5DKQA

Crystal structure of calcium-loaded s100b bound to sbi4214
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
91
structure length
91
Chain Sequence
MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFFEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-B
publication title Small Molecule Inhibitors of Ca(2+)-S100B Reveal Two Protein Conformations.
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein/inhibitor
total genus 31
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2015-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5dkqA00
1B47A 2K61A 4GBAA 1CMFA 4OV2A 2M8UA 1UHKA 1DF0A 2JNFA 4XJKA 1UUSA 4Q04A 2HQ8A 1QLSA 2LMTA 3I5GB 5AXIA 2F2PA 4CFRA 1WY9A 2LE9B 3KO0A 3F45A 1A2XA 3O2PA 3SG7A 1MQ1A 1DJIA 2KI4B 1MR8A 1NCYA 1SYMA 1MXLC 1JFJA 4YGDB 1ZMZA 2JZIA 2KI6C 1A75B 3CZTX 1CFCA 1L2OC 4ICBA 1SR6B 1V1GA 1TIZA 2JWWA 2AMIA 3IQQA 3PN7C 1TNQA 5DKNA 2BL0C 1M63B 2LVJA 2F3YA 1F8HA 2KYFA 2L0PA 1M45A 1CFPA 5HYDA 1SCVA 1RTP1 1NCXA 3EVRA 1WRLA 1B4CA 4JWQA 2KOTA 2L4HA 1B7TZ 2HETA 4MZJA 5CSFA 1S1EA 1S6IA 2F3ZA 2M3WA 4M2PA 4USLA 3VRNA 4GGFC 1TNXA 2LMVA 1DVIA 1NUBA 2HF5A 2LNKA 2SASA 4PHMA 4CIDA 1SCMB 2CBLA 2FJUB 3A4UB 1NWDA 4PALA 3FWCA 1S36A 1ALWA 3KEVA 3I5IB 1CLLA 2JQ6A 5K89A 1F71A 3SG5A 3BOWB 5DKRA 3LCPC 2KFFA 3ZWHA 3SIBA 2LVVA 1OZSA 1XK4C 1B1GA 1NIWA 4DUQA 2K8MB 4HSZA 2WC8A 4N1GA 2F8PA 1YX8A 1AVSA 3OX6A 3K21A 4AQJA 2EHBA 2V53A 4DIRA 2Y1MA 1BT6A 4CPVA 1V1FA 1FW4A 4ZCUA 1RJVA 1KWOC 1CKKA 1A03A 2KHNA 2ZN9A 1SK6D 3DVKA 2KAVA 3DF0B 4E68A 2CTNA 1BG1A 1KQMC 1QVIZ 1TRFA 1XFWO 4JPZB 1YUSA 1F4OA 4ZCVA 3GK2A 4QJ5B 1GQMA 4WQ3A 1GGZA 4M2QA 4NDBA 2P6BB 1DF0B 2ZNDA 2PASA 4XJKB 1FF1A 1DJGA 1IQ3A 3HCMA 1LA0A 1K9KA 3IQOA 4GGFA 3VRPA 1DMOA 2CCMA 3NSOA 2IS9A 4BY5A 5KU1A 3EKHA 2ZFDA 1KFXL 5CSIA 3TUYC 2NLNA 3DVEA 3PM8A 5BPJA 1EH2A 1B8LA 1XK4A 1QATA 2M1UA 2JRFA 5JOLA 2PALA 3QRXA 2BE4A 4NQGA 1C07A 1K95A 1OSAA 1SL9A 2R2IA 3OHMB 5CPVA 3BOWA 1NYAA 2EC6C 2WCEA 1IRJA 1CNPA 1DJXA 1K90D 1XA5A 3H4SE 2MRDA 1J1DA 2OTGC 2BBMA 3TS5C 1BU3A 1QX5B 1IWQA 2K7BA 4F0ZB 1RWYA 1S6JA 2LCPA 2LHIA 3I5HC 1S3PA 1QX7A 1YVHA 4U8DA 3JVTC 1PALA 3CWGA 1CLMA 1UHHA 1B7TY 2LAPA 2BKIB 1IKUA 4I5JA 3TDUA 1LVCD 1H8BA 4D1EA 1OOJA 1R6PA 1X02A 1JF2A 2JULA 3SG6A 1CM1A 1L2OB 3WNXB 1TTXA 3PN7B 3C1VA 3KF9A 1F54A 2BL0B 3PATA 1OMRA 2LP3A 3D0YA 3GK1A 1XFZO 1QV0A 2KAYA 1XVJA 1IG5A 2LP2A 3WHUB 3HX4A 1BR4B 2M97A 4DRWA 4MZLA 3RLZA 1KSMA 2I94A 1ZFSA 2BCAA 1NX2A 2Y1NA 2KGRA 3TDZA 5HLOA 2I18A 1S26D 1QIWA 1W7IB 5PALA 3WHTB 2KAXA 1EL4A 4PE7A 1KK7Z 2NZ0A 2Q91A 1PULA 2JTZA 3DD4A 1NCZA 1YR5A 1F55A 1PVBA 4TNCA 4QJ4B 2O60A 3VRQA 2K7CA 5HKYA 2KI6D 2SCPA 2FCDA 1IJ5A 1QJTA 2MLEC 4FTGA 1WRKA 2KFHA 3SIAA 2G2BA 4DS7A 2K2FA 1QVIY 2TN4A 1UURA 2ZN8A 2M9GA 1Y1UA 2ZRSA 1PSRA 3CR5X 1ZUZA 1K9UA 1QXPA 3TZ1A 4BY4A 1F70A 1DTLA 2GGZA 2Y5IA 1QS7A 2ZRTA 3JTDC 1M46A 2EGDA 1J1EA 1LKJA 2LHLA 1B8RA 1KWOB 5F6TA 3ZNIA 2I2RE 3LK0A 3LLEA 1CLBA 1S6CA 4OR9B 4OVNF 3VROA 1N0YA 3CLNA 4I5KA 4FQOA 1E8AA 1BODA 1KQMB 1UHNA 3CS1A 3SG2A 1MWNA 4HRHA 4R1EA 1QASA 1K94A 1CDLA 2MJWB 2LLSA 1J7RA 2F33A 1A4PA 3BYAA 4HRGA 1J55A 3OB1B 1UHIA 3PALA 4IL1A 2LMUA 1DJZA 5AERA 2BECA 4GUKA 2L51A 3TUYB 3MSEB 2JT0A 1SKTA 1TCOB 3AKBA 1NX0A 2E6WA 3SG4A 5CSNA 1AJ5A 3D0YB 3TDIA 3BUNB 2ZKMX 2OS8B 3GOFA 4I5LB 4MRYA 1MXEA 1J7QA 1AK8A 3NXAA 2K2AA 1A29A 2BBNA 2KBMA 5I2LA 1M39A 3AAKA 2NXQA 5JJGA 1K2HA 3EVVA 1U5IA 2FOTA 3VGOA 1CDNA 1DJHA 1UWOA 1IGVA 2EC6B 2K7DA 4WQ2A 5KSZA 4I5NB 2L98A 2L50A 1BLQA 2HPSA 1FBVA 4A4BA 5FYXA 1CFFA 3M0WA 1XFYO 1EG4A 1WLZA 1UP5A 2LC5A 3VRRA 1DGUA 2AAOA 2OTGB 3TS5B 3OX5A 1C7WA 3DVJA 2KSPA 4YGEB 1D1OA 4OKHA 1K93D 5I8NA 1RECA 2MBXA 1AP4A 3I5HB 3EK4A 1K9PA 2GV5A 4PHNA 3JVTB 1FPWA 4MEWA 2WCBA 4MBEA 1NPQA 1W7JB 1K96A 1KK8C 2JNXA 3A8RA 3EKJA 4GFTA 3ICBA 2G9BA 1K8UA 4YGCB 1QV1A 4C0JA 4P2YB 1Y1AA 5TNCA 2BCXA 1IJ6A 1G8IA 2M1KB 2KYCA 1MUXA 1SW8A 1C7VA 2JC2A 1NX3A 1QX2A 5HLVA 2D8NA 2ZNEA 1F4QA 4UPGA 3I5FC 2PSRA 1KCYA 1YURA 3KPXA 3BUXB 1CM4A 3D10A 1DJYA 1TOPA 4PE1A 1AUIB 2E30A 1HQVA 2KFGA 1M31A 2DOQA 1PRWA 4OCIA 2NCPA 3EK8A 4PE0A 4YI9A 1LA3A 3SG3A 2B1UA 2JT3A 2PVBA 5AFPA 2M7NA 3CR4X 4YGAA 1LINA 5HKWA 3O6BA 1N2DA 2CNPA 1Y6WA 2Q4UA 1S5GZ 5AANA 2PRUA 4MZKA 4JQ0D 2MLFC 1KFUS 2JT8A 1Y0VH 2JPTA 1SL7A 3EVUA 2PMYA 1H4BA 4L9MA 1WDCC 3NSLA 3DVMA 4ORCB 1KQVA 4C0KA 2LM5A 1Y1XA 4C0LA 3OP0A 1RK9A 2OPOA 2JXLA 3JTDB 1OZOA 4PE4A 1U5IB 2LUCA 4WRIA 4GPLB 2O5GA 3GK4X 4N1FA 2JTTA 1CDMA 2JOJA 2H61C 3SJSA 2WNDA 1YUUA 1YRUB 5J3XA 1CDPA 5GQQC 4PDZA 1TN4A 5IBWA 2WCFA 3I5GC 3BUWB 1SL8A 4YGBB 1HT9A 1CB1A 2KNEA 3PLFB 2LLTA 1GJYA 2KI4C 1JUOA 4NDCA 1R2UA 1EXRA 2QPTA 3OB2B 2KQYA 3EK7A 1SR6C 3AKAA 4GAOA 1XFVO 4PHJA 1BMOA 1ALVA 1DJWA 1G4YR 2CT9A 2I7AA 4GNKB 2H2KA 1CMGA 1SNLA 4XYNA 1GGWA 2LANA 3BXKA 5G08A 3CTNA 1EJ3A 1SY9A 2M0RA 2QACA 4ORAB 2CXJA 2MA2A 3E3RA 2LVIA 2MHHA 3KHEA 2HQWA 1YX7A 4PCWA 4ETOA 1XYDA 1BOCA 4MRXA 1CTRA 1SCMC 3PFVA 2KDHA 1L7ZA 2L4IA 2VRGA 4N5XA 5DKQA 3BUMB 2BCBA 1AHRA 3I5IC 5CSJA 3IF7A 2M29A 2JU0A 1SPYA 3O4YA 2H61A 2NCOA 2LV7A 4PHKA 2GGMA 5HKZA 1AJ4A 1TNWA 1QIVA 4MSPA 1OMVA 1B8CA 2MAZA 1PK0D 5D7FA 4DCKA 2AUCA 1JC2A 2JXCA 1Q80A 3NSKA 4QJ3B 2LLUA 1JFKA 3O78A 4ORBB 1A75A 2A4JA 1DGVA 1NX1A 1DT7B 4P5OE 2M49B 1KK8B 1XFXO 1J7OA 3LK1A 4MN0A 2F2OA 3CR2A 1YUTA 3NSIA 2K7OA 1RFJA 4GGNA 1J7PA 1B9AA 2M7LA 1PVAA 1ZOTB 2L2EA 1YRTB 1YTZC 5D69A 4YI8A 2L5XB 1BF5A 1JBAA 4A4CA 1G33A 4AOMA 1S5GY 3I5FB 3FS7A 1FI6A 1OQPA 3PSRA 2LVKA 1MF8B 1IQ5A 1XO5A 2Y4QA 5KTYA 2OS8C 5ER4X 1JSAA 3WXAA 4YBHB 2FCEA 1QLKA 1XFUO 4HREE 3BUOB 3FWBA 5B8IB 1PSBA 4NDDA 1NSHA 1KFUL 1KK7Y 3AAJA 1YVLA 1SMGA 4MLWA 2WORA 2KGBC 1JF0A 1QTXA 3RM1A 2RGIA 1SBJA 5AEQA 1CFDA 2K0JA 2WOSA 5ER5A 1WLMA 1WRZA 4YRUA 1MHOA 2LUXA 2KQ6A 1BR1B 3LL8B 4MVFA 1TCFA 1KFXS 1SRAA 1VRKA 1BJFA 2BE6A 1EG3A 1WDCB 1LXFC 4AQIA 1ODBA 5I2QA 1IH0A 1KSOA 3BQ3A 4M2OA 1UHJA 1OE9B 1JWDA 3CGAA 4CLNA 1RROA 2BKHB 2COLB 2KBIA 5I2OA 4CFQA 1TNPA 1ZACA 1N65A 1NP8A 3DF0A 1FI5A 2ISDA 3FIAA 1OMDA
chains in the Genus database with same CATH superfamily
1B47A 1XFRA 2K61A 2BAPA 3NGVA 4GBAA 1CMFA 4OV2A 2M8UA 1UHKA 1DF0A 2JNFA 4XJKA 1OW4A 1UUSA 4Q04A 2HQ8A 1QLSA 2LMTA 3I5GB 5AXIA 2F2PA 4CFRA 1WY9A 2LE9B 3KO0A 3F45A 1A2XA 3O2PA 3SG7A 1MQ1A 1DJIA 3PM2A 2KI4B 1MR8A 1NCYA 1SYMA 1MXLC 1JFJA 4YGDB 1ZMZA 2JZIA 2KI6C 3L4LA 4F7FA 1A75B 3CZTX 1CFCA 1L2OC 4ICBA 1SR6B 1V1GA 1TIZA 1QWVA 2AMIA 2JWWA 3D75A 3IQQA 3PN7C 1TNQA 5DKNA 4INWA 2BL0C 1M63B 2LVJA 2F3YA 5HL1A 1F8HA 2KYFA 2L0PA 1M45A 1CFPA 5HYDA 1SCVA 3K1EA 1RTP1 1NCXA 3EVRA 1WRLA 4PT1A 1B4CA 4JWQA 2KOTA 2L4HA 1B7TZ 2HETA 4MZJA 5CSFA 1S1EA 3EG5B 1S6IA 2F3ZA 2M3WA 2KLDA 4M2PA 3DZTA 3SS4A 4USLA 3VRNA 4GGFC 1TNXA 2LMVA 1DVIA 1NUBA 2HF5A 2LNKA 3QMEA 2SASA 4PHMA 4CIDA 1SCMB 2L2CA 2CBLA 2FJUB 3A4UB 1NWDA 3VB1A 4PALA 5FI2A 1DELA 1S36A 1ALWA 3FWCA 3I5IB 1CLLA 2JQ6A 3KEVA 5K89A 1F71A 4IJ7A 3SG5A 3BOWB 5DKRA 3LCPC 2KFFA 3ZWHA 3SIBA 2LVVA 1OZSA 1XK4C 1B1GA 1NIWA 4DUQA 2K8MB 4HSZA 2WC8A 4N1GA 2F8PA 1YX8A 1AVSA 3OX6A 3K21A 4AQJA 2EHBA 2V53A 4DIRA 2Y1MA 1BT6A 4CPVA 1V1FA 1FW4A 4ZCUA 1RJVA 1KWOC 1CKKA 1LS8A 1Z2CB 1A03A 2KHNA 2ZN9A 3S0AA 1SK6D 3DVKA 2KAVA 3DF0B 4E68A 2CTNA 3CDNA 1BG1A 1KQMC 1Z4HA 1QVIZ 1TRFA 1XFWO 1YUSA 1F4OA 4JPZB 3GK2A 4ZCVA 4QJ5B 1GQMA 3CABA 4WQ3A 1GGZA 3NHTA 4M2QA 4NDBA 2P6BB 1DF0B 2ZNDA 2PASA 4XJKB 1FF1A 1DJGA 1IQ3A 3HCMA 1LA0A 1K9KA 3IQOA 4GGFA 3VRPA 1DMOA 1OOGA 2CCMA 3NSOA 2IS9A 4BY5A 5KU1A 3EKHA 2ZFDA 1KFXL 5CSIA 3TUYC 2NLNA 3DVEA 3PM8A 5BPJA 1EH2A 1B8LA 1XK4A 1QATA 2M1UA 2JRFA 5JOLA 2PALA 3QRXA 2BE4A 4NQGA 1C07A 1K95A 1OSAA 1SL9A 4OZDA 3S0EA 2R2IA 3OHMB 5CPVA 3BOWA 1NYAA 2EC6C 2WCEA 1IRJA 1CNPA 1DJXA 1K90D 1XA5A 3H4SE 2WCHA 2MRDA 1J1DA 2GTEA 2OTGC 2BBMA 3D76A 3TS5C 1BU3A 1QX5B 1IWQA 2K7BA 4F0ZB 1RWYA 2KLEA 1S6JA 1TUJA 2LCPA 2LHIA 1S3PA 3BFHA 3I5HC 1QX7A 2BNXA 1YVHA 4U8DA 3JVTC 1PALA 3CWGA 1CLMA 1UHHA 1B7TY 2LAPA 2BKIB 1IKUA 4I5JA 3TDUA 1LVCD 1H8BA 4D1EA 1OOJA 1R6PA 1X02A 1JF2A 3B87A 2JULA 3SG6A 1CM1A 1L2OB 3WNXB 1TTXA 3PN7B 3C1VA 3KF9A 1F54A 2BL0B 3PATA 1OMRA 2LP3A 3D0YA 3GK1A 1XFZO 1QV0A 2KAYA 3CZ2A 1XVJA 1IG5A 2LP2A 3WHUB 3HX4A 1BR4B 2M97A 4DRWA 1FI5A 4MZLA 3RLZA 1KSMA 2I94A 1ZFSA 2BCAA 1NX2A 2Y1NA 2KGRA 3TDZA 5HLOA 2I18A 1GM0A 1S26D 1QIWA 1W7IB 5PALA 3WHTB 2KAXA 1EL4A 4PE7A 1KK7Z 2NZ0A 2Q91A 1PULA 2JTZA 3DD4A 1NCZA 1YR5A 5D3OA 1PVBA 4TNCA 4QJ4B 1F55A 2O60A 3VRQA 2K7CA 5HKYA 2KI6D 2SCPA 2FCDA 1IJ5A 1QJTA 2MLEC 4FTGA 1WRKA 2KFHA 3D73A 2G2BA 3SIAA 2K2FA 1QVIY 2TN4A 1UURA 2ZN8A 2M9GA 1Y1UA 2ZRSA 3N7HA 1PSRA 3CR5X 1ZUZA 3SS5A 1K9UA 1QXPA 2P70A 3TZ1A 4BY4A 3UNWA 1F70A 1DTLA 2GGZA 2Y5IA 1QS7A 2WCJA 2ZRTA 3JTDC 1M46A 2EGDA 3D74A 1J1EA 1LKJA 2LHLA 1B8RA 1KWOB 3B7AA 5F6TA 3ZNIA 2I2RE 3LK0A 2WC6A 3LLEA 1CLBA 1S6CA 4OR9B 4OVNF 3VROA 1N0YA 3CZ1A 3CLNA 4I5KA 3R1OA 1E8AA 4FQOA 1BODA 1KQMB 1UHNA 3S0BA 3CS1A 3SG2A 1MWNA 3B88A 4HRHA 4R1EA 1QASA 1K94A 1CDLA 2MJWB 2LLSA 1J7RA 2F33A 1A4PA 1SSEB 3BYAA 3B6XA 4HRGA 1J55A 3SS3A 4FQTA 3CYZA 3OB1B 1UHIA 3B86A 3PALA 4IL1A 2LMUA 1DJZA 2WCLA 5AERA 2QDIA 3IVTA 2BECA 4GUKA 2L51A 3TUYB 3MSEB 2JT0A 1SKTA 1TCOB 3AKBA 1NX0A 2E6WA 3SG4A 5CSNA 1AJ5A 3D0YB 3TDIA 1DQEA 3BUNB 2ZKMX 2OS8B 2WCMA 3GOFA 4I5LB 4MRYA 1MXEA 1J7QA 1AK8A 3NXAA 2K2AA 1A29A 2BBNA 2KBMA 5I2LA 1M39A 3AAKA 2NXQA 1C3ZA 5JJGA 1K2HA 3EVVA 1U5IA 2FOTA 3VGOA 1CDNA 1DJHA 1UWOA 1IGVA 2EC6B 2K7DA 4WQ2A 5I94A 4I5NB 2L98A 2L50A 5KSZA 3RZSA 1BLQA 2HPSA 1FBVA 4A4BA 5FYXA 1CFFA 3M0WA 1XFYO 3DXLA 1EG4A 1WLZA 1UP5A 2LC5A 3VRRA 1DGUA 3R72A 2AAOA 2OTGB 5DICA 3TS5B 3OX5A 1C7WA 3DVJA 2KSPA 4YGEB 1D1OA 4OKHA 1K93D 5I8NA 1RECA 2MBXA 1AP4A 3I5HB 3PJIA 3EK4A 1K9PA 2GV5A 4PHNA 3JVTB 2QEOA 4MEWA 1FPWA 2WCBA 4MBEA 1NPQA 1W7JB 1K96A 1KK8C 2JNXA 3A8RA 3EKJA 4GFTA 3ICBA 2G9BA 1K8UA 4YGCB 1QV1A 4C0JA 4P2YB 1Y1AA 5TNCA 4JKTA 2BCXA 1IJ6A 1G8IA 1OOIX 2KYCA 2M1KB 1MUXA 1SW8A 1C7VA 2JC2A 3S0DA 1NX3A 1QX2A 5HLVA 2D8NA 2ZNEA 1F4QA 4UPGA 3I5FC 2PSRA 2QEVA 1KCYA 1YURA 3KPXA 2PYQA 3BUXB 1CM4A 3D10A 1DJYA 1TOPA 4PE1A 1AUIB 2E30A 1HQVA 2KFGA 1M31A 2DOQA 1PRWA 4OCIA 2NCPA 3EK8A 4DS7A 4PE0A 3DYEA 1LA3A 4YI9A 3SG3A 2B1UA 2JT3A 2PVBA 5AFPA 2M7NA 3CR4X 4YGAA 3FE9A 1LINA 5HKWA 3O6BA 1N2DA 2CNPA 1Y6WA 2Q4UA 1S5GZ 5AANA 2PRUA 4MZKA 4JQ0D 2MLFC 1KFUS 2JT8A 1Y0VH 2JPTA 2PQLA 1SL7A 3EVUA 2PMYA 5EL2A 1H4BA 3L47A 4L9MA 1WDCC 3L4AA 3NSLA 1ORGA 3DVMA 1W9ZA 4ORCB 1KQVA 4C0KA 2LM5A 1Y1XA 4C0LA 3OP0A 1RK9A 2OPOA 2JXLA 2P71A 3JTDB 1OZOA 4PE4A 1IIOA 1U5IB 2LUCA 4WRIA 4GPLB 2O5GA 3GK4X 4N1FA 3BJHA 2JTTA 2K60A 1CDMA 2JOJA 2H61C 3SJSA 2WNDA 1YUUA 1YRUB 5J3XA 1CDPA 5GQQC 4PDZA 1TN4A 5IBWA 2WCFA 2ERBA 3I5GC 3FE6A 3S0FA 3BUWB 1SL8A 2WC5A 4YGBB 1HT9A 1CB1A 2JPOA 2KNEA 3PLFB 3R1PA 2LLTA 1GJYA 2KI4C 1JUOA 4NDCA 1R2UA 1EXRA 2QPTA 3OB2B 2KQYA 3EK7A 1SR6C 2FJYA 3AKAA 4GAOA 1XFVO 3D78A 4PHJA 1BMOA 1ALVA 1DJWA 1G4YR 2CT9A 2I7AA 4GNKB 2H2KA 1CMGA 1SNLA 4XYNA 1GGWA 2LANA 3BXKA 3NHIA 5G08A 3CTNA 1T14A 1EJ3A 1SY9A 2M0RA 2QACA 4ORAB 2CXJA 2MA2A 3E3RA 2LVIA 2MHHA 3BFAA 3KHEA 2HQWA 1YX7A 4PCWA 3V2LA 4ETOA 1XYDA 1BOCA 4MRXA 2QEHA 1CTRA 2L5YA 3FE8A 1SCMC 3PFVA 3R1VA 2KDHA 1L7ZA 2L4IA 2VRGA 4N5XA 5DKQA 1DC1A 3BUMB 2BCBA 1AHRA 3I5IC 5CSJA 3IF7A 2M29A 2JU0A 1SPYA 2KPHA 3O4YA 2H61A 2NCOA 4INXA 2LV7A 4JD9A 4PHKA 2GGMA 5HKZA 1AJ4A 1TNWA 5FI6A 1QIVA 3CZ0A 4MSPA 1TWOA 1OMVA 1B8CA 2MAZA 1PK0D 5D7FA 4DCKA 2AUCA 1JC2A 2JXCA 1Q80A 3NSKA 4QJ3B 2LLUA 1JFKA 3O78A 4ORBB 3Q8IA 1A75A 1TUZA 1DGVA 2A4JA 1NX1A 1DT7B 4P5OE 4KYNA 5FI7A 2M49B 1KK8B 1XFXO 1J7OA 3LK1A 4MN0A 2F2OA 3CR2A 1DEKA 1YUTA 3NSIA 2K7OA 1RFJA 4GGNA 3UO9A 1J7PA 1B9AA 2M7LA 1PVAA 1ZOTB 2L2EA 1YRTB 1YTZC 5D69A 4YI8A 2L5XB 1BF5A 1JBAA 4A4CA 1G33A 4AOMA 1S5GY 3I5FB 3FS7A 1FI6A 1OQPA 3PSRA 2YGUA 2LVKA 1MF8B 1IQ5A 1OOHA 1XO5A 2Y4QA 5KTYA 2OS8C 5ER4X 3D77A 3O4XA 1JSAA 2H8VA 3WXAA 4YBHB 2FCEA 1QLKA 1XFUO 4HREE 3BUOB 3FWBA 5B8IB 1PSBA 4NDDA 3DY9A 1NSHA 1KFUL 1KK7Y 3AAJA 1YVLA 1SMGA 4MLWA 2WORA 2KGBC 1JF0A 1QTXA 3OBVA 3RM1A 1C3YA 2RGIA 3S0GA 1SBJA 5AEQA 1CFDA 2K0JA 2WOSA 5ER5A 2QEBA 3BFBA 1WLMA 1WRZA 4YRUA 1MHOA 2LUXA 2KQ6A 1BR1B 3LL8B 4MVFA 1OOFA 1KFXS 1TCFA 1SRAA 1VRKA 1P28A 1BJFA 2BE6A 1EG3A 1WDCB 1LXFC 4AQIA 1ODBA 5I2QA 1IH0A 1KSOA 3BQ3A 4M2OA 1UHJA 1OE9B 1JWDA 3CGAA 4CLNA 1RROA 2BKHB 2COLB 2KBIA 5I2OA 4CFQA 1TNPA 1ZACA 1N65A 1NP8A 3DF0A 3OGNA 2WCKA 2ISDA 3FIAA 1OMDA
chains in the Genus database with same CATH topology
1B47A 2K61A 4GBAA 1CMFA 4OV2A 2M8UA 1UHKA 1DF0A 2JNFA 4XJKA 1UUSA 4Q04A 2HQ8A 1QLSA 2LMTA 3I5GB 5AXIA 2F2PA 4CFRA 1WY9A 2LE9B 3KO0A 3F45A 1A2XA 3O2PA 3SG7A 1MQ1A 1DJIA 2KI4B 1MR8A 1NCYA 1SYMA 1MXLC 1JFJA 4YGDB 1ZMZA 2JZIA 2KI6C 1A75B 3CZTX 1CFCA 1L2OC 4ICBA 1SR6B 1V1GA 1TIZA 2JWWA 2AMIA 3IQQA 3PN7C 1TNQA 5DKNA 2BL0C 1M63B 2LVJA 2F3YA 1F8HA 2KYFA 2L0PA 1M45A 1CFPA 5HYDA 1SCVA 1RTP1 1NCXA 3EVRA 1WRLA 1B4CA 4JWQA 2KOTA 2L4HA 1B7TZ 2HETA 4MZJA 5CSFA 1S1EA 1S6IA 2F3ZA 2M3WA 4M2PA 4USLA 3VRNA 4GGFC 1TNXA 2LMVA 1DVIA 1NUBA 2HF5A 2LNKA 2SASA 4PHMA 4CIDA 1SCMB 2CBLA 2FJUB 3A4UB 1NWDA 4PALA 3FWCA 1S36A 1ALWA 3KEVA 3I5IB 1CLLA 2JQ6A 5K89A 1F71A 3SG5A 3BOWB 5DKRA 3LCPC 2KFFA 3ZWHA 3SIBA 2LVVA 1OZSA 1XK4C 1B1GA 1NIWA 4DUQA 2K8MB 4HSZA 2WC8A 4N1GA 2F8PA 1YX8A 1AVSA 3OX6A 3K21A 4AQJA 2EHBA 2V53A 4DIRA 2Y1MA 1BT6A 4CPVA 1V1FA 1FW4A 4ZCUA 1RJVA 1KWOC 1CKKA 1A03A 2KHNA 2ZN9A 1SK6D 3DVKA 2KAVA 3DF0B 4E68A 2CTNA 1BG1A 1KQMC 1QVIZ 1TRFA 1XFWO 4JPZB 1YUSA 1F4OA 4ZCVA 3GK2A 4QJ5B 1GQMA 4WQ3A 1GGZA 4M2QA 4NDBA 2P6BB 1DF0B 2ZNDA 2PASA 4XJKB 1FF1A 1DJGA 1IQ3A 3HCMA 1LA0A 1K9KA 3IQOA 4GGFA 3VRPA 1DMOA 2CCMA 3NSOA 2IS9A 4BY5A 5KU1A 3EKHA 2ZFDA 1KFXL 5CSIA 3TUYC 2NLNA 3DVEA 3PM8A 5BPJA 1EH2A 1B8LA 1XK4A 1QATA 2M1UA 2JRFA 5JOLA 2PALA 3QRXA 2BE4A 4NQGA 1C07A 1K95A 1OSAA 1SL9A 2R2IA 3OHMB 5CPVA 3BOWA 1NYAA 2EC6C 2WCEA 1IRJA 1CNPA 1DJXA 1K90D 1XA5A 3H4SE 2MRDA 1J1DA 2OTGC 2BBMA 3TS5C 1BU3A 1QX5B 1IWQA 2K7BA 4F0ZB 1RWYA 1S6JA 2LCPA 2LHIA 3I5HC 1S3PA 1QX7A 1YVHA 4U8DA 3JVTC 1PALA 3CWGA 1CLMA 1UHHA 1B7TY 2LAPA 2BKIB 1IKUA 4I5JA 3TDUA 1LVCD 1H8BA 4D1EA 1OOJA 1R6PA 1X02A 1JF2A 2JULA 3SG6A 1CM1A 1L2OB 3WNXB 1TTXA 3PN7B 3C1VA 3KF9A 1F54A 2BL0B 3PATA 1OMRA 2LP3A 3D0YA 3GK1A 1XFZO 1QV0A 2KAYA 1XVJA 1IG5A 2LP2A 3WHUB 3HX4A 1BR4B 2M97A 4DRWA 4MZLA 3RLZA 1KSMA 2I94A 1ZFSA 2BCAA 1NX2A 2Y1NA 2KGRA 3TDZA 5HLOA 2I18A 1S26D 1QIWA 1W7IB 5PALA 3WHTB 2KAXA 1EL4A 4PE7A 1KK7Z 2NZ0A 2Q91A 1PULA 2JTZA 3DD4A 1NCZA 1YR5A 1F55A 1PVBA 4TNCA 4QJ4B 2O60A 3VRQA 2K7CA 5HKYA 2KI6D 2SCPA 2FCDA 1IJ5A 1QJTA 2MLEC 4FTGA 1WRKA 2KFHA 3SIAA 2G2BA 4DS7A 2K2FA 1QVIY 2TN4A 1UURA 2ZN8A 2M9GA 1Y1UA 2ZRSA 1PSRA 3CR5X 1ZUZA 1K9UA 1QXPA 3TZ1A 4BY4A 1F70A 1DTLA 2GGZA 2Y5IA 1QS7A 2ZRTA 3JTDC 1M46A 2EGDA 1J1EA 1LKJA 2LHLA 1B8RA 1KWOB 5F6TA 3ZNIA 2I2RE 3LK0A 3LLEA 1CLBA 1S6CA 4OR9B 4OVNF 3VROA 1N0YA 3CLNA 4I5KA 4FQOA 1E8AA 1BODA 1KQMB 1UHNA 3CS1A 3SG2A 1MWNA 4HRHA 4R1EA 1QASA 1K94A 1CDLA 2MJWB 2LLSA 1J7RA 2F33A 1A4PA 3BYAA 4HRGA 1J55A 3OB1B 1UHIA 3PALA 4IL1A 2LMUA 1DJZA 5AERA 2BECA 4GUKA 2L51A 3TUYB 3MSEB 2JT0A 1SKTA 1TCOB 3AKBA 1NX0A 2E6WA 3SG4A 5CSNA 1AJ5A 3D0YB 3TDIA 3BUNB 2ZKMX 2OS8B 3GOFA 4I5LB 4MRYA 1MXEA 1J7QA 1AK8A 3NXAA 2K2AA 1A29A 2BBNA 2KBMA 5I2LA 1M39A 3AAKA 2NXQA 5JJGA 1K2HA 3EVVA 1U5IA 2FOTA 3VGOA 1CDNA 1DJHA 1UWOA 1IGVA 2EC6B 2K7DA 4WQ2A 5KSZA 4I5NB 2L98A 2L50A 1BLQA 2HPSA 1FBVA 4A4BA 5FYXA 1CFFA 3M0WA 1XFYO 1EG4A 1WLZA 1UP5A 2LC5A 3VRRA 1DGUA 2AAOA 2OTGB 3TS5B 3OX5A 1C7WA 3DVJA 2KSPA 4YGEB 1D1OA 4OKHA 1K93D 5I8NA 1RECA 2MBXA 1AP4A 3I5HB 3EK4A 1K9PA 2GV5A 4PHNA 3JVTB 1FPWA 4MEWA 2WCBA 4MBEA 1NPQA 1W7JB 1K96A 1KK8C 2JNXA 3A8RA 3EKJA 4GFTA 3ICBA 2G9BA 1K8UA 4YGCB 1QV1A 4C0JA 4P2YB 1Y1AA 5TNCA 2BCXA 1IJ6A 1G8IA 2M1KB 2KYCA 1MUXA 1SW8A 1C7VA 2JC2A 1NX3A 1QX2A 5HLVA 2D8NA 2ZNEA 1F4QA 4UPGA 3I5FC 2PSRA 1KCYA 1YURA 3KPXA 3BUXB 1CM4A 3D10A 1DJYA 1TOPA 4PE1A 1AUIB 2E30A 1HQVA 2KFGA 1M31A 2DOQA 1PRWA 4OCIA 2NCPA 3EK8A 4PE0A 4YI9A 1LA3A 3SG3A 2B1UA 2JT3A 2PVBA 5AFPA 2M7NA 3CR4X 4YGAA 1LINA 5HKWA 3O6BA 1N2DA 2CNPA 1Y6WA 2Q4UA 1S5GZ 5AANA 2PRUA 4MZKA 4JQ0D 2MLFC 1KFUS 2JT8A 1Y0VH 2JPTA 1SL7A 3EVUA 2PMYA 1H4BA 4L9MA 1WDCC 3NSLA 3DVMA 4ORCB 1KQVA 4C0KA 2LM5A 1Y1XA 4C0LA 3OP0A 1RK9A 2OPOA 2JXLA 3JTDB 1OZOA 4PE4A 1U5IB 2LUCA 4WRIA 4GPLB 2O5GA 3GK4X 4N1FA 2JTTA 1CDMA 2JOJA 2H61C 3SJSA 2WNDA 1YUUA 1YRUB 5J3XA 1CDPA 5GQQC 4PDZA 1TN4A 5IBWA 2WCFA 3I5GC 3BUWB 1SL8A 4YGBB 1HT9A 1CB1A 2KNEA 3PLFB 2LLTA 1GJYA 2KI4C 1JUOA 4NDCA 1R2UA 1EXRA 2QPTA 3OB2B 2KQYA 3EK7A 1SR6C 3AKAA 4GAOA 1XFVO 4PHJA 1BMOA 1ALVA 1DJWA 1G4YR 2CT9A 2I7AA 4GNKB 2H2KA 1CMGA 1SNLA 4XYNA 1GGWA 2LANA 3BXKA 5G08A 3CTNA 1EJ3A 1SY9A 2M0RA 2QACA 4ORAB 2CXJA 2MA2A 3E3RA 2LVIA 2MHHA 3KHEA 2HQWA 1YX7A 4PCWA 4ETOA 1XYDA 1BOCA 4MRXA 1CTRA 1SCMC 3PFVA 2KDHA 1L7ZA 2L4IA 2VRGA 4N5XA 5DKQA 3BUMB 2BCBA 1AHRA 3I5IC 5CSJA 3IF7A 2M29A 2JU0A 1SPYA 3O4YA 2H61A 2NCOA 2LV7A 4PHKA 2GGMA 5HKZA 1AJ4A 1TNWA 1QIVA 4MSPA 1OMVA 1B8CA 2MAZA 1PK0D 5D7FA 4DCKA 2AUCA 1JC2A 2JXCA 1Q80A 3NSKA 4QJ3B 2LLUA 1JFKA 3O78A 4ORBB 1A75A 2A4JA 1DGVA 1NX1A 1DT7B 4P5OE 2M49B 1KK8B 1XFXO 1J7OA 3LK1A 4MN0A 2F2OA 3CR2A 1YUTA 3NSIA 2K7OA 1RFJA 4GGNA 1J7PA 1B9AA 2M7LA 1PVAA 1ZOTB 2L2EA 1YRTB 1YTZC 5D69A 4YI8A 2L5XB 1BF5A 1JBAA 4A4CA 1G33A 4AOMA 1S5GY 3I5FB 3FS7A 1FI6A 1OQPA 3PSRA 2LVKA 1MF8B 1IQ5A 1XO5A 2Y4QA 5KTYA 2OS8C 5ER4X 1JSAA 3WXAA 4YBHB 2FCEA 1QLKA 1XFUO 4HREE 3BUOB 3FWBA 5B8IB 1PSBA 4NDDA 1NSHA 1KFUL 1KK7Y 3AAJA 1YVLA 1SMGA 4MLWA 2WORA 2KGBC 1JF0A 1QTXA 3RM1A 2RGIA 1SBJA 5AEQA 1CFDA 2K0JA 2WOSA 5ER5A 1WLMA 1WRZA 4YRUA 1MHOA 2LUXA 2KQ6A 1BR1B 3LL8B 4MVFA 1TCFA 1KFXS 1SRAA 1VRKA 1BJFA 2BE6A 1EG3A 1WDCB 1LXFC 4AQIA 1ODBA 5I2QA 1IH0A 1KSOA 3BQ3A 4M2OA 1UHJA 1OE9B 1JWDA 3CGAA 4CLNA 1RROA 2BKHB 2COLB 2KBIA 5I2OA 4CFQA 1TNPA 1ZACA 1N65A 1NP8A 3DF0A 1FI5A 2ISDA 3FIAA 1OMDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B47 A;  2K61 A;  4GBA A;  1CMF A;  4OV2 A;  2M8U A;  1UHK A;  1DF0 A;  2JNF A;  4XJK A;  1UUS A;  4Q04 A;  2HQ8 A;  1QLS A;  2LMT A;  3I5G B;  5AXI A;  2F2P A;  4CFR A;  1WY9 A;  2LE9 B;  3KO0 A;  3F45 A;  1A2X A;  3O2P A;  3SG7 A;  1MQ1 A;  1DJI A;  2KI4 B;  1MR8 A;  1NCY A;  1SYM A;  1MXL C;  1JFJ A;  4YGD B;  1ZMZ A;  2JZI A;  2KI6 C;  1A75 B;  3CZT X;  1CFC A;  1L2O C;  4ICB A;  1SR6 B;  1V1G A;  1TIZ A;  2JWW A;  2AMI A;  3IQQ A;  3PN7 C;  1TNQ A;  5DKN A;  2BL0 C;  1M63 B;  2LVJ A;  2F3Y A;  1F8H A;  2KYF A;  2L0P A;  1M45 A;  1CFP A;  5HYD A;  1SCV A;  1RTP 1;  1NCX A;  3EVR A;  1WRL A;  1B4C A;  4JWQ A;  2KOT A;  2L4H A;  1B7T Z;  2HET A;  4MZJ A;  5CSF A;  1S1E A;  1S6I A;  2F3Z A;  2M3W A;  4M2P A;  4USL A;  3VRN A;  4GGF C;  1TNX A;  2LMV A;  1DVI A;  1NUB A;  2HF5 A;  2LNK A;  2SAS A;  4PHM A;  4CID A;  1SCM B;  2CBL A;  2FJU B;  3A4U B;  1NWD A;  4PAL A;  3FWC A;  1S36 A;  1ALW A;  3KEV A;  3I5I B;  1CLL A;  2JQ6 A;  5K89 A;  1F71 A;  3SG5 A;  3BOW B;  5DKR A;  3LCP C;  2KFF A;  3ZWH A;  3SIB A;  2LVV A;  1OZS A;  1XK4 C;  1B1G A;  1NIW A;  4DUQ A;  2K8M B;  4HSZ A;  2WC8 A;  4N1G A;  2F8P A;  1YX8 A;  1AVS A;  3OX6 A;  3K21 A;  4AQJ A;  2EHB A;  2V53 A;  4DIR A;  2Y1M A;  1BT6 A;  4CPV A;  1V1F A;  1FW4 A;  4ZCU A;  1RJV A;  1KWO C;  1CKK A;  1A03 A;  2KHN A;  2ZN9 A;  1SK6 D;  3DVK A;  2KAV A;  3DF0 B;  4E68 A;  2CTN A;  1BG1 A;  1KQM C;  1QVI Z;  1TRF A;  1XFW O;  4JPZ B;  1YUS A;  1F4O A;  4ZCV A;  3GK2 A;  4QJ5 B;  1GQM A;  4WQ3 A;  1GGZ A;  4M2Q A;  4NDB A;  2P6B B;  1DF0 B;  2ZND A;  2PAS A;  4XJK B;  1FF1 A;  1DJG A;  1IQ3 A;  3HCM A;  1LA0 A;  1K9K A;  3IQO A;  4GGF A;  3VRP A;  1DMO A;  2CCM A;  3NSO A;  2IS9 A;  4BY5 A;  5KU1 A;  3EKH A;  2ZFD A;  1KFX L;  5CSI A;  3TUY C;  2NLN A;  3DVE A;  3PM8 A;  5BPJ A;  1EH2 A;  1B8L A;  1XK4 A;  1QAT A;  2M1U A;  2JRF A;  5JOL A;  2PAL A;  3QRX A;  2BE4 A;  4NQG A;  1C07 A;  1K95 A;  1OSA A;  1SL9 A;  2R2I A;  3OHM B;  5CPV A;  3BOW A;  1NYA A;  2EC6 C;  2WCE A;  1IRJ A;  1CNP A;  1DJX A;  1K90 D;  1XA5 A;  3H4S E;  2MRD A;  1J1D A;  2OTG C;  2BBM A;  3TS5 C;  1BU3 A;  1QX5 B;  1IWQ A;  2K7B A;  4F0Z B;  1RWY A;  1S6J A;  2LCP A;  2LHI A;  3I5H C;  1S3P A;  1QX7 A;  1YVH A;  4U8D A;  3JVT C;  1PAL A;  3CWG A;  1CLM A;  1UHH A;  1B7T Y;  2LAP A;  2BKI B;  1IKU A;  4I5J A;  3TDU A;  1LVC D;  1H8B A;  4D1E A;  1OOJ A;  1R6P A;  1X02 A;  1JF2 A;  2JUL A;  3SG6 A;  1CM1 A;  1L2O B;  3WNX B;  1TTX A;  3PN7 B;  3C1V A;  3KF9 A;  1F54 A;  2BL0 B;  3PAT A;  1OMR A;  2LP3 A;  3D0Y A;  3GK1 A;  1XFZ O;  1QV0 A;  2KAY A;  1XVJ A;  1IG5 A;  2LP2 A;  3WHU B;  3HX4 A;  1BR4 B;  2M97 A;  4DRW A;  4MZL A;  3RLZ A;  1KSM A;  2I94 A;  1ZFS A;  2BCA A;  1NX2 A;  2Y1N A;  2KGR A;  3TDZ A;  5HLO A;  2I18 A;  1S26 D;  1QIW A;  1W7I B;  5PAL A;  3WHT B;  2KAX A;  1EL4 A;  4PE7 A;  1KK7 Z;  2NZ0 A;  2Q91 A;  1PUL A;  2JTZ A;  3DD4 A;  1NCZ A;  1YR5 A;  1F55 A;  1PVB A;  4TNC A;  4QJ4 B;  2O60 A;  3VRQ A;  2K7C A;  5HKY A;  2KI6 D;  2SCP A;  2FCD A;  1IJ5 A;  1QJT A;  2MLE C;  4FTG A;  1WRK A;  2KFH A;  3SIA A;  2G2B A;  4DS7 A;  2K2F A;  1QVI Y;  2TN4 A;  1UUR A;  2ZN8 A;  2M9G A;  1Y1U A;  2ZRS A;  1PSR A;  3CR5 X;  1ZUZ A;  1K9U A;  1QXP A;  3TZ1 A;  4BY4 A;  1F70 A;  1DTL A;  2GGZ A;  2Y5I A;  1QS7 A;  2ZRT A;  3JTD C;  1M46 A;  2EGD A;  1J1E A;  1LKJ A;  2LHL A;  1B8R A;  1KWO B;  5F6T A;  3ZNI A;  2I2R E;  3LK0 A;  3LLE A;  1CLB A;  1S6C A;  4OR9 B;  4OVN F;  3VRO A;  1N0Y A;  3CLN A;  4I5K A;  4FQO A;  1E8A A;  1BOD A;  1KQM B;  1UHN A;  3CS1 A;  3SG2 A;  1MWN A;  4HRH A;  4R1E A;  1QAS A;  1K94 A;  1CDL A;  2MJW B;  2LLS A;  1J7R A;  2F33 A;  1A4P A;  3BYA A;  4HRG A;  1J55 A;  3OB1 B;  1UHI A;  3PAL A;  4IL1 A;  2LMU A;  1DJZ A;  5AER A;  2BEC A;  4GUK A;  2L51 A;  3TUY B;  3MSE B;  2JT0 A;  1SKT A;  1TCO B;  3AKB A;  1NX0 A;  2E6W A;  3SG4 A;  5CSN A;  1AJ5 A;  3D0Y B;  3TDI A;  3BUN B;  2ZKM X;  2OS8 B;  3GOF A;  4I5L B;  4MRY A;  1MXE A;  1J7Q A;  1AK8 A;  3NXA A;  2K2A A;  1A29 A;  2BBN A;  2KBM A;  5I2L A;  1M39 A;  3AAK A;  2NXQ A;  5JJG A;  1K2H A;  3EVV A;  1U5I A;  2FOT A;  3VGO A;  1CDN A;  1DJH A;  1UWO A;  1IGV A;  2EC6 B;  2K7D A;  4WQ2 A;  5KSZ A;  4I5N B;  2L98 A;  2L50 A;  1BLQ A;  2HPS A;  1FBV A;  4A4B A;  5FYX A;  1CFF A;  3M0W A;  1XFY O;  1EG4 A;  1WLZ A;  1UP5 A;  2LC5 A;  3VRR A;  1DGU A;  2AAO A;  2OTG B;  3TS5 B;  3OX5 A;  1C7W A;  3DVJ A;  2KSP A;  4YGE B;  1D1O A;  4OKH A;  1K93 D;  5I8N A;  1REC A;  2MBX A;  1AP4 A;  3I5H B;  3EK4 A;  1K9P A;  2GV5 A;  4PHN A;  3JVT B;  1FPW A;  4MEW A;  2WCB A;  4MBE A;  1NPQ A;  1W7J B;  1K96 A;  1KK8 C;  2JNX A;  3A8R A;  3EKJ A;  4GFT A;  3ICB A;  2G9B A;  1K8U A;  4YGC B;  1QV1 A;  4C0J A;  4P2Y B;  1Y1A A;  5TNC A;  2BCX A;  1IJ6 A;  1G8I A;  2M1K B;  2KYC A;  1MUX A;  1SW8 A;  1C7V A;  2JC2 A;  1NX3 A;  1QX2 A;  5HLV A;  2D8N A;  2ZNE A;  1F4Q A;  4UPG A;  3I5F C;  2PSR A;  1KCY A;  1YUR A;  3KPX A;  3BUX B;  1CM4 A;  3D10 A;  1DJY A;  1TOP A;  4PE1 A;  1AUI B;  2E30 A;  1HQV A;  2KFG A;  1M31 A;  2DOQ A;  1PRW A;  4OCI A;  2NCP A;  3EK8 A;  4PE0 A;  4YI9 A;  1LA3 A;  3SG3 A;  2B1U A;  2JT3 A;  2PVB A;  5AFP A;  2M7N A;  3CR4 X;  4YGA A;  1LIN A;  5HKW A;  3O6B A;  1N2D A;  2CNP A;  1Y6W A;  2Q4U A;  1S5G Z;  5AAN A;  2PRU A;  4MZK A;  4JQ0 D;  2MLF C;  1KFU S;  2JT8 A;  1Y0V H;  2JPT A;  1SL7 A;  3EVU A;  2PMY A;  1H4B A;  4L9M A;  1WDC C;  3NSL A;  3DVM A;  4ORC B;  1KQV A;  4C0K A;  2LM5 A;  1Y1X A;  4C0L A;  3OP0 A;  1RK9 A;  2OPO A;  2JXL A;  3JTD B;  1OZO A;  4PE4 A;  1U5I B;  2LUC A;  4WRI A;  4GPL B;  2O5G A;  3GK4 X;  4N1F A;  2JTT A;  1CDM A;  2JOJ A;  2H61 C;  3SJS A;  2WND A;  1YUU A;  1YRU B;  5J3X A;  1CDP A;  5GQQ C;  4PDZ A;  1TN4 A;  5IBW A;  2WCF A;  3I5G C;  3BUW B;  1SL8 A;  4YGB B;  1HT9 A;  1CB1 A;  2KNE A;  3PLF B;  2LLT A;  1GJY A;  2KI4 C;  1JUO A;  4NDC A;  1R2U A;  1EXR A;  2QPT A;  3OB2 B;  2KQY A;  3EK7 A;  1SR6 C;  3AKA A;  4GAO A;  1XFV O;  4PHJ A;  1BMO A;  1ALV A;  1DJW A;  1G4Y R;  2CT9 A;  2I7A A;  4GNK B;  2H2K A;  1CMG A;  1SNL A;  4XYN A;  1GGW A;  2LAN A;  3BXK A;  5G08 A;  3CTN A;  1EJ3 A;  1SY9 A;  2M0R A;  2QAC A;  4ORA B;  2CXJ A;  2MA2 A;  3E3R A;  2LVI A;  2MHH A;  3KHE A;  2HQW A;  1YX7 A;  4PCW A;  4ETO A;  1XYD A;  1BOC A;  4MRX A;  1CTR A;  1SCM C;  3PFV A;  2KDH A;  1L7Z A;  2L4I A;  2VRG A;  4N5X A;  5DKQ A;  3BUM B;  2BCB A;  1AHR A;  3I5I C;  5CSJ A;  3IF7 A;  2M29 A;  2JU0 A;  1SPY A;  3O4Y A;  2H61 A;  2NCO A;  2LV7 A;  4PHK A;  2GGM A;  5HKZ A;  1AJ4 A;  1TNW A;  1QIV A;  4MSP A;  1OMV A;  1B8C A;  2MAZ A;  1PK0 D;  5D7F A;  4DCK A;  2AUC A;  1JC2 A;  2JXC A;  1Q80 A;  3NSK A;  4QJ3 B;  2LLU A;  1JFK A;  3O78 A;  4ORB B;  1A75 A;  2A4J A;  1DGV A;  1NX1 A;  1DT7 B;  4P5O E;  2M49 B;  1KK8 B;  1XFX O;  1J7O A;  3LK1 A;  4MN0 A;  2F2O A;  3CR2 A;  1YUT A;  3NSI A;  2K7O A;  1RFJ A;  4GGN A;  1J7P A;  1B9A A;  2M7L A;  1PVA A;  1ZOT B;  2L2E A;  1YRT B;  1YTZ C;  5D69 A;  4YI8 A;  2L5X B;  1BF5 A;  1JBA A;  4A4C A;  1G33 A;  4AOM A;  1S5G Y;  3I5F B;  3FS7 A;  1FI6 A;  1OQP A;  3PSR A;  2LVK A;  1MF8 B;  1IQ5 A;  1XO5 A;  2Y4Q A;  5KTY A;  2OS8 C;  5ER4 X;  1JSA A;  3WXA A;  4YBH B;  2FCE A;  1QLK A;  1XFU O;  4HRE E;  3BUO B;  3FWB A;  5B8I B;  1PSB A;  4NDD A;  1NSH A;  1KFU L;  1KK7 Y;  3AAJ A;  1YVL A;  1SMG A;  4MLW A;  2WOR A;  2KGB C;  1JF0 A;  1QTX A;  3RM1 A;  2RGI A;  1SBJ A;  5AEQ A;  1CFD A;  2K0J A;  2WOS A;  5ER5 A;  1WLM A;  1WRZ A;  4YRU A;  1MHO A;  2LUX A;  2KQ6 A;  1BR1 B;  3LL8 B;  4MVF A;  1TCF A;  1KFX S;  1SRA A;  1VRK A;  1BJF A;  2BE6 A;  1EG3 A;  1WDC B;  1LXF C;  4AQI A;  1ODB A;  5I2Q A;  1IH0 A;  1KSO A;  3BQ3 A;  4M2O A;  1UHJ A;  1OE9 B;  1JWD A;  3CGA A;  4CLN A;  1RRO A;  2BKH B;  2COL B;  2KBI A;  5I2O A;  4CFQ A;  1TNP A;  1ZAC A;  1N65 A;  1NP8 A;  3DF0 A;  1FI5 A;  2ISD A;  3FIA A;  1OMD A; 
#chains in the Genus database with same CATH topology
 1B47 A;  1XFR A;  2K61 A;  2BAP A;  3NGV A;  4GBA A;  1CMF A;  4OV2 A;  2M8U A;  1UHK A;  1DF0 A;  2JNF A;  4XJK A;  1OW4 A;  1UUS A;  4Q04 A;  2HQ8 A;  1QLS A;  2LMT A;  3I5G B;  5AXI A;  2F2P A;  4CFR A;  1WY9 A;  2LE9 B;  3KO0 A;  3F45 A;  1A2X A;  3O2P A;  3SG7 A;  1MQ1 A;  1DJI A;  3PM2 A;  2KI4 B;  1MR8 A;  1NCY A;  1SYM A;  1MXL C;  1JFJ A;  4YGD B;  1ZMZ A;  2JZI A;  2KI6 C;  3L4L A;  4F7F A;  1A75 B;  3CZT X;  1CFC A;  1L2O C;  4ICB A;  1SR6 B;  1V1G A;  1TIZ A;  1QWV A;  2AMI A;  2JWW A;  3D75 A;  3IQQ A;  3PN7 C;  1TNQ A;  5DKN A;  4INW A;  2BL0 C;  1M63 B;  2LVJ A;  2F3Y A;  5HL1 A;  1F8H A;  2KYF A;  2L0P A;  1M45 A;  1CFP A;  5HYD A;  1SCV A;  3K1E A;  1RTP 1;  1NCX A;  3EVR A;  1WRL A;  4PT1 A;  1B4C A;  4JWQ A;  2KOT A;  2L4H A;  1B7T Z;  2HET A;  4MZJ A;  5CSF A;  1S1E A;  3EG5 B;  1S6I A;  2F3Z A;  2M3W A;  2KLD A;  4M2P A;  3DZT A;  3SS4 A;  4USL A;  3VRN A;  4GGF C;  1TNX A;  2LMV A;  1DVI A;  1NUB A;  2HF5 A;  2LNK A;  3QME A;  2SAS A;  4PHM A;  4CID A;  1SCM B;  2L2C A;  2CBL A;  2FJU B;  3A4U B;  1NWD A;  3VB1 A;  4PAL A;  5FI2 A;  1DEL A;  1S36 A;  1ALW A;  3FWC A;  3I5I B;  1CLL A;  2JQ6 A;  3KEV A;  5K89 A;  1F71 A;  4IJ7 A;  3SG5 A;  3BOW B;  5DKR A;  3LCP C;  2KFF A;  3ZWH A;  3SIB A;  2LVV A;  1OZS A;  1XK4 C;  1B1G A;  1NIW A;  4DUQ A;  2K8M B;  4HSZ A;  2WC8 A;  4N1G A;  2F8P A;  1YX8 A;  1AVS A;  3OX6 A;  3K21 A;  4AQJ A;  2EHB A;  2V53 A;  4DIR A;  2Y1M A;  1BT6 A;  4CPV A;  1V1F A;  1FW4 A;  4ZCU A;  1RJV A;  1KWO C;  1CKK A;  1LS8 A;  1Z2C B;  1A03 A;  2KHN A;  2ZN9 A;  3S0A A;  1SK6 D;  3DVK A;  2KAV A;  3DF0 B;  4E68 A;  2CTN A;  3CDN A;  1BG1 A;  1KQM C;  1Z4H A;  1QVI Z;  1TRF A;  1XFW O;  1YUS A;  1F4O A;  4JPZ B;  3GK2 A;  4ZCV A;  4QJ5 B;  1GQM A;  3CAB A;  4WQ3 A;  1GGZ A;  3NHT A;  4M2Q A;  4NDB A;  2P6B B;  1DF0 B;  2ZND A;  2PAS A;  4XJK B;  1FF1 A;  1DJG A;  1IQ3 A;  3HCM A;  1LA0 A;  1K9K A;  3IQO A;  4GGF A;  3VRP A;  1DMO A;  1OOG A;  2CCM A;  3NSO A;  2IS9 A;  4BY5 A;  5KU1 A;  3EKH A;  2ZFD A;  1KFX L;  5CSI A;  3TUY C;  2NLN A;  3DVE A;  3PM8 A;  5BPJ A;  1EH2 A;  1B8L A;  1XK4 A;  1QAT A;  2M1U A;  2JRF A;  5JOL A;  2PAL A;  3QRX A;  2BE4 A;  4NQG A;  1C07 A;  1K95 A;  1OSA A;  1SL9 A;  4OZD A;  3S0E A;  2R2I A;  3OHM B;  5CPV A;  3BOW A;  1NYA A;  2EC6 C;  2WCE A;  1IRJ A;  1CNP A;  1DJX A;  1K90 D;  1XA5 A;  3H4S E;  2WCH A;  2MRD A;  1J1D A;  2GTE A;  2OTG C;  2BBM A;  3D76 A;  3TS5 C;  1BU3 A;  1QX5 B;  1IWQ A;  2K7B A;  4F0Z B;  1RWY A;  2KLE A;  1S6J A;  1TUJ A;  2LCP A;  2LHI A;  1S3P A;  3BFH A;  3I5H C;  1QX7 A;  2BNX A;  1YVH A;  4U8D A;  3JVT C;  1PAL A;  3CWG A;  1CLM A;  1UHH A;  1B7T Y;  2LAP A;  2BKI B;  1IKU A;  4I5J A;  3TDU A;  1LVC D;  1H8B A;  4D1E A;  1OOJ A;  1R6P A;  1X02 A;  1JF2 A;  3B87 A;  2JUL A;  3SG6 A;  1CM1 A;  1L2O B;  3WNX B;  1TTX A;  3PN7 B;  3C1V A;  3KF9 A;  1F54 A;  2BL0 B;  3PAT A;  1OMR A;  2LP3 A;  3D0Y A;  3GK1 A;  1XFZ O;  1QV0 A;  2KAY A;  3CZ2 A;  1XVJ A;  1IG5 A;  2LP2 A;  3WHU B;  3HX4 A;  1BR4 B;  2M97 A;  4DRW A;  1FI5 A;  4MZL A;  3RLZ A;  1KSM A;  2I94 A;  1ZFS A;  2BCA A;  1NX2 A;  2Y1N A;  2KGR A;  3TDZ A;  5HLO A;  2I18 A;  1GM0 A;  1S26 D;  1QIW A;  1W7I B;  5PAL A;  3WHT B;  2KAX A;  1EL4 A;  4PE7 A;  1KK7 Z;  2NZ0 A;  2Q91 A;  1PUL A;  2JTZ A;  3DD4 A;  1NCZ A;  1YR5 A;  5D3O A;  1PVB A;  4TNC A;  4QJ4 B;  1F55 A;  2O60 A;  3VRQ A;  2K7C A;  5HKY A;  2KI6 D;  2SCP A;  2FCD A;  1IJ5 A;  1QJT A;  2MLE C;  4FTG A;  1WRK A;  2KFH A;  3D73 A;  2G2B A;  3SIA A;  2K2F A;  1QVI Y;  2TN4 A;  1UUR A;  2ZN8 A;  2M9G A;  1Y1U A;  2ZRS A;  3N7H A;  1PSR A;  3CR5 X;  1ZUZ A;  3SS5 A;  1K9U A;  1QXP A;  2P70 A;  3TZ1 A;  4BY4 A;  3UNW A;  1F70 A;  1DTL A;  2GGZ A;  2Y5I A;  1QS7 A;  2WCJ A;  2ZRT A;  3JTD C;  1M46 A;  2EGD A;  3D74 A;  1J1E A;  1LKJ A;  2LHL A;  1B8R A;  1KWO B;  3B7A A;  5F6T A;  3ZNI A;  2I2R E;  3LK0 A;  2WC6 A;  3LLE A;  1CLB A;  1S6C A;  4OR9 B;  4OVN F;  3VRO A;  1N0Y A;  3CZ1 A;  3CLN A;  4I5K A;  3R1O A;  1E8A A;  4FQO A;  1BOD A;  1KQM B;  1UHN A;  3S0B A;  3CS1 A;  3SG2 A;  1MWN A;  3B88 A;  4HRH A;  4R1E A;  1QAS A;  1K94 A;  1CDL A;  2MJW B;  2LLS A;  1J7R A;  2F33 A;  1A4P A;  1SSE B;  3BYA A;  3B6X A;  4HRG A;  1J55 A;  3SS3 A;  4FQT A;  3CYZ A;  3OB1 B;  1UHI A;  3B86 A;  3PAL A;  4IL1 A;  2LMU A;  1DJZ A;  2WCL A;  5AER A;  2QDI A;  3IVT A;  2BEC A;  4GUK A;  2L51 A;  3TUY B;  3MSE B;  2JT0 A;  1SKT A;  1TCO B;  3AKB A;  1NX0 A;  2E6W A;  3SG4 A;  5CSN A;  1AJ5 A;  3D0Y B;  3TDI A;  1DQE A;  3BUN B;  2ZKM X;  2OS8 B;  2WCM A;  3GOF A;  4I5L B;  4MRY A;  1MXE A;  1J7Q A;  1AK8 A;  3NXA A;  2K2A A;  1A29 A;  2BBN A;  2KBM A;  5I2L A;  1M39 A;  3AAK A;  2NXQ A;  1C3Z A;  5JJG A;  1K2H A;  3EVV A;  1U5I A;  2FOT A;  3VGO A;  1CDN A;  1DJH A;  1UWO A;  1IGV A;  2EC6 B;  2K7D A;  4WQ2 A;  5I94 A;  4I5N B;  2L98 A;  2L50 A;  5KSZ A;  3RZS A;  1BLQ A;  2HPS A;  1FBV A;  4A4B A;  5FYX A;  1CFF A;  3M0W A;  1XFY O;  3DXL A;  1EG4 A;  1WLZ A;  1UP5 A;  2LC5 A;  3VRR A;  1DGU A;  3R72 A;  2AAO A;  2OTG B;  5DIC A;  3TS5 B;  3OX5 A;  1C7W A;  3DVJ A;  2KSP A;  4YGE B;  1D1O A;  4OKH A;  1K93 D;  5I8N A;  1REC A;  2MBX A;  1AP4 A;  3I5H B;  3PJI A;  3EK4 A;  1K9P A;  2GV5 A;  4PHN A;  3JVT B;  2QEO A;  4MEW A;  1FPW A;  2WCB A;  4MBE A;  1NPQ A;  1W7J B;  1K96 A;  1KK8 C;  2JNX A;  3A8R A;  3EKJ A;  4GFT A;  3ICB A;  2G9B A;  1K8U A;  4YGC B;  1QV1 A;  4C0J A;  4P2Y B;  1Y1A A;  5TNC A;  4JKT A;  2BCX A;  1IJ6 A;  1G8I A;  1OOI X;  2KYC A;  2M1K B;  1MUX A;  1SW8 A;  1C7V A;  2JC2 A;  3S0D A;  1NX3 A;  1QX2 A;  5HLV A;  2D8N A;  2ZNE A;  1F4Q A;  4UPG A;  3I5F C;  2PSR A;  2QEV A;  1KCY A;  1YUR A;  3KPX A;  2PYQ A;  3BUX B;  1CM4 A;  3D10 A;  1DJY A;  1TOP A;  4PE1 A;  1AUI B;  2E30 A;  1HQV A;  2KFG A;  1M31 A;  2DOQ A;  1PRW A;  4OCI A;  2NCP A;  3EK8 A;  4DS7 A;  4PE0 A;  3DYE A;  1LA3 A;  4YI9 A;  3SG3 A;  2B1U A;  2JT3 A;  2PVB A;  5AFP A;  2M7N A;  3CR4 X;  4YGA A;  3FE9 A;  1LIN A;  5HKW A;  3O6B A;  1N2D A;  2CNP A;  1Y6W A;  2Q4U A;  1S5G Z;  5AAN A;  2PRU A;  4MZK A;  4JQ0 D;  2MLF C;  1KFU S;  2JT8 A;  1Y0V H;  2JPT A;  2PQL A;  1SL7 A;  3EVU A;  2PMY A;  5EL2 A;  1H4B A;  3L47 A;  4L9M A;  1WDC C;  3L4A A;  3NSL A;  1ORG A;  3DVM A;  1W9Z A;  4ORC B;  1KQV A;  4C0K A;  2LM5 A;  1Y1X A;  4C0L A;  3OP0 A;  1RK9 A;  2OPO A;  2JXL A;  2P71 A;  3JTD B;  1OZO A;  4PE4 A;  1IIO A;  1U5I B;  2LUC A;  4WRI A;  4GPL B;  2O5G A;  3GK4 X;  4N1F A;  3BJH A;  2JTT A;  2K60 A;  1CDM A;  2JOJ A;  2H61 C;  3SJS A;  2WND A;  1YUU A;  1YRU B;  5J3X A;  1CDP A;  5GQQ C;  4PDZ A;  1TN4 A;  5IBW A;  2WCF A;  2ERB A;  3I5G C;  3FE6 A;  3S0F A;  3BUW B;  1SL8 A;  2WC5 A;  4YGB B;  1HT9 A;  1CB1 A;  2JPO A;  2KNE A;  3PLF B;  3R1P A;  2LLT A;  1GJY A;  2KI4 C;  1JUO A;  4NDC A;  1R2U A;  1EXR A;  2QPT A;  3OB2 B;  2KQY A;  3EK7 A;  1SR6 C;  2FJY A;  3AKA A;  4GAO A;  1XFV O;  3D78 A;  4PHJ A;  1BMO A;  1ALV A;  1DJW A;  1G4Y R;  2CT9 A;  2I7A A;  4GNK B;  2H2K A;  1CMG A;  1SNL A;  4XYN A;  1GGW A;  2LAN A;  3BXK A;  3NHI A;  5G08 A;  3CTN A;  1T14 A;  1EJ3 A;  1SY9 A;  2M0R A;  2QAC A;  4ORA B;  2CXJ A;  2MA2 A;  3E3R A;  2LVI A;  2MHH A;  3BFA A;  3KHE A;  2HQW A;  1YX7 A;  4PCW A;  3V2L A;  4ETO A;  1XYD A;  1BOC A;  4MRX A;  2QEH A;  1CTR A;  2L5Y A;  3FE8 A;  1SCM C;  3PFV A;  3R1V A;  2KDH A;  1L7Z A;  2L4I A;  2VRG A;  4N5X A;  5DKQ A;  1DC1 A;  3BUM B;  2BCB A;  1AHR A;  3I5I C;  5CSJ A;  3IF7 A;  2M29 A;  2JU0 A;  1SPY A;  2KPH A;  3O4Y A;  2H61 A;  2NCO A;  4INX A;  2LV7 A;  4JD9 A;  4PHK A;  2GGM A;  5HKZ A;  1AJ4 A;  1TNW A;  5FI6 A;  1QIV A;  3CZ0 A;  4MSP A;  1TWO A;  1OMV A;  1B8C A;  2MAZ A;  1PK0 D;  5D7F A;  4DCK A;  2AUC A;  1JC2 A;  2JXC A;  1Q80 A;  3NSK A;  4QJ3 B;  2LLU A;  1JFK A;  3O78 A;  4ORB B;  3Q8I A;  1A75 A;  1TUZ A;  1DGV A;  2A4J A;  1NX1 A;  1DT7 B;  4P5O E;  4KYN A;  5FI7 A;  2M49 B;  1KK8 B;  1XFX O;  1J7O A;  3LK1 A;  4MN0 A;  2F2O A;  3CR2 A;  1DEK A;  1YUT A;  3NSI A;  2K7O A;  1RFJ A;  4GGN A;  3UO9 A;  1J7P A;  1B9A A;  2M7L A;  1PVA A;  1ZOT B;  2L2E A;  1YRT B;  1YTZ C;  5D69 A;  4YI8 A;  2L5X B;  1BF5 A;  1JBA A;  4A4C A;  1G33 A;  4AOM A;  1S5G Y;  3I5F B;  3FS7 A;  1FI6 A;  1OQP A;  3PSR A;  2YGU A;  2LVK A;  1MF8 B;  1IQ5 A;  1OOH A;  1XO5 A;  2Y4Q A;  5KTY A;  2OS8 C;  5ER4 X;  3D77 A;  3O4X A;  1JSA A;  2H8V A;  3WXA A;  4YBH B;  2FCE A;  1QLK A;  1XFU O;  4HRE E;  3BUO B;  3FWB A;  5B8I B;  1PSB A;  4NDD A;  3DY9 A;  1NSH A;  1KFU L;  1KK7 Y;  3AAJ A;  1YVL A;  1SMG A;  4MLW A;  2WOR A;  2KGB C;  1JF0 A;  1QTX A;  3OBV A;  3RM1 A;  1C3Y A;  2RGI A;  3S0G A;  1SBJ A;  5AEQ A;  1CFD A;  2K0J A;  2WOS A;  5ER5 A;  2QEB A;  3BFB A;  1WLM A;  1WRZ A;  4YRU A;  1MHO A;  2LUX A;  2KQ6 A;  1BR1 B;  3LL8 B;  4MVF A;  1OOF A;  1KFX S;  1TCF A;  1SRA A;  1VRK A;  1P28 A;  1BJF A;  2BE6 A;  1EG3 A;  1WDC B;  1LXF C;  4AQI A;  1ODB A;  5I2Q A;  1IH0 A;  1KSO A;  3BQ3 A;  4M2O A;  1UHJ A;  1OE9 B;  1JWD A;  3CGA A;  4CLN A;  1RRO A;  2BKH B;  2COL B;  2KBI A;  5I2O A;  4CFQ A;  1TNP A;  1ZAC A;  1N65 A;  1NP8 A;  3DF0 A;  3OGN A;  2WCK A;  2ISD A;  3FIA A;  1OMD A; 
#chains in the Genus database with same CATH homology
 1B47 A;  2K61 A;  4GBA A;  1CMF A;  4OV2 A;  2M8U A;  1UHK A;  1DF0 A;  2JNF A;  4XJK A;  1UUS A;  4Q04 A;  2HQ8 A;  1QLS A;  2LMT A;  3I5G B;  5AXI A;  2F2P A;  4CFR A;  1WY9 A;  2LE9 B;  3KO0 A;  3F45 A;  1A2X A;  3O2P A;  3SG7 A;  1MQ1 A;  1DJI A;  2KI4 B;  1MR8 A;  1NCY A;  1SYM A;  1MXL C;  1JFJ A;  4YGD B;  1ZMZ A;  2JZI A;  2KI6 C;  1A75 B;  3CZT X;  1CFC A;  1L2O C;  4ICB A;  1SR6 B;  1V1G A;  1TIZ A;  2JWW A;  2AMI A;  3IQQ A;  3PN7 C;  1TNQ A;  5DKN A;  2BL0 C;  1M63 B;  2LVJ A;  2F3Y A;  1F8H A;  2KYF A;  2L0P A;  1M45 A;  1CFP A;  5HYD A;  1SCV A;  1RTP 1;  1NCX A;  3EVR A;  1WRL A;  1B4C A;  4JWQ A;  2KOT A;  2L4H A;  1B7T Z;  2HET A;  4MZJ A;  5CSF A;  1S1E A;  1S6I A;  2F3Z A;  2M3W A;  4M2P A;  4USL A;  3VRN A;  4GGF C;  1TNX A;  2LMV A;  1DVI A;  1NUB A;  2HF5 A;  2LNK A;  2SAS A;  4PHM A;  4CID A;  1SCM B;  2CBL A;  2FJU B;  3A4U B;  1NWD A;  4PAL A;  3FWC A;  1S36 A;  1ALW A;  3KEV A;  3I5I B;  1CLL A;  2JQ6 A;  5K89 A;  1F71 A;  3SG5 A;  3BOW B;  5DKR A;  3LCP C;  2KFF A;  3ZWH A;  3SIB A;  2LVV A;  1OZS A;  1XK4 C;  1B1G A;  1NIW A;  4DUQ A;  2K8M B;  4HSZ A;  2WC8 A;  4N1G A;  2F8P A;  1YX8 A;  1AVS A;  3OX6 A;  3K21 A;  4AQJ A;  2EHB A;  2V53 A;  4DIR A;  2Y1M A;  1BT6 A;  4CPV A;  1V1F A;  1FW4 A;  4ZCU A;  1RJV A;  1KWO C;  1CKK A;  1A03 A;  2KHN A;  2ZN9 A;  1SK6 D;  3DVK A;  2KAV A;  3DF0 B;  4E68 A;  2CTN A;  1BG1 A;  1KQM C;  1QVI Z;  1TRF A;  1XFW O;  4JPZ B;  1YUS A;  1F4O A;  4ZCV A;  3GK2 A;  4QJ5 B;  1GQM A;  4WQ3 A;  1GGZ A;  4M2Q A;  4NDB A;  2P6B B;  1DF0 B;  2ZND A;  2PAS A;  4XJK B;  1FF1 A;  1DJG A;  1IQ3 A;  3HCM A;  1LA0 A;  1K9K A;  3IQO A;  4GGF A;  3VRP A;  1DMO A;  2CCM A;  3NSO A;  2IS9 A;  4BY5 A;  5KU1 A;  3EKH A;  2ZFD A;  1KFX L;  5CSI A;  3TUY C;  2NLN A;  3DVE A;  3PM8 A;  5BPJ A;  1EH2 A;  1B8L A;  1XK4 A;  1QAT A;  2M1U A;  2JRF A;  5JOL A;  2PAL A;  3QRX A;  2BE4 A;  4NQG A;  1C07 A;  1K95 A;  1OSA A;  1SL9 A;  2R2I A;  3OHM B;  5CPV A;  3BOW A;  1NYA A;  2EC6 C;  2WCE A;  1IRJ A;  1CNP A;  1DJX A;  1K90 D;  1XA5 A;  3H4S E;  2MRD A;  1J1D A;  2OTG C;  2BBM A;  3TS5 C;  1BU3 A;  1QX5 B;  1IWQ A;  2K7B A;  4F0Z B;  1RWY A;  1S6J A;  2LCP A;  2LHI A;  3I5H C;  1S3P A;  1QX7 A;  1YVH A;  4U8D A;  3JVT C;  1PAL A;  3CWG A;  1CLM A;  1UHH A;  1B7T Y;  2LAP A;  2BKI B;  1IKU A;  4I5J A;  3TDU A;  1LVC D;  1H8B A;  4D1E A;  1OOJ A;  1R6P A;  1X02 A;  1JF2 A;  2JUL A;  3SG6 A;  1CM1 A;  1L2O B;  3WNX B;  1TTX A;  3PN7 B;  3C1V A;  3KF9 A;  1F54 A;  2BL0 B;  3PAT A;  1OMR A;  2LP3 A;  3D0Y A;  3GK1 A;  1XFZ O;  1QV0 A;  2KAY A;  1XVJ A;  1IG5 A;  2LP2 A;  3WHU B;  3HX4 A;  1BR4 B;  2M97 A;  4DRW A;  4MZL A;  3RLZ A;  1KSM A;  2I94 A;  1ZFS A;  2BCA A;  1NX2 A;  2Y1N A;  2KGR A;  3TDZ A;  5HLO A;  2I18 A;  1S26 D;  1QIW A;  1W7I B;  5PAL A;  3WHT B;  2KAX A;  1EL4 A;  4PE7 A;  1KK7 Z;  2NZ0 A;  2Q91 A;  1PUL A;  2JTZ A;  3DD4 A;  1NCZ A;  1YR5 A;  1F55 A;  1PVB A;  4TNC A;  4QJ4 B;  2O60 A;  3VRQ A;  2K7C A;  5HKY A;  2KI6 D;  2SCP A;  2FCD A;  1IJ5 A;  1QJT A;  2MLE C;  4FTG A;  1WRK A;  2KFH A;  3SIA A;  2G2B A;  4DS7 A;  2K2F A;  1QVI Y;  2TN4 A;  1UUR A;  2ZN8 A;  2M9G A;  1Y1U A;  2ZRS A;  1PSR A;  3CR5 X;  1ZUZ A;  1K9U A;  1QXP A;  3TZ1 A;  4BY4 A;  1F70 A;  1DTL A;  2GGZ A;  2Y5I A;  1QS7 A;  2ZRT A;  3JTD C;  1M46 A;  2EGD A;  1J1E A;  1LKJ A;  2LHL A;  1B8R A;  1KWO B;  5F6T A;  3ZNI A;  2I2R E;  3LK0 A;  3LLE A;  1CLB A;  1S6C A;  4OR9 B;  4OVN F;  3VRO A;  1N0Y A;  3CLN A;  4I5K A;  4FQO A;  1E8A A;  1BOD A;  1KQM B;  1UHN A;  3CS1 A;  3SG2 A;  1MWN A;  4HRH A;  4R1E A;  1QAS A;  1K94 A;  1CDL A;  2MJW B;  2LLS A;  1J7R A;  2F33 A;  1A4P A;  3BYA A;  4HRG A;  1J55 A;  3OB1 B;  1UHI A;  3PAL A;  4IL1 A;  2LMU A;  1DJZ A;  5AER A;  2BEC A;  4GUK A;  2L51 A;  3TUY B;  3MSE B;  2JT0 A;  1SKT A;  1TCO B;  3AKB A;  1NX0 A;  2E6W A;  3SG4 A;  5CSN A;  1AJ5 A;  3D0Y B;  3TDI A;  3BUN B;  2ZKM X;  2OS8 B;  3GOF A;  4I5L B;  4MRY A;  1MXE A;  1J7Q A;  1AK8 A;  3NXA A;  2K2A A;  1A29 A;  2BBN A;  2KBM A;  5I2L A;  1M39 A;  3AAK A;  2NXQ A;  5JJG A;  1K2H A;  3EVV A;  1U5I A;  2FOT A;  3VGO A;  1CDN A;  1DJH A;  1UWO A;  1IGV A;  2EC6 B;  2K7D A;  4WQ2 A;  5KSZ A;  4I5N B;  2L98 A;  2L50 A;  1BLQ A;  2HPS A;  1FBV A;  4A4B A;  5FYX A;  1CFF A;  3M0W A;  1XFY O;  1EG4 A;  1WLZ A;  1UP5 A;  2LC5 A;  3VRR A;  1DGU A;  2AAO A;  2OTG B;  3TS5 B;  3OX5 A;  1C7W A;  3DVJ A;  2KSP A;  4YGE B;  1D1O A;  4OKH A;  1K93 D;  5I8N A;  1REC A;  2MBX A;  1AP4 A;  3I5H B;  3EK4 A;  1K9P A;  2GV5 A;  4PHN A;  3JVT B;  1FPW A;  4MEW A;  2WCB A;  4MBE A;  1NPQ A;  1W7J B;  1K96 A;  1KK8 C;  2JNX A;  3A8R A;  3EKJ A;  4GFT A;  3ICB A;  2G9B A;  1K8U A;  4YGC B;  1QV1 A;  4C0J A;  4P2Y B;  1Y1A A;  5TNC A;  2BCX A;  1IJ6 A;  1G8I A;  2M1K B;  2KYC A;  1MUX A;  1SW8 A;  1C7V A;  2JC2 A;  1NX3 A;  1QX2 A;  5HLV A;  2D8N A;  2ZNE A;  1F4Q A;  4UPG A;  3I5F C;  2PSR A;  1KCY A;  1YUR A;  3KPX A;  3BUX B;  1CM4 A;  3D10 A;  1DJY A;  1TOP A;  4PE1 A;  1AUI B;  2E30 A;  1HQV A;  2KFG A;  1M31 A;  2DOQ A;  1PRW A;  4OCI A;  2NCP A;  3EK8 A;  4PE0 A;  4YI9 A;  1LA3 A;  3SG3 A;  2B1U A;  2JT3 A;  2PVB A;  5AFP A;  2M7N A;  3CR4 X;  4YGA A;  1LIN A;  5HKW A;  3O6B A;  1N2D A;  2CNP A;  1Y6W A;  2Q4U A;  1S5G Z;  5AAN A;  2PRU A;  4MZK A;  4JQ0 D;  2MLF C;  1KFU S;  2JT8 A;  1Y0V H;  2JPT A;  1SL7 A;  3EVU A;  2PMY A;  1H4B A;  4L9M A;  1WDC C;  3NSL A;  3DVM A;  4ORC B;  1KQV A;  4C0K A;  2LM5 A;  1Y1X A;  4C0L A;  3OP0 A;  1RK9 A;  2OPO A;  2JXL A;  3JTD B;  1OZO A;  4PE4 A;  1U5I B;  2LUC A;  4WRI A;  4GPL B;  2O5G A;  3GK4 X;  4N1F A;  2JTT A;  1CDM A;  2JOJ A;  2H61 C;  3SJS A;  2WND A;  1YUU A;  1YRU B;  5J3X A;  1CDP A;  5GQQ C;  4PDZ A;  1TN4 A;  5IBW A;  2WCF A;  3I5G C;  3BUW B;  1SL8 A;  4YGB B;  1HT9 A;  1CB1 A;  2KNE A;  3PLF B;  2LLT A;  1GJY A;  2KI4 C;  1JUO A;  4NDC A;  1R2U A;  1EXR A;  2QPT A;  3OB2 B;  2KQY A;  3EK7 A;  1SR6 C;  3AKA A;  4GAO A;  1XFV O;  4PHJ A;  1BMO A;  1ALV A;  1DJW A;  1G4Y R;  2CT9 A;  2I7A A;  4GNK B;  2H2K A;  1CMG A;  1SNL A;  4XYN A;  1GGW A;  2LAN A;  3BXK A;  5G08 A;  3CTN A;  1EJ3 A;  1SY9 A;  2M0R A;  2QAC A;  4ORA B;  2CXJ A;  2MA2 A;  3E3R A;  2LVI A;  2MHH A;  3KHE A;  2HQW A;  1YX7 A;  4PCW A;  4ETO A;  1XYD A;  1BOC A;  4MRX A;  1CTR A;  1SCM C;  3PFV A;  2KDH A;  1L7Z A;  2L4I A;  2VRG A;  4N5X A;  5DKQ A;  3BUM B;  2BCB A;  1AHR A;  3I5I C;  5CSJ A;  3IF7 A;  2M29 A;  2JU0 A;  1SPY A;  3O4Y A;  2H61 A;  2NCO A;  2LV7 A;  4PHK A;  2GGM A;  5HKZ A;  1AJ4 A;  1TNW A;  1QIV A;  4MSP A;  1OMV A;  1B8C A;  2MAZ A;  1PK0 D;  5D7F A;  4DCK A;  2AUC A;  1JC2 A;  2JXC A;  1Q80 A;  3NSK A;  4QJ3 B;  2LLU A;  1JFK A;  3O78 A;  4ORB B;  1A75 A;  2A4J A;  1DGV A;  1NX1 A;  1DT7 B;  4P5O E;  2M49 B;  1KK8 B;  1XFX O;  1J7O A;  3LK1 A;  4MN0 A;  2F2O A;  3CR2 A;  1YUT A;  3NSI A;  2K7O A;  1RFJ A;  4GGN A;  1J7P A;  1B9A A;  2M7L A;  1PVA A;  1ZOT B;  2L2E A;  1YRT B;  1YTZ C;  5D69 A;  4YI8 A;  2L5X B;  1BF5 A;  1JBA A;  4A4C A;  1G33 A;  4AOM A;  1S5G Y;  3I5F B;  3FS7 A;  1FI6 A;  1OQP A;  3PSR A;  2LVK A;  1MF8 B;  1IQ5 A;  1XO5 A;  2Y4Q A;  5KTY A;  2OS8 C;  5ER4 X;  1JSA A;  3WXA A;  4YBH B;  2FCE A;  1QLK A;  1XFU O;  4HRE E;  3BUO B;  3FWB A;  5B8I B;  1PSB A;  4NDD A;  1NSH A;  1KFU L;  1KK7 Y;  3AAJ A;  1YVL A;  1SMG A;  4MLW A;  2WOR A;  2KGB C;  1JF0 A;  1QTX A;  3RM1 A;  2RGI A;  1SBJ A;  5AEQ A;  1CFD A;  2K0J A;  2WOS A;  5ER5 A;  1WLM A;  1WRZ A;  4YRU A;  1MHO A;  2LUX A;  2KQ6 A;  1BR1 B;  3LL8 B;  4MVF A;  1TCF A;  1KFX S;  1SRA A;  1VRK A;  1BJF A;  2BE6 A;  1EG3 A;  1WDC B;  1LXF C;  4AQI A;  1ODB A;  5I2Q A;  1IH0 A;  1KSO A;  3BQ3 A;  4M2O A;  1UHJ A;  1OE9 B;  1JWD A;  3CGA A;  4CLN A;  1RRO A;  2BKH B;  2COL B;  2KBI A;  5I2O A;  4CFQ A;  1TNP A;  1ZAC A;  1N65 A;  1NP8 A;  3DF0 A;  1FI5 A;  2ISD A;  3FIA A;  1OMD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...