VGOA 2O60A 1TN4A 4GGNA 4MBEA 1B4CA 1DJYA 1K93D 1KQMC 2HPSA 1WLZA 1G4YR 4IL1A 4USLA 1SYMA 3H4SE 4OCIA 5F6TA 4HRGA 2M0RA 1KQVA 2LC5A 1L7ZA 3FWBA 2L50A 1C7WA 1V1GA 2KAYA 1CDLA 1S36A 1TCFA 1S5GZ 1S6IA 3VRRA 2LUCA 3EK8A 3SIBA 3D0YA 2B1UA 3KF9A 5I8NA 4MN0A 2JULA 1DJIA 1N0YA 2CCMA 2QPTA 2ZN8A 1PSRA 3CGAA 4GGFC 1H8BA 5GQQC 1DT7B 1ZOTB 4N5XA 1OQPA 4PE4A 5IBWA 4GBAA 1EG4A 1FI6A 2M7NA 3JVTB 1XVJA 3EKHA 2GGMA 3PN7B 3KO0A 3I5FB 5I2QA 2MRDA 5DKRA 3C1VA 1XA5A 1FBVA 2H2KA 1FF1A 1OMVA 2KHNA 1RWYA 2JU0A 2OS8C 3VROA 1A03A 1JFKA 1IG5A 4P2YB 3IF7A 2F2OA 1DJGA 4HREE 1D1OA 1MXLC 3I5IB 4U8DA 1CMFA 1F55A 3EVUA 1M46A 3F45A 1YTZC 3I5GC 2E30A 3OP0A 1ZUZA 1M39A 3SJSA 1NCZA 4YGDB 2DOQA 2K2AA 1YVHA 2OTGC 1YR5A 3ZWHA 2KI6C 2LVKA 2KBMA 3PM8A 2KFGA 5D69A 2CXJA 1OE9B 1LA0A 4CLNA 1F70A 3SG7A 5K89A 1JFJA 2LHLA 2Y1NA 2F8PA 1NCXA 3CR2A 1IGVA 3IQQA 1CTRA 2GV5A 1M45A 5JJGA 1F8HA 4GUKA 3RM1A 3O4YA 3PFVA 4PE7A 1BG1A 1KFUS 1CDPA 1YUSA 3JTDB 1S6JA 4A4BA 1CNPA 1L2OC 2MAZA 2PASA 3TDZA 1PALA 1SL9A 2JNXA 1AJ5A 3OX6A 1SNLA 1UHKA 1UHNA 2NCPA 1OMRA 1OOJA 3AAKA 4PHJA 3BQ3A 4GFTA 2SASA
chains in the Genus database with same CATH superfamily
1OOFA 4PHNA 2KFFA 1GQMA 1F71A 1QLSA 2BCAA 4WQ3A 3PATA 1CDMA 1DTLA 2ZKMX 2O5GA 1IH0A 5HKYA 2M8UA 1GGZA 1TRFA 2R2IA 3BJHA 5D7FA 1KWOB 1G33A 1AK8A 2ZN9A 1A29A 1NX3A 1TNQA 1U5IB 3HCMA 3DVEA 1RTP1 2BNXA 2ZRSA 3OGNA 2EC6B 2K60A 1SR6B 2WNDA 3S0EA 1AHRA 4L9MA 3I5IC 1QXPA 4E68A 2PYQA 1FPWA 1ZFSA 1CFPA 2LLTA 1N2DA 2LMVA 3FE9A 1NSHA 5CPVA 1PVAA 5FI6A 1NYAA 1S26D 5HKZA 1WRKA 2KAVA 3D78A 1JSAA 1HT9A 1SK6D 4YI8A 1CLLA 1YURA 1A75A 1BMOA 1F4OA 4XYNA 3D75A 1QX7A 1TCOB 4OVNF 5ER4X 3S0GA 2WC5A 2I7AA 1GGWA 4GAOA 4MLWA 1AP4A 1P28A 2Y4QA 3O2PA 1RROA 3EVVA 1RK9A 2LANA 1CB1A 2LM5A 2G2BA 3EVRA 4HRHA 4XJKB 1QVIZ 1IRJA 3GK1A 4FQOA 1KK7Y 5HKWA 2H8VA 1SPYA 2QEOA 2M1UA 3BFAA 3GOFA 4PALA 4MSPA 2MA2A 2M7LA 2L2EA 3UNWA 1JWDA 2L5XB 3SG2A 2KI6D 2JNFA 5HLOA 2K8MB 1WLMA 1S6CA 3A4UB 1OZSA 3SS3A 3NSKA 2JT0A 1WRZA 3E3RA 1CFCA 1YRTB 1SCMC 3B88A 1J7OA 4NQGA 1JBAA 1RECA 1KQMB 5B8IB 4I5NB 1QX2A 5DKNA 2BE6A 1KK8B 2KQ6A 1J7PA 2LP2A 4YGCB 1K95A 4M2QA 1F54A 1MWNA 2EHBA 1M31A 2LP3A 1ALVA 4YGEB 4JWQA 3A8RA 4M2PA 2BBNA 2KLDA 1W7IB 2MLEC 5CSNA 3V2LA 2GGZA 2JPTA 1MF8B 2WC6A 3BOWB 4ORBB 5CSFA 4MZJA 1OOGA 1YX7A 2LVJA 5KSZA 1BODA 2TN4A 1KK8C 2FJUB 3CR5X 4ORAB 1H4BA 2PMYA 4GGFA 1BF5A 2BKIB 2WCFA 2AMIA 2HF5A 3O78A 1KFUL 4TNCA 3PSRA 2KPHA 1VRKA 4CFRA 4MRYA 2P6BB 3D0YB 5I2LA 3SIAA 1ALWA 2JC2A 2F33A 1WDCB 3PLFB 5EL2A 2QEBA 1R6PA 2PRUA 1B8LA 4JPZB 4AQJA 2D8NA 1B7TZ 3WHUB 1QLKA 1TUJA 1QS7A 3ZNIA 3SG3A 1AVSA 3D10A 2CBLA 2I18A 3D74A 3TS5B 4MVFA 4MZKA 4I5KA 1LINA 4DS7A 1S3PA 2L98A 2L2CA 3RZSA 4BY4A 4A4CA 1K96A 2JT3A 2I94A 4NDBA 1PSBA 2I2RE 2ZRTA 1PULA 2K2FA 4C0JA 3DY9A 1SL7A 2KI4C 4ZCVA 1KCYA 3GK4X 1PRWA 2L4HA 1XFXO 5DKQA 4PDZA 3WNXB 5AERA 2KFHA 1CLBA 1K8UA 3R72A 1J55A 1LVCD 5J3XA 2K7OA 1HQVA 2CNPA 5JOLA 1CMGA 1EH2A 1TNPA 3WHTB 4CFQA 1SBJA 2KNEA 1J1DA 1FW4A 5D3OA 2K7DA 2F2PA 3VRPA 4DIRA 3TDUA 1SKTA 4PT1A 1X02A 2A4JA 3DVKA 1YRUB 3DYEA 2JXCA 2M3WA 2LLUA 3LLEA 2JOJA 4JQ0D 3RLZA 2Y1MA 3LCPC 3VB1A 1DF0B 1BR4B 1CLMA 1BU3A 2M97A 4PHMA 2LUXA 2M9GA 4PHKA 3FWCA 2HQ8A 2LAPA 2FCDA 4OZDA 4MZLA 1UP5A 1LS8A 2HETA 3KEVA 3JVTC 5BPJA 3AKAA 1QIWA 1E8AA 2QDIA 2WC8A 5KU1A 1OOIX 1EL4A 1WRLA 1RJVA 2FJYA 2HQWA 3QMEA 1SL8A 1MHOA 2AAOA 1F4QA 5AEQA 1QV1A 1XK4C 2KYFA 2BECA 3L4LA 4DCKA 1IWQA 2Q4UA 1DGUA 2WORA 1DC1A 2LLSA 2M49B 1J1EA 1SMGA 2K7BA 4IJ7A 1UURA 1XK4A 3UO9A 2PQLA 3OX5A 3TS5C 1NWDA 3WXAA 1IQ3A 1MUXA 5I2OA 1K9KA 1SR6C 4ETOA 4CPVA 3CZTX 1GM0A 1OSAA 1JF2A 1QX5B 2LHIA 4OR9B 3SG5A 1U5IA 2L4IA 2WCKA 2FCEA 3BUXB 3D73A 4FQTA 4OKHA 3S0FA 2LVVA 3DVMA 1NIWA 4N1FA 2LV7A 1NCYA 1KFXS 1RFJA 1TIZA 2QEHA 4UPGA 1QV0A 3DVJA 2P70A 1DF0A 3M0WA 2COLB 3OB2B 3NSOA 4FTGA 1SCVA 4DRWA 1DJZA 1M63B 3OB1B 4D1EA 1CKKA 1TWOA 1A4PA 3NGVA 1L2OB 1MXEA 2MJWB 3Q8IA 2KQYA 2P71A 1CM1A 4YGBB 2MBXA 2BCXA 4GPLB 3SG4A 3TUYB 1IJ5A 4F0ZB 1DJXA 1GJYA 1Y1XA 1XO5A 1W9ZA 1Y0VH 2WOSA 4YI9A 5G08A 2KGRA 1A2XA 1XFWO 4C0LA 3LK0A 5AFPA 1J7RA 4PE1A 1WY9A 4F7FA 1AJ4A 1C3ZA 3DD4A 1Q80A 5KTYA 1JC2A 1BT6A 1Y6WA 3SS4A 5HYDA 4YBHB 1SRAA 2SCPA 1SSEB 1UHJA 4ICBA 1NP8A 3TUYC 2CT9A 2JWWA 5HLVA 3O4XA 2KBIA 4I5JA 1ZMZA 1NX1A 1ZACA 1V1FA 1EG3A 1SY9A 1UHHA 1TTXA 3CTNA 4P5OE 2V53A 1XFVO 4I5LB 2ZFDA 3B86A 1XFYO 1K9PA 2ISDA 1CFDA 1K2HA 2BBMA 2CTNA 1KK7Z 3PN7C 1ODBA 2WCMA 3LK1A 1B8CA 1BJFA 3BUWB 1J7QA 3L47A 4CIDA 3B7AA 1B47A 1KSMA 2LE9B 2PVBA 1R2UA 4HSZA 1C3YA 4N1GA 1W7JB 3QRXA 2JPOA 3IVTA 4ZCUA 1CFFA 2F3YA 1G8IA 2ZNEA 3BOWA 3EKJA 1DGVA 3DF0A 4DUQA 1Y1AA 1WDCC 4NDDA 1QWVA 2BE4A 2K0JA 5ER5A 4C0KA 4YGAA 2E6WA 3CLNA 4GNKB 4INWA 1B7TY 2OTGB 3D76A 1N65A 1DJWA 1UHIA 1AUIB 2WCEA 2LNKA 2EC6C 3IQOA 2NLNA 4KYNA 2PALA 3LL8B 3PJIA 2JT8A 3EK4A 5AXIA 5PALA 1OW4A 1TNXA 1LXFC 1YX8A 5DICA 2L0PA 2KI4B 3BYAA 3BUNB 4YRUA 2JQ6A 3I5FC 1BOCA 1NX0A 3HX4A 1SCMB 5CSJA 2NCOA 1CDNA 1LA3A 1EJ3A 3CZ0A 1IIOA 2KAXA 2OS8B 2KSPA 1Z4HA 1MR8A 1YUUA 3AKBA 4Q04A 4R1EA 2EGDA 1QIVA 1XFUO 1QJTA 3NSLA 3GK2A 5CSIA 1NX2A 2IS9A 1K94A 1QASA 1DMOA 2OPOA 1UWOA 1MQ1A 2K61A 2Q91A 3B6XA 5FYXA 3L4AA 4INXA 2VRGA 2NZ0A 1XYDA 5FI2A 2YGUA 3TZ1A 3VRNA 5I94A 1K90D 1K9UA 3K21A 3MSEB 2FOTA 1TOPA 2MLFC 5AANA 2AUCA 3KHEA 5TNCA 3NXAA 3O6BA 4BY5A 3CYZA 1S5GY 4WQ2A 1BR1B 3EK7A 1S1EA 3SG6A 4QJ5B 3BUOB 2KYCA 2M29A 4QJ3B 4ORCB 1IJ6A 1PVBA 3DZTA 2JTTA 3N7HA 1PK0D 1B1GA 1IKUA 3DF0B 3FIAA 1C7VA 4QJ4B 1KWOC 1JF0A 3AAJA 3BUMB 4AOMA 2ZNDA 3FS7A 3I5HB 4MEWA 1QTXA 2KLEA 1IQ5A 2LMUA 1YVLA 2KOTA 1A75B 4WRIA 2F3ZA 4OV2A 3BXKA 2QACA 2H61A 4PE0A 1C07A 2LCPA 3D77A 2M1KB 1EXRA 3NHIA 1FI5A 2NXQA 1KSOA 2JZIA 1OZOA 2KGBC 2LMTA 2K7CA 1DEKA 4M2OA 2BL0C 1DJHA 2JXLA 2RGIA 1LKJA 1NUBA 3I5HC 1B8RA 2KDHA 2MHHA 1NPQA 4XJKA 2H61C 1XFRA 3NSIA 1UUSA 2BCBA 3BFHA 3CR4X 3TDIA 3VRQA 2BKHB 1OMDA 3KPXA 1QATA 3JTDC 1TNWA 3CS1A 1XFZO 3NHTA 1KFXL 2JRFA 3PALA 1BLQA 1Y1UA 1JUOA 4NDCA 3I5GB 4PCWA 1B9AA 2WCBA 2G9BA 1OOHA 2BL0B 2PSRA 3ICBA 1QVIY 1CM4A 4MRXA 2JTZA 2LVIA 2L51A 1DVIA 1SW8A 4AQIA 1YUTA 3CWGA 2Y5IA 3OHMB 3VGOA 2O60A 3EG5B 1TN4A 4GGNA 4MBEA 1B4CA 1DJYA 1K93D 1KQMC 2HPSA 1WLZA 1G4YR 4IL1A 4USLA 1SYMA 3CDNA 3FE8A 3H4SE 4OCIA 5F6TA 4HRGA 2M0RA 3CZ2A 1KQVA 2LC5A 1L7ZA 3FWBA 2L50A 1C7WA 1V1GA 3FE6A 1T14A 2KAYA 3CABA 1CDLA 1S36A 1TCFA 4JD9A 1S5GZ 1S6IA 3VRRA 2LUCA 3EK8A 3SIBA 1DELA 1ORGA 3D0YA 2B1UA 3KF9A 5I8NA 4MN0A 2JULA 1DJIA 1N0YA 2CCMA 2QPTA 3B87A 3SS5A 2ZN8A 1PSRA 3CGAA 4GGFC 1H8BA 5GQQC 1DT7B 1ZOTB 2ERBA 4N5XA 1OQPA 4PE4A 4JKTA 5IBWA 3CZ1A 4GBAA 1EG4A 2WCHA 1FI6A 2M7NA 3JVTB 1XVJA 3EKHA 2GGMA 3PN7B 5FI7A 3S0AA 3KO0A 3I5FB 5I2QA 2MRDA 5DKRA 3C1VA 1XA5A 3R1OA 1FBVA 2H2KA 1FF1A 3R1VA 1OMVA 2KHNA 1RWYA 2JU0A 3R1PA 2OS8C 3K1EA 3VROA 1A03A 1JFKA 5HL1A 1IG5A 4P2YB 3IF7A 2F2OA 3OBVA 1DJGA 3S0BA 4HREE 1D1OA 2GTEA 1MXLC 3I5IB 4U8DA 1CMFA 3S0DA 1F55A 3DXLA 3EVUA 1M46A 3F45A 1YTZC 3I5GC 1Z2CB 2E30A 1ZUZA 1M39A 3OP0A 3SJSA 3PM2A 1NCZA 4YGDB 2DOQA 2K2AA 1YVHA 2OTGC 1YR5A 3ZWHA 2KI6C 2LVKA 2KBMA 3PM8A 2WCJA 1DQEA 2KFGA 5D69A 2CXJA 1OE9B 2L5YA 1LA0A 4CLNA 1F70A 3SG7A 5K89A 1JFJA 2LHLA 2WCLA 2Y1NA 2F8PA 3BFBA 1NCXA 3CR2A 1IGVA 3IQQA 1CTRA 2GV5A 1M45A 1TUZA 5JJGA 1F8HA 4GUKA 3RM1A 3O4YA 3PFVA 4PE7A 1BG1A 1KFUS 1CDPA 1YUSA 3JTDB 1S6JA 4A4BA 1CNPA 1L2OC 2MAZA 2PASA 2QEVA 3TDZA 1PALA 1SL9A 2JNXA 1AJ5A 3OX6A 1SNLA 1UHKA 1UHNA 2NCPA 2BAPA 1OMRA 1OOJA 3AAKA 4PHJA 3BQ3A 4GFTA 2SASA
chains in the Genus database with same CATH topology
4PHNA 2KFFA 1GQMA 1F71A 1QLSA 2BCAA 4WQ3A 3PATA 1CDMA 1DTLA 2ZKMX 2O5GA 1IH0A 5HKYA 2M8UA 1GGZA 1TRFA 2R2IA 5D7FA 1KWOB 1G33A 1AK8A 2ZN9A 1A29A 1NX3A 1TNQA 1U5IB 3HCMA 3DVEA 1RTP1 2ZRSA 2EC6B 1SR6B 2WNDA 1AHRA 4L9MA 3I5IC 1QXPA 4E68A 1FPWA 1ZFSA 1CFPA 2LLTA 1N2DA 2LMVA 1NSHA 5CPVA 1PVAA 1NYAA 1S26D 5HKZA 1WRKA 2KAVA 1JSAA 1HT9A 1SK6D 4YI8A 1CLLA 1YURA 1A75A 1BMOA 1F4OA 4XYNA 1QX7A 1TCOB 4OVNF 5ER4X 2I7AA 1GGWA 4GAOA 4MLWA 1AP4A 2Y4QA 3O2PA 1RROA 3EVVA 1RK9A 2LANA 1CB1A 2LM5A 2G2BA 3EVRA 4HRHA 4XJKB 1QVIZ 1IRJA 3GK1A 4FQOA 1KK7Y 5HKWA 1SPYA 2M1UA 3GOFA 4PALA 4MSPA 2MA2A 2M7LA 2L2EA 1JWDA 2L5XB 3SG2A 2KI6D 2JNFA 5HLOA 2K8MB 1WLMA 1S6CA 3A4UB 1OZSA 1CFCA 3NSKA 2JT0A 1WRZA 3E3RA 1J7OA 1YRTB 1SCMC 1JBAA 4NQGA 1RECA 1KQMB 5B8IB 4I5NB 1QX2A 5DKNA 2BE6A 1KK8B 2KQ6A 1J7PA 2LP2A 4YGCB 1K95A 4M2QA 1F54A 1MWNA 2EHBA 1M31A 2LP3A 1ALVA 4YGEB 4JWQA 3A8RA 4M2PA 2BBNA 1W7IB 2MLEC 5CSNA 2GGZA 2JPTA 1MF8B 3BOWB 4ORBB 5CSFA 4MZJA 2LVJA 1YX7A 5KSZA 1BODA 2TN4A 1KK8C 2FJUB 3CR5X 4ORAB 1H4BA 2PMYA 4GGFA 1BF5A 2BKIB 2WCFA 2AMIA 2HF5A 3O78A 1KFUL 4TNCA 3PSRA 1VRKA 4CFRA 4MRYA 2P6BB 3D0YB 5I2LA 3SIAA 1ALWA 2JC2A 2F33A 1WDCB 3PLFB 1R6PA 2PRUA 1B8LA 4JPZB 4AQJA 2D8NA 1B7TZ 3WHUB 1QLKA 1QS7A 3ZNIA 3SG3A 1AVSA 3D10A 2CBLA 2I18A 3TS5B 4MVFA 4MZKA 4I5KA 1LINA 4DS7A 1S3PA 2L98A 4BY4A 4A4CA 1K96A 2JT3A 2I94A 4NDBA 1PSBA 2I2RE 2ZRTA 1PULA 2K2FA 4C0JA 4ZCVA 1SL7A 2KI4C 1KCYA 3GK4X 1PRWA 2L4HA 1XFXO 5DKQA 4PDZA 3WNXB 5AERA 2KFHA 1CLBA 1K8UA 1J55A 1LVCD 5J3XA 2K7OA 1HQVA 2CNPA 5JOLA 1CMGA 1EH2A 1TNPA 3WHTB 4CFQA 1SBJA 2KNEA 1J1DA 1FW4A 2K7DA 2F2PA 3VRPA 4DIRA 3TDUA 1SKTA 1X02A 2A4JA 3DVKA 1YRUB 2JXCA 2M3WA 2LLUA 3LLEA 2JOJA 4JQ0D 3RLZA 2Y1MA 3LCPC 1DF0B 1BR4B 1CLMA 1BU3A 2M97A 4PHMA 2LUXA 2M9GA 4PHKA 3FWCA 2HQ8A 2LAPA 2FCDA 4MZLA 1UP5A 2HETA 3KEVA 3JVTC 5BPJA 3AKAA 1QIWA 1E8AA 2WC8A 5KU1A 1EL4A 1WRLA 1RJVA 2HQWA 1SL8A 1MHOA 2AAOA 1F4QA 5AEQA 1QV1A 1XK4C 2KYFA 2BECA 4DCKA 1IWQA 2Q4UA 1DGUA 2WORA 2LLSA 2M49B 1J1EA 1SMGA 2K7BA 1UURA 1XK4A 3OX5A 3TS5C 1NWDA 3WXAA 1IQ3A 1MUXA 5I2OA 1K9KA 1SR6C 4ETOA 4CPVA 3CZTX 1OSAA 1JF2A 1QX5B 2LHIA 4OR9B 3SG5A 1U5IA 2L4IA 2FCEA 3BUXB 4OKHA 2LVVA 3DVMA 1NIWA 4N1FA 2LV7A 1NCYA 1KFXS 1RFJA 1TIZA 4UPGA 1QV0A 3DVJA 3M0WA 1DF0A 3OB2B 2COLB 4FTGA 3NSOA 1SCVA 4DRWA 1DJZA 1M63B 3OB1B 4D1EA 1CKKA 1A4PA 1L2OB 1MXEA 2MJWB 2KQYA 4YGBB 1CM1A 2MBXA 2BCXA 4GPLB 3SG4A 3TUYB 1IJ5A 4F0ZB 1DJXA 1GJYA 1Y1XA 1XO5A 2WOSA 1Y0VH 4YI9A 5G08A 2KGRA 1A2XA 1XFWO 4C0LA 3LK0A 5AFPA 1J7RA 4PE1A 1WY9A 5KTYA 1AJ4A 3DD4A 1Q80A 1JC2A 1BT6A 1Y6WA 5HYDA 4YBHB 1SRAA 2SCPA 1UHJA 4ICBA 1NP8A 3TUYC 2CT9A 2JWWA 5HLVA 2KBIA 4I5JA 1ZMZA 1NX1A 1ZACA 1V1FA 1EG3A 1SY9A 1UHHA 1TTXA 3CTNA 4P5OE 2V53A 1XFVO 4I5LB 2ZFDA 1XFYO 1K9PA 2ISDA 1CFDA 1K2HA 2BBMA 2CTNA 1KK7Z 3PN7C 1ODBA 3LK1A 1B8CA 1BJFA 3BUWB 1J7QA 4CIDA 1B47A 1KSMA 2LE9B 2PVBA 1R2UA 4HSZA 4N1GA 1W7JB 3QRXA 4ZCUA 1CFFA 2F3YA 1G8IA 2ZNEA 3BOWA 3EKJA 1DGVA 3DF0A 4DUQA 1Y1AA 1WDCC 4NDDA 2BE4A 2K0JA 5ER5A 4C0KA 4YGAA 2E6WA 3CLNA 4GNKB 1B7TY 2OTGB 1N65A 1DJWA 1UHIA 1AUIB 2WCEA 2LNKA 2EC6C 3IQOA 2NLNA 2PALA 3LL8B 2JT8A 3EK4A 5AXIA 5PALA 1TNXA 1LXFC 1YX8A 2L0PA 2KI4B 3BYAA 3BUNB 4YRUA 2JQ6A 3I5FC 1BOCA 1NX0A 3HX4A 1SCMB 5CSJA 2NCOA 1CDNA 1LA3A 1EJ3A 2KAXA 2OS8B 2KSPA 1MR8A 1YUUA 3AKBA 4Q04A 4R1EA 2EGDA 1QIVA 1XFUO 1QJTA 3NSLA 3GK2A 5CSIA 1NX2A 2IS9A 1K94A 1QASA 1DMOA 2OPOA 1UWOA 1MQ1A 2K61A 2Q91A 5FYXA 2VRGA 2NZ0A 1XYDA 3VRNA 3TZ1A 1K90D 1K9UA 3K21A 3MSEB 2FOTA 1TOPA 2MLFC 5AANA 2AUCA 3KHEA 5TNCA 3NXAA 3O6BA 4BY5A 4QJ5B 1S5GY 4WQ2A 1BR1B 3EK7A 1S1EA 3SG6A 3BUOB 2KYCA 2M29A 4QJ3B 4ORCB 1IJ6A 1PVBA 2JTTA 1PK0D 1B1GA 1IKUA 3DF0B 3FIAA 1C7VA 4QJ4B 1KWOC 1JF0A 3AAJA 3BUMB 4AOMA 2ZNDA 3FS7A 3I5HB 4MEWA 1QTXA 1IQ5A 2LMUA 1YVLA 2KOTA 1A75B 4WRIA 2F3ZA 4OV2A 3BXKA 2QACA 2H61A 4PE0A 1C07A 2LCPA 2M1KB 1EXRA 1FI5A 2NXQA 1KSOA 2JZIA 1OZOA 2KGBC 2LMTA 2K7CA 4M2OA 2BL0C 1DJHA 2JXLA 2RGIA 1LKJA 1NUBA 3I5HC 1B8RA 2KDHA 2MHHA 1NPQA 4XJKA 2H61C 3NSIA 1UUSA 2BCBA 3CR4X 3TDIA 3VRQA 2BKHB 1OMDA 3KPXA 1QATA 3JTDC 1TNWA 3CS1A 1XFZO 3PALA 1KFXL 2JRFA 1BLQA 1Y1UA 1JUOA 4NDCA 3I5GB 4PCWA 1B9AA 2WCBA 2G9BA 2BL0B 2PSRA 3ICBA 1QVIY 1CM4A 4MRXA 2JTZA 2LVIA 2L51A 1DVIA 1SW8A 4AQIA 1YUTA 3CWGA 2Y5IA 3OHMB 3VGOA 2O60A 1TN4A 4GGNA 4MBEA 1B4CA 1DJYA 1K93D 1KQMC 2HPSA 1WLZA 1G4YR 4IL1A 4USLA 1SYMA 3H4SE 4OCIA 5F6TA 4HRGA 2M0RA 1KQVA 2LC5A 1L7ZA 3FWBA 2L50A 1C7WA 1V1GA 2KAYA 1CDLA 1S36A 1TCFA 1S5GZ 1S6IA 3VRRA 2LUCA 3EK8A 3SIBA 3D0YA 2B1UA 3KF9A 5I8NA 4MN0A 2JULA 1DJIA 1N0YA 2CCMA 2QPTA 2ZN8A 1PSRA 3CGAA 4GGFC 1H8BA 5GQQC 1DT7B 1ZOTB 4N5XA 1OQPA 4PE4A 5IBWA 4GBAA 1EG4A 1FI6A 2M7NA 3JVTB 1XVJA 3EKHA 2GGMA 3PN7B 3KO0A 3I5FB 5I2QA 2MRDA 5DKRA 3C1VA 1XA5A 1FBVA 2H2KA 1FF1A 1OMVA 2KHNA 1RWYA 2JU0A 2OS8C 3VROA 1A03A 1JFKA 1IG5A 4P2YB 3IF7A 2F2OA 1DJGA 4HREE 1D1OA 1MXLC 3I5IB 4U8DA 1CMFA 1F55A 3EVUA 1M46A 3F45A 1YTZC 3I5GC 2E30A 3OP0A 1ZUZA 1M39A 3SJSA 1NCZA 4YGDB 2DOQA 2K2AA 1YVHA 2OTGC 1YR5A 3ZWHA 2KI6C 2LVKA 2KBMA 3PM8A 2KFGA 5D69A 2CXJA 1OE9B 1LA0A 4CLNA 1F70A 3SG7A 5K89A 1JFJA 2LHLA 2Y1NA 2F8PA 1NCXA 3CR2A 1IGVA 3IQQA 1CTRA 2GV5A 1M45A 5JJGA 1F8HA 4GUKA 3RM1A 3O4YA 3PFVA 4PE7A 1BG1A 1KFUS 1CDPA 1YUSA 3JTDB 1S6JA 4A4BA 1CNPA 1L2OC 2MAZA 2PASA 3TDZA 1PALA 1SL9A 2JNXA 1AJ5A 3OX6A 1SNLA 1UHKA 1UHNA 2NCPA 1OMRA 1OOJA 3AAKA 4PHJA 3BQ3A 4GFTA 2SASA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PHN A;  2KFF A;  1GQM A;  1F71 A;  1QLS A;  2BCA A;  4WQ3 A;  3PAT A;  1CDM A;  1DTL A;  2ZKM X;  2O5G A;  1IH0 A;  5HKY A;  2M8U A;  1GGZ A;  1TRF A;  2R2I A;  5D7F A;  1KWO B;  1G33 A;  1AK8 A;  2ZN9 A;  1A29 A;  1NX3 A;  1TNQ A;  1U5I B;  3HCM A;  3DVE A;  1RTP 1;  2ZRS A;  2EC6 B;  1SR6 B;  2WND A;  1AHR A;  4L9M A;  3I5I C;  1QXP A;  4E68 A;  1FPW A;  1ZFS A;  1CFP A;  2LLT A;  1N2D A;  2LMV A;  1NSH A;  5CPV A;  1PVA A;  1NYA A;  1S26 D;  5HKZ A;  1WRK A;  2KAV A;  1JSA A;  1HT9 A;  1SK6 D;  4YI8 A;  1CLL A;  1YUR A;  1A75 A;  1BMO A;  1F4O A;  4XYN A;  1QX7 A;  1TCO B;  4OVN F;  5ER4 X;  2I7A A;  1GGW A;  4GAO A;  4MLW A;  1AP4 A;  2Y4Q A;  3O2P A;  1RRO A;  3EVV A;  1RK9 A;  2LAN A;  1CB1 A;  2LM5 A;  2G2B A;  3EVR A;  4HRH A;  4XJK B;  1QVI Z;  1IRJ A;  3GK1 A;  4FQO A;  1KK7 Y;  5HKW A;  1SPY A;  2M1U A;  3GOF A;  4PAL A;  4MSP A;  2MA2 A;  2M7L A;  2L2E A;  1JWD A;  2L5X B;  3SG2 A;  2KI6 D;  2JNF A;  5HLO A;  2K8M B;  1WLM A;  1S6C A;  3A4U B;  1OZS A;  1CFC A;  3NSK A;  2JT0 A;  1WRZ A;  3E3R A;  1J7O A;  1YRT B;  1SCM C;  1JBA A;  4NQG A;  1REC A;  1KQM B;  5B8I B;  4I5N B;  1QX2 A;  5DKN A;  2BE6 A;  1KK8 B;  2KQ6 A;  1J7P A;  2LP2 A;  4YGC B;  1K95 A;  4M2Q A;  1F54 A;  1MWN A;  2EHB A;  1M31 A;  2LP3 A;  1ALV A;  4YGE B;  4JWQ A;  3A8R A;  4M2P A;  2BBN A;  1W7I B;  2MLE C;  5CSN A;  2GGZ A;  2JPT A;  1MF8 B;  3BOW B;  4ORB B;  5CSF A;  4MZJ A;  2LVJ A;  1YX7 A;  5KSZ A;  1BOD A;  2TN4 A;  1KK8 C;  2FJU B;  3CR5 X;  4ORA B;  1H4B A;  2PMY A;  4GGF A;  1BF5 A;  2BKI B;  2WCF A;  2AMI A;  2HF5 A;  3O78 A;  1KFU L;  4TNC A;  3PSR A;  1VRK A;  4CFR A;  4MRY A;  2P6B B;  3D0Y B;  5I2L A;  3SIA A;  1ALW A;  2JC2 A;  2F33 A;  1WDC B;  3PLF B;  1R6P A;  2PRU A;  1B8L A;  4JPZ B;  4AQJ A;  2D8N A;  1B7T Z;  3WHU B;  1QLK A;  1QS7 A;  3ZNI A;  3SG3 A;  1AVS A;  3D10 A;  2CBL A;  2I18 A;  3TS5 B;  4MVF A;  4MZK A;  4I5K A;  1LIN A;  4DS7 A;  1S3P A;  2L98 A;  4BY4 A;  4A4C A;  1K96 A;  2JT3 A;  2I94 A;  4NDB A;  1PSB A;  2I2R E;  2ZRT A;  1PUL A;  2K2F A;  4C0J A;  4ZCV A;  1SL7 A;  2KI4 C;  1KCY A;  3GK4 X;  1PRW A;  2L4H A;  1XFX O;  5DKQ A;  4PDZ A;  3WNX B;  5AER A;  2KFH A;  1CLB A;  1K8U A;  1J55 A;  1LVC D;  5J3X A;  2K7O A;  1HQV A;  2CNP A;  5JOL A;  1CMG A;  1EH2 A;  1TNP A;  3WHT B;  4CFQ A;  1SBJ A;  2KNE A;  1J1D A;  1FW4 A;  2K7D A;  2F2P A;  3VRP A;  4DIR A;  3TDU A;  1SKT A;  1X02 A;  2A4J A;  3DVK A;  1YRU B;  2JXC A;  2M3W A;  2LLU A;  3LLE A;  2JOJ A;  4JQ0 D;  3RLZ A;  2Y1M A;  3LCP C;  1DF0 B;  1BR4 B;  1CLM A;  1BU3 A;  2M97 A;  4PHM A;  2LUX A;  2M9G A;  4PHK A;  3FWC A;  2HQ8 A;  2LAP A;  2FCD A;  4MZL A;  1UP5 A;  2HET A;  3KEV A;  3JVT C;  5BPJ A;  3AKA A;  1QIW A;  1E8A A;  2WC8 A;  5KU1 A;  1EL4 A;  1WRL A;  1RJV A;  2HQW A;  1SL8 A;  1MHO A;  2AAO A;  1F4Q A;  5AEQ A;  1QV1 A;  1XK4 C;  2KYF A;  2BEC A;  4DCK A;  1IWQ A;  2Q4U A;  1DGU A;  2WOR A;  2LLS A;  2M49 B;  1J1E A;  1SMG A;  2K7B A;  1UUR A;  1XK4 A;  3OX5 A;  3TS5 C;  1NWD A;  3WXA A;  1IQ3 A;  1MUX A;  5I2O A;  1K9K A;  1SR6 C;  4ETO A;  4CPV A;  3CZT X;  1OSA A;  1JF2 A;  1QX5 B;  2LHI A;  4OR9 B;  3SG5 A;  1U5I A;  2L4I A;  2FCE A;  3BUX B;  4OKH A;  2LVV A;  3DVM A;  1NIW A;  4N1F A;  2LV7 A;  1NCY A;  1KFX S;  1RFJ A;  1TIZ A;  4UPG A;  1QV0 A;  3DVJ A;  3M0W A;  1DF0 A;  3OB2 B;  2COL B;  4FTG A;  3NSO A;  1SCV A;  4DRW A;  1DJZ A;  1M63 B;  3OB1 B;  4D1E A;  1CKK A;  1A4P A;  1L2O B;  1MXE A;  2MJW B;  2KQY A;  4YGB B;  1CM1 A;  2MBX A;  2BCX A;  4GPL B;  3SG4 A;  3TUY B;  1IJ5 A;  4F0Z B;  1DJX A;  1GJY A;  1Y1X A;  1XO5 A;  2WOS A;  1Y0V H;  4YI9 A;  5G08 A;  2KGR A;  1A2X A;  1XFW O;  4C0L A;  3LK0 A;  5AFP A;  1J7R A;  4PE1 A;  1WY9 A;  5KTY A;  1AJ4 A;  3DD4 A;  1Q80 A;  1JC2 A;  1BT6 A;  1Y6W A;  5HYD A;  4YBH B;  1SRA A;  2SCP A;  1UHJ A;  4ICB A;  1NP8 A;  3TUY C;  2CT9 A;  2JWW A;  5HLV A;  2KBI A;  4I5J A;  1ZMZ A;  1NX1 A;  1ZAC A;  1V1F A;  1EG3 A;  1SY9 A;  1UHH A;  1TTX A;  3CTN A;  4P5O E;  2V53 A;  1XFV O;  4I5L B;  2ZFD A;  1XFY O;  1K9P A;  2ISD A;  1CFD A;  1K2H A;  2BBM A;  2CTN A;  1KK7 Z;  3PN7 C;  1ODB A;  3LK1 A;  1B8C A;  1BJF A;  3BUW B;  1J7Q A;  4CID A;  1B47 A;  1KSM A;  2LE9 B;  2PVB A;  1R2U A;  4HSZ A;  4N1G A;  1W7J B;  3QRX A;  4ZCU A;  1CFF A;  2F3Y A;  1G8I A;  2ZNE A;  3BOW A;  3EKJ A;  1DGV A;  3DF0 A;  4DUQ A;  1Y1A A;  1WDC C;  4NDD A;  2BE4 A;  2K0J A;  5ER5 A;  4C0K A;  4YGA A;  2E6W A;  3CLN A;  4GNK B;  1B7T Y;  2OTG B;  1N65 A;  1DJW A;  1UHI A;  1AUI B;  2WCE A;  2LNK A;  2EC6 C;  3IQO A;  2NLN A;  2PAL A;  3LL8 B;  2JT8 A;  3EK4 A;  5AXI A;  5PAL A;  1TNX A;  1LXF C;  1YX8 A;  2L0P A;  2KI4 B;  3BYA A;  3BUN B;  4YRU A;  2JQ6 A;  3I5F C;  1BOC A;  1NX0 A;  3HX4 A;  1SCM B;  5CSJ A;  2NCO A;  1CDN A;  1LA3 A;  1EJ3 A;  2KAX A;  2OS8 B;  2KSP A;  1MR8 A;  1YUU A;  3AKB A;  4Q04 A;  4R1E A;  2EGD A;  1QIV A;  1XFU O;  1QJT A;  3NSL A;  3GK2 A;  5CSI A;  1NX2 A;  2IS9 A;  1K94 A;  1QAS A;  1DMO A;  2OPO A;  1UWO A;  1MQ1 A;  2K61 A;  2Q91 A;  5FYX A;  2VRG A;  2NZ0 A;  1XYD A;  3VRN A;  3TZ1 A;  1K90 D;  1K9U A;  3K21 A;  3MSE B;  2FOT A;  1TOP A;  2MLF C;  5AAN A;  2AUC A;  3KHE A;  5TNC A;  3NXA A;  3O6B A;  4BY5 A;  4QJ5 B;  1S5G Y;  4WQ2 A;  1BR1 B;  3EK7 A;  1S1E A;  3SG6 A;  3BUO B;  2KYC A;  2M29 A;  4QJ3 B;  4ORC B;  1IJ6 A;  1PVB A;  2JTT A;  1PK0 D;  1B1G A;  1IKU A;  3DF0 B;  3FIA A;  1C7V A;  4QJ4 B;  1KWO C;  1JF0 A;  3AAJ A;  3BUM B;  4AOM A;  2ZND A;  3FS7 A;  3I5H B;  4MEW A;  1QTX A;  1IQ5 A;  2LMU A;  1YVL A;  2KOT A;  1A75 B;  4WRI A;  2F3Z A;  4OV2 A;  3BXK A;  2QAC A;  2H61 A;  4PE0 A;  1C07 A;  2LCP A;  2M1K B;  1EXR A;  1FI5 A;  2NXQ A;  1KSO A;  2JZI A;  1OZO A;  2KGB C;  2LMT A;  2K7C A;  4M2O A;  2BL0 C;  1DJH A;  2JXL A;  2RGI A;  1LKJ A;  1NUB A;  3I5H C;  1B8R A;  2KDH A;  2MHH A;  1NPQ A;  4XJK A;  2H61 C;  3NSI A;  1UUS A;  2BCB A;  3CR4 X;  3TDI A;  3VRQ A;  2BKH B;  1OMD A;  3KPX A;  1QAT A;  3JTD C;  1TNW A;  3CS1 A;  1XFZ O;  3PAL A;  1KFX L;  2JRF A;  1BLQ A;  1Y1U A;  1JUO A;  4NDC A;  3I5G B;  4PCW A;  1B9A A;  2WCB A;  2G9B A;  2BL0 B;  2PSR A;  3ICB A;  1QVI Y;  1CM4 A;  4MRX A;  2JTZ A;  2LVI A;  2L51 A;  1DVI A;  1SW8 A;  4AQI A;  1YUT A;  3CWG A;  2Y5I A;  3OHM B;  3VGO A;  2O60 A;  1TN4 A;  4GGN A;  4MBE A;  1B4C A;  1DJY A;  1K93 D;  1KQM C;  2HPS A;  1WLZ A;  1G4Y R;  4IL1 A;  4USL A;  1SYM A;  3H4S E;  4OCI A;  5F6T A;  4HRG A;  2M0R A;  1KQV A;  2LC5 A;  1L7Z A;  3FWB A;  2L50 A;  1C7W A;  1V1G A;  2KAY A;  1CDL A;  1S36 A;  1TCF A;  1S5G Z;  1S6I A;  3VRR A;  2LUC A;  3EK8 A;  3SIB A;  3D0Y A;  2B1U A;  3KF9 A;  5I8N A;  4MN0 A;  2JUL A;  1DJI A;  1N0Y A;  2CCM A;  2QPT A;  2ZN8 A;  1PSR A;  3CGA A;  4GGF C;  1H8B A;  5GQQ C;  1DT7 B;  1ZOT B;  4N5X A;  1OQP A;  4PE4 A;  5IBW A;  4GBA A;  1EG4 A;  1FI6 A;  2M7N A;  3JVT B;  1XVJ A;  3EKH A;  2GGM A;  3PN7 B;  3KO0 A;  3I5F B;  5I2Q A;  2MRD A;  5DKR A;  3C1V A;  1XA5 A;  1FBV A;  2H2K A;  1FF1 A;  1OMV A;  2KHN A;  1RWY A;  2JU0 A;  2OS8 C;  3VRO A;  1A03 A;  1JFK A;  1IG5 A;  4P2Y B;  3IF7 A;  2F2O A;  1DJG A;  4HRE E;  1D1O A;  1MXL C;  3I5I B;  4U8D A;  1CMF A;  1F55 A;  3EVU A;  1M46 A;  3F45 A;  1YTZ C;  3I5G C;  2E30 A;  3OP0 A;  1ZUZ A;  1M39 A;  3SJS A;  1NCZ A;  4YGD B;  2DOQ A;  2K2A A;  1YVH A;  2OTG C;  1YR5 A;  3ZWH A;  2KI6 C;  2LVK A;  2KBM A;  3PM8 A;  2KFG A;  5D69 A;  2CXJ A;  1OE9 B;  1LA0 A;  4CLN A;  1F70 A;  3SG7 A;  5K89 A;  1JFJ A;  2LHL A;  2Y1N A;  2F8P A;  1NCX A;  3CR2 A;  1IGV A;  3IQQ A;  1CTR A;  2GV5 A;  1M45 A;  5JJG A;  1F8H A;  4GUK A;  3RM1 A;  3O4Y A;  3PFV A;  4PE7 A;  1BG1 A;  1KFU S;  1CDP A;  1YUS A;  3JTD B;  1S6J A;  4A4B A;  1CNP A;  1L2O C;  2MAZ A;  2PAS A;  3TDZ A;  1PAL A;  1SL9 A;  2JNX A;  1AJ5 A;  3OX6 A;  1SNL A;  1UHK A;  1UHN A;  2NCP A;  1OMR A;  1OOJ A;  3AAK A;  4PHJ A;  3BQ3 A;  4GFT A;  2SAS A; 
#chains in the Genus database with same CATH topology
 1OOF A;  4PHN A;  2KFF A;  1GQM A;  1F71 A;  1QLS A;  2BCA A;  4WQ3 A;  3PAT A;  1CDM A;  1DTL A;  2ZKM X;  2O5G A;  1IH0 A;  5HKY A;  2M8U A;  1GGZ A;  1TRF A;  2R2I A;  3BJH A;  5D7F A;  1KWO B;  1G33 A;  1AK8 A;  2ZN9 A;  1A29 A;  1NX3 A;  1TNQ A;  1U5I B;  3HCM A;  3DVE A;  1RTP 1;  2BNX A;  2ZRS A;  3OGN A;  2EC6 B;  2K60 A;  1SR6 B;  2WND A;  3S0E A;  1AHR A;  4L9M A;  3I5I C;  1QXP A;  4E68 A;  2PYQ A;  1FPW A;  1ZFS A;  1CFP A;  2LLT A;  1N2D A;  2LMV A;  3FE9 A;  1NSH A;  5CPV A;  1PVA A;  5FI6 A;  1NYA A;  1S26 D;  5HKZ A;  1WRK A;  2KAV A;  3D78 A;  1JSA A;  1HT9 A;  1SK6 D;  4YI8 A;  1CLL A;  1YUR A;  1A75 A;  1BMO A;  1F4O A;  4XYN A;  3D75 A;  1QX7 A;  1TCO B;  4OVN F;  5ER4 X;  3S0G A;  2WC5 A;  2I7A A;  1GGW A;  4GAO A;  4MLW A;  1AP4 A;  1P28 A;  2Y4Q A;  3O2P A;  1RRO A;  3EVV A;  1RK9 A;  2LAN A;  1CB1 A;  2LM5 A;  2G2B A;  3EVR A;  4HRH A;  4XJK B;  1QVI Z;  1IRJ A;  3GK1 A;  4FQO A;  1KK7 Y;  5HKW A;  2H8V A;  1SPY A;  2QEO A;  2M1U A;  3BFA A;  3GOF A;  4PAL A;  4MSP A;  2MA2 A;  2M7L A;  2L2E A;  3UNW A;  1JWD A;  2L5X B;  3SG2 A;  2KI6 D;  2JNF A;  5HLO A;  2K8M B;  1WLM A;  1S6C A;  3A4U B;  1OZS A;  3SS3 A;  3NSK A;  2JT0 A;  1WRZ A;  3E3R A;  1CFC A;  1YRT B;  1SCM C;  3B88 A;  1J7O A;  4NQG A;  1JBA A;  1REC A;  1KQM B;  5B8I B;  4I5N B;  1QX2 A;  5DKN A;  2BE6 A;  1KK8 B;  2KQ6 A;  1J7P A;  2LP2 A;  4YGC B;  1K95 A;  4M2Q A;  1F54 A;  1MWN A;  2EHB A;  1M31 A;  2LP3 A;  1ALV A;  4YGE B;  4JWQ A;  3A8R A;  4M2P A;  2BBN A;  2KLD A;  1W7I B;  2MLE C;  5CSN A;  3V2L A;  2GGZ A;  2JPT A;  1MF8 B;  2WC6 A;  3BOW B;  4ORB B;  5CSF A;  4MZJ A;  1OOG A;  1YX7 A;  2LVJ A;  5KSZ A;  1BOD A;  2TN4 A;  1KK8 C;  2FJU B;  3CR5 X;  4ORA B;  1H4B A;  2PMY A;  4GGF A;  1BF5 A;  2BKI B;  2WCF A;  2AMI A;  2HF5 A;  3O78 A;  1KFU L;  4TNC A;  3PSR A;  2KPH A;  1VRK A;  4CFR A;  4MRY A;  2P6B B;  3D0Y B;  5I2L A;  3SIA A;  1ALW A;  2JC2 A;  2F33 A;  1WDC B;  3PLF B;  5EL2 A;  2QEB A;  1R6P A;  2PRU A;  1B8L A;  4JPZ B;  4AQJ A;  2D8N A;  1B7T Z;  3WHU B;  1QLK A;  1TUJ A;  1QS7 A;  3ZNI A;  3SG3 A;  1AVS A;  3D10 A;  2CBL A;  2I18 A;  3D74 A;  3TS5 B;  4MVF A;  4MZK A;  4I5K A;  1LIN A;  4DS7 A;  1S3P A;  2L98 A;  2L2C A;  3RZS A;  4BY4 A;  4A4C A;  1K96 A;  2JT3 A;  2I94 A;  4NDB A;  1PSB A;  2I2R E;  2ZRT A;  1PUL A;  2K2F A;  4C0J A;  3DY9 A;  1SL7 A;  2KI4 C;  4ZCV A;  1KCY A;  3GK4 X;  1PRW A;  2L4H A;  1XFX O;  5DKQ A;  4PDZ A;  3WNX B;  5AER A;  2KFH A;  1CLB A;  1K8U A;  3R72 A;  1J55 A;  1LVC D;  5J3X A;  2K7O A;  1HQV A;  2CNP A;  5JOL A;  1CMG A;  1EH2 A;  1TNP A;  3WHT B;  4CFQ A;  1SBJ A;  2KNE A;  1J1D A;  1FW4 A;  5D3O A;  2K7D A;  2F2P A;  3VRP A;  4DIR A;  3TDU A;  1SKT A;  4PT1 A;  1X02 A;  2A4J A;  3DVK A;  1YRU B;  3DYE A;  2JXC A;  2M3W A;  2LLU A;  3LLE A;  2JOJ A;  4JQ0 D;  3RLZ A;  2Y1M A;  3LCP C;  3VB1 A;  1DF0 B;  1BR4 B;  1CLM A;  1BU3 A;  2M97 A;  4PHM A;  2LUX A;  2M9G A;  4PHK A;  3FWC A;  2HQ8 A;  2LAP A;  2FCD A;  4OZD A;  4MZL A;  1UP5 A;  1LS8 A;  2HET A;  3KEV A;  3JVT C;  5BPJ A;  3AKA A;  1QIW A;  1E8A A;  2QDI A;  2WC8 A;  5KU1 A;  1OOI X;  1EL4 A;  1WRL A;  1RJV A;  2FJY A;  2HQW A;  3QME A;  1SL8 A;  1MHO A;  2AAO A;  1F4Q A;  5AEQ A;  1QV1 A;  1XK4 C;  2KYF A;  2BEC A;  3L4L A;  4DCK A;  1IWQ A;  2Q4U A;  1DGU A;  2WOR A;  1DC1 A;  2LLS A;  2M49 B;  1J1E A;  1SMG A;  2K7B A;  4IJ7 A;  1UUR A;  1XK4 A;  3UO9 A;  2PQL A;  3OX5 A;  3TS5 C;  1NWD A;  3WXA A;  1IQ3 A;  1MUX A;  5I2O A;  1K9K A;  1SR6 C;  4ETO A;  4CPV A;  3CZT X;  1GM0 A;  1OSA A;  1JF2 A;  1QX5 B;  2LHI A;  4OR9 B;  3SG5 A;  1U5I A;  2L4I A;  2WCK A;  2FCE A;  3BUX B;  3D73 A;  4FQT A;  4OKH A;  3S0F A;  2LVV A;  3DVM A;  1NIW A;  4N1F A;  2LV7 A;  1NCY A;  1KFX S;  1RFJ A;  1TIZ A;  2QEH A;  4UPG A;  1QV0 A;  3DVJ A;  2P70 A;  1DF0 A;  3M0W A;  2COL B;  3OB2 B;  3NSO A;  4FTG A;  1SCV A;  4DRW A;  1DJZ A;  1M63 B;  3OB1 B;  4D1E A;  1CKK A;  1TWO A;  1A4P A;  3NGV A;  1L2O B;  1MXE A;  2MJW B;  3Q8I A;  2KQY A;  2P71 A;  1CM1 A;  4YGB B;  2MBX A;  2BCX A;  4GPL B;  3SG4 A;  3TUY B;  1IJ5 A;  4F0Z B;  1DJX A;  1GJY A;  1Y1X A;  1XO5 A;  1W9Z A;  1Y0V H;  2WOS A;  4YI9 A;  5G08 A;  2KGR A;  1A2X A;  1XFW O;  4C0L A;  3LK0 A;  5AFP A;  1J7R A;  4PE1 A;  1WY9 A;  4F7F A;  1AJ4 A;  1C3Z A;  3DD4 A;  1Q80 A;  5KTY A;  1JC2 A;  1BT6 A;  1Y6W A;  3SS4 A;  5HYD A;  4YBH B;  1SRA A;  2SCP A;  1SSE B;  1UHJ A;  4ICB A;  1NP8 A;  3TUY C;  2CT9 A;  2JWW A;  5HLV A;  3O4X A;  2KBI A;  4I5J A;  1ZMZ A;  1NX1 A;  1ZAC A;  1V1F A;  1EG3 A;  1SY9 A;  1UHH A;  1TTX A;  3CTN A;  4P5O E;  2V53 A;  1XFV O;  4I5L B;  2ZFD A;  3B86 A;  1XFY O;  1K9P A;  2ISD A;  1CFD A;  1K2H A;  2BBM A;  2CTN A;  1KK7 Z;  3PN7 C;  1ODB A;  2WCM A;  3LK1 A;  1B8C A;  1BJF A;  3BUW B;  1J7Q A;  3L47 A;  4CID A;  3B7A A;  1B47 A;  1KSM A;  2LE9 B;  2PVB A;  1R2U A;  4HSZ A;  1C3Y A;  4N1G A;  1W7J B;  3QRX A;  2JPO A;  3IVT A;  4ZCU A;  1CFF A;  2F3Y A;  1G8I A;  2ZNE A;  3BOW A;  3EKJ A;  1DGV A;  3DF0 A;  4DUQ A;  1Y1A A;  1WDC C;  4NDD A;  1QWV A;  2BE4 A;  2K0J A;  5ER5 A;  4C0K A;  4YGA A;  2E6W A;  3CLN A;  4GNK B;  4INW A;  1B7T Y;  2OTG B;  3D76 A;  1N65 A;  1DJW A;  1UHI A;  1AUI B;  2WCE A;  2LNK A;  2EC6 C;  3IQO A;  2NLN A;  4KYN A;  2PAL A;  3LL8 B;  3PJI A;  2JT8 A;  3EK4 A;  5AXI A;  5PAL A;  1OW4 A;  1TNX A;  1LXF C;  1YX8 A;  5DIC A;  2L0P A;  2KI4 B;  3BYA A;  3BUN B;  4YRU A;  2JQ6 A;  3I5F C;  1BOC A;  1NX0 A;  3HX4 A;  1SCM B;  5CSJ A;  2NCO A;  1CDN A;  1LA3 A;  1EJ3 A;  3CZ0 A;  1IIO A;  2KAX A;  2OS8 B;  2KSP A;  1Z4H A;  1MR8 A;  1YUU A;  3AKB A;  4Q04 A;  4R1E A;  2EGD A;  1QIV A;  1XFU O;  1QJT A;  3NSL A;  3GK2 A;  5CSI A;  1NX2 A;  2IS9 A;  1K94 A;  1QAS A;  1DMO A;  2OPO A;  1UWO A;  1MQ1 A;  2K61 A;  2Q91 A;  3B6X A;  5FYX A;  3L4A A;  4INX A;  2VRG A;  2NZ0 A;  1XYD A;  5FI2 A;  2YGU A;  3TZ1 A;  3VRN A;  5I94 A;  1K90 D;  1K9U A;  3K21 A;  3MSE B;  2FOT A;  1TOP A;  2MLF C;  5AAN A;  2AUC A;  3KHE A;  5TNC A;  3NXA A;  3O6B A;  4BY5 A;  3CYZ A;  1S5G Y;  4WQ2 A;  1BR1 B;  3EK7 A;  1S1E A;  3SG6 A;  4QJ5 B;  3BUO B;  2KYC A;  2M29 A;  4QJ3 B;  4ORC B;  1IJ6 A;  1PVB A;  3DZT A;  2JTT A;  3N7H A;  1PK0 D;  1B1G A;  1IKU A;  3DF0 B;  3FIA A;  1C7V A;  4QJ4 B;  1KWO C;  1JF0 A;  3AAJ A;  3BUM B;  4AOM A;  2ZND A;  3FS7 A;  3I5H B;  4MEW A;  1QTX A;  2KLE A;  1IQ5 A;  2LMU A;  1YVL A;  2KOT A;  1A75 B;  4WRI A;  2F3Z A;  4OV2 A;  3BXK A;  2QAC A;  2H61 A;  4PE0 A;  1C07 A;  2LCP A;  3D77 A;  2M1K B;  1EXR A;  3NHI A;  1FI5 A;  2NXQ A;  1KSO A;  2JZI A;  1OZO A;  2KGB C;  2LMT A;  2K7C A;  1DEK A;  4M2O A;  2BL0 C;  1DJH A;  2JXL A;  2RGI A;  1LKJ A;  1NUB A;  3I5H C;  1B8R A;  2KDH A;  2MHH A;  1NPQ A;  4XJK A;  2H61 C;  1XFR A;  3NSI A;  1UUS A;  2BCB A;  3BFH A;  3CR4 X;  3TDI A;  3VRQ A;  2BKH B;  1OMD A;  3KPX A;  1QAT A;  3JTD C;  1TNW A;  3CS1 A;  1XFZ O;  3NHT A;  1KFX L;  2JRF A;  3PAL A;  1BLQ A;  1Y1U A;  1JUO A;  4NDC A;  3I5G B;  4PCW A;  1B9A A;  2WCB A;  2G9B A;  1OOH A;  2BL0 B;  2PSR A;  3ICB A;  1QVI Y;  1CM4 A;  4MRX A;  2JTZ A;  2LVI A;  2L51 A;  1DVI A;  1SW8 A;  4AQI A;  1YUT A;  3CWG A;  2Y5I A;  3OHM B;  3VGO A;  2O60 A;  3EG5 B;  1TN4 A;  4GGN A;  4MBE A;  1B4C A;  1DJY A;  1K93 D;  1KQM C;  2HPS A;  1WLZ A;  1G4Y R;  4IL1 A;  4USL A;  1SYM A;  3CDN A;  3FE8 A;  3H4S E;  4OCI A;  5F6T A;  4HRG A;  2M0R A;  3CZ2 A;  1KQV A;  2LC5 A;  1L7Z A;  3FWB A;  2L50 A;  1C7W A;  1V1G A;  3FE6 A;  1T14 A;  2KAY A;  3CAB A;  1CDL A;  1S36 A;  1TCF A;  4JD9 A;  1S5G Z;  1S6I A;  3VRR A;  2LUC A;  3EK8 A;  3SIB A;  1DEL A;  1ORG A;  3D0Y A;  2B1U A;  3KF9 A;  5I8N A;  4MN0 A;  2JUL A;  1DJI A;  1N0Y A;  2CCM A;  2QPT A;  3B87 A;  3SS5 A;  2ZN8 A;  1PSR A;  3CGA A;  4GGF C;  1H8B A;  5GQQ C;  1DT7 B;  1ZOT B;  2ERB A;  4N5X A;  1OQP A;  4PE4 A;  4JKT A;  5IBW A;  3CZ1 A;  4GBA A;  1EG4 A;  2WCH A;  1FI6 A;  2M7N A;  3JVT B;  1XVJ A;  3EKH A;  2GGM A;  3PN7 B;  5FI7 A;  3S0A A;  3KO0 A;  3I5F B;  5I2Q A;  2MRD A;  5DKR A;  3C1V A;  1XA5 A;  3R1O A;  1FBV A;  2H2K A;  1FF1 A;  3R1V A;  1OMV A;  2KHN A;  1RWY A;  2JU0 A;  3R1P A;  2OS8 C;  3K1E A;  3VRO A;  1A03 A;  1JFK A;  5HL1 A;  1IG5 A;  4P2Y B;  3IF7 A;  2F2O A;  3OBV A;  1DJG A;  3S0B A;  4HRE E;  1D1O A;  2GTE A;  1MXL C;  3I5I B;  4U8D A;  1CMF A;  3S0D A;  1F55 A;  3DXL A;  3EVU A;  1M46 A;  3F45 A;  1YTZ C;  3I5G C;  1Z2C B;  2E30 A;  1ZUZ A;  1M39 A;  3OP0 A;  3SJS A;  3PM2 A;  1NCZ A;  4YGD B;  2DOQ A;  2K2A A;  1YVH A;  2OTG C;  1YR5 A;  3ZWH A;  2KI6 C;  2LVK A;  2KBM A;  3PM8 A;  2WCJ A;  1DQE A;  2KFG A;  5D69 A;  2CXJ A;  1OE9 B;  2L5Y A;  1LA0 A;  4CLN A;  1F70 A;  3SG7 A;  5K89 A;  1JFJ A;  2LHL A;  2WCL A;  2Y1N A;  2F8P A;  3BFB A;  1NCX A;  3CR2 A;  1IGV A;  3IQQ A;  1CTR A;  2GV5 A;  1M45 A;  1TUZ A;  5JJG A;  1F8H A;  4GUK A;  3RM1 A;  3O4Y A;  3PFV A;  4PE7 A;  1BG1 A;  1KFU S;  1CDP A;  1YUS A;  3JTD B;  1S6J A;  4A4B A;  1CNP A;  1L2O C;  2MAZ A;  2PAS A;  2QEV A;  3TDZ A;  1PAL A;  1SL9 A;  2JNX A;  1AJ5 A;  3OX6 A;  1SNL A;  1UHK A;  1UHN A;  2NCP A;  2BAP A;  1OMR A;  1OOJ A;  3AAK A;  4PHJ A;  3BQ3 A;  4GFT A;  2SAS A; 
#chains in the Genus database with same CATH homology
 4PHN A;  2KFF A;  1GQM A;  1F71 A;  1QLS A;  2BCA A;  4WQ3 A;  3PAT A;  1CDM A;  1DTL A;  2ZKM X;  2O5G A;  1IH0 A;  5HKY A;  2M8U A;  1GGZ A;  1TRF A;  2R2I A;  5D7F A;  1KWO B;  1G33 A;  1AK8 A;  2ZN9 A;  1A29 A;  1NX3 A;  1TNQ A;  1U5I B;  3HCM A;  3DVE A;  1RTP 1;  2ZRS A;  2EC6 B;  1SR6 B;  2WND A;  1AHR A;  4L9M A;  3I5I C;  1QXP A;  4E68 A;  1FPW A;  1ZFS A;  1CFP A;  2LLT A;  1N2D A;  2LMV A;  1NSH A;  5CPV A;  1PVA A;  1NYA A;  1S26 D;  5HKZ A;  1WRK A;  2KAV A;  1JSA A;  1HT9 A;  1SK6 D;  4YI8 A;  1CLL A;  1YUR A;  1A75 A;  1BMO A;  1F4O A;  4XYN A;  1QX7 A;  1TCO B;  4OVN F;  5ER4 X;  2I7A A;  1GGW A;  4GAO A;  4MLW A;  1AP4 A;  2Y4Q A;  3O2P A;  1RRO A;  3EVV A;  1RK9 A;  2LAN A;  1CB1 A;  2LM5 A;  2G2B A;  3EVR A;  4HRH A;  4XJK B;  1QVI Z;  1IRJ A;  3GK1 A;  4FQO A;  1KK7 Y;  5HKW A;  1SPY A;  2M1U A;  3GOF A;  4PAL A;  4MSP A;  2MA2 A;  2M7L A;  2L2E A;  1JWD A;  2L5X B;  3SG2 A;  2KI6 D;  2JNF A;  5HLO A;  2K8M B;  1WLM A;  1S6C A;  3A4U B;  1OZS A;  1CFC A;  3NSK A;  2JT0 A;  1WRZ A;  3E3R A;  1J7O A;  1YRT B;  1SCM C;  1JBA A;  4NQG A;  1REC A;  1KQM B;  5B8I B;  4I5N B;  1QX2 A;  5DKN A;  2BE6 A;  1KK8 B;  2KQ6 A;  1J7P A;  2LP2 A;  4YGC B;  1K95 A;  4M2Q A;  1F54 A;  1MWN A;  2EHB A;  1M31 A;  2LP3 A;  1ALV A;  4YGE B;  4JWQ A;  3A8R A;  4M2P A;  2BBN A;  1W7I B;  2MLE C;  5CSN A;  2GGZ A;  2JPT A;  1MF8 B;  3BOW B;  4ORB B;  5CSF A;  4MZJ A;  2LVJ A;  1YX7 A;  5KSZ A;  1BOD A;  2TN4 A;  1KK8 C;  2FJU B;  3CR5 X;  4ORA B;  1H4B A;  2PMY A;  4GGF A;  1BF5 A;  2BKI B;  2WCF A;  2AMI A;  2HF5 A;  3O78 A;  1KFU L;  4TNC A;  3PSR A;  1VRK A;  4CFR A;  4MRY A;  2P6B B;  3D0Y B;  5I2L A;  3SIA A;  1ALW A;  2JC2 A;  2F33 A;  1WDC B;  3PLF B;  1R6P A;  2PRU A;  1B8L A;  4JPZ B;  4AQJ A;  2D8N A;  1B7T Z;  3WHU B;  1QLK A;  1QS7 A;  3ZNI A;  3SG3 A;  1AVS A;  3D10 A;  2CBL A;  2I18 A;  3TS5 B;  4MVF A;  4MZK A;  4I5K A;  1LIN A;  4DS7 A;  1S3P A;  2L98 A;  4BY4 A;  4A4C A;  1K96 A;  2JT3 A;  2I94 A;  4NDB A;  1PSB A;  2I2R E;  2ZRT A;  1PUL A;  2K2F A;  4C0J A;  4ZCV A;  1SL7 A;  2KI4 C;  1KCY A;  3GK4 X;  1PRW A;  2L4H A;  1XFX O;  5DKQ A;  4PDZ A;  3WNX B;  5AER A;  2KFH A;  1CLB A;  1K8U A;  1J55 A;  1LVC D;  5J3X A;  2K7O A;  1HQV A;  2CNP A;  5JOL A;  1CMG A;  1EH2 A;  1TNP A;  3WHT B;  4CFQ A;  1SBJ A;  2KNE A;  1J1D A;  1FW4 A;  2K7D A;  2F2P A;  3VRP A;  4DIR A;  3TDU A;  1SKT A;  1X02 A;  2A4J A;  3DVK A;  1YRU B;  2JXC A;  2M3W A;  2LLU A;  3LLE A;  2JOJ A;  4JQ0 D;  3RLZ A;  2Y1M A;  3LCP C;  1DF0 B;  1BR4 B;  1CLM A;  1BU3 A;  2M97 A;  4PHM A;  2LUX A;  2M9G A;  4PHK A;  3FWC A;  2HQ8 A;  2LAP A;  2FCD A;  4MZL A;  1UP5 A;  2HET A;  3KEV A;  3JVT C;  5BPJ A;  3AKA A;  1QIW A;  1E8A A;  2WC8 A;  5KU1 A;  1EL4 A;  1WRL A;  1RJV A;  2HQW A;  1SL8 A;  1MHO A;  2AAO A;  1F4Q A;  5AEQ A;  1QV1 A;  1XK4 C;  2KYF A;  2BEC A;  4DCK A;  1IWQ A;  2Q4U A;  1DGU A;  2WOR A;  2LLS A;  2M49 B;  1J1E A;  1SMG A;  2K7B A;  1UUR A;  1XK4 A;  3OX5 A;  3TS5 C;  1NWD A;  3WXA A;  1IQ3 A;  1MUX A;  5I2O A;  1K9K A;  1SR6 C;  4ETO A;  4CPV A;  3CZT X;  1OSA A;  1JF2 A;  1QX5 B;  2LHI A;  4OR9 B;  3SG5 A;  1U5I A;  2L4I A;  2FCE A;  3BUX B;  4OKH A;  2LVV A;  3DVM A;  1NIW A;  4N1F A;  2LV7 A;  1NCY A;  1KFX S;  1RFJ A;  1TIZ A;  4UPG A;  1QV0 A;  3DVJ A;  3M0W A;  1DF0 A;  3OB2 B;  2COL B;  4FTG A;  3NSO A;  1SCV A;  4DRW A;  1DJZ A;  1M63 B;  3OB1 B;  4D1E A;  1CKK A;  1A4P A;  1L2O B;  1MXE A;  2MJW B;  2KQY A;  4YGB B;  1CM1 A;  2MBX A;  2BCX A;  4GPL B;  3SG4 A;  3TUY B;  1IJ5 A;  4F0Z B;  1DJX A;  1GJY A;  1Y1X A;  1XO5 A;  2WOS A;  1Y0V H;  4YI9 A;  5G08 A;  2KGR A;  1A2X A;  1XFW O;  4C0L A;  3LK0 A;  5AFP A;  1J7R A;  4PE1 A;  1WY9 A;  5KTY A;  1AJ4 A;  3DD4 A;  1Q80 A;  1JC2 A;  1BT6 A;  1Y6W A;  5HYD A;  4YBH B;  1SRA A;  2SCP A;  1UHJ A;  4ICB A;  1NP8 A;  3TUY C;  2CT9 A;  2JWW A;  5HLV A;  2KBI A;  4I5J A;  1ZMZ A;  1NX1 A;  1ZAC A;  1V1F A;  1EG3 A;  1SY9 A;  1UHH A;  1TTX A;  3CTN A;  4P5O E;  2V53 A;  1XFV O;  4I5L B;  2ZFD A;  1XFY O;  1K9P A;  2ISD A;  1CFD A;  1K2H A;  2BBM A;  2CTN A;  1KK7 Z;  3PN7 C;  1ODB A;  3LK1 A;  1B8C A;  1BJF A;  3BUW B;  1J7Q A;  4CID A;  1B47 A;  1KSM A;  2LE9 B;  2PVB A;  1R2U A;  4HSZ A;  4N1G A;  1W7J B;  3QRX A;  4ZCU A;  1CFF A;  2F3Y A;  1G8I A;  2ZNE A;  3BOW A;  3EKJ A;  1DGV A;  3DF0 A;  4DUQ A;  1Y1A A;  1WDC C;  4NDD A;  2BE4 A;  2K0J A;  5ER5 A;  4C0K A;  4YGA A;  2E6W A;  3CLN A;  4GNK B;  1B7T Y;  2OTG B;  1N65 A;  1DJW A;  1UHI A;  1AUI B;  2WCE A;  2LNK A;  2EC6 C;  3IQO A;  2NLN A;  2PAL A;  3LL8 B;  2JT8 A;  3EK4 A;  5AXI A;  5PAL A;  1TNX A;  1LXF C;  1YX8 A;  2L0P A;  2KI4 B;  3BYA A;  3BUN B;  4YRU A;  2JQ6 A;  3I5F C;  1BOC A;  1NX0 A;  3HX4 A;  1SCM B;  5CSJ A;  2NCO A;  1CDN A;  1LA3 A;  1EJ3 A;  2KAX A;  2OS8 B;  2KSP A;  1MR8 A;  1YUU A;  3AKB A;  4Q04 A;  4R1E A;  2EGD A;  1QIV A;  1XFU O;  1QJT A;  3NSL A;  3GK2 A;  5CSI A;  1NX2 A;  2IS9 A;  1K94 A;  1QAS A;  1DMO A;  2OPO A;  1UWO A;  1MQ1 A;  2K61 A;  2Q91 A;  5FYX A;  2VRG A;  2NZ0 A;  1XYD A;  3VRN A;  3TZ1 A;  1K90 D;  1K9U A;  3K21 A;  3MSE B;  2FOT A;  1TOP A;  2MLF C;  5AAN A;  2AUC A;  3KHE A;  5TNC A;  3NXA A;  3O6B A;  4BY5 A;  4QJ5 B;  1S5G Y;  4WQ2 A;  1BR1 B;  3EK7 A;  1S1E A;  3SG6 A;  3BUO B;  2KYC A;  2M29 A;  4QJ3 B;  4ORC B;  1IJ6 A;  1PVB A;  2JTT A;  1PK0 D;  1B1G A;  1IKU A;  3DF0 B;  3FIA A;  1C7V A;  4QJ4 B;  1KWO C;  1JF0 A;  3AAJ A;  3BUM B;  4AOM A;  2ZND A;  3FS7 A;  3I5H B;  4MEW A;  1QTX A;  1IQ5 A;  2LMU A;  1YVL A;  2KOT A;  1A75 B;  4WRI A;  2F3Z A;  4OV2 A;  3BXK A;  2QAC A;  2H61 A;  4PE0 A;  1C07 A;  2LCP A;  2M1K B;  1EXR A;  1FI5 A;  2NXQ A;  1KSO A;  2JZI A;  1OZO A;  2KGB C;  2LMT A;  2K7C A;  4M2O A;  2BL0 C;  1DJH A;  2JXL A;  2RGI A;  1LKJ A;  1NUB A;  3I5H C;  1B8R A;  2KDH A;  2MHH A;  1NPQ A;  4XJK A;  2H61 C;  3NSI A;  1UUS A;  2BCB A;  3CR4 X;  3TDI A;  3VRQ A;  2BKH B;  1OMD A;  3KPX A;  1QAT A;  3JTD C;  1TNW A;  3CS1 A;  1XFZ O;  3PAL A;  1KFX L;  2JRF A;  1BLQ A;  1Y1U A;  1JUO A;  4NDC A;  3I5G B;  4PCW A;  1B9A A;  2WCB A;  2G9B A;  2BL0 B;  2PSR A;  3ICB A;  1QVI Y;  1CM4 A;  4MRX A;  2JTZ A;  2LVI A;  2L51 A;  1DVI A;  1SW8 A;  4AQI A;  1YUT A;  3CWG A;  2Y5I A;  3OHM B;  3VGO A;  2O60 A;  1TN4 A;  4GGN A;  4MBE A;  1B4C A;  1DJY A;  1K93 D;  1KQM C;  2HPS A;  1WLZ A;  1G4Y R;  4IL1 A;  4USL A;  1SYM A;  3H4S E;  4OCI A;  5F6T A;  4HRG A;  2M0R A;  1KQV A;  2LC5 A;  1L7Z A;  3FWB A;  2L50 A;  1C7W A;  1V1G A;  2KAY A;  1CDL A;  1S36 A;  1TCF A;  1S5G Z;  1S6I A;  3VRR A;  2LUC A;  3EK8 A;  3SIB A;  3D0Y A;  2B1U A;  3KF9 A;  5I8N A;  4MN0 A;  2JUL A;  1DJI A;  1N0Y A;  2CCM A;  2QPT A;  2ZN8 A;  1PSR A;  3CGA A;  4GGF C;  1H8B A;  5GQQ C;  1DT7 B;  1ZOT B;  4N5X A;  1OQP A;  4PE4 A;  5IBW A;  4GBA A;  1EG4 A;  1FI6 A;  2M7N A;  3JVT B;  1XVJ A;  3EKH A;  2GGM A;  3PN7 B;  3KO0 A;  3I5F B;  5I2Q A;  2MRD A;  5DKR A;  3C1V A;  1XA5 A;  1FBV A;  2H2K A;  1FF1 A;  1OMV A;  2KHN A;  1RWY A;  2JU0 A;  2OS8 C;  3VRO A;  1A03 A;  1JFK A;  1IG5 A;  4P2Y B;  3IF7 A;  2F2O A;  1DJG A;  4HRE E;  1D1O A;  1MXL C;  3I5I B;  4U8D A;  1CMF A;  1F55 A;  3EVU A;  1M46 A;  3F45 A;  1YTZ C;  3I5G C;  2E30 A;  3OP0 A;  1ZUZ A;  1M39 A;  3SJS A;  1NCZ A;  4YGD B;  2DOQ A;  2K2A A;  1YVH A;  2OTG C;  1YR5 A;  3ZWH A;  2KI6 C;  2LVK A;  2KBM A;  3PM8 A;  2KFG A;  5D69 A;  2CXJ A;  1OE9 B;  1LA0 A;  4CLN A;  1F70 A;  3SG7 A;  5K89 A;  1JFJ A;  2LHL A;  2Y1N A;  2F8P A;  1NCX A;  3CR2 A;  1IGV A;  3IQQ A;  1CTR A;  2GV5 A;  1M45 A;  5JJG A;  1F8H A;  4GUK A;  3RM1 A;  3O4Y A;  3PFV A;  4PE7 A;  1BG1 A;  1KFU S;  1CDP A;  1YUS A;  3JTD B;  1S6J A;  4A4B A;  1CNP A;  1L2O C;  2MAZ A;  2PAS A;  3TDZ A;  1PAL A;  1SL9 A;  2JNX A;  1AJ5 A;  3OX6 A;  1SNL A;  1UHK A;  1UHN A;  2NCP A;  1OMR A;  1OOJ A;  3AAK A;  4PHJ A;  3BQ3 A;  4GFT A;  2SAS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...