5DKQA

Crystal structure of calcium-loaded s100b bound to sbi4214
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
91
structure length
91
Chain Sequence
MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFFEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein/inhibitor
molecule keywords Protein S100-B
publication title Small Molecule Inhibitors of Ca(2+)-S100B Reveal Two Protein Conformations.
pubmed doi rcsb
source organism Bos taurus
total genus 31
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2015-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5dkqA00
5FYXA 1JC2A 1GGWA 4U8DA 4E68A 2MAZA 1JBAA 1B9AA 3OX6A 2JOJA 3TDZA 1PRWA 2COLB 1PVBA 3CR5X 1KK7Y 3MSEB 4AQIA 1FPWA 1NCXA 1DT7B 3FIAA 1NPQA 4M2QA 1CDLA 4C0LA 1PK0D 2OTGC 2CBLA 1UHHA 2HQ8A 3I5HC 1RROA 3CZTX 5D7FA 1QVIZ 1SL7A 1XA5A 1PVAA 4WQ3A 2NZ0A 2Y4QA 4PHMA 2LHLA 2KAVA 3EVUA 5ER5A 2HQWA 4OVNF 1QVIY 1FBVA 4XYNA 2L50A 3BOWB 1TNQA 3JVTB 2BECA 1TOPA 1OOJA 2PRUA 3AKAA 1TTXA 1IRJA 4PHNA 1A75A 1IGVA 3OX5A 3TDIA 1JUOA 1KFXL 1J1EA 3SG4A 2MHHA 2K7CA 2IS9A 1CMGA 1Y1AA 3WHTB 2H2KA 2JNXA 4WRIA 1Y1XA 2MBXA 1RTP1 1QX7A 1BR1B 2BL0B 1W7IB 3A8RA 4TNCA 2LP3A 1CDMA 1SNLA 2FJUB 5AEQA 3BUMB 2LE9B 2KDHA 3TS5C 1CLBA 2LMUA 1LXFC 1ZMZA 2M7LA 1SCMB 1WRZA 1OQPA 1QIWA 3NXAA 4CIDA 1WRLA 1MHOA 1KFUS 1F4OA 1QATA 2F2OA 1BG1A 1YX7A 1PULA 1A2XA 1M39A 3EKJA 2AMIA 3PFVA 4CPVA 5K89A 1C7WA 2WCEA 3CR2A 1MF8B 3HX4A 3ICBA 4JQ0D 3TDUA 1BR4B 1G4YR 1YUUA 3JVTC 1OMDA 3EK7A 1TN4A 2KFHA 1K95A 2KOTA 2EC6B 5AANA 3ZWHA 2ZNEA 1GGZA 1N2DA 1OSAA 4YI8A 2G2BA 1K2HA 1BMOA 4GFTA 2K7BA 2HF5A 1EL4A 1XYDA 2I7AA 4GBAA 2KHNA 2KYCA 2LLUA 2BL0C 3VGOA 4Q04A 1VRKA 2I94A 1G8IA 1XFVO 1LA0A 1J7OA 4PHJA 1WDCB 1BODA 1K96A 1C7VA 1EG3A 1L2OC 3PALA 2KQYA 3K21A 1NYAA 2WOSA 4GAOA 5CSFA 4A4CA 2JNFA 5BPJA 3SG3A 1QX2A 1GJYA 4D1EA 1MR8A 2M9GA 2WORA 5HYDA 1XK4C 2R2IA 4MRXA 1DGVA 1TNXA 5HKZA 4GPLB 1BOCA 3SIAA 2PVBA 2P6BB 2L0PA 3IQQA 1UWOA 3E3RA 3LL8B 4I5JA 1CFDA 1MWNA 2EGDA 3SG2A 2K8MB 3O4YA 2LVVA 2OTGB 3BUWB 1BT6A 2BE6A 4CFRA 3I5HB 5I2OA 2LANA 5DKNA 2K2AA 4AOMA 1NX2A 1K9PA 1DJZA 2M3WA 4IL1A 2MRDA 3CLNA 2JXLA 2LCPA 2NXQA 5AERA 1FW4A 1QLKA 2L5XB 3D0YA 2BCBA 4GUKA 1JWDA 1K8UA 4GGFC 1L7ZA 2KBIA 3FS7A 4GNKB 1LVCD 2LMTA 3LLEA 3NSIA 1IQ5A 1K94A 5HLVA 3SG7A 1AJ5A 1D1OA 1KFXS 4I5LB 4FTGA 2K7OA 1CLMA 2O60A 3BUOB 5F6TA 3VROA 3WXAA 4ZCVA 1YUTA 4MEWA 4OR9B 3HCMA 1JSAA 2GGZA 1XVJA 1ZACA 5TNCA 1RWYA 3C1VA 5HLOA 4PCWA 1YURA 2CNPA 2KNEA 1Y0VH 3M0WA 1B8RA 2E6WA 1SRAA 5DKQA 2O5GA 1IKUA 3TS5B 2F2PA 2OPOA 2H61C 2JRFA 1KSOA 1UHNA 1F71A 1AVSA 1S1EA 1BJFA 4YBHB 3CWGA 3F45A 1DF0B 4R1EA 2BKIB 1TNWA 2RGIA 1IQ3A 2KFFA 4DRWA 2KSPA 2M49B 3JTDC 4OKHA 1MQ1A 2ZRSA 4PE7A 1SYMA 1NCZA 1B8LA 2KFGA 1SW8A 2ZN8A 3BUXB 4MBEA 1CB1A 2L98A 3O6BA 1S3PA 1CFPA 1RK9A 2CXJA 1F55A 1DJWA 2LLSA 2KYFA 2JWWA 2G9BA 1M45A 2NCPA 1Y1UA 4MZKA 1HQVA 1Y6WA 4MZLA 4MVFA 4UPGA 3EKHA 3CGAA 5AXIA 2SCPA 4YGAA 5GQQC 1BLQA 1DJHA 1U5IB 1K90D 2L4IA 4DCKA 5CSNA 3AAJA 4HRGA 5KU1A 5KTYA 2WNDA 1QTXA 1L2OB 4PDZA 1EJ3A 1LKJA 3FWBA 1W7JB 2M97A 1IWQA 1V1GA 2LVJA 1SY9A 5AFPA 1KSMA 2MLEC 1BF5A 1RECA 1SPYA 1ALVA 5J3XA 1ALWA 4PE1A 3KPXA 1XFYO 2PSRA 1KCYA 2PMYA 3I5FB 3LK0A 1QX5B 4AQJA 1QIVA 1C07A 4HRHA 3LK1A 2NCOA 1RFJA 2LVIA 2JT0A 1M46A 1DF0A 1WY9A 2M7NA 2JTTA 3EVVA 2Y5IA 2I2RE 2OS8B 4C0JA 1QXPA 1S36A 3CTNA 1H4BA 3BOWA 4PALA 1XFWO 2A4JA 1B7TZ 1B4CA 2BCAA 2SASA 1N0YA 1CLLA 4C0KA 3IQOA 3SG6A 1OMVA 4PE4A 1J7PA 2MLFC 4XJKB 4N1FA 3O2PA 5CSIA 3TZ1A 3GK2A 1SR6C 1UHKA 3TUYC 4OCIA 1TCOB 2GGMA 1RJVA 5HKWA 1BU3A 2HETA 1XO5A 1XFUO 2ZNDA 3I5FC 2CT9A 1F70A 1LA3A 4NDCA 4QJ4B 1JF2A 1MUXA 1NCYA 1FF1A 4I5KA 2KAYA 1JFJA 1QLSA 4PHKA 3I5IC 2JTZA 3WNXB 1YTZC 3PLFB 1KWOC 2OS8C 2QACA 5ER4X 2M1UA 4DIRA 4USLA 3IF7A 5JJGA 1XK4A 3H4SE 1PSBA 1B8CA 3RM1A 2M0RA 1S6CA 1B1GA 1IJ6A 1NWDA 1QJTA 1S5GZ 3BUNB 3CR4X 1TIZA 1AJ4A 1PALA 2MA2A 5G08A 3JTDB 2D8NA 3KO0A 4DUQA 5JOLA 1QV0A 1SKTA 3CS1A 1S5GY 2JT8A 1KQMC 3RLZA 4FQOA 4JPZB 1NSHA 1SMGA 2Y1NA 3VRQA 1DMOA 1S6JA 2F3ZA 1TCFA 1DJYA 1HT9A 3LCPC 2TN4A 4GGFA 4DS7A 3BYAA 3SIBA 4F0ZB 1CKKA 2LVKA 1XFXO 2WCBA 3BQ3A 2LP2A 1WRKA 1SBJA 3PN7B 1EG4A 1DJXA 4YI9A 3ZNIA 4ICBA 2LAPA 2ZN9A 1CM1A 2JULA 3FWCA 2KQ6A 1R2UA 1NX3A 2FCEA 2PALA 2KI6C 3OB2B 1KK7Z 3PM8A 2PASA 4JWQA 1E8AA 1IJ5A 1KK8C 1UHJA 2LM5A 1YR5A 5HKYA 2KI4B 5CPVA 3WHUB 1YRTB 2L2EA 3D10A 2F33A 2JQ6A 2KAXA 1MXEA 2E30A 1M31A 1CDNA 1S26D 2FCDA 1K9UA 2H61A 1ZOTB 3PATA 2AAOA 1ZUZA 2M1KB 1F8HA 1IH0A 1J1DA 4N5XA 4MLWA 4QJ5B 1YX8A 1SK6D 1QS7A 1UURA 2LC5A 2V53A 1JF0A 1AHRA 1DGUA 4ZCUA 2M29A 2KGRA 1CTRA 2KI6D 2F3YA 4YGCB 2LUXA 4BY4A 3PN7C 4GGNA 5IBWA 1YUSA 1QASA 3NSOA 2BCXA 3PSRA 2B1UA 1A03A 4CFQA 2K7DA 1SR6B 1UUSA 2ZKMX 4I5NB 4CLNA 2M8UA 3TUYB 2Q4UA 2FOTA 1V1FA 2KGBC 5DKRA 2ISDA 1CNPA 1EH2A 1SL8A 2WC8A 2KI4C 1DJGA 1KQVA 2JPTA 2AUCA 2JXCA 3DVEA 1NIWA 1CMFA 1F54A 5I2LA 1DJIA 5D69A 3VRNA 1YVHA 2ZFDA 4M2PA 4M2OA 1F4QA 2BBMA 2F8PA 3KHEA 3I5IB 1TRFA 4N1GA 1GQMA 2K2FA 1DTLA 1KWOB 3GOFA 1A4PA 2L4HA 3SJSA 2LLTA 3OHMB 3OP0A 1M63B 2CTNA 2EHBA 2JZIA 1SL9A 1ZFSA 2I18A 2K0JA 4PE0A 3DVMA 2LHIA 2K61A 3SG5A 3GK4X 1EXRA 5KSZA 3D0YB 1B7TY 4NDBA 4NQGA 5CSJA 3DVKA 2BBNA 3DF0B 2DOQA 1ODBA 2BE4A 5I2QA 1KQMB 1J7RA 2JU0A 2VRGA 1X02A 2JT3A 1JFKA 1U5IA 4YGDB 2GV5A 1YRUB 2Q91A 3A4UB 1OE9B 1TNPA 3VRPA 4YGBB 2CCMA 2LNKA 2KBMA 3VRRA 1CM4A 1S6IA 1SCMC 3BXKA 3I5GB 3KEVA 4ORBB 3DVJA 3KF9A 3EK8A 1OMRA 2LV7A 4ETOA 1SCVA 2NLNA 1G33A 2WCFA 4NDDA 4MRYA 5PALA 1XFZO 1B47A 2JC2A 2LUCA 2ZRTA 1FI6A 1N65A 2LMVA 3AKBA 4YGEB 1KFUL 3AAKA 1KK8B 4ORAB 3GK1A 1J55A 2HPSA 3O78A 4P5OE 1IG5A 1WLZA 3OB1B 1AK8A 2QPTA 4HREE 1J7QA 3NSLA 2EC6C 3EVRA 1K93D 4QJ3B 1WLMA 4HSZA 2Y1MA 1OZOA 2BKHB 4OV2A 3QRXA 1PSRA 4BY5A 1AUIB 3DD4A 3EK4A 1NX0A 1H8BA 1UP5A 1CFCA 1DVIA 4ORCB 1NUBA 1A75B 1R6PA 4XJKA 1CDPA 1WDCC 1NX1A 1UHIA 4WQ2A 1A29A 4P2YB 4MZJA 1Q80A 2MJWB 2L51A 3DF0A 1FI5A 1QV1A 3I5GC 1AP4A 1NP8A 4MN0A 4MSPA 4YRUA 5I8NA 4A4BA 4L9MA 1OZSA 1K9KA 1CFFA 3NSKA 5B8IB 1LINA 1YVLA 1MXLC
chains in the Genus database with same CATH superfamily
5FYXA 4INXA 1JC2A 1GGWA 4U8DA 4E68A 2MAZA 3B87A 1JBAA 1B9AA 3OX6A 2JOJA 3UNWA 3TDZA 1PRWA 2COLB 1PVBA 3CR5X 1KK7Y 3BFBA 3MSEB 4AQIA 1NCXA 1DT7B 1C3YA 1FPWA 3FIAA 1NPQA 4M2QA 1CDLA 4C0LA 1PK0D 2OTGC 2CBLA 1UHHA 2HQ8A 3I5HC 1RROA 3CZTX 5D7FA 1QVIZ 3R1PA 1SL7A 1XA5A 3S0FA 1PVAA 4WQ3A 2NZ0A 2Y4QA 4PHMA 1C3ZA 2LHLA 2KAVA 3EVUA 5ER5A 2HQWA 3NHIA 4OVNF 1QVIY 1FBVA 4XYNA 2L50A 3BOWB 1TNQA 3S0BA 1GM0A 3JVTB 2BECA 1TOPA 1OOJA 2PRUA 3AKAA 1TTXA 1IRJA 4PHNA 1A75A 1IGVA 3OX5A 3TDIA 1JUOA 1KFXL 1J1EA 4FQTA 3SG4A 2MHHA 2K7CA 2IS9A 1CMGA 3SS4A 1Y1AA 3WHTB 2H2KA 2JNXA 4WRIA 1Y1XA 2MBXA 1RTP1 1QX7A 1BR1B 2BL0B 4JD9A 1W7IB 3A8RA 4TNCA 2LP3A 1CDMA 1SNLA 2FJUB 5AEQA 3BUMB 2LE9B 2KDHA 3TS5C 1CLBA 2LMUA 1LXFC 1ZMZA 2M7LA 1SCMB 1WRZA 1OQPA 1J7QA 1QIWA 3NXAA 4CIDA 1WRLA 1MHOA 1KFUS 1F4OA 1QATA 2F2OA 1TUZA 1BG1A 1YX7A 1PULA 1A2XA 3RZSA 1M39A 3EKJA 2AMIA 3PFVA 4CPVA 5K89A 1C7WA 2WC6A 2WCEA 3CR2A 1MF8B 3HX4A 3ICBA 4JQ0D 3TDUA 1BR4B 1G4YR 1YUUA 3JVTC 1OMDA 3EK7A 1TN4A 1XFRA 2KFHA 1K95A 3PM2A 2KOTA 2EC6B 5AANA 1OW4A 3ZWHA 2ZNEA 1GGZA 1N2DA 1OSAA 4YI8A 2G2BA 1K2HA 1BMOA 4GFTA 1SSEB 2HF5A 1EL4A 1XYDA 2I7AA 2K7BA 2KHNA 4GBAA 2KYCA 2LLUA 2BL0C 4INWA 3VGOA 4Q04A 1VRKA 2I94A 1G8IA 1P28A 1LA0A 1XFVO 1J7OA 4PHJA 1WDCB 1BODA 2P71A 1K96A 1C7VA 1EG3A 1L2OC 2YGUA 2KQYA 3B86A 1NYAA 2WOSA 2P70A 1DEKA 3K21A 3PALA 4GAOA 5CSFA 4A4CA 2KPHA 3S0DA 2JNFA 2JPOA 2PQLA 5BPJA 3SG3A 1QX2A 1GJYA 4D1EA 1MR8A 2M9GA 2WORA 5HYDA 1XK4C 2R2IA 4MRXA 1DGVA 1TNXA 2KLDA 4GPLB 5HKZA 3SS5A 3SIAA 3OBVA 1BOCA 2PVBA 2P6BB 2L0PA 3IQQA 1UWOA 3E3RA 3LL8B 4I5JA 1CFDA 1MWNA 2EGDA 3SG2A 2K8MB 3O4YA 2LVVA 2OTGB 2ERBA 3BUWB 1BT6A 2BE6A 4CFRA 3I5HB 5I2OA 2LANA 5DKNA 2K2AA 4AOMA 1NX2A 3OGNA 1K9PA 1DJZA 2M3WA 4IL1A 2MRDA 3CLNA 2JXLA 2LCPA 2NXQA 5AERA 1FW4A 1QLKA 2L5XB 3D0YA 2BCBA 4GUKA 3S0EA 1JWDA 1K8UA 4GGFC 1L7ZA 2KBIA 3FS7A 4GNKB 2KLEA 1LVCD 2LMTA 3LLEA 3NSIA 1IQ5A 1K94A 3DYEA 3L4AA 5HLVA 3SG7A 1AJ5A 2L2CA 1D1OA 1KFXS 4I5LB 4FTGA 2K7OA 2H8VA 1CLMA 2O60A 3BUOB 5F6TA 3VROA 3WXAA 4ZCVA 1YUTA 4MEWA 4OR9B 3HCMA 5D3OA 1OOIX 1JSAA 2GGZA 1XVJA 1ZACA 1ORGA 2WCKA 5TNCA 1RWYA 3C1VA 5HLOA 4PCWA 1YURA 2CNPA 3V2LA 2KNEA 1Y0VH 3M0WA 4F7FA 1B8RA 2E6WA 4OZDA 1SRAA 5DKQA 2O5GA 1IKUA 3BFAA 2F2PA 2OPOA 2H61C 3D78A 3TS5B 5EL2A 2JRFA 3DZTA 1KSOA 1UHNA 1F71A 1AVSA 1S1EA 1BJFA 4YBHB 3CWGA 3F45A 1DF0B 4R1EA 3R72A 2BKIB 1TNWA 2RGIA 1IQ3A 2KFFA 4DRWA 2KSPA 2M49B 3JTDC 4OKHA 1MQ1A 1QWVA 2ZRSA 4PE7A 1SYMA 1NCZA 1B8LA 2KFGA 5DICA 1SW8A 2ZN8A 3BUXB 4MBEA 1CB1A 2L98A 3O6BA 1S3PA 1CFPA 1RK9A 2CXJA 1F55A 1DJWA 2LLSA 2KYFA 2JWWA 2G9BA 2WCMA 1M45A 2NCPA 1Y1UA 3D74A 4MZKA 3S0AA 1HQVA 1Y6WA 4MZLA 4MVFA 4UPGA 3CYZA 3EKHA 3CGAA 5AXIA 2SCPA 4YGAA 5GQQC 1BLQA 1DJHA 1U5IB 1K90D 2L4IA 4DCKA 5CSNA 3AAJA 4HRGA 5KU1A 2QEOA 5KTYA 2WNDA 1QTXA 1L2OB 4PDZA 1EJ3A 1LKJA 3FWBA 3QMEA 1W7JB 2M97A 1IWQA 1V1GA 2LVJA 2WCJA 1SY9A 5AFPA 1KSMA 2MLEC 3D77A 5FI7A 1BF5A 3D76A 1RECA 1SPYA 1ALVA 2BNXA 5J3XA 1ALWA 4PE1A 3KPXA 1XFYO 2PSRA 1KCYA 2PMYA 3I5FB 3LK0A 1QX5B 4AQJA 1QIVA 1DC1A 1C07A 4HRHA 3LK1A 2NCOA 1RFJA 2LVIA 2JT0A 1M46A 1DF0A 1WY9A 2M7NA 2JTTA 3EVVA 3N7HA 2Y5IA 2I2RE 2OS8B 1TWOA 4C0JA 1QXPA 1S36A 3CTNA 1H4BA 3BOWA 1Z2CB 4PALA 1XFWO 2A4JA 1B7TZ 1B4CA 2BCAA 2SASA 1N0YA 1CLLA 4C0KA 3IQOA 3SG6A 1OMVA 4PE4A 1J7PA 2MLFC 4XJKB 4N1FA 3O2PA 5CSIA 3TZ1A 2WCLA 1SR6C 3GK2A 2WC5A 1UHKA 3TUYC 4OCIA 1TCOB 3FE6A 2GGMA 1RJVA 5HKWA 1BU3A 1OOHA 3Q8IA 2HETA 1XO5A 1XFUO 2ZNDA 3I5FC 2CT9A 1F70A 1LA3A 4NDCA 4QJ4B 1JF2A 1MUXA 1NCYA 3BFHA 1FF1A 4I5KA 2KAYA 1JFJA 1QLSA 4PHKA 3I5IC 2JTZA 3WNXB 1YTZC 3PLFB 1KWOC 2OS8C 2QACA 5ER4X 2M1UA 4DIRA 4USLA 3IF7A 5JJGA 1XK4A 3H4SE 1PSBA 1B8CA 5HL1A 2BAPA 2M0RA 1S6CA 3RM1A 1B1GA 1IJ6A 1NWDA 1QJTA 1S5GZ 3BUNB 3CR4X 1TIZA 1AJ4A 1PALA 2MA2A 3BJHA 1OOGA 3CDNA 3JTDB 2D8NA 5FI6A 3KO0A 4DUQA 5JOLA 1QV0A 1SKTA 3CS1A 1S5GY 2JT8A 2K60A 1LS8A 3O4XA 1KQMC 3RLZA 4FQOA 3L4LA 4JPZB 1NSHA 1SMGA 2Y1NA 3VRQA 1DMOA 1S6JA 2F3ZA 1TCFA 1DJYA 1HT9A 3LCPC 2TN4A 4GGFA 4DS7A 3BYAA 3SIBA 4F0ZB 1CKKA 2LVKA 2QDIA 1XFXO 2WCBA 5G08A 3BQ3A 2LP2A 1WRKA 2PYQA 1SBJA 3PN7B 1EG4A 1DJXA 4YI9A 3ZNIA 4ICBA 2LAPA 2ZN9A 1CM1A 2JULA 3FWCA 3R1VA 2KQ6A 3NGVA 1R2UA 1NX3A 2FCEA 2PALA 2KI6C 3OB2B 1KK7Z 3DXLA 2PASA 3PM8A 1E8AA 4JWQA 1IJ5A 1KK8C 1UHJA 2LM5A 1YR5A 5HKYA 2KI4B 5CPVA 3WHUB 1YRTB 1IIOA 2L2EA 3D10A 2F33A 2JQ6A 2KAXA 1MXEA 2E30A 2L5YA 1M31A 1CDNA 1S26D 2FCDA 3FE8A 1K9UA 2H61A 4KYNA 1ZOTB 3PATA 2AAOA 1ZUZA 1TUJA 2M1KB 5FI2A 1J1DA 1F8HA 4N5XA 1IH0A 4MLWA 4QJ5B 1YX8A 1SK6D 1QS7A 1UURA 2LC5A 2V53A 1JF0A 3UO9A 1AHRA 1DGUA 4ZCUA 2M29A 2KGRA 1CTRA 2KI6D 2F3YA 4YGCB 2LUXA 4BY4A 3PN7C 4GGNA 5IBWA 1YUSA 3B6XA 1DELA 1QASA 3NSOA 2BCXA 3PSRA 2B1UA 1A03A 4IJ7A 4CFQA 2K7DA 1SR6B 1UUSA 2ZKMX 4I5NB 4CLNA 2M8UA 3TUYB 2Q4UA 2FOTA 3R1OA 1V1FA 2KGBC 3CZ2A 5DKRA 2ISDA 1CNPA 1EH2A 1SL8A 2WC8A 2KI4C 1DJGA 3D73A 1KQVA 2JPTA 2AUCA 2JXCA 3DVEA 1NIWA 1CMFA 1F54A 5I2LA 1DJIA 3K1EA 1OOFA 5D69A 3VRNA 1YVHA 2ZFDA 4M2PA 4M2OA 1F4QA 2BBMA 2F8PA 3KHEA 3I5IB 1TRFA 4N1GA 1GQMA 2K2FA 1DTLA 1KWOB 3GOFA 3NHTA 1A4PA 2L4HA 3SJSA 3VB1A 2LLTA 3OHMB 3OP0A 1M63B 2CTNA 2EHBA 2JZIA 1SL9A 1ZFSA 2I18A 2QEHA 4PT1A 2K0JA 4PE0A 3DVMA 2LHIA 2K61A 3EG5B 3D75A 3GK4X 3SG5A 3IVTA 1EXRA 5KSZA 3D0YB 1B7TY 4NDBA 4NQGA 5CSJA 3DVKA 3FE9A 2BBNA 3DF0B 2DOQA 1ODBA 2BE4A 5I2QA 1KQMB 1J7RA 3DY9A 2JU0A 2VRGA 1X02A 2JT3A 3B88A 1JFKA 1U5IA 4YGDB 3SS3A 2GV5A 1YRUB 2Q91A 3A4UB 3L47A 1OE9B 1TNPA 3VRPA 2QEBA 4YGBB 2CCMA 2LNKA 2KBMA 3VRRA 1CM4A 1S6IA 1SCMC 3BXKA 3I5GB 3KEVA 4ORBB 3DVJA 3KF9A 2WCHA 3EK8A 3PJIA 1OMRA 2LV7A 4ETOA 1SCVA 2NLNA 1G33A 2WCFA 4NDDA 4MRYA 5PALA 1XFZO 1B47A 2JC2A 2LUCA 2ZRTA 1FI6A 1N65A 2LMVA 3AKBA 1DQEA 1KFUL 2FJYA 4YGEB 3AAKA 1KK8B 4JKTA 4ORAB 3GK1A 1J55A 2HPSA 3O78A 4P5OE 1IG5A 1WLZA 3OB1B 1AK8A 2QPTA 4HREE 5I94A 3NSLA 2EC6C 3EVRA 3CZ1A 1K93D 4QJ3B 1WLMA 2GTEA 4HSZA 2Y1MA 1OZOA 2BKHB 4OV2A 3QRXA 1PSRA 4BY5A 1AUIB 3DD4A 3EK4A 1NX0A 1H8BA 1UP5A 3CZ0A 1CFCA 1DVIA 4ORCB 1Z4HA 1NUBA 1A75B 1R6PA 4XJKA 1CDPA 1WDCC 2QEVA 1NX1A 1UHIA 4WQ2A 1A29A 4P2YB 1W9ZA 4MZJA 1Q80A 3S0GA 2MJWB 2L51A 3CABA 3DF0A 1FI5A 1QV1A 3I5GC 1AP4A 1NP8A 1T14A 4MN0A 4MSPA 4YRUA 5I8NA 4A4BA 4L9MA 1OZSA 1K9KA 1CFFA 3B7AA 3NSKA 5B8IB 1LINA 1YVLA 1MXLC
chains in the Genus database with same CATH topology
5FYXA 1JC2A 1GGWA 4U8DA 4E68A 2MAZA 1JBAA 1B9AA 3OX6A 2JOJA 3TDZA 1PRWA 2COLB 1PVBA 3CR5X 1KK7Y 3MSEB 4AQIA 1FPWA 1NCXA 1DT7B 3FIAA 1NPQA 4M2QA 1CDLA 4C0LA 1PK0D 2OTGC 2CBLA 1UHHA 2HQ8A 3I5HC 1RROA 3CZTX 5D7FA 1QVIZ 1SL7A 1XA5A 1PVAA 4WQ3A 2NZ0A 2Y4QA 4PHMA 2LHLA 2KAVA 3EVUA 5ER5A 2HQWA 4OVNF 1QVIY 1FBVA 4XYNA 2L50A 3BOWB 1TNQA 3JVTB 2BECA 1TOPA 1OOJA 2PRUA 3AKAA 1TTXA 1IRJA 4PHNA 1A75A 1IGVA 3OX5A 3TDIA 1JUOA 1KFXL 1J1EA 3SG4A 2MHHA 2K7CA 2IS9A 1CMGA 1Y1AA 3WHTB 2H2KA 2JNXA 4WRIA 1Y1XA 2MBXA 1RTP1 1QX7A 1BR1B 2BL0B 1W7IB 3A8RA 4TNCA 2LP3A 1CDMA 1SNLA 2FJUB 5AEQA 3BUMB 2LE9B 2KDHA 3TS5C 1CLBA 2LMUA 1LXFC 1ZMZA 2M7LA 1SCMB 1WRZA 1OQPA 1QIWA 3NXAA 4CIDA 1WRLA 1MHOA 1KFUS 1F4OA 1QATA 2F2OA 1BG1A 1YX7A 1PULA 1A2XA 1M39A 3EKJA 2AMIA 3PFVA 4CPVA 5K89A 1C7WA 2WCEA 3CR2A 1MF8B 3HX4A 3ICBA 4JQ0D 3TDUA 1BR4B 1G4YR 1YUUA 3JVTC 1OMDA 3EK7A 1TN4A 2KFHA 1K95A 2KOTA 2EC6B 5AANA 3ZWHA 2ZNEA 1GGZA 1N2DA 1OSAA 4YI8A 2G2BA 1K2HA 1BMOA 4GFTA 2K7BA 2HF5A 1EL4A 1XYDA 2I7AA 4GBAA 2KHNA 2KYCA 2LLUA 2BL0C 3VGOA 4Q04A 1VRKA 2I94A 1G8IA 1XFVO 1LA0A 1J7OA 4PHJA 1WDCB 1BODA 1K96A 1C7VA 1EG3A 1L2OC 3PALA 2KQYA 3K21A 1NYAA 2WOSA 4GAOA 5CSFA 4A4CA 2JNFA 5BPJA 3SG3A 1QX2A 1GJYA 4D1EA 1MR8A 2M9GA 2WORA 5HYDA 1XK4C 2R2IA 4MRXA 1DGVA 1TNXA 5HKZA 4GPLB 1BOCA 3SIAA 2PVBA 2P6BB 2L0PA 3IQQA 1UWOA 3E3RA 3LL8B 4I5JA 1CFDA 1MWNA 2EGDA 3SG2A 2K8MB 3O4YA 2LVVA 2OTGB 3BUWB 1BT6A 2BE6A 4CFRA 3I5HB 5I2OA 2LANA 5DKNA 2K2AA 4AOMA 1NX2A 1K9PA 1DJZA 2M3WA 4IL1A 2MRDA 3CLNA 2JXLA 2LCPA 2NXQA 5AERA 1FW4A 1QLKA 2L5XB 3D0YA 2BCBA 4GUKA 1JWDA 1K8UA 4GGFC 1L7ZA 2KBIA 3FS7A 4GNKB 1LVCD 2LMTA 3LLEA 3NSIA 1IQ5A 1K94A 5HLVA 3SG7A 1AJ5A 1D1OA 1KFXS 4I5LB 4FTGA 2K7OA 1CLMA 2O60A 3BUOB 5F6TA 3VROA 3WXAA 4ZCVA 1YUTA 4MEWA 4OR9B 3HCMA 1JSAA 2GGZA 1XVJA 1ZACA 5TNCA 1RWYA 3C1VA 5HLOA 4PCWA 1YURA 2CNPA 2KNEA 1Y0VH 3M0WA 1B8RA 2E6WA 1SRAA 5DKQA 2O5GA 1IKUA 3TS5B 2F2PA 2OPOA 2H61C 2JRFA 1KSOA 1UHNA 1F71A 1AVSA 1S1EA 1BJFA 4YBHB 3CWGA 3F45A 1DF0B 4R1EA 2BKIB 1TNWA 2RGIA 1IQ3A 2KFFA 4DRWA 2KSPA 2M49B 3JTDC 4OKHA 1MQ1A 2ZRSA 4PE7A 1SYMA 1NCZA 1B8LA 2KFGA 1SW8A 2ZN8A 3BUXB 4MBEA 1CB1A 2L98A 3O6BA 1S3PA 1CFPA 1RK9A 2CXJA 1F55A 1DJWA 2LLSA 2KYFA 2JWWA 2G9BA 1M45A 2NCPA 1Y1UA 4MZKA 1HQVA 1Y6WA 4MZLA 4MVFA 4UPGA 3EKHA 3CGAA 5AXIA 2SCPA 4YGAA 5GQQC 1BLQA 1DJHA 1U5IB 1K90D 2L4IA 4DCKA 5CSNA 3AAJA 4HRGA 5KU1A 5KTYA 2WNDA 1QTXA 1L2OB 4PDZA 1EJ3A 1LKJA 3FWBA 1W7JB 2M97A 1IWQA 1V1GA 2LVJA 1SY9A 5AFPA 1KSMA 2MLEC 1BF5A 1RECA 1SPYA 1ALVA 5J3XA 1ALWA 4PE1A 3KPXA 1XFYO 2PSRA 1KCYA 2PMYA 3I5FB 3LK0A 1QX5B 4AQJA 1QIVA 1C07A 4HRHA 3LK1A 2NCOA 1RFJA 2LVIA 2JT0A 1M46A 1DF0A 1WY9A 2M7NA 2JTTA 3EVVA 2Y5IA 2I2RE 2OS8B 4C0JA 1QXPA 1S36A 3CTNA 1H4BA 3BOWA 4PALA 1XFWO 2A4JA 1B7TZ 1B4CA 2BCAA 2SASA 1N0YA 1CLLA 4C0KA 3IQOA 3SG6A 1OMVA 4PE4A 1J7PA 2MLFC 4XJKB 4N1FA 3O2PA 5CSIA 3TZ1A 3GK2A 1SR6C 1UHKA 3TUYC 4OCIA 1TCOB 2GGMA 1RJVA 5HKWA 1BU3A 2HETA 1XO5A 1XFUO 2ZNDA 3I5FC 2CT9A 1F70A 1LA3A 4NDCA 4QJ4B 1JF2A 1MUXA 1NCYA 1FF1A 4I5KA 2KAYA 1JFJA 1QLSA 4PHKA 3I5IC 2JTZA 3WNXB 1YTZC 3PLFB 1KWOC 2OS8C 2QACA 5ER4X 2M1UA 4DIRA 4USLA 3IF7A 5JJGA 1XK4A 3H4SE 1PSBA 1B8CA 3RM1A 2M0RA 1S6CA 1B1GA 1IJ6A 1NWDA 1QJTA 1S5GZ 3BUNB 3CR4X 1TIZA 1AJ4A 1PALA 2MA2A 5G08A 3JTDB 2D8NA 3KO0A 4DUQA 5JOLA 1QV0A 1SKTA 3CS1A 1S5GY 2JT8A 1KQMC 3RLZA 4FQOA 4JPZB 1NSHA 1SMGA 2Y1NA 3VRQA 1DMOA 1S6JA 2F3ZA 1TCFA 1DJYA 1HT9A 3LCPC 2TN4A 4GGFA 4DS7A 3BYAA 3SIBA 4F0ZB 1CKKA 2LVKA 1XFXO 2WCBA 3BQ3A 2LP2A 1WRKA 1SBJA 3PN7B 1EG4A 1DJXA 4YI9A 3ZNIA 4ICBA 2LAPA 2ZN9A 1CM1A 2JULA 3FWCA 2KQ6A 1R2UA 1NX3A 2FCEA 2PALA 2KI6C 3OB2B 1KK7Z 3PM8A 2PASA 4JWQA 1E8AA 1IJ5A 1KK8C 1UHJA 2LM5A 1YR5A 5HKYA 2KI4B 5CPVA 3WHUB 1YRTB 2L2EA 3D10A 2F33A 2JQ6A 2KAXA 1MXEA 2E30A 1M31A 1CDNA 1S26D 2FCDA 1K9UA 2H61A 1ZOTB 3PATA 2AAOA 1ZUZA 2M1KB 1F8HA 1IH0A 1J1DA 4N5XA 4MLWA 4QJ5B 1YX8A 1SK6D 1QS7A 1UURA 2LC5A 2V53A 1JF0A 1AHRA 1DGUA 4ZCUA 2M29A 2KGRA 1CTRA 2KI6D 2F3YA 4YGCB 2LUXA 4BY4A 3PN7C 4GGNA 5IBWA 1YUSA 1QASA 3NSOA 2BCXA 3PSRA 2B1UA 1A03A 4CFQA 2K7DA 1SR6B 1UUSA 2ZKMX 4I5NB 4CLNA 2M8UA 3TUYB 2Q4UA 2FOTA 1V1FA 2KGBC 5DKRA 2ISDA 1CNPA 1EH2A 1SL8A 2WC8A 2KI4C 1DJGA 1KQVA 2JPTA 2AUCA 2JXCA 3DVEA 1NIWA 1CMFA 1F54A 5I2LA 1DJIA 5D69A 3VRNA 1YVHA 2ZFDA 4M2PA 4M2OA 1F4QA 2BBMA 2F8PA 3KHEA 3I5IB 1TRFA 4N1GA 1GQMA 2K2FA 1DTLA 1KWOB 3GOFA 1A4PA 2L4HA 3SJSA 2LLTA 3OHMB 3OP0A 1M63B 2CTNA 2EHBA 2JZIA 1SL9A 1ZFSA 2I18A 2K0JA 4PE0A 3DVMA 2LHIA 2K61A 3SG5A 3GK4X 1EXRA 5KSZA 3D0YB 1B7TY 4NDBA 4NQGA 5CSJA 3DVKA 2BBNA 3DF0B 2DOQA 1ODBA 2BE4A 5I2QA 1KQMB 1J7RA 2JU0A 2VRGA 1X02A 2JT3A 1JFKA 1U5IA 4YGDB 2GV5A 1YRUB 2Q91A 3A4UB 1OE9B 1TNPA 3VRPA 4YGBB 2CCMA 2LNKA 2KBMA 3VRRA 1CM4A 1S6IA 1SCMC 3BXKA 3I5GB 3KEVA 4ORBB 3DVJA 3KF9A 3EK8A 1OMRA 2LV7A 4ETOA 1SCVA 2NLNA 1G33A 2WCFA 4NDDA 4MRYA 5PALA 1XFZO 1B47A 2JC2A 2LUCA 2ZRTA 1FI6A 1N65A 2LMVA 3AKBA 4YGEB 1KFUL 3AAKA 1KK8B 4ORAB 3GK1A 1J55A 2HPSA 3O78A 4P5OE 1IG5A 1WLZA 3OB1B 1AK8A 2QPTA 4HREE 1J7QA 3NSLA 2EC6C 3EVRA 1K93D 4QJ3B 1WLMA 4HSZA 2Y1MA 1OZOA 2BKHB 4OV2A 3QRXA 1PSRA 4BY5A 1AUIB 3DD4A 3EK4A 1NX0A 1H8BA 1UP5A 1CFCA 1DVIA 4ORCB 1NUBA 1A75B 1R6PA 4XJKA 1CDPA 1WDCC 1NX1A 1UHIA 4WQ2A 1A29A 4P2YB 4MZJA 1Q80A 2MJWB 2L51A 3DF0A 1FI5A 1QV1A 3I5GC 1AP4A 1NP8A 4MN0A 4MSPA 4YRUA 5I8NA 4A4BA 4L9MA 1OZSA 1K9KA 1CFFA 3NSKA 5B8IB 1LINA 1YVLA 1MXLC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FYX A;  1JC2 A;  1GGW A;  4U8D A;  4E68 A;  2MAZ A;  1JBA A;  1B9A A;  3OX6 A;  2JOJ A;  3TDZ A;  1PRW A;  2COL B;  1PVB A;  3CR5 X;  1KK7 Y;  3MSE B;  4AQI A;  1FPW A;  1NCX A;  1DT7 B;  3FIA A;  1NPQ A;  4M2Q A;  1CDL A;  4C0L A;  1PK0 D;  2OTG C;  2CBL A;  1UHH A;  2HQ8 A;  3I5H C;  1RRO A;  3CZT X;  5D7F A;  1QVI Z;  1SL7 A;  1XA5 A;  1PVA A;  4WQ3 A;  2NZ0 A;  2Y4Q A;  4PHM A;  2LHL A;  2KAV A;  3EVU A;  5ER5 A;  2HQW A;  4OVN F;  1QVI Y;  1FBV A;  4XYN A;  2L50 A;  3BOW B;  1TNQ A;  3JVT B;  2BEC A;  1TOP A;  1OOJ A;  2PRU A;  3AKA A;  1TTX A;  1IRJ A;  4PHN A;  1A75 A;  1IGV A;  3OX5 A;  3TDI A;  1JUO A;  1KFX L;  1J1E A;  3SG4 A;  2MHH A;  2K7C A;  2IS9 A;  1CMG A;  1Y1A A;  3WHT B;  2H2K A;  2JNX A;  4WRI A;  1Y1X A;  2MBX A;  1RTP 1;  1QX7 A;  1BR1 B;  2BL0 B;  1W7I B;  3A8R A;  4TNC A;  2LP3 A;  1CDM A;  1SNL A;  2FJU B;  5AEQ A;  3BUM B;  2LE9 B;  2KDH A;  3TS5 C;  1CLB A;  2LMU A;  1LXF C;  1ZMZ A;  2M7L A;  1SCM B;  1WRZ A;  1OQP A;  1QIW A;  3NXA A;  4CID A;  1WRL A;  1MHO A;  1KFU S;  1F4O A;  1QAT A;  2F2O A;  1BG1 A;  1YX7 A;  1PUL A;  1A2X A;  1M39 A;  3EKJ A;  2AMI A;  3PFV A;  4CPV A;  5K89 A;  1C7W A;  2WCE A;  3CR2 A;  1MF8 B;  3HX4 A;  3ICB A;  4JQ0 D;  3TDU A;  1BR4 B;  1G4Y R;  1YUU A;  3JVT C;  1OMD A;  3EK7 A;  1TN4 A;  2KFH A;  1K95 A;  2KOT A;  2EC6 B;  5AAN A;  3ZWH A;  2ZNE A;  1GGZ A;  1N2D A;  1OSA A;  4YI8 A;  2G2B A;  1K2H A;  1BMO A;  4GFT A;  2K7B A;  2HF5 A;  1EL4 A;  1XYD A;  2I7A A;  4GBA A;  2KHN A;  2KYC A;  2LLU A;  2BL0 C;  3VGO A;  4Q04 A;  1VRK A;  2I94 A;  1G8I A;  1XFV O;  1LA0 A;  1J7O A;  4PHJ A;  1WDC B;  1BOD A;  1K96 A;  1C7V A;  1EG3 A;  1L2O C;  3PAL A;  2KQY A;  3K21 A;  1NYA A;  2WOS A;  4GAO A;  5CSF A;  4A4C A;  2JNF A;  5BPJ A;  3SG3 A;  1QX2 A;  1GJY A;  4D1E A;  1MR8 A;  2M9G A;  2WOR A;  5HYD A;  1XK4 C;  2R2I A;  4MRX A;  1DGV A;  1TNX A;  5HKZ A;  4GPL B;  1BOC A;  3SIA A;  2PVB A;  2P6B B;  2L0P A;  3IQQ A;  1UWO A;  3E3R A;  3LL8 B;  4I5J A;  1CFD A;  1MWN A;  2EGD A;  3SG2 A;  2K8M B;  3O4Y A;  2LVV A;  2OTG B;  3BUW B;  1BT6 A;  2BE6 A;  4CFR A;  3I5H B;  5I2O A;  2LAN A;  5DKN A;  2K2A A;  4AOM A;  1NX2 A;  1K9P A;  1DJZ A;  2M3W A;  4IL1 A;  2MRD A;  3CLN A;  2JXL A;  2LCP A;  2NXQ A;  5AER A;  1FW4 A;  1QLK A;  2L5X B;  3D0Y A;  2BCB A;  4GUK A;  1JWD A;  1K8U A;  4GGF C;  1L7Z A;  2KBI A;  3FS7 A;  4GNK B;  1LVC D;  2LMT A;  3LLE A;  3NSI A;  1IQ5 A;  1K94 A;  5HLV A;  3SG7 A;  1AJ5 A;  1D1O A;  1KFX S;  4I5L B;  4FTG A;  2K7O A;  1CLM A;  2O60 A;  3BUO B;  5F6T A;  3VRO A;  3WXA A;  4ZCV A;  1YUT A;  4MEW A;  4OR9 B;  3HCM A;  1JSA A;  2GGZ A;  1XVJ A;  1ZAC A;  5TNC A;  1RWY A;  3C1V A;  5HLO A;  4PCW A;  1YUR A;  2CNP A;  2KNE A;  1Y0V H;  3M0W A;  1B8R A;  2E6W A;  1SRA A;  5DKQ A;  2O5G A;  1IKU A;  3TS5 B;  2F2P A;  2OPO A;  2H61 C;  2JRF A;  1KSO A;  1UHN A;  1F71 A;  1AVS A;  1S1E A;  1BJF A;  4YBH B;  3CWG A;  3F45 A;  1DF0 B;  4R1E A;  2BKI B;  1TNW A;  2RGI A;  1IQ3 A;  2KFF A;  4DRW A;  2KSP A;  2M49 B;  3JTD C;  4OKH A;  1MQ1 A;  2ZRS A;  4PE7 A;  1SYM A;  1NCZ A;  1B8L A;  2KFG A;  1SW8 A;  2ZN8 A;  3BUX B;  4MBE A;  1CB1 A;  2L98 A;  3O6B A;  1S3P A;  1CFP A;  1RK9 A;  2CXJ A;  1F55 A;  1DJW A;  2LLS A;  2KYF A;  2JWW A;  2G9B A;  1M45 A;  2NCP A;  1Y1U A;  4MZK A;  1HQV A;  1Y6W A;  4MZL A;  4MVF A;  4UPG A;  3EKH A;  3CGA A;  5AXI A;  2SCP A;  4YGA A;  5GQQ C;  1BLQ A;  1DJH A;  1U5I B;  1K90 D;  2L4I A;  4DCK A;  5CSN A;  3AAJ A;  4HRG A;  5KU1 A;  5KTY A;  2WND A;  1QTX A;  1L2O B;  4PDZ A;  1EJ3 A;  1LKJ A;  3FWB A;  1W7J B;  2M97 A;  1IWQ A;  1V1G A;  2LVJ A;  1SY9 A;  5AFP A;  1KSM A;  2MLE C;  1BF5 A;  1REC A;  1SPY A;  1ALV A;  5J3X A;  1ALW A;  4PE1 A;  3KPX A;  1XFY O;  2PSR A;  1KCY A;  2PMY A;  3I5F B;  3LK0 A;  1QX5 B;  4AQJ A;  1QIV A;  1C07 A;  4HRH A;  3LK1 A;  2NCO A;  1RFJ A;  2LVI A;  2JT0 A;  1M46 A;  1DF0 A;  1WY9 A;  2M7N A;  2JTT A;  3EVV A;  2Y5I A;  2I2R E;  2OS8 B;  4C0J A;  1QXP A;  1S36 A;  3CTN A;  1H4B A;  3BOW A;  4PAL A;  1XFW O;  2A4J A;  1B7T Z;  1B4C A;  2BCA A;  2SAS A;  1N0Y A;  1CLL A;  4C0K A;  3IQO A;  3SG6 A;  1OMV A;  4PE4 A;  1J7P A;  2MLF C;  4XJK B;  4N1F A;  3O2P A;  5CSI A;  3TZ1 A;  3GK2 A;  1SR6 C;  1UHK A;  3TUY C;  4OCI A;  1TCO B;  2GGM A;  1RJV A;  5HKW A;  1BU3 A;  2HET A;  1XO5 A;  1XFU O;  2ZND A;  3I5F C;  2CT9 A;  1F70 A;  1LA3 A;  4NDC A;  4QJ4 B;  1JF2 A;  1MUX A;  1NCY A;  1FF1 A;  4I5K A;  2KAY A;  1JFJ A;  1QLS A;  4PHK A;  3I5I C;  2JTZ A;  3WNX B;  1YTZ C;  3PLF B;  1KWO C;  2OS8 C;  2QAC A;  5ER4 X;  2M1U A;  4DIR A;  4USL A;  3IF7 A;  5JJG A;  1XK4 A;  3H4S E;  1PSB A;  1B8C A;  3RM1 A;  2M0R A;  1S6C A;  1B1G A;  1IJ6 A;  1NWD A;  1QJT A;  1S5G Z;  3BUN B;  3CR4 X;  1TIZ A;  1AJ4 A;  1PAL A;  2MA2 A;  5G08 A;  3JTD B;  2D8N A;  3KO0 A;  4DUQ A;  5JOL A;  1QV0 A;  1SKT A;  3CS1 A;  1S5G Y;  2JT8 A;  1KQM C;  3RLZ A;  4FQO A;  4JPZ B;  1NSH A;  1SMG A;  2Y1N A;  3VRQ A;  1DMO A;  1S6J A;  2F3Z A;  1TCF A;  1DJY A;  1HT9 A;  3LCP C;  2TN4 A;  4GGF A;  4DS7 A;  3BYA A;  3SIB A;  4F0Z B;  1CKK A;  2LVK A;  1XFX O;  2WCB A;  3BQ3 A;  2LP2 A;  1WRK A;  1SBJ A;  3PN7 B;  1EG4 A;  1DJX A;  4YI9 A;  3ZNI A;  4ICB A;  2LAP A;  2ZN9 A;  1CM1 A;  2JUL A;  3FWC A;  2KQ6 A;  1R2U A;  1NX3 A;  2FCE A;  2PAL A;  2KI6 C;  3OB2 B;  1KK7 Z;  3PM8 A;  2PAS A;  4JWQ A;  1E8A A;  1IJ5 A;  1KK8 C;  1UHJ A;  2LM5 A;  1YR5 A;  5HKY A;  2KI4 B;  5CPV A;  3WHU B;  1YRT B;  2L2E A;  3D10 A;  2F33 A;  2JQ6 A;  2KAX A;  1MXE A;  2E30 A;  1M31 A;  1CDN A;  1S26 D;  2FCD A;  1K9U A;  2H61 A;  1ZOT B;  3PAT A;  2AAO A;  1ZUZ A;  2M1K B;  1F8H A;  1IH0 A;  1J1D A;  4N5X A;  4MLW A;  4QJ5 B;  1YX8 A;  1SK6 D;  1QS7 A;  1UUR A;  2LC5 A;  2V53 A;  1JF0 A;  1AHR A;  1DGU A;  4ZCU A;  2M29 A;  2KGR A;  1CTR A;  2KI6 D;  2F3Y A;  4YGC B;  2LUX A;  4BY4 A;  3PN7 C;  4GGN A;  5IBW A;  1YUS A;  1QAS A;  3NSO A;  2BCX A;  3PSR A;  2B1U A;  1A03 A;  4CFQ A;  2K7D A;  1SR6 B;  1UUS A;  2ZKM X;  4I5N B;  4CLN A;  2M8U A;  3TUY B;  2Q4U A;  2FOT A;  1V1F A;  2KGB C;  5DKR A;  2ISD A;  1CNP A;  1EH2 A;  1SL8 A;  2WC8 A;  2KI4 C;  1DJG A;  1KQV A;  2JPT A;  2AUC A;  2JXC A;  3DVE A;  1NIW A;  1CMF A;  1F54 A;  5I2L A;  1DJI A;  5D69 A;  3VRN A;  1YVH A;  2ZFD A;  4M2P A;  4M2O A;  1F4Q A;  2BBM A;  2F8P A;  3KHE A;  3I5I B;  1TRF A;  4N1G A;  1GQM A;  2K2F A;  1DTL A;  1KWO B;  3GOF A;  1A4P A;  2L4H A;  3SJS A;  2LLT A;  3OHM B;  3OP0 A;  1M63 B;  2CTN A;  2EHB A;  2JZI A;  1SL9 A;  1ZFS A;  2I18 A;  2K0J A;  4PE0 A;  3DVM A;  2LHI A;  2K61 A;  3SG5 A;  3GK4 X;  1EXR A;  5KSZ A;  3D0Y B;  1B7T Y;  4NDB A;  4NQG A;  5CSJ A;  3DVK A;  2BBN A;  3DF0 B;  2DOQ A;  1ODB A;  2BE4 A;  5I2Q A;  1KQM B;  1J7R A;  2JU0 A;  2VRG A;  1X02 A;  2JT3 A;  1JFK A;  1U5I A;  4YGD B;  2GV5 A;  1YRU B;  2Q91 A;  3A4U B;  1OE9 B;  1TNP A;  3VRP A;  4YGB B;  2CCM A;  2LNK A;  2KBM A;  3VRR A;  1CM4 A;  1S6I A;  1SCM C;  3BXK A;  3I5G B;  3KEV A;  4ORB B;  3DVJ A;  3KF9 A;  3EK8 A;  1OMR A;  2LV7 A;  4ETO A;  1SCV A;  2NLN A;  1G33 A;  2WCF A;  4NDD A;  4MRY A;  5PAL A;  1XFZ O;  1B47 A;  2JC2 A;  2LUC A;  2ZRT A;  1FI6 A;  1N65 A;  2LMV A;  3AKB A;  4YGE B;  1KFU L;  3AAK A;  1KK8 B;  4ORA B;  3GK1 A;  1J55 A;  2HPS A;  3O78 A;  4P5O E;  1IG5 A;  1WLZ A;  3OB1 B;  1AK8 A;  2QPT A;  4HRE E;  1J7Q A;  3NSL A;  2EC6 C;  3EVR A;  1K93 D;  4QJ3 B;  1WLM A;  4HSZ A;  2Y1M A;  1OZO A;  2BKH B;  4OV2 A;  3QRX A;  1PSR A;  4BY5 A;  1AUI B;  3DD4 A;  3EK4 A;  1NX0 A;  1H8B A;  1UP5 A;  1CFC A;  1DVI A;  4ORC B;  1NUB A;  1A75 B;  1R6P A;  4XJK A;  1CDP A;  1WDC C;  1NX1 A;  1UHI A;  4WQ2 A;  1A29 A;  4P2Y B;  4MZJ A;  1Q80 A;  2MJW B;  2L51 A;  3DF0 A;  1FI5 A;  1QV1 A;  3I5G C;  1AP4 A;  1NP8 A;  4MN0 A;  4MSP A;  4YRU A;  5I8N A;  4A4B A;  4L9M A;  1OZS A;  1K9K A;  1CFF A;  3NSK A;  5B8I B;  1LIN A;  1YVL A;  1MXL C; 
#chains in the Genus database with same CATH topology
 5FYX A;  4INX A;  1JC2 A;  1GGW A;  4U8D A;  4E68 A;  2MAZ A;  3B87 A;  1JBA A;  1B9A A;  3OX6 A;  2JOJ A;  3UNW A;  3TDZ A;  1PRW A;  2COL B;  1PVB A;  3CR5 X;  1KK7 Y;  3BFB A;  3MSE B;  4AQI A;  1NCX A;  1DT7 B;  1C3Y A;  1FPW A;  3FIA A;  1NPQ A;  4M2Q A;  1CDL A;  4C0L A;  1PK0 D;  2OTG C;  2CBL A;  1UHH A;  2HQ8 A;  3I5H C;  1RRO A;  3CZT X;  5D7F A;  1QVI Z;  3R1P A;  1SL7 A;  1XA5 A;  3S0F A;  1PVA A;  4WQ3 A;  2NZ0 A;  2Y4Q A;  4PHM A;  1C3Z A;  2LHL A;  2KAV A;  3EVU A;  5ER5 A;  2HQW A;  3NHI A;  4OVN F;  1QVI Y;  1FBV A;  4XYN A;  2L50 A;  3BOW B;  1TNQ A;  3S0B A;  1GM0 A;  3JVT B;  2BEC A;  1TOP A;  1OOJ A;  2PRU A;  3AKA A;  1TTX A;  1IRJ A;  4PHN A;  1A75 A;  1IGV A;  3OX5 A;  3TDI A;  1JUO A;  1KFX L;  1J1E A;  4FQT A;  3SG4 A;  2MHH A;  2K7C A;  2IS9 A;  1CMG A;  3SS4 A;  1Y1A A;  3WHT B;  2H2K A;  2JNX A;  4WRI A;  1Y1X A;  2MBX A;  1RTP 1;  1QX7 A;  1BR1 B;  2BL0 B;  4JD9 A;  1W7I B;  3A8R A;  4TNC A;  2LP3 A;  1CDM A;  1SNL A;  2FJU B;  5AEQ A;  3BUM B;  2LE9 B;  2KDH A;  3TS5 C;  1CLB A;  2LMU A;  1LXF C;  1ZMZ A;  2M7L A;  1SCM B;  1WRZ A;  1OQP A;  1J7Q A;  1QIW A;  3NXA A;  4CID A;  1WRL A;  1MHO A;  1KFU S;  1F4O A;  1QAT A;  2F2O A;  1TUZ A;  1BG1 A;  1YX7 A;  1PUL A;  1A2X A;  3RZS A;  1M39 A;  3EKJ A;  2AMI A;  3PFV A;  4CPV A;  5K89 A;  1C7W A;  2WC6 A;  2WCE A;  3CR2 A;  1MF8 B;  3HX4 A;  3ICB A;  4JQ0 D;  3TDU A;  1BR4 B;  1G4Y R;  1YUU A;  3JVT C;  1OMD A;  3EK7 A;  1TN4 A;  1XFR A;  2KFH A;  1K95 A;  3PM2 A;  2KOT A;  2EC6 B;  5AAN A;  1OW4 A;  3ZWH A;  2ZNE A;  1GGZ A;  1N2D A;  1OSA A;  4YI8 A;  2G2B A;  1K2H A;  1BMO A;  4GFT A;  1SSE B;  2HF5 A;  1EL4 A;  1XYD A;  2I7A A;  2K7B A;  2KHN A;  4GBA A;  2KYC A;  2LLU A;  2BL0 C;  4INW A;  3VGO A;  4Q04 A;  1VRK A;  2I94 A;  1G8I A;  1P28 A;  1LA0 A;  1XFV O;  1J7O A;  4PHJ A;  1WDC B;  1BOD A;  2P71 A;  1K96 A;  1C7V A;  1EG3 A;  1L2O C;  2YGU A;  2KQY A;  3B86 A;  1NYA A;  2WOS A;  2P70 A;  1DEK A;  3K21 A;  3PAL A;  4GAO A;  5CSF A;  4A4C A;  2KPH A;  3S0D A;  2JNF A;  2JPO A;  2PQL A;  5BPJ A;  3SG3 A;  1QX2 A;  1GJY A;  4D1E A;  1MR8 A;  2M9G A;  2WOR A;  5HYD A;  1XK4 C;  2R2I A;  4MRX A;  1DGV A;  1TNX A;  2KLD A;  4GPL B;  5HKZ A;  3SS5 A;  3SIA A;  3OBV A;  1BOC A;  2PVB A;  2P6B B;  2L0P A;  3IQQ A;  1UWO A;  3E3R A;  3LL8 B;  4I5J A;  1CFD A;  1MWN A;  2EGD A;  3SG2 A;  2K8M B;  3O4Y A;  2LVV A;  2OTG B;  2ERB A;  3BUW B;  1BT6 A;  2BE6 A;  4CFR A;  3I5H B;  5I2O A;  2LAN A;  5DKN A;  2K2A A;  4AOM A;  1NX2 A;  3OGN A;  1K9P A;  1DJZ A;  2M3W A;  4IL1 A;  2MRD A;  3CLN A;  2JXL A;  2LCP A;  2NXQ A;  5AER A;  1FW4 A;  1QLK A;  2L5X B;  3D0Y A;  2BCB A;  4GUK A;  3S0E A;  1JWD A;  1K8U A;  4GGF C;  1L7Z A;  2KBI A;  3FS7 A;  4GNK B;  2KLE A;  1LVC D;  2LMT A;  3LLE A;  3NSI A;  1IQ5 A;  1K94 A;  3DYE A;  3L4A A;  5HLV A;  3SG7 A;  1AJ5 A;  2L2C A;  1D1O A;  1KFX S;  4I5L B;  4FTG A;  2K7O A;  2H8V A;  1CLM A;  2O60 A;  3BUO B;  5F6T A;  3VRO A;  3WXA A;  4ZCV A;  1YUT A;  4MEW A;  4OR9 B;  3HCM A;  5D3O A;  1OOI X;  1JSA A;  2GGZ A;  1XVJ A;  1ZAC A;  1ORG A;  2WCK A;  5TNC A;  1RWY A;  3C1V A;  5HLO A;  4PCW A;  1YUR A;  2CNP A;  3V2L A;  2KNE A;  1Y0V H;  3M0W A;  4F7F A;  1B8R A;  2E6W A;  4OZD A;  1SRA A;  5DKQ A;  2O5G A;  1IKU A;  3BFA A;  2F2P A;  2OPO A;  2H61 C;  3D78 A;  3TS5 B;  5EL2 A;  2JRF A;  3DZT A;  1KSO A;  1UHN A;  1F71 A;  1AVS A;  1S1E A;  1BJF A;  4YBH B;  3CWG A;  3F45 A;  1DF0 B;  4R1E A;  3R72 A;  2BKI B;  1TNW A;  2RGI A;  1IQ3 A;  2KFF A;  4DRW A;  2KSP A;  2M49 B;  3JTD C;  4OKH A;  1MQ1 A;  1QWV A;  2ZRS A;  4PE7 A;  1SYM A;  1NCZ A;  1B8L A;  2KFG A;  5DIC A;  1SW8 A;  2ZN8 A;  3BUX B;  4MBE A;  1CB1 A;  2L98 A;  3O6B A;  1S3P A;  1CFP A;  1RK9 A;  2CXJ A;  1F55 A;  1DJW A;  2LLS A;  2KYF A;  2JWW A;  2G9B A;  2WCM A;  1M45 A;  2NCP A;  1Y1U A;  3D74 A;  4MZK A;  3S0A A;  1HQV A;  1Y6W A;  4MZL A;  4MVF A;  4UPG A;  3CYZ A;  3EKH A;  3CGA A;  5AXI A;  2SCP A;  4YGA A;  5GQQ C;  1BLQ A;  1DJH A;  1U5I B;  1K90 D;  2L4I A;  4DCK A;  5CSN A;  3AAJ A;  4HRG A;  5KU1 A;  2QEO A;  5KTY A;  2WND A;  1QTX A;  1L2O B;  4PDZ A;  1EJ3 A;  1LKJ A;  3FWB A;  3QME A;  1W7J B;  2M97 A;  1IWQ A;  1V1G A;  2LVJ A;  2WCJ A;  1SY9 A;  5AFP A;  1KSM A;  2MLE C;  3D77 A;  5FI7 A;  1BF5 A;  3D76 A;  1REC A;  1SPY A;  1ALV A;  2BNX A;  5J3X A;  1ALW A;  4PE1 A;  3KPX A;  1XFY O;  2PSR A;  1KCY A;  2PMY A;  3I5F B;  3LK0 A;  1QX5 B;  4AQJ A;  1QIV A;  1DC1 A;  1C07 A;  4HRH A;  3LK1 A;  2NCO A;  1RFJ A;  2LVI A;  2JT0 A;  1M46 A;  1DF0 A;  1WY9 A;  2M7N A;  2JTT A;  3EVV A;  3N7H A;  2Y5I A;  2I2R E;  2OS8 B;  1TWO A;  4C0J A;  1QXP A;  1S36 A;  3CTN A;  1H4B A;  3BOW A;  1Z2C B;  4PAL A;  1XFW O;  2A4J A;  1B7T Z;  1B4C A;  2BCA A;  2SAS A;  1N0Y A;  1CLL A;  4C0K A;  3IQO A;  3SG6 A;  1OMV A;  4PE4 A;  1J7P A;  2MLF C;  4XJK B;  4N1F A;  3O2P A;  5CSI A;  3TZ1 A;  2WCL A;  1SR6 C;  3GK2 A;  2WC5 A;  1UHK A;  3TUY C;  4OCI A;  1TCO B;  3FE6 A;  2GGM A;  1RJV A;  5HKW A;  1BU3 A;  1OOH A;  3Q8I A;  2HET A;  1XO5 A;  1XFU O;  2ZND A;  3I5F C;  2CT9 A;  1F70 A;  1LA3 A;  4NDC A;  4QJ4 B;  1JF2 A;  1MUX A;  1NCY A;  3BFH A;  1FF1 A;  4I5K A;  2KAY A;  1JFJ A;  1QLS A;  4PHK A;  3I5I C;  2JTZ A;  3WNX B;  1YTZ C;  3PLF B;  1KWO C;  2OS8 C;  2QAC A;  5ER4 X;  2M1U A;  4DIR A;  4USL A;  3IF7 A;  5JJG A;  1XK4 A;  3H4S E;  1PSB A;  1B8C A;  5HL1 A;  2BAP A;  2M0R A;  1S6C A;  3RM1 A;  1B1G A;  1IJ6 A;  1NWD A;  1QJT A;  1S5G Z;  3BUN B;  3CR4 X;  1TIZ A;  1AJ4 A;  1PAL A;  2MA2 A;  3BJH A;  1OOG A;  3CDN A;  3JTD B;  2D8N A;  5FI6 A;  3KO0 A;  4DUQ A;  5JOL A;  1QV0 A;  1SKT A;  3CS1 A;  1S5G Y;  2JT8 A;  2K60 A;  1LS8 A;  3O4X A;  1KQM C;  3RLZ A;  4FQO A;  3L4L A;  4JPZ B;  1NSH A;  1SMG A;  2Y1N A;  3VRQ A;  1DMO A;  1S6J A;  2F3Z A;  1TCF A;  1DJY A;  1HT9 A;  3LCP C;  2TN4 A;  4GGF A;  4DS7 A;  3BYA A;  3SIB A;  4F0Z B;  1CKK A;  2LVK A;  2QDI A;  1XFX O;  2WCB A;  5G08 A;  3BQ3 A;  2LP2 A;  1WRK A;  2PYQ A;  1SBJ A;  3PN7 B;  1EG4 A;  1DJX A;  4YI9 A;  3ZNI A;  4ICB A;  2LAP A;  2ZN9 A;  1CM1 A;  2JUL A;  3FWC A;  3R1V A;  2KQ6 A;  3NGV A;  1R2U A;  1NX3 A;  2FCE A;  2PAL A;  2KI6 C;  3OB2 B;  1KK7 Z;  3DXL A;  2PAS A;  3PM8 A;  1E8A A;  4JWQ A;  1IJ5 A;  1KK8 C;  1UHJ A;  2LM5 A;  1YR5 A;  5HKY A;  2KI4 B;  5CPV A;  3WHU B;  1YRT B;  1IIO A;  2L2E A;  3D10 A;  2F33 A;  2JQ6 A;  2KAX A;  1MXE A;  2E30 A;  2L5Y A;  1M31 A;  1CDN A;  1S26 D;  2FCD A;  3FE8 A;  1K9U A;  2H61 A;  4KYN A;  1ZOT B;  3PAT A;  2AAO A;  1ZUZ A;  1TUJ A;  2M1K B;  5FI2 A;  1J1D A;  1F8H A;  4N5X A;  1IH0 A;  4MLW A;  4QJ5 B;  1YX8 A;  1SK6 D;  1QS7 A;  1UUR A;  2LC5 A;  2V53 A;  1JF0 A;  3UO9 A;  1AHR A;  1DGU A;  4ZCU A;  2M29 A;  2KGR A;  1CTR A;  2KI6 D;  2F3Y A;  4YGC B;  2LUX A;  4BY4 A;  3PN7 C;  4GGN A;  5IBW A;  1YUS A;  3B6X A;  1DEL A;  1QAS A;  3NSO A;  2BCX A;  3PSR A;  2B1U A;  1A03 A;  4IJ7 A;  4CFQ A;  2K7D A;  1SR6 B;  1UUS A;  2ZKM X;  4I5N B;  4CLN A;  2M8U A;  3TUY B;  2Q4U A;  2FOT A;  3R1O A;  1V1F A;  2KGB C;  3CZ2 A;  5DKR A;  2ISD A;  1CNP A;  1EH2 A;  1SL8 A;  2WC8 A;  2KI4 C;  1DJG A;  3D73 A;  1KQV A;  2JPT A;  2AUC A;  2JXC A;  3DVE A;  1NIW A;  1CMF A;  1F54 A;  5I2L A;  1DJI A;  3K1E A;  1OOF A;  5D69 A;  3VRN A;  1YVH A;  2ZFD A;  4M2P A;  4M2O A;  1F4Q A;  2BBM A;  2F8P A;  3KHE A;  3I5I B;  1TRF A;  4N1G A;  1GQM A;  2K2F A;  1DTL A;  1KWO B;  3GOF A;  3NHT A;  1A4P A;  2L4H A;  3SJS A;  3VB1 A;  2LLT A;  3OHM B;  3OP0 A;  1M63 B;  2CTN A;  2EHB A;  2JZI A;  1SL9 A;  1ZFS A;  2I18 A;  2QEH A;  4PT1 A;  2K0J A;  4PE0 A;  3DVM A;  2LHI A;  2K61 A;  3EG5 B;  3D75 A;  3GK4 X;  3SG5 A;  3IVT A;  1EXR A;  5KSZ A;  3D0Y B;  1B7T Y;  4NDB A;  4NQG A;  5CSJ A;  3DVK A;  3FE9 A;  2BBN A;  3DF0 B;  2DOQ A;  1ODB A;  2BE4 A;  5I2Q A;  1KQM B;  1J7R A;  3DY9 A;  2JU0 A;  2VRG A;  1X02 A;  2JT3 A;  3B88 A;  1JFK A;  1U5I A;  4YGD B;  3SS3 A;  2GV5 A;  1YRU B;  2Q91 A;  3A4U B;  3L47 A;  1OE9 B;  1TNP A;  3VRP A;  2QEB A;  4YGB B;  2CCM A;  2LNK A;  2KBM A;  3VRR A;  1CM4 A;  1S6I A;  1SCM C;  3BXK A;  3I5G B;  3KEV A;  4ORB B;  3DVJ A;  3KF9 A;  2WCH A;  3EK8 A;  3PJI A;  1OMR A;  2LV7 A;  4ETO A;  1SCV A;  2NLN A;  1G33 A;  2WCF A;  4NDD A;  4MRY A;  5PAL A;  1XFZ O;  1B47 A;  2JC2 A;  2LUC A;  2ZRT A;  1FI6 A;  1N65 A;  2LMV A;  3AKB A;  1DQE A;  1KFU L;  2FJY A;  4YGE B;  3AAK A;  1KK8 B;  4JKT A;  4ORA B;  3GK1 A;  1J55 A;  2HPS A;  3O78 A;  4P5O E;  1IG5 A;  1WLZ A;  3OB1 B;  1AK8 A;  2QPT A;  4HRE E;  5I94 A;  3NSL A;  2EC6 C;  3EVR A;  3CZ1 A;  1K93 D;  4QJ3 B;  1WLM A;  2GTE A;  4HSZ A;  2Y1M A;  1OZO A;  2BKH B;  4OV2 A;  3QRX A;  1PSR A;  4BY5 A;  1AUI B;  3DD4 A;  3EK4 A;  1NX0 A;  1H8B A;  1UP5 A;  3CZ0 A;  1CFC A;  1DVI A;  4ORC B;  1Z4H A;  1NUB A;  1A75 B;  1R6P A;  4XJK A;  1CDP A;  1WDC C;  2QEV A;  1NX1 A;  1UHI A;  4WQ2 A;  1A29 A;  4P2Y B;  1W9Z A;  4MZJ A;  1Q80 A;  3S0G A;  2MJW B;  2L51 A;  3CAB A;  3DF0 A;  1FI5 A;  1QV1 A;  3I5G C;  1AP4 A;  1NP8 A;  1T14 A;  4MN0 A;  4MSP A;  4YRU A;  5I8N A;  4A4B A;  4L9M A;  1OZS A;  1K9K A;  1CFF A;  3B7A A;  3NSK A;  5B8I B;  1LIN A;  1YVL A;  1MXL C; 
#chains in the Genus database with same CATH homology
 5FYX A;  1JC2 A;  1GGW A;  4U8D A;  4E68 A;  2MAZ A;  1JBA A;  1B9A A;  3OX6 A;  2JOJ A;  3TDZ A;  1PRW A;  2COL B;  1PVB A;  3CR5 X;  1KK7 Y;  3MSE B;  4AQI A;  1FPW A;  1NCX A;  1DT7 B;  3FIA A;  1NPQ A;  4M2Q A;  1CDL A;  4C0L A;  1PK0 D;  2OTG C;  2CBL A;  1UHH A;  2HQ8 A;  3I5H C;  1RRO A;  3CZT X;  5D7F A;  1QVI Z;  1SL7 A;  1XA5 A;  1PVA A;  4WQ3 A;  2NZ0 A;  2Y4Q A;  4PHM A;  2LHL A;  2KAV A;  3EVU A;  5ER5 A;  2HQW A;  4OVN F;  1QVI Y;  1FBV A;  4XYN A;  2L50 A;  3BOW B;  1TNQ A;  3JVT B;  2BEC A;  1TOP A;  1OOJ A;  2PRU A;  3AKA A;  1TTX A;  1IRJ A;  4PHN A;  1A75 A;  1IGV A;  3OX5 A;  3TDI A;  1JUO A;  1KFX L;  1J1E A;  3SG4 A;  2MHH A;  2K7C A;  2IS9 A;  1CMG A;  1Y1A A;  3WHT B;  2H2K A;  2JNX A;  4WRI A;  1Y1X A;  2MBX A;  1RTP 1;  1QX7 A;  1BR1 B;  2BL0 B;  1W7I B;  3A8R A;  4TNC A;  2LP3 A;  1CDM A;  1SNL A;  2FJU B;  5AEQ A;  3BUM B;  2LE9 B;  2KDH A;  3TS5 C;  1CLB A;  2LMU A;  1LXF C;  1ZMZ A;  2M7L A;  1SCM B;  1WRZ A;  1OQP A;  1QIW A;  3NXA A;  4CID A;  1WRL A;  1MHO A;  1KFU S;  1F4O A;  1QAT A;  2F2O A;  1BG1 A;  1YX7 A;  1PUL A;  1A2X A;  1M39 A;  3EKJ A;  2AMI A;  3PFV A;  4CPV A;  5K89 A;  1C7W A;  2WCE A;  3CR2 A;  1MF8 B;  3HX4 A;  3ICB A;  4JQ0 D;  3TDU A;  1BR4 B;  1G4Y R;  1YUU A;  3JVT C;  1OMD A;  3EK7 A;  1TN4 A;  2KFH A;  1K95 A;  2KOT A;  2EC6 B;  5AAN A;  3ZWH A;  2ZNE A;  1GGZ A;  1N2D A;  1OSA A;  4YI8 A;  2G2B A;  1K2H A;  1BMO A;  4GFT A;  2K7B A;  2HF5 A;  1EL4 A;  1XYD A;  2I7A A;  4GBA A;  2KHN A;  2KYC A;  2LLU A;  2BL0 C;  3VGO A;  4Q04 A;  1VRK A;  2I94 A;  1G8I A;  1XFV O;  1LA0 A;  1J7O A;  4PHJ A;  1WDC B;  1BOD A;  1K96 A;  1C7V A;  1EG3 A;  1L2O C;  3PAL A;  2KQY A;  3K21 A;  1NYA A;  2WOS A;  4GAO A;  5CSF A;  4A4C A;  2JNF A;  5BPJ A;  3SG3 A;  1QX2 A;  1GJY A;  4D1E A;  1MR8 A;  2M9G A;  2WOR A;  5HYD A;  1XK4 C;  2R2I A;  4MRX A;  1DGV A;  1TNX A;  5HKZ A;  4GPL B;  1BOC A;  3SIA A;  2PVB A;  2P6B B;  2L0P A;  3IQQ A;  1UWO A;  3E3R A;  3LL8 B;  4I5J A;  1CFD A;  1MWN A;  2EGD A;  3SG2 A;  2K8M B;  3O4Y A;  2LVV A;  2OTG B;  3BUW B;  1BT6 A;  2BE6 A;  4CFR A;  3I5H B;  5I2O A;  2LAN A;  5DKN A;  2K2A A;  4AOM A;  1NX2 A;  1K9P A;  1DJZ A;  2M3W A;  4IL1 A;  2MRD A;  3CLN A;  2JXL A;  2LCP A;  2NXQ A;  5AER A;  1FW4 A;  1QLK A;  2L5X B;  3D0Y A;  2BCB A;  4GUK A;  1JWD A;  1K8U A;  4GGF C;  1L7Z A;  2KBI A;  3FS7 A;  4GNK B;  1LVC D;  2LMT A;  3LLE A;  3NSI A;  1IQ5 A;  1K94 A;  5HLV A;  3SG7 A;  1AJ5 A;  1D1O A;  1KFX S;  4I5L B;  4FTG A;  2K7O A;  1CLM A;  2O60 A;  3BUO B;  5F6T A;  3VRO A;  3WXA A;  4ZCV A;  1YUT A;  4MEW A;  4OR9 B;  3HCM A;  1JSA A;  2GGZ A;  1XVJ A;  1ZAC A;  5TNC A;  1RWY A;  3C1V A;  5HLO A;  4PCW A;  1YUR A;  2CNP A;  2KNE A;  1Y0V H;  3M0W A;  1B8R A;  2E6W A;  1SRA A;  5DKQ A;  2O5G A;  1IKU A;  3TS5 B;  2F2P A;  2OPO A;  2H61 C;  2JRF A;  1KSO A;  1UHN A;  1F71 A;  1AVS A;  1S1E A;  1BJF A;  4YBH B;  3CWG A;  3F45 A;  1DF0 B;  4R1E A;  2BKI B;  1TNW A;  2RGI A;  1IQ3 A;  2KFF A;  4DRW A;  2KSP A;  2M49 B;  3JTD C;  4OKH A;  1MQ1 A;  2ZRS A;  4PE7 A;  1SYM A;  1NCZ A;  1B8L A;  2KFG A;  1SW8 A;  2ZN8 A;  3BUX B;  4MBE A;  1CB1 A;  2L98 A;  3O6B A;  1S3P A;  1CFP A;  1RK9 A;  2CXJ A;  1F55 A;  1DJW A;  2LLS A;  2KYF A;  2JWW A;  2G9B A;  1M45 A;  2NCP A;  1Y1U A;  4MZK A;  1HQV A;  1Y6W A;  4MZL A;  4MVF A;  4UPG A;  3EKH A;  3CGA A;  5AXI A;  2SCP A;  4YGA A;  5GQQ C;  1BLQ A;  1DJH A;  1U5I B;  1K90 D;  2L4I A;  4DCK A;  5CSN A;  3AAJ A;  4HRG A;  5KU1 A;  5KTY A;  2WND A;  1QTX A;  1L2O B;  4PDZ A;  1EJ3 A;  1LKJ A;  3FWB A;  1W7J B;  2M97 A;  1IWQ A;  1V1G A;  2LVJ A;  1SY9 A;  5AFP A;  1KSM A;  2MLE C;  1BF5 A;  1REC A;  1SPY A;  1ALV A;  5J3X A;  1ALW A;  4PE1 A;  3KPX A;  1XFY O;  2PSR A;  1KCY A;  2PMY A;  3I5F B;  3LK0 A;  1QX5 B;  4AQJ A;  1QIV A;  1C07 A;  4HRH A;  3LK1 A;  2NCO A;  1RFJ A;  2LVI A;  2JT0 A;  1M46 A;  1DF0 A;  1WY9 A;  2M7N A;  2JTT A;  3EVV A;  2Y5I A;  2I2R E;  2OS8 B;  4C0J A;  1QXP A;  1S36 A;  3CTN A;  1H4B A;  3BOW A;  4PAL A;  1XFW O;  2A4J A;  1B7T Z;  1B4C A;  2BCA A;  2SAS A;  1N0Y A;  1CLL A;  4C0K A;  3IQO A;  3SG6 A;  1OMV A;  4PE4 A;  1J7P A;  2MLF C;  4XJK B;  4N1F A;  3O2P A;  5CSI A;  3TZ1 A;  3GK2 A;  1SR6 C;  1UHK A;  3TUY C;  4OCI A;  1TCO B;  2GGM A;  1RJV A;  5HKW A;  1BU3 A;  2HET A;  1XO5 A;  1XFU O;  2ZND A;  3I5F C;  2CT9 A;  1F70 A;  1LA3 A;  4NDC A;  4QJ4 B;  1JF2 A;  1MUX A;  1NCY A;  1FF1 A;  4I5K A;  2KAY A;  1JFJ A;  1QLS A;  4PHK A;  3I5I C;  2JTZ A;  3WNX B;  1YTZ C;  3PLF B;  1KWO C;  2OS8 C;  2QAC A;  5ER4 X;  2M1U A;  4DIR A;  4USL A;  3IF7 A;  5JJG A;  1XK4 A;  3H4S E;  1PSB A;  1B8C A;  3RM1 A;  2M0R A;  1S6C A;  1B1G A;  1IJ6 A;  1NWD A;  1QJT A;  1S5G Z;  3BUN B;  3CR4 X;  1TIZ A;  1AJ4 A;  1PAL A;  2MA2 A;  5G08 A;  3JTD B;  2D8N A;  3KO0 A;  4DUQ A;  5JOL A;  1QV0 A;  1SKT A;  3CS1 A;  1S5G Y;  2JT8 A;  1KQM C;  3RLZ A;  4FQO A;  4JPZ B;  1NSH A;  1SMG A;  2Y1N A;  3VRQ A;  1DMO A;  1S6J A;  2F3Z A;  1TCF A;  1DJY A;  1HT9 A;  3LCP C;  2TN4 A;  4GGF A;  4DS7 A;  3BYA A;  3SIB A;  4F0Z B;  1CKK A;  2LVK A;  1XFX O;  2WCB A;  3BQ3 A;  2LP2 A;  1WRK A;  1SBJ A;  3PN7 B;  1EG4 A;  1DJX A;  4YI9 A;  3ZNI A;  4ICB A;  2LAP A;  2ZN9 A;  1CM1 A;  2JUL A;  3FWC A;  2KQ6 A;  1R2U A;  1NX3 A;  2FCE A;  2PAL A;  2KI6 C;  3OB2 B;  1KK7 Z;  3PM8 A;  2PAS A;  4JWQ A;  1E8A A;  1IJ5 A;  1KK8 C;  1UHJ A;  2LM5 A;  1YR5 A;  5HKY A;  2KI4 B;  5CPV A;  3WHU B;  1YRT B;  2L2E A;  3D10 A;  2F33 A;  2JQ6 A;  2KAX A;  1MXE A;  2E30 A;  1M31 A;  1CDN A;  1S26 D;  2FCD A;  1K9U A;  2H61 A;  1ZOT B;  3PAT A;  2AAO A;  1ZUZ A;  2M1K B;  1F8H A;  1IH0 A;  1J1D A;  4N5X A;  4MLW A;  4QJ5 B;  1YX8 A;  1SK6 D;  1QS7 A;  1UUR A;  2LC5 A;  2V53 A;  1JF0 A;  1AHR A;  1DGU A;  4ZCU A;  2M29 A;  2KGR A;  1CTR A;  2KI6 D;  2F3Y A;  4YGC B;  2LUX A;  4BY4 A;  3PN7 C;  4GGN A;  5IBW A;  1YUS A;  1QAS A;  3NSO A;  2BCX A;  3PSR A;  2B1U A;  1A03 A;  4CFQ A;  2K7D A;  1SR6 B;  1UUS A;  2ZKM X;  4I5N B;  4CLN A;  2M8U A;  3TUY B;  2Q4U A;  2FOT A;  1V1F A;  2KGB C;  5DKR A;  2ISD A;  1CNP A;  1EH2 A;  1SL8 A;  2WC8 A;  2KI4 C;  1DJG A;  1KQV A;  2JPT A;  2AUC A;  2JXC A;  3DVE A;  1NIW A;  1CMF A;  1F54 A;  5I2L A;  1DJI A;  5D69 A;  3VRN A;  1YVH A;  2ZFD A;  4M2P A;  4M2O A;  1F4Q A;  2BBM A;  2F8P A;  3KHE A;  3I5I B;  1TRF A;  4N1G A;  1GQM A;  2K2F A;  1DTL A;  1KWO B;  3GOF A;  1A4P A;  2L4H A;  3SJS A;  2LLT A;  3OHM B;  3OP0 A;  1M63 B;  2CTN A;  2EHB A;  2JZI A;  1SL9 A;  1ZFS A;  2I18 A;  2K0J A;  4PE0 A;  3DVM A;  2LHI A;  2K61 A;  3SG5 A;  3GK4 X;  1EXR A;  5KSZ A;  3D0Y B;  1B7T Y;  4NDB A;  4NQG A;  5CSJ A;  3DVK A;  2BBN A;  3DF0 B;  2DOQ A;  1ODB A;  2BE4 A;  5I2Q A;  1KQM B;  1J7R A;  2JU0 A;  2VRG A;  1X02 A;  2JT3 A;  1JFK A;  1U5I A;  4YGD B;  2GV5 A;  1YRU B;  2Q91 A;  3A4U B;  1OE9 B;  1TNP A;  3VRP A;  4YGB B;  2CCM A;  2LNK A;  2KBM A;  3VRR A;  1CM4 A;  1S6I A;  1SCM C;  3BXK A;  3I5G B;  3KEV A;  4ORB B;  3DVJ A;  3KF9 A;  3EK8 A;  1OMR A;  2LV7 A;  4ETO A;  1SCV A;  2NLN A;  1G33 A;  2WCF A;  4NDD A;  4MRY A;  5PAL A;  1XFZ O;  1B47 A;  2JC2 A;  2LUC A;  2ZRT A;  1FI6 A;  1N65 A;  2LMV A;  3AKB A;  4YGE B;  1KFU L;  3AAK A;  1KK8 B;  4ORA B;  3GK1 A;  1J55 A;  2HPS A;  3O78 A;  4P5O E;  1IG5 A;  1WLZ A;  3OB1 B;  1AK8 A;  2QPT A;  4HRE E;  1J7Q A;  3NSL A;  2EC6 C;  3EVR A;  1K93 D;  4QJ3 B;  1WLM A;  4HSZ A;  2Y1M A;  1OZO A;  2BKH B;  4OV2 A;  3QRX A;  1PSR A;  4BY5 A;  1AUI B;  3DD4 A;  3EK4 A;  1NX0 A;  1H8B A;  1UP5 A;  1CFC A;  1DVI A;  4ORC B;  1NUB A;  1A75 B;  1R6P A;  4XJK A;  1CDP A;  1WDC C;  1NX1 A;  1UHI A;  4WQ2 A;  1A29 A;  4P2Y B;  4MZJ A;  1Q80 A;  2MJW B;  2L51 A;  3DF0 A;  1FI5 A;  1QV1 A;  3I5G C;  1AP4 A;  1NP8 A;  4MN0 A;  4MSP A;  4YRU A;  5I8N A;  4A4B A;  4L9M A;  1OZS A;  1K9K A;  1CFF A;  3NSK A;  5B8I B;  1LIN A;  1YVL A;  1MXL C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...