5DKQA

Crystal structure of calcium-loaded s100b bound to sbi4214
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
91
structure length
91
Chain Sequence
MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFFEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-B
publication title Small Molecule Inhibitors of Ca(2+)-S100B Reveal Two Protein Conformations.
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein/inhibitor
total genus 31
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2015-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5dkqA00
2OS8B 3EVUA 2NXQA 1KFUL 2LVVA 5D7FA 3CS1A 2WC8A 4MZJA 1YX7A 2KI4C 2JC2A 4YBHB 4MZKA 1TNQA 2KI6C 1M31A 2F2PA 5JOLA 1WDCC 3DVMA 2LE9B 1JUOA 1YUTA 1F71A 1DF0A 1QASA 1SNLA 1S5GY 4PHKA 1S6JA 3VROA 1BOCA 1SK6D 1QTXA 1TIZA 3A4UB 3CR5X 2LHIA 1QX5B 1YURA 3TS5B 2MRDA 4IL1A 3I5FC 4JQ0D 4OR9B 2BE6A 5AERA 1B7TZ 1KQVA 1B9AA 2O60A 1MF8B 4YGBB 1A75A 1FI6A 4N5XA 1YUUA 2KGBC 2GGZA 1RK9A 3AAKA 1PVAA 4MBEA 1DGUA 1RFJA 1XFZO 3FIAA 2JULA 2O5GA 4M2QA 2M3WA 2K0JA 1XFVO 3VRPA 1L7ZA 4ICBA 4USLA 1BR1B 1K93D 1QV1A 1IGVA 1XK4C 2K2AA 1AP4A 5GQQC 1B7TY 5I2QA 3KEVA 2K7CA 2BCAA 1JWDA 2VRGA 1A29A 2Y4QA 2K7BA 4MVFA 2Q4UA 3O6BA 1JF2A 2M1KB 2M0RA 1TNPA 3FS7A 5AEQA 1SCMC 2WCFA 4MEWA 1F55A 1J55A 2HQ8A 4MLWA 3EKJA 4QJ3B 1CDMA 4YGEB 1ALWA 2CT9A 4ZCVA 3JTDC 1D1OA 1F54A 3BYAA 3DVEA 1K95A 1PSBA 1CDPA 1EL4A 2JT0A 1UHJA 4I5JA 3SG2A 1W7JB 3SIBA 4GBAA 1B4CA 1IWQA 1DJWA 2LVJA 1QS7A 3I5IC 3AKAA 1EG4A 1LKJA 5AXIA 1SPYA 2KAXA 2Y1MA 4BY4A 1CFPA 1AJ5A 1LA3A 3CTNA 4GNKB 1G4YR 2JRFA 2L50A 2LANA 4AQJA 2LCPA 2ZKMX 2M1UA 1K2HA 1WRKA 1L2OC 1S6CA 2BL0B 3F45A 3KF9A 3LLEA 1ZMZA 5KTYA 1XK4A 1OMDA 1WLMA 2FOTA 1C07A 2BKIB 3D0YA 5I2OA 2K8MB 4WRIA 1XO5A 1IKUA 1XFXO 1NX2A 1QVIZ 1G33A 2COLB 5I2LA 1S3PA 5KU1A 4OCIA 4XYNA 4R1EA 2LHLA 2PSRA 3PSRA 3SG3A 4ORAB 1CB1A 1NX3A 1ZOTB 1J1EA 1SCVA 1QXPA 5AANA 3CLNA 4DIRA 3EVRA 2LUCA 1XFYO 1AUIB 3LK1A 2M7NA 3BOWB 1CLLA 1S26D 2JTZA 1LA0A 2AUCA 2MJWB 1CM1A 5JJGA 4HREE 1QIWA 2LVKA 2LMTA 1OQPA 1DVIA 3NXAA 2R2IA 1CDNA 2LLTA 2OTGB 2FCEA 3CR2A 1S36A 1M63B 5IBWA 1KK8B 1IJ5A 2MBXA 2SASA 1DJHA 3BUXB 2F8PA 5I8NA 2L4IA 5DKRA 1DT7B 1BODA 1M45A 1GJYA 1YRTB 4GGFC 1GGWA 1DMOA 1LVCD 3IF7A 1CTRA 1KWOC 2MLFC 1KQMB 1YTZC 2ISDA 5HKYA 2KQ6A 1J7OA 2JPTA 5B8IB 1NSHA 3I5GB 1GQMA 2KFFA 5ER4X 1PVBA 2HQWA 5KSZA 1KFXL 2KBMA 3GK4X 1MXLC 3I5HB 1PULA 3OX5A 1NWDA 1TTXA 2RGIA 2OPOA 1AHRA 1BR4B 1HT9A 1K9PA 1Y1AA 2CCMA 2OS8C 2KNEA 2L5XB 2NLNA 1NCYA 1QLSA 4HRHA 2KAYA 5PALA 2AAOA 1J7PA 3SG5A 1GGZA 2F2OA 3FWBA 4OV2A 3KO0A 1KFXS 2GV5A 1RTP1 3EKHA 4YGDB 2WCBA 1PSRA 1TNXA 1R2UA 4JWQA 4I5NB 3JVTB 4U8DA 5D69A 1DJXA 1Y0VH 2G2BA 3TDZA 2CNPA 3KPXA 1DGVA 1B8LA 2M8UA 1A2XA 1F4QA 2PASA 2H61C 3K21A 4PHJA 4GUKA 3TS5C 3ICBA 1SW8A 4M2PA 5K89A 2ZRTA 1Y6WA 1KK7Z 1G8IA 3DD4A 4C0LA 2K7DA 1HQVA 2QPTA 1OOJA 4GAOA 4PHMA 3DF0A 1CFDA 1Q80A 3CWGA 1J7QA 1K94A 1Y1UA 4N1GA 2JTTA 2MAZA 2LMVA 2D8NA 3MSEB 4PHNA 1EXRA 2NCOA 1M46A 1YUSA 2LAPA 1IQ5A 4XJKA 3A8RA 3BUMB 4NDCA 1SRAA 1MUXA 5DKNA 2Q91A 2WORA 2JT3A 1KK7Y 1V1FA 2B1UA 4GGNA 5F6TA 1JSAA 1IH0A 1S6IA 3HX4A 1EH2A 4FTGA 2Y5IA 1MQ1A 4OVNF 1K96A 4MRXA 1JFKA 1NYAA 2I7AA 1YVLA 1EG3A 5CSFA 3DVKA 4A4BA 2F3YA 5CSNA 4L9MA 3ZNIA 2M29A 1K8UA 1QLKA 4YI9A 2H61A 2QACA 1AK8A 2L0PA 2WOSA 2ZRSA 3EK8A 1SL7A 2M7LA 2HETA 1KSMA 1UUSA 1H8BA 3H4SE 2ZN9A 1SBJA 1YVHA 3EVVA 2L51A 5DKQA 5HKZA 1SMGA 2M49B 4ZCUA 1DF0B 1IJ6A 1FF1A 3BUWB 1QIVA 3PN7B 2AMIA 4YGAA 4C0JA 4NQGA 2FCDA 4YRUA 5BPJA 1IRJA 1ZACA 2P6BB 1CFCA 4F0ZB 1KCYA 3VGOA 2KYCA 2BL0C 1YR5A 2MHHA 1B1GA 1C7VA 1SL8A 1X02A 2BBNA 2IS9A 3TUYB 2JT8A 1CMGA 1WRZA 2CXJA 2JZIA 3O78A 1A75B 1OMVA 2LC5A 1FI5A 4UPGA 2LLUA 3M0WA 2K2FA 3PATA 2ZN8A 3NSKA 4GPLB 4DUQA 2L2EA 3RLZA 4PE0A 1QV0A 4A4CA 3NSLA 2KDHA 4N1FA 2LNKA 1TN4A 3OB1B 4GFTA 5CSJA 1NUBA 1UWOA 1ZUZA 3PM8A 1J7RA 3PN7C 3SJSA 1EJ3A 5ER5A 1YRUB 2FJUB 2K61A 1OSAA 2A4JA 2L4HA 4MZLA 1NIWA 1QX7A 2MA2A 2PVBA 2LMUA 1CM4A 1NX1A 1QJTA 2KI4B 4YGCB 2PRUA 1B47A 1SL9A 1CLBA 4E68A 1BLQA 1PRWA 4NDBA 1CNPA 1LINA 1WDCB 1NP8A 3AAJA 1BF5A 2F3ZA 3E3RA 1V1GA 2CBLA 3PALA 1H4BA 1OE9B 1BG1A 3TDIA 1NPQA 2JU0A 1UHHA 2OTGC 3WHUB 4BY5A 2E30A 4JPZB 3SIAA 5CPVA 1KK8C 3CGAA 3SG4A 2KSPA 3I5FB 4DS7A 5TNCA 1OMRA 1SR6B 3RM1A 1RROA 2NCPA 2LP3A 2JNFA 2M9GA 1CMFA 1SY9A 3WXAA 4PE1A 2HF5A 4P2YB 2DOQA 1KSOA 1MWNA 2KBIA 1RWYA 3SG6A 3CR4X 3CZTX 2JQ6A 2K7OA 1AVSA 1KQMC 4FQOA 4YI8A 3VRQA 2WNDA 2I2RE 3IQOA 3D0YB 1IG5A 3NSOA 3I5GC 1UURA 1W7IB 1KFUS 1F70A 2I94A 4GGFA 2LP2A 2JXLA 2WCEA 4P5OE 5CSIA 1JF0A 3BOWA 3VRNA 3I5HC 1SR6C 2HPSA 3PFVA 1U5IA 2H2KA 2KFHA 4HRGA 1CFFA 1SCMB 3NSIA 4D1EA 2GGMA 2LV7A 3D10A 4HSZA 1YX8A 1WLZA 1AJ4A 2Y1NA 1DJZA 2JOJA 1WRLA 1N2DA 4CIDA 3ZWHA 3JTDB 2JXCA 4MRYA 1WY9A 5AFPA 1E8AA 3BUOB 4QJ5B 1PK0D 5HYDA 1UP5A 2L98A 3GOFA 4ORBB 2E6WA 3LL8B 1CLMA 1UHNA 2G9BA 3I5IB 3JVTC 4CLNA 1TOPA 2KOTA 5HKWA 1MXEA 1B8CA 2CTNA 1F8HA 1R6PA 4NDDA 2SCPA 2KGRA 1MHOA 2BE4A 2EC6B 4WQ3A 1L2OB 1N65A 1QATA 3OHMB 4WQ2A 3TDUA 1ODBA 2JNXA 1CDLA 3OP0A 4AQIA 4QJ4B 1LXFC 4OKHA 1UHKA 4AOMA 4C0KA 1PALA 4CFQA 1A03A 1CKKA 4PE7A 3SG7A 5J3XA 3WHTB 3DVJA 3HCMA 1A4PA 2PALA 3C1VA 1JBAA 1QX2A 2V53A 3GK1A 1MR8A 1TRFA 2KHNA 2M97A 5FYXA 1DTLA 1XA5A 2BCBA 1TCFA 2I18A 2BCXA 2LUXA 5G08A 1FPWA 1F4OA 2JWWA 1FW4A 1UHIA 5HLVA 2EC6C 3IQQA 3EK4A 2BKHB 1BJFA 1IQ3A 4PALA 2MLEC 4Q04A 4PDZA 1RECA 1XFUO 2LM5A 4I5KA 2KAVA 3OX6A 1DJGA 3O2PA 4MN0A 2ZFDA 3QRXA 1Y1XA 1M39A 2NZ0A 1JFJA 3KHEA 1BU3A 2TN4A 3TZ1A 3O4YA 1SKTA 2KYFA 1JC2A 4M2OA 2KQYA 2KI6D 2ZNDA 3BUNB 1B8RA 2LLSA 5HLOA 1S1EA 4I5LB 1ALVA 1XYDA 4TNCA 1NX0A 2BBMA 3FWCA 4PCWA 1BMOA 1RJVA 4MSPA 2EHBA 1NCZA 1C7WA 1N0YA 1QVIY 1KWOB 1K9KA 4CFRA 1TNWA 3WNXB 1U5IB 1XFWO 2ZNEA 1VRKA 1OZSA 1TCOB 1XVJA 3TUYC 1DJIA 3OB2B 1J1DA 3BQ3A 1OZOA 2BECA 1BT6A 2PMYA 1K9UA 4ORCB 4ETOA 2F33A 1FBVA 3LK0A 3LCPC 3PLFB 3DF0B 4CPVA 2KFGA 3EK7A 4PE4A 3VRRA 1K90D 3AKBA 4DRWA 3GK2A 1SYMA 2EGDA 1NCXA 1ZFSA 1S5GZ 4DCKA 2LVIA 3BXKA 1DJYA 4XJKB
chains in the Genus database with same CATH superfamily
2OS8B 3EVUA 2NXQA 1KFUL 2LVVA 5D7FA 3CYZA 3CS1A 3CZ0A 2WC8A 4MZJA 1YX7A 2KI4C 2JC2A 1LS8A 4YBHB 4MZKA 1TNQA 2KI6C 1M31A 2F2PA 5JOLA 1WDCC 3DVMA 2LE9B 1JUOA 1YUTA 1F71A 1DF0A 1QASA 1SNLA 1S5GY 4PHKA 1S6JA 3VROA 1BOCA 1SK6D 1QTXA 1TIZA 3A4UB 3CR5X 2LHIA 4OZDA 1QX5B 1YURA 3TS5B 2MRDA 4IL1A 3I5FC 3CABA 4JQ0D 2BE6A 4OR9B 1TUJA 3SS5A 1B7TZ 5AERA 1KQVA 1B9AA 2O60A 1MF8B 4YGBB 1A75A 1FI6A 1T14A 4N5XA 2JPOA 1YUUA 2KGBC 2GGZA 1RK9A 3AAKA 1PVAA 4MBEA 1DGUA 1RFJA 1XFZO 3FIAA 2JULA 2O5GA 3D77A 4M2QA 1C3YA 2M3WA 2K0JA 1XFVO 3VRPA 3PM2A 1L7ZA 4ICBA 4USLA 1BR1B 1K93D 1QV1A 1IGVA 1XK4C 2H8VA 2K2AA 2WCKA 1AP4A 5GQQC 1B7TY 5I2QA 3KEVA 2K7CA 2BCAA 1JWDA 2VRGA 3BFHA 1A29A 2Y4QA 2K7BA 4MVFA 2Q4UA 3O6BA 1JF2A 3B6XA 2M1KB 3D73A 1C3ZA 1TNPA 2M0RA 3CZ2A 3FS7A 2WCMA 5AEQA 1SCMC 2WCFA 4MEWA 1F55A 1J55A 2HQ8A 4MLWA 3EKJA 4QJ3B 1CDMA 4YGEB 1ALWA 2CT9A 4ZCVA 3JTDC 1D1OA 1F54A 3BYAA 2PYQA 3DVEA 1K95A 1PSBA 1CDPA 5DICA 2FJYA 1EL4A 2JT0A 1UHJA 4FQTA 4I5JA 1W7JB 3SG2A 2WC5A 4GBAA 4JD9A 3SIBA 3D74A 1B4CA 1IWQA 1DJWA 1XFRA 2LVJA 1QS7A 3I5IC 3AKAA 3S0BA 1EG4A 1LKJA 5AXIA 1SPYA 2KAXA 2Y1MA 4BY4A 1CFPA 1AJ5A 1LA3A 3CTNA 4GNKB 1G4YR 2JRFA 2L50A 2LANA 4AQJA 2LCPA 2ZKMX 2M1UA 1K2HA 1WRKA 1L2OC 1S6CA 2BL0B 2KLDA 3F45A 3B86A 3KF9A 3LLEA 1ZMZA 2QEBA 5KTYA 1XK4A 1OMDA 1WLMA 2FOTA 3S0DA 3S0AA 1C07A 2BKIB 3D0YA 5I2OA 2K8MB 4WRIA 1XO5A 3R1VA 1XFXO 1NX2A 1IKUA 1QVIZ 1G33A 2COLB 5I2LA 1S3PA 5KU1A 4OCIA 4XYNA 4R1EA 2LHLA 5FI2A 1Z2CB 2PSRA 3PSRA 3SG3A 4ORAB 1CB1A 1NX3A 1ZOTB 1J1EA 1GM0A 1SCVA 1QXPA 5AANA 3CLNA 4DIRA 1SSEB 3S0EA 3EVRA 3D78A 2LUCA 1XFYO 1AUIB 3LK1A 2QEOA 2M7NA 3BOWB 1CLLA 1S26D 2JTZA 1LA0A 2AUCA 2MJWB 1CM1A 5JJGA 4HREE 1QIWA 2LVKA 2LMTA 1OQPA 1DVIA 3NXAA 2R2IA 1CDNA 2LLTA 2OTGB 2FCEA 3CR2A 1S36A 2BAPA 1M63B 3DXLA 5IBWA 1KK8B 1IJ5A 2MBXA 2SASA 1DJHA 3DY9A 3BUXB 2F8PA 5I8NA 3D76A 2L4IA 5DKRA 1DT7B 1BODA 5FI7A 1M45A 1GJYA 1YRTB 4GGFC 3L4AA 1GGWA 1DMOA 1LVCD 3IF7A 1CTRA 3B87A 1KWOC 5EL2A 2MLFC 1KQMB 1YTZC 2ISDA 5HKYA 2KQ6A 1J7OA 2JPTA 5B8IB 1NSHA 3I5GB 1GQMA 2KFFA 5ER4X 1PVBA 2HQWA 5KSZA 1KFXL 2KBMA 3GK4X 1MXLC 3I5HB 1PULA 3OX5A 1NWDA 1W9ZA 1TTXA 2RGIA 2OPOA 1AHRA 1BR4B 1HT9A 1K9PA 1Y1AA 2CCMA 2OS8C 2KNEA 2L5XB 2NLNA 1NCYA 1QLSA 4HRHA 2KAYA 5PALA 2AAOA 1J7PA 3SG5A 1GGZA 2F2OA 3FWBA 4OV2A 3KO0A 1KFXS 2GV5A 1RTP1 3EKHA 4YGDB 2WCBA 1PSRA 1TNXA 1R2UA 4JWQA 3VB1A 4I5NB 3JVTB 4U8DA 5FI6A 5D69A 1DJXA 1Y0VH 2G2BA 3TDZA 2WC6A 2CNPA 3KPXA 1DGVA 1B8LA 2M8UA 1A2XA 1F4QA 2PASA 2H61C 3K21A 4PHJA 4GUKA 3TS5C 3ICBA 1OOIX 1SW8A 3R1PA 4M2PA 5K89A 2ZRTA 1Y6WA 3CZ1A 1KK7Z 1G8IA 3DD4A 4C0LA 2K7DA 1HQVA 2QPTA 1OOJA 2YGUA 4GAOA 4PHMA 3DF0A 1CFDA 1Q80A 3CWGA 3L4LA 1J7QA 1K94A 1Y1UA 4N1GA 2JTTA 1OOFA 2MAZA 2LMVA 2D8NA 3MSEB 4PHNA 1EXRA 2NCOA 1M46A 1YUSA 2LAPA 1IQ5A 3D75A 4XJKA 3A8RA 3BUMB 4NDCA 1OOGA 1SRAA 1MUXA 5DKNA 2Q91A 2WORA 2JT3A 1KK7Y 1V1FA 2B1UA 4GGNA 5F6TA 1JSAA 1IH0A 1S6IA 3HX4A 1EH2A 4FTGA 2Y5IA 1MQ1A 2K60A 4OVNF 1K96A 4MRXA 1JFKA 1NYAA 1OW4A 2I7AA 1YVLA 1EG3A 5CSFA 3DVKA 4A4BA 2F3YA 5CSNA 1Z4HA 3K1EA 2ERBA 4L9MA 3ZNIA 2M29A 1K8UA 3DYEA 1QLKA 4YI9A 2H61A 2QACA 1AK8A 2L0PA 2WOSA 2ZRSA 3EK8A 1SL7A 2M7LA 2HETA 1KSMA 2QEHA 1UUSA 1H8BA 3H4SE 2ZN9A 3DZTA 1SBJA 1YVHA 3EVVA 2L51A 2WCJA 5DKQA 1SMGA 5HKZA 2M49B 3IVTA 4ZCUA 1DF0B 1IJ6A 1FF1A 3BUWB 1QIVA 3PN7B 2AMIA 4YGAA 4C0JA 4NQGA 2FCDA 4YRUA 5BPJA 1IRJA 1ZACA 2P6BB 4JKTA 1CFCA 4F0ZB 1KCYA 3VGOA 2KYCA 1DEKA 2BL0C 1YR5A 2MHHA 1B1GA 1C7VA 1SL8A 1X02A 2BBNA 2IS9A 3TUYB 2JT8A 1CMGA 1WRZA 2CXJA 2JZIA 3O78A 2P71A 1A75B 1OMVA 2LC5A 1FI5A 4UPGA 2LLUA 3M0WA 3Q8IA 2K2FA 3PATA 2ZN8A 3NSKA 4GPLB 4DUQA 2L2EA 5I94A 3RLZA 4PE0A 1QV0A 3NGVA 4A4CA 3NSLA 2KDHA 4N1FA 2LNKA 1TN4A 3OB1B 4GFTA 5CSJA 1ORGA 1NUBA 1UWOA 1ZUZA 3PM8A 1J7RA 3PN7C 3SJSA 1EJ3A 1QWVA 5ER5A 1YRUB 2FJUB 2K61A 1OSAA 2A4JA 2L4HA 4IJ7A 1NIWA 1QX7A 2MA2A 2PVBA 4MZLA 2LMUA 1CM4A 1NX1A 1QJTA 2KI4B 4YGCB 2PRUA 1B47A 1SL9A 1CLBA 4E68A 1BLQA 1PRWA 4NDBA 1CNPA 1LINA 1WDCB 3FE8A 1NP8A 3AAJA 1BF5A 2F3ZA 3E3RA 1V1GA 2CBLA 3PALA 3V2LA 1H4BA 1OE9B 1BG1A 3TDIA 1NPQA 2JU0A 1UHHA 2OTGC 3WHUB 4BY5A 2GTEA 2E30A 4JPZB 3SIAA 5CPVA 1KK8C 3CGAA 4PT1A 2KSPA 3I5FB 3SG4A 4DS7A 3RZSA 5TNCA 1OMRA 1SR6B 3O4XA 3RM1A 1RROA 2NCPA 2LP3A 2JNFA 2M9GA 1CMFA 1SY9A 3WXAA 4PE1A 1DELA 2HF5A 4P2YB 2DOQA 1KSOA 2PQLA 1MWNA 3BJHA 3BFAA 2KBIA 1RWYA 3OGNA 3SG6A 3CR4X 3CZTX 3QMEA 2JQ6A 2K7OA 1AVSA 1KQMC 4FQOA 4YI8A 3VRQA 2WCLA 2WNDA 2I2RE 3IQOA 3D0YB 1IG5A 3NSOA 3I5GC 1UURA 1W7IB 1KFUS 1F70A 2I94A 3EG5B 4GGFA 2LP2A 2JXLA 2WCEA 4P5OE 5CSIA 1JF0A 2BNXA 3BOWA 3VRNA 3PJIA 3B7AA 3I5HC 1SR6C 2HPSA 3R72A 3PFVA 2L2CA 1U5IA 2H2KA 2KFHA 4HRGA 1CFFA 1SCMB 3NSIA 4F7FA 4D1EA 2GGMA 2LV7A 3D10A 4HSZA 1YX8A 1WLZA 1AJ4A 2Y1NA 1DJZA 2JOJA 1WRLA 1N2DA 4CIDA 3ZWHA 3JTDB 2JXCA 4MRYA 1WY9A 5AFPA 1E8AA 3BUOB 4QJ5B 1PK0D 5HYDA 1UP5A 2L98A 3GOFA 4ORBB 2E6WA 3LL8B 1CLMA 1UHNA 2G9BA 2P70A 3BFBA 3I5IB 3JVTC 4INXA 1TOPA 2KOTA 5HKWA 4CLNA 1MXEA 1B8CA 2CTNA 1DC1A 3L47A 1F8HA 1R6PA 4NDDA 2SCPA 2KGRA 1MHOA 2BE4A 2EC6B 4WQ3A 1L2OB 1N65A 1QATA 3OHMB 4WQ2A 3TDUA 1ODBA 2JNXA 1CDLA 3NHTA 3OP0A 4AQIA 4QJ4B 1LXFC 4OKHA 1UHKA 4AOMA 1OOHA 1PALA 4C0KA 4CFQA 1A03A 1CKKA 4PE7A 3SG7A 5J3XA 3WHTB 3DVJA 3HCMA 1A4PA 2PALA 3C1VA 1JBAA 1QX2A 2V53A 3R1OA 3GK1A 1MR8A 1TRFA 2KHNA 2M97A 5FYXA 1DTLA 1XA5A 3FE6A 2BCBA 1TCFA 2I18A 2BCXA 2LUXA 5G08A 1FPWA 1F4OA 2JWWA 3N7HA 1FW4A 2QDIA 2QEVA 1UHIA 5HLVA 2EC6C 2WCHA 3IQQA 3EK4A 2BKHB 1BJFA 5D3OA 4PALA 2MLEC 2L5YA 1IQ3A 2KPHA 4Q04A 4PDZA 1RECA 1XFUO 2LM5A 3UNWA 4I5KA 2KAVA 3S0GA 3SS4A 3OX6A 1DJGA 3O2PA 4XJKB 4MN0A 2ZFDA 3QRXA 1Y1XA 3OBVA 1M39A 2NZ0A 3SS3A 1JFJA 3KHEA 1BU3A 2TN4A 3TZ1A 3O4YA 1SKTA 2KYFA 1JC2A 4M2OA 2KQYA 2KI6D 1TWOA 2ZNDA 1B8RA 3BUNB 1IIOA 1DQEA 2LLSA 5HLOA 1S1EA 4I5LB 1ALVA 1XYDA 4INWA 3CDNA 4TNCA 1NX0A 2BBMA 3FWCA 5HL1A 4PCWA 1BMOA 1RJVA 4MSPA 2EHBA 1NCZA 1C7WA 1N0YA 4KYNA 1QVIY 1KWOB 3B88A 1K9KA 4CFRA 1TNWA 3WNXB 1U5IB 1XFWO 2ZNEA 3S0FA 1VRKA 1OZSA 1TCOB 1XVJA 3TUYC 1DJIA 3OB2B 3FE9A 3UO9A 1J1DA 3BQ3A 1OZOA 2BECA 1BT6A 2PMYA 1K9UA 4ORCB 4ETOA 2F33A 1TUZA 1FBVA 3LK0A 3LCPC 3PLFB 3DF0B 4CPVA 2KFGA 3EK7A 4PE4A 3VRRA 1K90D 3AKBA 4DRWA 3GK2A 1SYMA 2EGDA 3NHIA 1NCXA 1ZFSA 1S5GZ 1P28A 4DCKA 2LVIA 3BXKA 1DJYA 2KLEA
chains in the Genus database with same CATH topology
2OS8B 3EVUA 2NXQA 1KFUL 2LVVA 5D7FA 3CS1A 2WC8A 4MZJA 1YX7A 2KI4C 2JC2A 4YBHB 4MZKA 1TNQA 2KI6C 1M31A 2F2PA 5JOLA 1WDCC 3DVMA 2LE9B 1JUOA 1YUTA 1F71A 1DF0A 1QASA 1SNLA 1S5GY 4PHKA 1S6JA 3VROA 1BOCA 1SK6D 1QTXA 1TIZA 3A4UB 3CR5X 2LHIA 1QX5B 1YURA 3TS5B 2MRDA 4IL1A 3I5FC 4JQ0D 4OR9B 2BE6A 5AERA 1B7TZ 1KQVA 1B9AA 2O60A 1MF8B 4YGBB 1A75A 1FI6A 4N5XA 1YUUA 2KGBC 2GGZA 1RK9A 3AAKA 1PVAA 4MBEA 1DGUA 1RFJA 1XFZO 3FIAA 2JULA 2O5GA 4M2QA 2M3WA 2K0JA 1XFVO 3VRPA 1L7ZA 4ICBA 4USLA 1BR1B 1K93D 1QV1A 1IGVA 1XK4C 2K2AA 1AP4A 5GQQC 1B7TY 5I2QA 3KEVA 2K7CA 2BCAA 1JWDA 2VRGA 1A29A 2Y4QA 2K7BA 4MVFA 2Q4UA 3O6BA 1JF2A 2M1KB 2M0RA 1TNPA 3FS7A 5AEQA 1SCMC 2WCFA 4MEWA 1F55A 1J55A 2HQ8A 4MLWA 3EKJA 4QJ3B 1CDMA 4YGEB 1ALWA 2CT9A 4ZCVA 3JTDC 1D1OA 1F54A 3BYAA 3DVEA 1K95A 1PSBA 1CDPA 1EL4A 2JT0A 1UHJA 4I5JA 3SG2A 1W7JB 3SIBA 4GBAA 1B4CA 1IWQA 1DJWA 2LVJA 1QS7A 3I5IC 3AKAA 1EG4A 1LKJA 5AXIA 1SPYA 2KAXA 2Y1MA 4BY4A 1CFPA 1AJ5A 1LA3A 3CTNA 4GNKB 1G4YR 2JRFA 2L50A 2LANA 4AQJA 2LCPA 2ZKMX 2M1UA 1K2HA 1WRKA 1L2OC 1S6CA 2BL0B 3F45A 3KF9A 3LLEA 1ZMZA 5KTYA 1XK4A 1OMDA 1WLMA 2FOTA 1C07A 2BKIB 3D0YA 5I2OA 2K8MB 4WRIA 1XO5A 1IKUA 1XFXO 1NX2A 1QVIZ 1G33A 2COLB 5I2LA 1S3PA 5KU1A 4OCIA 4XYNA 4R1EA 2LHLA 2PSRA 3PSRA 3SG3A 4ORAB 1CB1A 1NX3A 1ZOTB 1J1EA 1SCVA 1QXPA 5AANA 3CLNA 4DIRA 3EVRA 2LUCA 1XFYO 1AUIB 3LK1A 2M7NA 3BOWB 1CLLA 1S26D 2JTZA 1LA0A 2AUCA 2MJWB 1CM1A 5JJGA 4HREE 1QIWA 2LVKA 2LMTA 1OQPA 1DVIA 3NXAA 2R2IA 1CDNA 2LLTA 2OTGB 2FCEA 3CR2A 1S36A 1M63B 5IBWA 1KK8B 1IJ5A 2MBXA 2SASA 1DJHA 3BUXB 2F8PA 5I8NA 2L4IA 5DKRA 1DT7B 1BODA 1M45A 1GJYA 1YRTB 4GGFC 1GGWA 1DMOA 1LVCD 3IF7A 1CTRA 1KWOC 2MLFC 1KQMB 1YTZC 2ISDA 5HKYA 2KQ6A 1J7OA 2JPTA 5B8IB 1NSHA 3I5GB 1GQMA 2KFFA 5ER4X 1PVBA 2HQWA 5KSZA 1KFXL 2KBMA 3GK4X 1MXLC 3I5HB 1PULA 3OX5A 1NWDA 1TTXA 2RGIA 2OPOA 1AHRA 1BR4B 1HT9A 1K9PA 1Y1AA 2CCMA 2OS8C 2KNEA 2L5XB 2NLNA 1NCYA 1QLSA 4HRHA 2KAYA 5PALA 2AAOA 1J7PA 3SG5A 1GGZA 2F2OA 3FWBA 4OV2A 3KO0A 1KFXS 2GV5A 1RTP1 3EKHA 4YGDB 2WCBA 1PSRA 1TNXA 1R2UA 4JWQA 4I5NB 3JVTB 4U8DA 5D69A 1DJXA 1Y0VH 2G2BA 3TDZA 2CNPA 3KPXA 1DGVA 1B8LA 2M8UA 1A2XA 1F4QA 2PASA 2H61C 3K21A 4PHJA 4GUKA 3TS5C 3ICBA 1SW8A 4M2PA 5K89A 2ZRTA 1Y6WA 1KK7Z 1G8IA 3DD4A 4C0LA 2K7DA 1HQVA 2QPTA 1OOJA 4GAOA 4PHMA 3DF0A 1CFDA 1Q80A 3CWGA 1J7QA 1K94A 1Y1UA 4N1GA 2JTTA 2MAZA 2LMVA 2D8NA 3MSEB 4PHNA 1EXRA 2NCOA 1M46A 1YUSA 2LAPA 1IQ5A 4XJKA 3A8RA 3BUMB 4NDCA 1SRAA 1MUXA 5DKNA 2Q91A 2WORA 2JT3A 1KK7Y 1V1FA 2B1UA 4GGNA 5F6TA 1JSAA 1IH0A 1S6IA 3HX4A 1EH2A 4FTGA 2Y5IA 1MQ1A 4OVNF 1K96A 4MRXA 1JFKA 1NYAA 2I7AA 1YVLA 1EG3A 5CSFA 3DVKA 4A4BA 2F3YA 5CSNA 4L9MA 3ZNIA 2M29A 1K8UA 1QLKA 4YI9A 2H61A 2QACA 1AK8A 2L0PA 2WOSA 2ZRSA 3EK8A 1SL7A 2M7LA 2HETA 1KSMA 1UUSA 1H8BA 3H4SE 2ZN9A 1SBJA 1YVHA 3EVVA 2L51A 5DKQA 5HKZA 1SMGA 2M49B 4ZCUA 1DF0B 1IJ6A 1FF1A 3BUWB 1QIVA 3PN7B 2AMIA 4YGAA 4C0JA 4NQGA 2FCDA 4YRUA 5BPJA 1IRJA 1ZACA 2P6BB 1CFCA 4F0ZB 1KCYA 3VGOA 2KYCA 2BL0C 1YR5A 2MHHA 1B1GA 1C7VA 1SL8A 1X02A 2BBNA 2IS9A 3TUYB 2JT8A 1CMGA 1WRZA 2CXJA 2JZIA 3O78A 1A75B 1OMVA 2LC5A 1FI5A 4UPGA 2LLUA 3M0WA 2K2FA 3PATA 2ZN8A 3NSKA 4GPLB 4DUQA 2L2EA 3RLZA 4PE0A 1QV0A 4A4CA 3NSLA 2KDHA 4N1FA 2LNKA 1TN4A 3OB1B 4GFTA 5CSJA 1NUBA 1UWOA 1ZUZA 3PM8A 1J7RA 3PN7C 3SJSA 1EJ3A 5ER5A 1YRUB 2FJUB 2K61A 1OSAA 2A4JA 2L4HA 4MZLA 1NIWA 1QX7A 2MA2A 2PVBA 2LMUA 1CM4A 1NX1A 1QJTA 2KI4B 4YGCB 2PRUA 1B47A 1SL9A 1CLBA 4E68A 1BLQA 1PRWA 4NDBA 1CNPA 1LINA 1WDCB 1NP8A 3AAJA 1BF5A 2F3ZA 3E3RA 1V1GA 2CBLA 3PALA 1H4BA 1OE9B 1BG1A 3TDIA 1NPQA 2JU0A 1UHHA 2OTGC 3WHUB 4BY5A 2E30A 4JPZB 3SIAA 5CPVA 1KK8C 3CGAA 3SG4A 2KSPA 3I5FB 4DS7A 5TNCA 1OMRA 1SR6B 3RM1A 1RROA 2NCPA 2LP3A 2JNFA 2M9GA 1CMFA 1SY9A 3WXAA 4PE1A 2HF5A 4P2YB 2DOQA 1KSOA 1MWNA 2KBIA 1RWYA 3SG6A 3CR4X 3CZTX 2JQ6A 2K7OA 1AVSA 1KQMC 4FQOA 4YI8A 3VRQA 2WNDA 2I2RE 3IQOA 3D0YB 1IG5A 3NSOA 3I5GC 1UURA 1W7IB 1KFUS 1F70A 2I94A 4GGFA 2LP2A 2JXLA 2WCEA 4P5OE 5CSIA 1JF0A 3BOWA 3VRNA 3I5HC 1SR6C 2HPSA 3PFVA 1U5IA 2H2KA 2KFHA 4HRGA 1CFFA 1SCMB 3NSIA 4D1EA 2GGMA 2LV7A 3D10A 4HSZA 1YX8A 1WLZA 1AJ4A 2Y1NA 1DJZA 2JOJA 1WRLA 1N2DA 4CIDA 3ZWHA 3JTDB 2JXCA 4MRYA 1WY9A 5AFPA 1E8AA 3BUOB 4QJ5B 1PK0D 5HYDA 1UP5A 2L98A 3GOFA 4ORBB 2E6WA 3LL8B 1CLMA 1UHNA 2G9BA 3I5IB 3JVTC 4CLNA 1TOPA 2KOTA 5HKWA 1MXEA 1B8CA 2CTNA 1F8HA 1R6PA 4NDDA 2SCPA 2KGRA 1MHOA 2BE4A 2EC6B 4WQ3A 1L2OB 1N65A 1QATA 3OHMB 4WQ2A 3TDUA 1ODBA 2JNXA 1CDLA 3OP0A 4AQIA 4QJ4B 1LXFC 4OKHA 1UHKA 4AOMA 4C0KA 1PALA 4CFQA 1A03A 1CKKA 4PE7A 3SG7A 5J3XA 3WHTB 3DVJA 3HCMA 1A4PA 2PALA 3C1VA 1JBAA 1QX2A 2V53A 3GK1A 1MR8A 1TRFA 2KHNA 2M97A 5FYXA 1DTLA 1XA5A 2BCBA 1TCFA 2I18A 2BCXA 2LUXA 5G08A 1FPWA 1F4OA 2JWWA 1FW4A 1UHIA 5HLVA 2EC6C 3IQQA 3EK4A 2BKHB 1BJFA 1IQ3A 4PALA 2MLEC 4Q04A 4PDZA 1RECA 1XFUO 2LM5A 4I5KA 2KAVA 3OX6A 1DJGA 3O2PA 4MN0A 2ZFDA 3QRXA 1Y1XA 1M39A 2NZ0A 1JFJA 3KHEA 1BU3A 2TN4A 3TZ1A 3O4YA 1SKTA 2KYFA 1JC2A 4M2OA 2KQYA 2KI6D 2ZNDA 3BUNB 1B8RA 2LLSA 5HLOA 1S1EA 4I5LB 1ALVA 1XYDA 4TNCA 1NX0A 2BBMA 3FWCA 4PCWA 1BMOA 1RJVA 4MSPA 2EHBA 1NCZA 1C7WA 1N0YA 1QVIY 1KWOB 1K9KA 4CFRA 1TNWA 3WNXB 1U5IB 1XFWO 2ZNEA 1VRKA 1OZSA 1TCOB 1XVJA 3TUYC 1DJIA 3OB2B 1J1DA 3BQ3A 1OZOA 2BECA 1BT6A 2PMYA 1K9UA 4ORCB 4ETOA 2F33A 1FBVA 3LK0A 3LCPC 3PLFB 3DF0B 4CPVA 2KFGA 3EK7A 4PE4A 3VRRA 1K90D 3AKBA 4DRWA 3GK2A 1SYMA 2EGDA 1NCXA 1ZFSA 1S5GZ 4DCKA 2LVIA 3BXKA 1DJYA 4XJKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OS8 B;  3EVU A;  2NXQ A;  1KFU L;  2LVV A;  5D7F A;  3CS1 A;  2WC8 A;  4MZJ A;  1YX7 A;  2KI4 C;  2JC2 A;  4YBH B;  4MZK A;  1TNQ A;  2KI6 C;  1M31 A;  2F2P A;  5JOL A;  1WDC C;  3DVM A;  2LE9 B;  1JUO A;  1YUT A;  1F71 A;  1DF0 A;  1QAS A;  1SNL A;  1S5G Y;  4PHK A;  1S6J A;  3VRO A;  1BOC A;  1SK6 D;  1QTX A;  1TIZ A;  3A4U B;  3CR5 X;  2LHI A;  1QX5 B;  1YUR A;  3TS5 B;  2MRD A;  4IL1 A;  3I5F C;  4JQ0 D;  4OR9 B;  2BE6 A;  5AER A;  1B7T Z;  1KQV A;  1B9A A;  2O60 A;  1MF8 B;  4YGB B;  1A75 A;  1FI6 A;  4N5X A;  1YUU A;  2KGB C;  2GGZ A;  1RK9 A;  3AAK A;  1PVA A;  4MBE A;  1DGU A;  1RFJ A;  1XFZ O;  3FIA A;  2JUL A;  2O5G A;  4M2Q A;  2M3W A;  2K0J A;  1XFV O;  3VRP A;  1L7Z A;  4ICB A;  4USL A;  1BR1 B;  1K93 D;  1QV1 A;  1IGV A;  1XK4 C;  2K2A A;  1AP4 A;  5GQQ C;  1B7T Y;  5I2Q A;  3KEV A;  2K7C A;  2BCA A;  1JWD A;  2VRG A;  1A29 A;  2Y4Q A;  2K7B A;  4MVF A;  2Q4U A;  3O6B A;  1JF2 A;  2M1K B;  2M0R A;  1TNP A;  3FS7 A;  5AEQ A;  1SCM C;  2WCF A;  4MEW A;  1F55 A;  1J55 A;  2HQ8 A;  4MLW A;  3EKJ A;  4QJ3 B;  1CDM A;  4YGE B;  1ALW A;  2CT9 A;  4ZCV A;  3JTD C;  1D1O A;  1F54 A;  3BYA A;  3DVE A;  1K95 A;  1PSB A;  1CDP A;  1EL4 A;  2JT0 A;  1UHJ A;  4I5J A;  3SG2 A;  1W7J B;  3SIB A;  4GBA A;  1B4C A;  1IWQ A;  1DJW A;  2LVJ A;  1QS7 A;  3I5I C;  3AKA A;  1EG4 A;  1LKJ A;  5AXI A;  1SPY A;  2KAX A;  2Y1M A;  4BY4 A;  1CFP A;  1AJ5 A;  1LA3 A;  3CTN A;  4GNK B;  1G4Y R;  2JRF A;  2L50 A;  2LAN A;  4AQJ A;  2LCP A;  2ZKM X;  2M1U A;  1K2H A;  1WRK A;  1L2O C;  1S6C A;  2BL0 B;  3F45 A;  3KF9 A;  3LLE A;  1ZMZ A;  5KTY A;  1XK4 A;  1OMD A;  1WLM A;  2FOT A;  1C07 A;  2BKI B;  3D0Y A;  5I2O A;  2K8M B;  4WRI A;  1XO5 A;  1IKU A;  1XFX O;  1NX2 A;  1QVI Z;  1G33 A;  2COL B;  5I2L A;  1S3P A;  5KU1 A;  4OCI A;  4XYN A;  4R1E A;  2LHL A;  2PSR A;  3PSR A;  3SG3 A;  4ORA B;  1CB1 A;  1NX3 A;  1ZOT B;  1J1E A;  1SCV A;  1QXP A;  5AAN A;  3CLN A;  4DIR A;  3EVR A;  2LUC A;  1XFY O;  1AUI B;  3LK1 A;  2M7N A;  3BOW B;  1CLL A;  1S26 D;  2JTZ A;  1LA0 A;  2AUC A;  2MJW B;  1CM1 A;  5JJG A;  4HRE E;  1QIW A;  2LVK A;  2LMT A;  1OQP A;  1DVI A;  3NXA A;  2R2I A;  1CDN A;  2LLT A;  2OTG B;  2FCE A;  3CR2 A;  1S36 A;  1M63 B;  5IBW A;  1KK8 B;  1IJ5 A;  2MBX A;  2SAS A;  1DJH A;  3BUX B;  2F8P A;  5I8N A;  2L4I A;  5DKR A;  1DT7 B;  1BOD A;  1M45 A;  1GJY A;  1YRT B;  4GGF C;  1GGW A;  1DMO A;  1LVC D;  3IF7 A;  1CTR A;  1KWO C;  2MLF C;  1KQM B;  1YTZ C;  2ISD A;  5HKY A;  2KQ6 A;  1J7O A;  2JPT A;  5B8I B;  1NSH A;  3I5G B;  1GQM A;  2KFF A;  5ER4 X;  1PVB A;  2HQW A;  5KSZ A;  1KFX L;  2KBM A;  3GK4 X;  1MXL C;  3I5H B;  1PUL A;  3OX5 A;  1NWD A;  1TTX A;  2RGI A;  2OPO A;  1AHR A;  1BR4 B;  1HT9 A;  1K9P A;  1Y1A A;  2CCM A;  2OS8 C;  2KNE A;  2L5X B;  2NLN A;  1NCY A;  1QLS A;  4HRH A;  2KAY A;  5PAL A;  2AAO A;  1J7P A;  3SG5 A;  1GGZ A;  2F2O A;  3FWB A;  4OV2 A;  3KO0 A;  1KFX S;  2GV5 A;  1RTP 1;  3EKH A;  4YGD B;  2WCB A;  1PSR A;  1TNX A;  1R2U A;  4JWQ A;  4I5N B;  3JVT B;  4U8D A;  5D69 A;  1DJX A;  1Y0V H;  2G2B A;  3TDZ A;  2CNP A;  3KPX A;  1DGV A;  1B8L A;  2M8U A;  1A2X A;  1F4Q A;  2PAS A;  2H61 C;  3K21 A;  4PHJ A;  4GUK A;  3TS5 C;  3ICB A;  1SW8 A;  4M2P A;  5K89 A;  2ZRT A;  1Y6W A;  1KK7 Z;  1G8I A;  3DD4 A;  4C0L A;  2K7D A;  1HQV A;  2QPT A;  1OOJ A;  4GAO A;  4PHM A;  3DF0 A;  1CFD A;  1Q80 A;  3CWG A;  1J7Q A;  1K94 A;  1Y1U A;  4N1G A;  2JTT A;  2MAZ A;  2LMV A;  2D8N A;  3MSE B;  4PHN A;  1EXR A;  2NCO A;  1M46 A;  1YUS A;  2LAP A;  1IQ5 A;  4XJK A;  3A8R A;  3BUM B;  4NDC A;  1SRA A;  1MUX A;  5DKN A;  2Q91 A;  2WOR A;  2JT3 A;  1KK7 Y;  1V1F A;  2B1U A;  4GGN A;  5F6T A;  1JSA A;  1IH0 A;  1S6I A;  3HX4 A;  1EH2 A;  4FTG A;  2Y5I A;  1MQ1 A;  4OVN F;  1K96 A;  4MRX A;  1JFK A;  1NYA A;  2I7A A;  1YVL A;  1EG3 A;  5CSF A;  3DVK A;  4A4B A;  2F3Y A;  5CSN A;  4L9M A;  3ZNI A;  2M29 A;  1K8U A;  1QLK A;  4YI9 A;  2H61 A;  2QAC A;  1AK8 A;  2L0P A;  2WOS A;  2ZRS A;  3EK8 A;  1SL7 A;  2M7L A;  2HET A;  1KSM A;  1UUS A;  1H8B A;  3H4S E;  2ZN9 A;  1SBJ A;  1YVH A;  3EVV A;  2L51 A;  5DKQ A;  5HKZ A;  1SMG A;  2M49 B;  4ZCU A;  1DF0 B;  1IJ6 A;  1FF1 A;  3BUW B;  1QIV A;  3PN7 B;  2AMI A;  4YGA A;  4C0J A;  4NQG A;  2FCD A;  4YRU A;  5BPJ A;  1IRJ A;  1ZAC A;  2P6B B;  1CFC A;  4F0Z B;  1KCY A;  3VGO A;  2KYC A;  2BL0 C;  1YR5 A;  2MHH A;  1B1G A;  1C7V A;  1SL8 A;  1X02 A;  2BBN A;  2IS9 A;  3TUY B;  2JT8 A;  1CMG A;  1WRZ A;  2CXJ A;  2JZI A;  3O78 A;  1A75 B;  1OMV A;  2LC5 A;  1FI5 A;  4UPG A;  2LLU A;  3M0W A;  2K2F A;  3PAT A;  2ZN8 A;  3NSK A;  4GPL B;  4DUQ A;  2L2E A;  3RLZ A;  4PE0 A;  1QV0 A;  4A4C A;  3NSL A;  2KDH A;  4N1F A;  2LNK A;  1TN4 A;  3OB1 B;  4GFT A;  5CSJ A;  1NUB A;  1UWO A;  1ZUZ A;  3PM8 A;  1J7R A;  3PN7 C;  3SJS A;  1EJ3 A;  5ER5 A;  1YRU B;  2FJU B;  2K61 A;  1OSA A;  2A4J A;  2L4H A;  4MZL A;  1NIW A;  1QX7 A;  2MA2 A;  2PVB A;  2LMU A;  1CM4 A;  1NX1 A;  1QJT A;  2KI4 B;  4YGC B;  2PRU A;  1B47 A;  1SL9 A;  1CLB A;  4E68 A;  1BLQ A;  1PRW A;  4NDB A;  1CNP A;  1LIN A;  1WDC B;  1NP8 A;  3AAJ A;  1BF5 A;  2F3Z A;  3E3R A;  1V1G A;  2CBL A;  3PAL A;  1H4B A;  1OE9 B;  1BG1 A;  3TDI A;  1NPQ A;  2JU0 A;  1UHH A;  2OTG C;  3WHU B;  4BY5 A;  2E30 A;  4JPZ B;  3SIA A;  5CPV A;  1KK8 C;  3CGA A;  3SG4 A;  2KSP A;  3I5F B;  4DS7 A;  5TNC A;  1OMR A;  1SR6 B;  3RM1 A;  1RRO A;  2NCP A;  2LP3 A;  2JNF A;  2M9G A;  1CMF A;  1SY9 A;  3WXA A;  4PE1 A;  2HF5 A;  4P2Y B;  2DOQ A;  1KSO A;  1MWN A;  2KBI A;  1RWY A;  3SG6 A;  3CR4 X;  3CZT X;  2JQ6 A;  2K7O A;  1AVS A;  1KQM C;  4FQO A;  4YI8 A;  3VRQ A;  2WND A;  2I2R E;  3IQO A;  3D0Y B;  1IG5 A;  3NSO A;  3I5G C;  1UUR A;  1W7I B;  1KFU S;  1F70 A;  2I94 A;  4GGF A;  2LP2 A;  2JXL A;  2WCE A;  4P5O E;  5CSI A;  1JF0 A;  3BOW A;  3VRN A;  3I5H C;  1SR6 C;  2HPS A;  3PFV A;  1U5I A;  2H2K A;  2KFH A;  4HRG A;  1CFF A;  1SCM B;  3NSI A;  4D1E A;  2GGM A;  2LV7 A;  3D10 A;  4HSZ A;  1YX8 A;  1WLZ A;  1AJ4 A;  2Y1N A;  1DJZ A;  2JOJ A;  1WRL A;  1N2D A;  4CID A;  3ZWH A;  3JTD B;  2JXC A;  4MRY A;  1WY9 A;  5AFP A;  1E8A A;  3BUO B;  4QJ5 B;  1PK0 D;  5HYD A;  1UP5 A;  2L98 A;  3GOF A;  4ORB B;  2E6W A;  3LL8 B;  1CLM A;  1UHN A;  2G9B A;  3I5I B;  3JVT C;  4CLN A;  1TOP A;  2KOT A;  5HKW A;  1MXE A;  1B8C A;  2CTN A;  1F8H A;  1R6P A;  4NDD A;  2SCP A;  2KGR A;  1MHO A;  2BE4 A;  2EC6 B;  4WQ3 A;  1L2O B;  1N65 A;  1QAT A;  3OHM B;  4WQ2 A;  3TDU A;  1ODB A;  2JNX A;  1CDL A;  3OP0 A;  4AQI A;  4QJ4 B;  1LXF C;  4OKH A;  1UHK A;  4AOM A;  4C0K A;  1PAL A;  4CFQ A;  1A03 A;  1CKK A;  4PE7 A;  3SG7 A;  5J3X A;  3WHT B;  3DVJ A;  3HCM A;  1A4P A;  2PAL A;  3C1V A;  1JBA A;  1QX2 A;  2V53 A;  3GK1 A;  1MR8 A;  1TRF A;  2KHN A;  2M97 A;  5FYX A;  1DTL A;  1XA5 A;  2BCB A;  1TCF A;  2I18 A;  2BCX A;  2LUX A;  5G08 A;  1FPW A;  1F4O A;  2JWW A;  1FW4 A;  1UHI A;  5HLV A;  2EC6 C;  3IQQ A;  3EK4 A;  2BKH B;  1BJF A;  1IQ3 A;  4PAL A;  2MLE C;  4Q04 A;  4PDZ A;  1REC A;  1XFU O;  2LM5 A;  4I5K A;  2KAV A;  3OX6 A;  1DJG A;  3O2P A;  4MN0 A;  2ZFD A;  3QRX A;  1Y1X A;  1M39 A;  2NZ0 A;  1JFJ A;  3KHE A;  1BU3 A;  2TN4 A;  3TZ1 A;  3O4Y A;  1SKT A;  2KYF A;  1JC2 A;  4M2O A;  2KQY A;  2KI6 D;  2ZND A;  3BUN B;  1B8R A;  2LLS A;  5HLO A;  1S1E A;  4I5L B;  1ALV A;  1XYD A;  4TNC A;  1NX0 A;  2BBM A;  3FWC A;  4PCW A;  1BMO A;  1RJV A;  4MSP A;  2EHB A;  1NCZ A;  1C7W A;  1N0Y A;  1QVI Y;  1KWO B;  1K9K A;  4CFR A;  1TNW A;  3WNX B;  1U5I B;  1XFW O;  2ZNE A;  1VRK A;  1OZS A;  1TCO B;  1XVJ A;  3TUY C;  1DJI A;  3OB2 B;  1J1D A;  3BQ3 A;  1OZO A;  2BEC A;  1BT6 A;  2PMY A;  1K9U A;  4ORC B;  4ETO A;  2F33 A;  1FBV A;  3LK0 A;  3LCP C;  3PLF B;  3DF0 B;  4CPV A;  2KFG A;  3EK7 A;  4PE4 A;  3VRR A;  1K90 D;  3AKB A;  4DRW A;  3GK2 A;  1SYM A;  2EGD A;  1NCX A;  1ZFS A;  1S5G Z;  4DCK A;  2LVI A;  3BXK A;  1DJY A;  4XJK B; 
#chains in the Genus database with same CATH topology
 2OS8 B;  3EVU A;  2NXQ A;  1KFU L;  2LVV A;  5D7F A;  3CYZ A;  3CS1 A;  3CZ0 A;  2WC8 A;  4MZJ A;  1YX7 A;  2KI4 C;  2JC2 A;  1LS8 A;  4YBH B;  4MZK A;  1TNQ A;  2KI6 C;  1M31 A;  2F2P A;  5JOL A;  1WDC C;  3DVM A;  2LE9 B;  1JUO A;  1YUT A;  1F71 A;  1DF0 A;  1QAS A;  1SNL A;  1S5G Y;  4PHK A;  1S6J A;  3VRO A;  1BOC A;  1SK6 D;  1QTX A;  1TIZ A;  3A4U B;  3CR5 X;  2LHI A;  4OZD A;  1QX5 B;  1YUR A;  3TS5 B;  2MRD A;  4IL1 A;  3I5F C;  3CAB A;  4JQ0 D;  2BE6 A;  4OR9 B;  1TUJ A;  3SS5 A;  1B7T Z;  5AER A;  1KQV A;  1B9A A;  2O60 A;  1MF8 B;  4YGB B;  1A75 A;  1FI6 A;  1T14 A;  4N5X A;  2JPO A;  1YUU A;  2KGB C;  2GGZ A;  1RK9 A;  3AAK A;  1PVA A;  4MBE A;  1DGU A;  1RFJ A;  1XFZ O;  3FIA A;  2JUL A;  2O5G A;  3D77 A;  4M2Q A;  1C3Y A;  2M3W A;  2K0J A;  1XFV O;  3VRP A;  3PM2 A;  1L7Z A;  4ICB A;  4USL A;  1BR1 B;  1K93 D;  1QV1 A;  1IGV A;  1XK4 C;  2H8V A;  2K2A A;  2WCK A;  1AP4 A;  5GQQ C;  1B7T Y;  5I2Q A;  3KEV A;  2K7C A;  2BCA A;  1JWD A;  2VRG A;  3BFH A;  1A29 A;  2Y4Q A;  2K7B A;  4MVF A;  2Q4U A;  3O6B A;  1JF2 A;  3B6X A;  2M1K B;  3D73 A;  1C3Z A;  1TNP A;  2M0R A;  3CZ2 A;  3FS7 A;  2WCM A;  5AEQ A;  1SCM C;  2WCF A;  4MEW A;  1F55 A;  1J55 A;  2HQ8 A;  4MLW A;  3EKJ A;  4QJ3 B;  1CDM A;  4YGE B;  1ALW A;  2CT9 A;  4ZCV A;  3JTD C;  1D1O A;  1F54 A;  3BYA A;  2PYQ A;  3DVE A;  1K95 A;  1PSB A;  1CDP A;  5DIC A;  2FJY A;  1EL4 A;  2JT0 A;  1UHJ A;  4FQT A;  4I5J A;  1W7J B;  3SG2 A;  2WC5 A;  4GBA A;  4JD9 A;  3SIB A;  3D74 A;  1B4C A;  1IWQ A;  1DJW A;  1XFR A;  2LVJ A;  1QS7 A;  3I5I C;  3AKA A;  3S0B A;  1EG4 A;  1LKJ A;  5AXI A;  1SPY A;  2KAX A;  2Y1M A;  4BY4 A;  1CFP A;  1AJ5 A;  1LA3 A;  3CTN A;  4GNK B;  1G4Y R;  2JRF A;  2L50 A;  2LAN A;  4AQJ A;  2LCP A;  2ZKM X;  2M1U A;  1K2H A;  1WRK A;  1L2O C;  1S6C A;  2BL0 B;  2KLD A;  3F45 A;  3B86 A;  3KF9 A;  3LLE A;  1ZMZ A;  2QEB A;  5KTY A;  1XK4 A;  1OMD A;  1WLM A;  2FOT A;  3S0D A;  3S0A A;  1C07 A;  2BKI B;  3D0Y A;  5I2O A;  2K8M B;  4WRI A;  1XO5 A;  3R1V A;  1XFX O;  1NX2 A;  1IKU A;  1QVI Z;  1G33 A;  2COL B;  5I2L A;  1S3P A;  5KU1 A;  4OCI A;  4XYN A;  4R1E A;  2LHL A;  5FI2 A;  1Z2C B;  2PSR A;  3PSR A;  3SG3 A;  4ORA B;  1CB1 A;  1NX3 A;  1ZOT B;  1J1E A;  1GM0 A;  1SCV A;  1QXP A;  5AAN A;  3CLN A;  4DIR A;  1SSE B;  3S0E A;  3EVR A;  3D78 A;  2LUC A;  1XFY O;  1AUI B;  3LK1 A;  2QEO A;  2M7N A;  3BOW B;  1CLL A;  1S26 D;  2JTZ A;  1LA0 A;  2AUC A;  2MJW B;  1CM1 A;  5JJG A;  4HRE E;  1QIW A;  2LVK A;  2LMT A;  1OQP A;  1DVI A;  3NXA A;  2R2I A;  1CDN A;  2LLT A;  2OTG B;  2FCE A;  3CR2 A;  1S36 A;  2BAP A;  1M63 B;  3DXL A;  5IBW A;  1KK8 B;  1IJ5 A;  2MBX A;  2SAS A;  1DJH A;  3DY9 A;  3BUX B;  2F8P A;  5I8N A;  3D76 A;  2L4I A;  5DKR A;  1DT7 B;  1BOD A;  5FI7 A;  1M45 A;  1GJY A;  1YRT B;  4GGF C;  3L4A A;  1GGW A;  1DMO A;  1LVC D;  3IF7 A;  1CTR A;  3B87 A;  1KWO C;  5EL2 A;  2MLF C;  1KQM B;  1YTZ C;  2ISD A;  5HKY A;  2KQ6 A;  1J7O A;  2JPT A;  5B8I B;  1NSH A;  3I5G B;  1GQM A;  2KFF A;  5ER4 X;  1PVB A;  2HQW A;  5KSZ A;  1KFX L;  2KBM A;  3GK4 X;  1MXL C;  3I5H B;  1PUL A;  3OX5 A;  1NWD A;  1W9Z A;  1TTX A;  2RGI A;  2OPO A;  1AHR A;  1BR4 B;  1HT9 A;  1K9P A;  1Y1A A;  2CCM A;  2OS8 C;  2KNE A;  2L5X B;  2NLN A;  1NCY A;  1QLS A;  4HRH A;  2KAY A;  5PAL A;  2AAO A;  1J7P A;  3SG5 A;  1GGZ A;  2F2O A;  3FWB A;  4OV2 A;  3KO0 A;  1KFX S;  2GV5 A;  1RTP 1;  3EKH A;  4YGD B;  2WCB A;  1PSR A;  1TNX A;  1R2U A;  4JWQ A;  3VB1 A;  4I5N B;  3JVT B;  4U8D A;  5FI6 A;  5D69 A;  1DJX A;  1Y0V H;  2G2B A;  3TDZ A;  2WC6 A;  2CNP A;  3KPX A;  1DGV A;  1B8L A;  2M8U A;  1A2X A;  1F4Q A;  2PAS A;  2H61 C;  3K21 A;  4PHJ A;  4GUK A;  3TS5 C;  3ICB A;  1OOI X;  1SW8 A;  3R1P A;  4M2P A;  5K89 A;  2ZRT A;  1Y6W A;  3CZ1 A;  1KK7 Z;  1G8I A;  3DD4 A;  4C0L A;  2K7D A;  1HQV A;  2QPT A;  1OOJ A;  2YGU A;  4GAO A;  4PHM A;  3DF0 A;  1CFD A;  1Q80 A;  3CWG A;  3L4L A;  1J7Q A;  1K94 A;  1Y1U A;  4N1G A;  2JTT A;  1OOF A;  2MAZ A;  2LMV A;  2D8N A;  3MSE B;  4PHN A;  1EXR A;  2NCO A;  1M46 A;  1YUS A;  2LAP A;  1IQ5 A;  3D75 A;  4XJK A;  3A8R A;  3BUM B;  4NDC A;  1OOG A;  1SRA A;  1MUX A;  5DKN A;  2Q91 A;  2WOR A;  2JT3 A;  1KK7 Y;  1V1F A;  2B1U A;  4GGN A;  5F6T A;  1JSA A;  1IH0 A;  1S6I A;  3HX4 A;  1EH2 A;  4FTG A;  2Y5I A;  1MQ1 A;  2K60 A;  4OVN F;  1K96 A;  4MRX A;  1JFK A;  1NYA A;  1OW4 A;  2I7A A;  1YVL A;  1EG3 A;  5CSF A;  3DVK A;  4A4B A;  2F3Y A;  5CSN A;  1Z4H A;  3K1E A;  2ERB A;  4L9M A;  3ZNI A;  2M29 A;  1K8U A;  3DYE A;  1QLK A;  4YI9 A;  2H61 A;  2QAC A;  1AK8 A;  2L0P A;  2WOS A;  2ZRS A;  3EK8 A;  1SL7 A;  2M7L A;  2HET A;  1KSM A;  2QEH A;  1UUS A;  1H8B A;  3H4S E;  2ZN9 A;  3DZT A;  1SBJ A;  1YVH A;  3EVV A;  2L51 A;  2WCJ A;  5DKQ A;  1SMG A;  5HKZ A;  2M49 B;  3IVT A;  4ZCU A;  1DF0 B;  1IJ6 A;  1FF1 A;  3BUW B;  1QIV A;  3PN7 B;  2AMI A;  4YGA A;  4C0J A;  4NQG A;  2FCD A;  4YRU A;  5BPJ A;  1IRJ A;  1ZAC A;  2P6B B;  4JKT A;  1CFC A;  4F0Z B;  1KCY A;  3VGO A;  2KYC A;  1DEK A;  2BL0 C;  1YR5 A;  2MHH A;  1B1G A;  1C7V A;  1SL8 A;  1X02 A;  2BBN A;  2IS9 A;  3TUY B;  2JT8 A;  1CMG A;  1WRZ A;  2CXJ A;  2JZI A;  3O78 A;  2P71 A;  1A75 B;  1OMV A;  2LC5 A;  1FI5 A;  4UPG A;  2LLU A;  3M0W A;  3Q8I A;  2K2F A;  3PAT A;  2ZN8 A;  3NSK A;  4GPL B;  4DUQ A;  2L2E A;  5I94 A;  3RLZ A;  4PE0 A;  1QV0 A;  3NGV A;  4A4C A;  3NSL A;  2KDH A;  4N1F A;  2LNK A;  1TN4 A;  3OB1 B;  4GFT A;  5CSJ A;  1ORG A;  1NUB A;  1UWO A;  1ZUZ A;  3PM8 A;  1J7R A;  3PN7 C;  3SJS A;  1EJ3 A;  1QWV A;  5ER5 A;  1YRU B;  2FJU B;  2K61 A;  1OSA A;  2A4J A;  2L4H A;  4IJ7 A;  1NIW A;  1QX7 A;  2MA2 A;  2PVB A;  4MZL A;  2LMU A;  1CM4 A;  1NX1 A;  1QJT A;  2KI4 B;  4YGC B;  2PRU A;  1B47 A;  1SL9 A;  1CLB A;  4E68 A;  1BLQ A;  1PRW A;  4NDB A;  1CNP A;  1LIN A;  1WDC B;  3FE8 A;  1NP8 A;  3AAJ A;  1BF5 A;  2F3Z A;  3E3R A;  1V1G A;  2CBL A;  3PAL A;  3V2L A;  1H4B A;  1OE9 B;  1BG1 A;  3TDI A;  1NPQ A;  2JU0 A;  1UHH A;  2OTG C;  3WHU B;  4BY5 A;  2GTE A;  2E30 A;  4JPZ B;  3SIA A;  5CPV A;  1KK8 C;  3CGA A;  4PT1 A;  2KSP A;  3I5F B;  3SG4 A;  4DS7 A;  3RZS A;  5TNC A;  1OMR A;  1SR6 B;  3O4X A;  3RM1 A;  1RRO A;  2NCP A;  2LP3 A;  2JNF A;  2M9G A;  1CMF A;  1SY9 A;  3WXA A;  4PE1 A;  1DEL A;  2HF5 A;  4P2Y B;  2DOQ A;  1KSO A;  2PQL A;  1MWN A;  3BJH A;  3BFA A;  2KBI A;  1RWY A;  3OGN A;  3SG6 A;  3CR4 X;  3CZT X;  3QME A;  2JQ6 A;  2K7O A;  1AVS A;  1KQM C;  4FQO A;  4YI8 A;  3VRQ A;  2WCL A;  2WND A;  2I2R E;  3IQO A;  3D0Y B;  1IG5 A;  3NSO A;  3I5G C;  1UUR A;  1W7I B;  1KFU S;  1F70 A;  2I94 A;  3EG5 B;  4GGF A;  2LP2 A;  2JXL A;  2WCE A;  4P5O E;  5CSI A;  1JF0 A;  2BNX A;  3BOW A;  3VRN A;  3PJI A;  3B7A A;  3I5H C;  1SR6 C;  2HPS A;  3R72 A;  3PFV A;  2L2C A;  1U5I A;  2H2K A;  2KFH A;  4HRG A;  1CFF A;  1SCM B;  3NSI A;  4F7F A;  4D1E A;  2GGM A;  2LV7 A;  3D10 A;  4HSZ A;  1YX8 A;  1WLZ A;  1AJ4 A;  2Y1N A;  1DJZ A;  2JOJ A;  1WRL A;  1N2D A;  4CID A;  3ZWH A;  3JTD B;  2JXC A;  4MRY A;  1WY9 A;  5AFP A;  1E8A A;  3BUO B;  4QJ5 B;  1PK0 D;  5HYD A;  1UP5 A;  2L98 A;  3GOF A;  4ORB B;  2E6W A;  3LL8 B;  1CLM A;  1UHN A;  2G9B A;  2P70 A;  3BFB A;  3I5I B;  3JVT C;  4INX A;  1TOP A;  2KOT A;  5HKW A;  4CLN A;  1MXE A;  1B8C A;  2CTN A;  1DC1 A;  3L47 A;  1F8H A;  1R6P A;  4NDD A;  2SCP A;  2KGR A;  1MHO A;  2BE4 A;  2EC6 B;  4WQ3 A;  1L2O B;  1N65 A;  1QAT A;  3OHM B;  4WQ2 A;  3TDU A;  1ODB A;  2JNX A;  1CDL A;  3NHT A;  3OP0 A;  4AQI A;  4QJ4 B;  1LXF C;  4OKH A;  1UHK A;  4AOM A;  1OOH A;  1PAL A;  4C0K A;  4CFQ A;  1A03 A;  1CKK A;  4PE7 A;  3SG7 A;  5J3X A;  3WHT B;  3DVJ A;  3HCM A;  1A4P A;  2PAL A;  3C1V A;  1JBA A;  1QX2 A;  2V53 A;  3R1O A;  3GK1 A;  1MR8 A;  1TRF A;  2KHN A;  2M97 A;  5FYX A;  1DTL A;  1XA5 A;  3FE6 A;  2BCB A;  1TCF A;  2I18 A;  2BCX A;  2LUX A;  5G08 A;  1FPW A;  1F4O A;  2JWW A;  3N7H A;  1FW4 A;  2QDI A;  2QEV A;  1UHI A;  5HLV A;  2EC6 C;  2WCH A;  3IQQ A;  3EK4 A;  2BKH B;  1BJF A;  5D3O A;  4PAL A;  2MLE C;  2L5Y A;  1IQ3 A;  2KPH A;  4Q04 A;  4PDZ A;  1REC A;  1XFU O;  2LM5 A;  3UNW A;  4I5K A;  2KAV A;  3S0G A;  3SS4 A;  3OX6 A;  1DJG A;  3O2P A;  4XJK B;  4MN0 A;  2ZFD A;  3QRX A;  1Y1X A;  3OBV A;  1M39 A;  2NZ0 A;  3SS3 A;  1JFJ A;  3KHE A;  1BU3 A;  2TN4 A;  3TZ1 A;  3O4Y A;  1SKT A;  2KYF A;  1JC2 A;  4M2O A;  2KQY A;  2KI6 D;  1TWO A;  2ZND A;  1B8R A;  3BUN B;  1IIO A;  1DQE A;  2LLS A;  5HLO A;  1S1E A;  4I5L B;  1ALV A;  1XYD A;  4INW A;  3CDN A;  4TNC A;  1NX0 A;  2BBM A;  3FWC A;  5HL1 A;  4PCW A;  1BMO A;  1RJV A;  4MSP A;  2EHB A;  1NCZ A;  1C7W A;  1N0Y A;  4KYN A;  1QVI Y;  1KWO B;  3B88 A;  1K9K A;  4CFR A;  1TNW A;  3WNX B;  1U5I B;  1XFW O;  2ZNE A;  3S0F A;  1VRK A;  1OZS A;  1TCO B;  1XVJ A;  3TUY C;  1DJI A;  3OB2 B;  3FE9 A;  3UO9 A;  1J1D A;  3BQ3 A;  1OZO A;  2BEC A;  1BT6 A;  2PMY A;  1K9U A;  4ORC B;  4ETO A;  2F33 A;  1TUZ A;  1FBV A;  3LK0 A;  3LCP C;  3PLF B;  3DF0 B;  4CPV A;  2KFG A;  3EK7 A;  4PE4 A;  3VRR A;  1K90 D;  3AKB A;  4DRW A;  3GK2 A;  1SYM A;  2EGD A;  3NHI A;  1NCX A;  1ZFS A;  1S5G Z;  1P28 A;  4DCK A;  2LVI A;  3BXK A;  1DJY A;  2KLE A; 
#chains in the Genus database with same CATH homology
 2OS8 B;  3EVU A;  2NXQ A;  1KFU L;  2LVV A;  5D7F A;  3CS1 A;  2WC8 A;  4MZJ A;  1YX7 A;  2KI4 C;  2JC2 A;  4YBH B;  4MZK A;  1TNQ A;  2KI6 C;  1M31 A;  2F2P A;  5JOL A;  1WDC C;  3DVM A;  2LE9 B;  1JUO A;  1YUT A;  1F71 A;  1DF0 A;  1QAS A;  1SNL A;  1S5G Y;  4PHK A;  1S6J A;  3VRO A;  1BOC A;  1SK6 D;  1QTX A;  1TIZ A;  3A4U B;  3CR5 X;  2LHI A;  1QX5 B;  1YUR A;  3TS5 B;  2MRD A;  4IL1 A;  3I5F C;  4JQ0 D;  4OR9 B;  2BE6 A;  5AER A;  1B7T Z;  1KQV A;  1B9A A;  2O60 A;  1MF8 B;  4YGB B;  1A75 A;  1FI6 A;  4N5X A;  1YUU A;  2KGB C;  2GGZ A;  1RK9 A;  3AAK A;  1PVA A;  4MBE A;  1DGU A;  1RFJ A;  1XFZ O;  3FIA A;  2JUL A;  2O5G A;  4M2Q A;  2M3W A;  2K0J A;  1XFV O;  3VRP A;  1L7Z A;  4ICB A;  4USL A;  1BR1 B;  1K93 D;  1QV1 A;  1IGV A;  1XK4 C;  2K2A A;  1AP4 A;  5GQQ C;  1B7T Y;  5I2Q A;  3KEV A;  2K7C A;  2BCA A;  1JWD A;  2VRG A;  1A29 A;  2Y4Q A;  2K7B A;  4MVF A;  2Q4U A;  3O6B A;  1JF2 A;  2M1K B;  2M0R A;  1TNP A;  3FS7 A;  5AEQ A;  1SCM C;  2WCF A;  4MEW A;  1F55 A;  1J55 A;  2HQ8 A;  4MLW A;  3EKJ A;  4QJ3 B;  1CDM A;  4YGE B;  1ALW A;  2CT9 A;  4ZCV A;  3JTD C;  1D1O A;  1F54 A;  3BYA A;  3DVE A;  1K95 A;  1PSB A;  1CDP A;  1EL4 A;  2JT0 A;  1UHJ A;  4I5J A;  3SG2 A;  1W7J B;  3SIB A;  4GBA A;  1B4C A;  1IWQ A;  1DJW A;  2LVJ A;  1QS7 A;  3I5I C;  3AKA A;  1EG4 A;  1LKJ A;  5AXI A;  1SPY A;  2KAX A;  2Y1M A;  4BY4 A;  1CFP A;  1AJ5 A;  1LA3 A;  3CTN A;  4GNK B;  1G4Y R;  2JRF A;  2L50 A;  2LAN A;  4AQJ A;  2LCP A;  2ZKM X;  2M1U A;  1K2H A;  1WRK A;  1L2O C;  1S6C A;  2BL0 B;  3F45 A;  3KF9 A;  3LLE A;  1ZMZ A;  5KTY A;  1XK4 A;  1OMD A;  1WLM A;  2FOT A;  1C07 A;  2BKI B;  3D0Y A;  5I2O A;  2K8M B;  4WRI A;  1XO5 A;  1IKU A;  1XFX O;  1NX2 A;  1QVI Z;  1G33 A;  2COL B;  5I2L A;  1S3P A;  5KU1 A;  4OCI A;  4XYN A;  4R1E A;  2LHL A;  2PSR A;  3PSR A;  3SG3 A;  4ORA B;  1CB1 A;  1NX3 A;  1ZOT B;  1J1E A;  1SCV A;  1QXP A;  5AAN A;  3CLN A;  4DIR A;  3EVR A;  2LUC A;  1XFY O;  1AUI B;  3LK1 A;  2M7N A;  3BOW B;  1CLL A;  1S26 D;  2JTZ A;  1LA0 A;  2AUC A;  2MJW B;  1CM1 A;  5JJG A;  4HRE E;  1QIW A;  2LVK A;  2LMT A;  1OQP A;  1DVI A;  3NXA A;  2R2I A;  1CDN A;  2LLT A;  2OTG B;  2FCE A;  3CR2 A;  1S36 A;  1M63 B;  5IBW A;  1KK8 B;  1IJ5 A;  2MBX A;  2SAS A;  1DJH A;  3BUX B;  2F8P A;  5I8N A;  2L4I A;  5DKR A;  1DT7 B;  1BOD A;  1M45 A;  1GJY A;  1YRT B;  4GGF C;  1GGW A;  1DMO A;  1LVC D;  3IF7 A;  1CTR A;  1KWO C;  2MLF C;  1KQM B;  1YTZ C;  2ISD A;  5HKY A;  2KQ6 A;  1J7O A;  2JPT A;  5B8I B;  1NSH A;  3I5G B;  1GQM A;  2KFF A;  5ER4 X;  1PVB A;  2HQW A;  5KSZ A;  1KFX L;  2KBM A;  3GK4 X;  1MXL C;  3I5H B;  1PUL A;  3OX5 A;  1NWD A;  1TTX A;  2RGI A;  2OPO A;  1AHR A;  1BR4 B;  1HT9 A;  1K9P A;  1Y1A A;  2CCM A;  2OS8 C;  2KNE A;  2L5X B;  2NLN A;  1NCY A;  1QLS A;  4HRH A;  2KAY A;  5PAL A;  2AAO A;  1J7P A;  3SG5 A;  1GGZ A;  2F2O A;  3FWB A;  4OV2 A;  3KO0 A;  1KFX S;  2GV5 A;  1RTP 1;  3EKH A;  4YGD B;  2WCB A;  1PSR A;  1TNX A;  1R2U A;  4JWQ A;  4I5N B;  3JVT B;  4U8D A;  5D69 A;  1DJX A;  1Y0V H;  2G2B A;  3TDZ A;  2CNP A;  3KPX A;  1DGV A;  1B8L A;  2M8U A;  1A2X A;  1F4Q A;  2PAS A;  2H61 C;  3K21 A;  4PHJ A;  4GUK A;  3TS5 C;  3ICB A;  1SW8 A;  4M2P A;  5K89 A;  2ZRT A;  1Y6W A;  1KK7 Z;  1G8I A;  3DD4 A;  4C0L A;  2K7D A;  1HQV A;  2QPT A;  1OOJ A;  4GAO A;  4PHM A;  3DF0 A;  1CFD A;  1Q80 A;  3CWG A;  1J7Q A;  1K94 A;  1Y1U A;  4N1G A;  2JTT A;  2MAZ A;  2LMV A;  2D8N A;  3MSE B;  4PHN A;  1EXR A;  2NCO A;  1M46 A;  1YUS A;  2LAP A;  1IQ5 A;  4XJK A;  3A8R A;  3BUM B;  4NDC A;  1SRA A;  1MUX A;  5DKN A;  2Q91 A;  2WOR A;  2JT3 A;  1KK7 Y;  1V1F A;  2B1U A;  4GGN A;  5F6T A;  1JSA A;  1IH0 A;  1S6I A;  3HX4 A;  1EH2 A;  4FTG A;  2Y5I A;  1MQ1 A;  4OVN F;  1K96 A;  4MRX A;  1JFK A;  1NYA A;  2I7A A;  1YVL A;  1EG3 A;  5CSF A;  3DVK A;  4A4B A;  2F3Y A;  5CSN A;  4L9M A;  3ZNI A;  2M29 A;  1K8U A;  1QLK A;  4YI9 A;  2H61 A;  2QAC A;  1AK8 A;  2L0P A;  2WOS A;  2ZRS A;  3EK8 A;  1SL7 A;  2M7L A;  2HET A;  1KSM A;  1UUS A;  1H8B A;  3H4S E;  2ZN9 A;  1SBJ A;  1YVH A;  3EVV A;  2L51 A;  5DKQ A;  5HKZ A;  1SMG A;  2M49 B;  4ZCU A;  1DF0 B;  1IJ6 A;  1FF1 A;  3BUW B;  1QIV A;  3PN7 B;  2AMI A;  4YGA A;  4C0J A;  4NQG A;  2FCD A;  4YRU A;  5BPJ A;  1IRJ A;  1ZAC A;  2P6B B;  1CFC A;  4F0Z B;  1KCY A;  3VGO A;  2KYC A;  2BL0 C;  1YR5 A;  2MHH A;  1B1G A;  1C7V A;  1SL8 A;  1X02 A;  2BBN A;  2IS9 A;  3TUY B;  2JT8 A;  1CMG A;  1WRZ A;  2CXJ A;  2JZI A;  3O78 A;  1A75 B;  1OMV A;  2LC5 A;  1FI5 A;  4UPG A;  2LLU A;  3M0W A;  2K2F A;  3PAT A;  2ZN8 A;  3NSK A;  4GPL B;  4DUQ A;  2L2E A;  3RLZ A;  4PE0 A;  1QV0 A;  4A4C A;  3NSL A;  2KDH A;  4N1F A;  2LNK A;  1TN4 A;  3OB1 B;  4GFT A;  5CSJ A;  1NUB A;  1UWO A;  1ZUZ A;  3PM8 A;  1J7R A;  3PN7 C;  3SJS A;  1EJ3 A;  5ER5 A;  1YRU B;  2FJU B;  2K61 A;  1OSA A;  2A4J A;  2L4H A;  4MZL A;  1NIW A;  1QX7 A;  2MA2 A;  2PVB A;  2LMU A;  1CM4 A;  1NX1 A;  1QJT A;  2KI4 B;  4YGC B;  2PRU A;  1B47 A;  1SL9 A;  1CLB A;  4E68 A;  1BLQ A;  1PRW A;  4NDB A;  1CNP A;  1LIN A;  1WDC B;  1NP8 A;  3AAJ A;  1BF5 A;  2F3Z A;  3E3R A;  1V1G A;  2CBL A;  3PAL A;  1H4B A;  1OE9 B;  1BG1 A;  3TDI A;  1NPQ A;  2JU0 A;  1UHH A;  2OTG C;  3WHU B;  4BY5 A;  2E30 A;  4JPZ B;  3SIA A;  5CPV A;  1KK8 C;  3CGA A;  3SG4 A;  2KSP A;  3I5F B;  4DS7 A;  5TNC A;  1OMR A;  1SR6 B;  3RM1 A;  1RRO A;  2NCP A;  2LP3 A;  2JNF A;  2M9G A;  1CMF A;  1SY9 A;  3WXA A;  4PE1 A;  2HF5 A;  4P2Y B;  2DOQ A;  1KSO A;  1MWN A;  2KBI A;  1RWY A;  3SG6 A;  3CR4 X;  3CZT X;  2JQ6 A;  2K7O A;  1AVS A;  1KQM C;  4FQO A;  4YI8 A;  3VRQ A;  2WND A;  2I2R E;  3IQO A;  3D0Y B;  1IG5 A;  3NSO A;  3I5G C;  1UUR A;  1W7I B;  1KFU S;  1F70 A;  2I94 A;  4GGF A;  2LP2 A;  2JXL A;  2WCE A;  4P5O E;  5CSI A;  1JF0 A;  3BOW A;  3VRN A;  3I5H C;  1SR6 C;  2HPS A;  3PFV A;  1U5I A;  2H2K A;  2KFH A;  4HRG A;  1CFF A;  1SCM B;  3NSI A;  4D1E A;  2GGM A;  2LV7 A;  3D10 A;  4HSZ A;  1YX8 A;  1WLZ A;  1AJ4 A;  2Y1N A;  1DJZ A;  2JOJ A;  1WRL A;  1N2D A;  4CID A;  3ZWH A;  3JTD B;  2JXC A;  4MRY A;  1WY9 A;  5AFP A;  1E8A A;  3BUO B;  4QJ5 B;  1PK0 D;  5HYD A;  1UP5 A;  2L98 A;  3GOF A;  4ORB B;  2E6W A;  3LL8 B;  1CLM A;  1UHN A;  2G9B A;  3I5I B;  3JVT C;  4CLN A;  1TOP A;  2KOT A;  5HKW A;  1MXE A;  1B8C A;  2CTN A;  1F8H A;  1R6P A;  4NDD A;  2SCP A;  2KGR A;  1MHO A;  2BE4 A;  2EC6 B;  4WQ3 A;  1L2O B;  1N65 A;  1QAT A;  3OHM B;  4WQ2 A;  3TDU A;  1ODB A;  2JNX A;  1CDL A;  3OP0 A;  4AQI A;  4QJ4 B;  1LXF C;  4OKH A;  1UHK A;  4AOM A;  4C0K A;  1PAL A;  4CFQ A;  1A03 A;  1CKK A;  4PE7 A;  3SG7 A;  5J3X A;  3WHT B;  3DVJ A;  3HCM A;  1A4P A;  2PAL A;  3C1V A;  1JBA A;  1QX2 A;  2V53 A;  3GK1 A;  1MR8 A;  1TRF A;  2KHN A;  2M97 A;  5FYX A;  1DTL A;  1XA5 A;  2BCB A;  1TCF A;  2I18 A;  2BCX A;  2LUX A;  5G08 A;  1FPW A;  1F4O A;  2JWW A;  1FW4 A;  1UHI A;  5HLV A;  2EC6 C;  3IQQ A;  3EK4 A;  2BKH B;  1BJF A;  1IQ3 A;  4PAL A;  2MLE C;  4Q04 A;  4PDZ A;  1REC A;  1XFU O;  2LM5 A;  4I5K A;  2KAV A;  3OX6 A;  1DJG A;  3O2P A;  4MN0 A;  2ZFD A;  3QRX A;  1Y1X A;  1M39 A;  2NZ0 A;  1JFJ A;  3KHE A;  1BU3 A;  2TN4 A;  3TZ1 A;  3O4Y A;  1SKT A;  2KYF A;  1JC2 A;  4M2O A;  2KQY A;  2KI6 D;  2ZND A;  3BUN B;  1B8R A;  2LLS A;  5HLO A;  1S1E A;  4I5L B;  1ALV A;  1XYD A;  4TNC A;  1NX0 A;  2BBM A;  3FWC A;  4PCW A;  1BMO A;  1RJV A;  4MSP A;  2EHB A;  1NCZ A;  1C7W A;  1N0Y A;  1QVI Y;  1KWO B;  1K9K A;  4CFR A;  1TNW A;  3WNX B;  1U5I B;  1XFW O;  2ZNE A;  1VRK A;  1OZS A;  1TCO B;  1XVJ A;  3TUY C;  1DJI A;  3OB2 B;  1J1D A;  3BQ3 A;  1OZO A;  2BEC A;  1BT6 A;  2PMY A;  1K9U A;  4ORC B;  4ETO A;  2F33 A;  1FBV A;  3LK0 A;  3LCP C;  3PLF B;  3DF0 B;  4CPV A;  2KFG A;  3EK7 A;  4PE4 A;  3VRR A;  1K90 D;  3AKB A;  4DRW A;  3GK2 A;  1SYM A;  2EGD A;  1NCX A;  1ZFS A;  1S5G Z;  4DCK A;  2LVI A;  3BXK A;  1DJY A;  4XJK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...