2KSPA

Mechanism for the selective interaction of c-terminal eh-domain proteins with specific npf-containing partners
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
105
structure length
105
Chain Sequence
GPLGSDDVEWVVGKDKPTYDEIFYTLSPVNGKITGANAKKEMVKSKLPNTVLGKIWKLADVDKDGLLDDEEFALANHLIKVKLEGHELPADLPPHLVPPSKRRHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EH domain-containing protein 1
publication title Mechanism for the selective interaction of C-terminal Eps15 homology domain proteins with specific Asn-Pro-Phe-containing partners.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 32
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2010-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12763 EF-hand_4 Cytoskeletal-regulatory complex EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2kspA00
1N2DA 1OSAA 3PM8A 3ICBA 3EKJA 1S5GY 3PN7C 1UHKA 1XFXO 4OKHA 4GBAA 2PRUA 4YBHB 3I5IB 5DKRA 2EC6B 1JFJA 4JQ0D 3LK0A 1CFFA 2B1UA 1DGUA 1QLSA 5D69A 1B4CA 1LA3A 2M29A 4C0LA 3VGOA 1WDCB 4MVFA 2KI6D 2MRDA 2FJUB 2G9BA 4AOMA 1KFUS 3CWGA 1BG1A 3TUYB 2PALA 1AP4A 1J55A 3O6BA 1L2OB 4M2PA 4TNCA 1KWOC 2EGDA 1EL4A 1F4OA 1LA0A 2LVJA 1H8BA 3VRPA 3WXAA 1F70A 1AJ5A 1TN4A 2WOSA 3JTDB 4NDBA 1WRLA 1JSAA 2SASA 4ORAB 1YUSA 3CR5X 1C7WA 1DF0A 1WY9A 5KSZA 2RGIA 5HLOA 3VROA 1SYMA 4MLWA 4XYNA 2JT0A 2BBNA 2P6BB 3DVEA 3DD4A 1QX5B 1TNPA 1TCFA 3OB1B 3C1VA 5AXIA 2GV5A 3LCPC 4ORCB 1SKTA 5DKNA 1M46A 3KPXA 5KTYA 2KYFA 3SIAA 1X02A 3BYAA 4YGDB 2ZRTA 2JT3A 1SMGA 1UHJA 2CT9A 2K7DA 2A4JA 4USLA 2F2OA 1CKKA 1J1DA 1YTZC 2HQWA 4E68A 1DTLA 1UHIA 1CDLA 2KAXA 5IBWA 5AEQA 4MN0A 1ODBA 2IS9A 2LNKA 3D0YA 3I5FB 3TZ1A 3JVTB 2JRFA 1MXLC 2MJWB 2Y1NA 1PULA 3D10A 5TNCA 3WHTB 2JZIA 4GFTA 2HF5A 2K0JA 3NSKA 1QV1A 1S26D 2LHLA 2LLUA 2NXQA 4FTGA 1CM4A 3KF9A 2BL0C 1S3PA 1WLMA 4OR9B 1XK4A 1OQPA 1YUUA 1B7TY 3CZTX 3PFVA 3SG2A 1DJXA 1MQ1A 1IRJA 1KK8B 1KQMC 2LUCA 1KK7Z 1OOJA 1W7IB 4YGCB 1JFKA 1IWQA 4YI8A 3NSLA 3PALA 4P5OE 4CFQA 1CDNA 1OMDA 1SNLA 2BBMA 2BCXA 1QATA 1SBJA 1RECA 1YRTB 4PHMA 2LV7A 1YURA 1G4YR 1RTP1 4CFRA 3IQQA 1KSOA 1YR5A 3F45A 1CNPA 1UHHA 4MBEA 4DIRA 2PVBA 1Y0VH 3OX6A 4WRIA 2KFHA 1DJYA 2G2BA 4PHKA 2F3ZA 3DVMA 1XFYO 1S5GZ 3TS5C 3PATA 4BY5A 1S6JA 1M39A 1MF8B 3PLFB 5HYDA 2Y5IA 2M7LA 1TRFA 1ZMZA 1A03A 1FBVA 2DOQA 1G33A 4A4BA 2WCBA 2JULA 3D0YB 1BODA 1F71A 3AKAA 2F8PA 1NIWA 3BOWA 4ZCUA 3DVKA 1CB1A 1F54A 2K2AA 1NX0A 4OVNF 4WQ2A 2LP3A 5AERA 2BCAA 1NYAA 4GUKA 4R1EA 2GGZA 2LVIA 4ETOA 1EG3A 1YVLA 1RFJA 3FWBA 4HSZA 1TOPA 4C0JA 1HT9A 1BT6A 1OMVA 4YGAA 1J7PA 2KBMA 2R2IA 2F33A 4FQOA 1Y1UA 2KI4B 3CR4X 2BE4A 1U5IA 5I8NA 1B9AA 2E30A 2JWWA 1BJFA 3BUOB 1A75B 1C07A 1CFPA 2L2EA 5D7FA 4Q04A 1K9PA 1XYDA 3GK4X 1SPYA 5I2OA 1CDMA 2KBIA 1JF2A 1MHOA 3BUNB 1CMFA 2SCPA 1IG5A 2M0RA 1TNXA 1AJ4A 2BKHB 2COLB 1PSBA 1OMRA 1Y1AA 1QTXA 1TTXA 2K61A 5HKWA 3O2PA 3EK4A 1DJZA 2LCPA 1MXEA 2GGMA 2OPOA 1XFZO 2LMUA 1SL8A 2KHNA 3KHEA 2PSRA 1HQVA 1YRUB 1UUSA 1A2XA 1JWDA 1DJIA 1CLMA 5HKZA 1IQ3A 2K8MB 4CPVA 3SG5A 1DMOA 4DUQA 2NCPA 3O4YA 2JXCA 5GQQC 1PRWA 4MRXA 1DJGA 4I5KA 3OHMB 2KDHA 1QX2A 1PSRA 4PHJA 5CSNA 3EK8A 4CLNA 3BUXB 1EG4A 1XFUO 3MSEB 3OB2B 5AANA 3SIBA 2JNXA 1SCMB 3DF0A 1GGZA 1SY9A 2BKIB 2PMYA 1NPQA 3AKBA 1BOCA 1B7TZ 4CIDA 2KFFA 2KGBC 4MEWA 3KO0A 4PE1A 3RM1A 4WQ3A 4YRUA 4NDDA 2JXLA 1ZUZA 1GQMA 4NQGA 3RLZA 2Y4QA 2ZNDA 1R6PA 3CS1A 2EHBA 2LANA 1SR6B 1B1GA 1U5IB 1NWDA 2JNFA 1JF0A 1QVIY 3LK1A 4OV2A 2LMTA 2L4IA 3I5IC 1BR4B 1ALVA 2EC6C 1CTRA 2ZFDA 1NX3A 1BLQA 1E8AA 4QJ3B 1UWOA 2JC2A 2VRGA 3BUWB 3NSIA 2WCEA 2M49B 2MA2A 5I2QA 1SK6D 1NCXA 2LLSA 1WDCC 1LVCD 1B8CA 3DVJA 2QPTA 3WHUB 1AK8A 1V1GA 3EKHA 1M45A 3GOFA 1OZSA 4MZLA 4GGFC 3TUYC 4XJKA 5G08A 3IF7A 1L2OC 1KSMA 1RROA 4GAOA 4ORBB 1NX2A 3I5HB 3ZWHA 1LXFC 2ZNEA 3JTDC 1CLBA 1Q80A 2FCEA 3SG7A 4AQJA 4ICBA 5K89A 4N5XA 1A29A 1TCOB 2HETA 3CR2A 2LC5A 2K7CA 4IL1A 2NCOA 4N1FA 1DF0B 2BE6A 1IJ5A 1KFUL 1QV0A 4I5NB 4JWQA 2KAVA 1NP8A 2L50A 4AQIA 1TNQA 1LINA 2ZRSA 1J7RA 1K94A 4U8DA 3FIAA 1UP5A 4I5JA 4M2OA 1YVHA 2OTGB 1SL9A 2KAYA 4A4CA 4QJ4B 5JJGA 1SR6C 1V1FA 4PE7A 1QX7A 1YX7A 4GPLB 1ZFSA 2OS8B 3I5GB 3A4UB 3GK1A 3I5FC 3EVVA 2FOTA 2KOTA 3JVTC 3PN7B 5HLVA 2JTTA 1B47A 3SG3A 1D1OA 2KI6C 4GGNA 3K21A 2HQ8A 1KCYA 2LM5A 5FYXA 2NZ0A 1J7OA 1UHNA 5HKYA 1K96A 1TIZA 4GGFA 1BF5A 2Y1MA 2JTZA 2Q4UA 3AAKA 2JPTA 1KK8C 2H61C 1SRAA 4N1GA 3SJSA 1KWOB 2NLNA 1PK0D 2LVKA 3VRNA 1NSHA 1J1EA 1F55A 2M1UA 5DKQA 3ZNIA 1IJ6A 2PASA 2LHIA 2KQYA 1JBAA 1ALWA 2L0PA 2K7BA 1WLZA 3HX4A 3O78A 1NUBA 1QASA 1DVIA 2H2KA 2I94A 2QACA 2L51A 1H4BA 3BQ3A 1QIVA 2WNDA 4GNKB 1OZOA 3VRRA 1CLLA 1MWNA 2CXJA 2BCBA 1OE9B 1MR8A 2JU0A 1BU3A 1QVIZ 2M8UA 3M0WA 1KFXL 2MBXA 1RJVA 2KYCA 2M3WA 4YI9A 5I2LA 1R2UA 4M2QA 1WRZA 2CNPA 2L98A 4DCKA 3LL8B 1EXRA 1B8RA 2I2RE 5B8IB 4HRHA 5BPJA 1ZOTB 1EH2A 4ZCVA 1IGVA 3SG4A 1BR1B 3BOWB 1VRKA 1S6IA 4MZKA 2L4HA 1NCZA 1EJ3A 1K95A 3EK7A 1S1EA 5CSJA 4YGBB 1JC2A 1M31A 2BL0B 1PVBA 1XK4C 1XFVO 1AUIB 1S6CA 2H61A 1YX8A 4YGEB 2KI4C 2JOJA 3LLEA 3WNXB 2ZKMX 1KQMB 1CM1A 2O60A 3E3RA 2K2FA 2KSPA 4MRYA 4DRWA 2JQ6A 5ER4X 1QS7A 2WCFA 2E6WA 5ER5A 2M9GA 1K9UA 2ZN9A 3EVRA 1FI5A 1LKJA 1FF1A 3OX5A 1SCVA 2KQ6A 2HPSA 2LAPA 3PSRA 2CTNA 1XA5A 1CDPA 2V53A 1N0YA 2M1KB 1F8HA 4PE0A 5CPVA 1Y6WA 5KU1A 3TS5B 1AHRA 1XFWO 1YUTA 1C7VA 1TNWA 2MAZA 2LMVA 4JPZB 4PHNA 4HREE 1DGVA 1DJWA 2I18A 2KNEA 1B8LA 2F2PA 2M7NA 2WC8A 5JOLA 1K9KA 1SCMC 1SW8A 3VRQA 3HCMA 1NX1A 1KQVA 1Y1XA 2WORA 1XVJA 2JT8A 3DF0B 1J7QA 1DJHA 1IH0A 3BXKA 1DT7B 1RK9A 2K7OA 4P2YB 2CBLA 2FCDA 2CCMA 4F0ZB 1NCYA 4OCIA 1AVSA 1A75A 1CFCA 3CLNA 4HRGA 4NDCA 4C0KA 2L5XB 3QRXA 5F6TA 3TDUA 1QIWA 4PDZA 2I7AA 1KFXS 2LVVA 2MLEC 4I5LB 5J3XA 4MSPA 2TN4A 1XO5A 1K93D 1ZACA 5AFPA 1MUXA 3IQOA 2LP2A 1PALA 2LLTA 3SG6A 3KEVA 1GJYA 2KGRA 1GGWA 2AAOA 2O5GA 1SL7A 1FPWA 2M97A 2Q91A 3NXAA 3I5HC 4XJKB 1M63B 5PALA 2BECA 1QXPA 1N65A 3NSOA 2KFGA 1QLKA 1A4PA 2ISDA 4BY4A 3TDIA 3AAJA 1G8IA 1S36A 4QJ5B 2AUCA 2MHHA 2MLFC 4PALA 1K2HA 1KK7Y 4L9MA 2LUXA 4DS7A 1F4QA 1W7JB 1WRKA 2LE9B 5CSFA 3GK2A 3A8RA 1JUOA 1UURA 5CSIA 2F3YA 2ZN8A 4PE4A 4MZJA 1K90D 1RWYA 1IQ5A 4UPGA 4D1EA 1CMGA 2D8NA 1BMOA 3OP0A 2OTGC 3TDZA 1IKUA 3CTNA 3EVUA 3H4SE 1FW4A 1PVAA 4PCWA 1CFDA 3BUMB 3FS7A 1L7ZA 2OS8C 3FWCA 3I5GC 1FI6A 3CGAA 1K8UA 2AMIA 1QJTA
chains in the Genus database with same CATH superfamily
1N2DA 1OSAA 3PM8A 3ICBA 3EKJA 1S5GY 3PN7C 1UHKA 1XFXO 4OKHA 4GBAA 2PRUA 4YBHB 3I5IB 5DKRA 2EC6B 1JFJA 4JQ0D 3LK0A 1CFFA 2B1UA 3Q8IA 1DGUA 1QLSA 5D69A 1B4CA 1LA3A 2M29A 4C0LA 3VGOA 1WDCB 3DY9A 4MVFA 2KI6D 2MRDA 2FJUB 4F7FA 2G9BA 4AOMA 1KFUS 2WCLA 3CWGA 1BG1A 3TUYB 2PALA 3D74A 1AP4A 1J55A 3O6BA 1L2OB 4M2PA 4TNCA 1OOGA 1KWOC 2EGDA 1EL4A 1F4OA 1LA0A 2LVJA 1H8BA 3VRPA 3WXAA 1F70A 1AJ5A 3K1EA 1TN4A 2WOSA 3JTDB 4NDBA 1WRLA 1JSAA 2SASA 4ORAB 1YUSA 3CR5X 1C7WA 1DF0A 1WY9A 5KSZA 2RGIA 5HLOA 3VROA 1SYMA 4MLWA 4XYNA 2JT0A 2BBNA 2P6BB 3DVEA 3DD4A 1QX5B 1TNPA 1TCFA 3OB1B 3C1VA 5AXIA 2GV5A 3LCPC 4ORCB 1SKTA 5DKNA 1M46A 5I94A 1GM0A 3KPXA 3UNWA 5KTYA 2KYFA 3SIAA 1X02A 3BYAA 4YGDB 2ZRTA 2JT3A 1SMGA 1UHJA 2CT9A 3BFAA 2K7DA 2A4JA 4USLA 2F2OA 1CKKA 1J1DA 1YTZC 2HQWA 4E68A 1DTLA 1UHIA 1CDLA 2KAXA 5IBWA 5AEQA 4MN0A 1ODBA 2IS9A 2LNKA 3D0YA 3I5FB 3TZ1A 3JVTB 2JRFA 1MXLC 2MJWB 2Y1NA 1PULA 3D10A 5TNCA 3WHTB 2JZIA 4GFTA 2HF5A 2K0JA 3NSKA 1QV1A 1S26D 1QWVA 2LHLA 2LLUA 2NXQA 1C3YA 4FTGA 1CM4A 3KF9A 4PT1A 2BL0C 1S3PA 1WLMA 4OR9B 1XK4A 1OQPA 3R1VA 1YUUA 1B7TY 3CZTX 3PFVA 3SG2A 1DJXA 1MQ1A 1XFRA 1IRJA 1KK8B 1KQMC 2LUCA 1KK7Z 1OOJA 1W7IB 4YGCB 1JFKA 1IWQA 3R1OA 4YI8A 3NSLA 3PALA 4P5OE 4CFQA 1CDNA 1OMDA 1SNLA 2BBMA 2BCXA 1QATA 1SBJA 1RECA 1YRTB 4PHMA 2LV7A 1YURA 1G4YR 1RTP1 4CFRA 3SS4A 3IQQA 1KSOA 1YR5A 3F45A 1CNPA 1UHHA 2KLDA 4MBEA 4DIRA 2PVBA 1Y0VH 3OX6A 4WRIA 2KFHA 1DJYA 2G2BA 4PHKA 2F3ZA 3DVMA 1XFYO 5FI2A 1S5GZ 1C3ZA 3TS5C 2P70A 2QEBA 3PATA 4BY5A 1S6JA 1M39A 1MF8B 3PLFB 5HYDA 2Y5IA 2M7LA 1TRFA 1ZMZA 1A03A 4FQTA 1FBVA 2DOQA 1G33A 4A4BA 2WCBA 3CZ2A 3IVTA 2JULA 3D0YB 1BODA 1F71A 3AKAA 2F8PA 1NIWA 3BOWA 4ZCUA 3DVKA 1CB1A 1F54A 2K2AA 1NX0A 4OVNF 3CZ1A 4WQ2A 2LP3A 5AERA 2BCAA 1NYAA 4GUKA 4R1EA 2GGZA 2LVIA 4ETOA 1EG3A 1YVLA 1RFJA 2P71A 3FWBA 4HSZA 1TOPA 2WCJA 4C0JA 1HT9A 1BT6A 1OMVA 4YGAA 1J7PA 2KBMA 2R2IA 2F33A 4FQOA 1Y1UA 2KI4B 3CR4X 2BE4A 1U5IA 3S0BA 1B9AA 2E30A 5I8NA 2JWWA 1BJFA 3BUOB 1A75B 1C07A 1CFPA 2L2EA 5D7FA 4Q04A 1K9PA 1XYDA 3GK4X 1SPYA 2QEOA 5I2OA 1CDMA 2KBIA 1JF2A 1MHOA 3FE9A 3BUNB 1CMFA 2SCPA 1IG5A 2M0RA 1TNXA 1AJ4A 2BKHB 2COLB 1PSBA 1OMRA 1Y1AA 1QTXA 1TTXA 2K61A 5HKWA 3O2PA 3EK4A 1DJZA 2LCPA 1MXEA 2GGMA 2OPOA 1XFZO 1Z4HA 2LMUA 1SL8A 2KHNA 3KHEA 2PSRA 1HQVA 1YRUB 1UUSA 1A2XA 4KYNA 1JWDA 1DJIA 1CLMA 5HKZA 1IQ3A 3FE8A 2K8MB 4CPVA 3SG5A 1DMOA 4DUQA 2NCPA 1DELA 3O4YA 2JXCA 5GQQC 3QMEA 1DEKA 1PRWA 4MRXA 1DJGA 4I5KA 3OHMB 2KDHA 1QX2A 1PSRA 4PHJA 5CSNA 3EK8A 4CLNA 3BUXB 1EG4A 1XFUO 3MSEB 3OB2B 5AANA 3SIBA 2JNXA 1SCMB 3DF0A 1GGZA 1SY9A 2BKIB 2PMYA 1NPQA 3AKBA 1BOCA 1B7TZ 4CIDA 2KFFA 2KGBC 3OGNA 3KO0A 4MEWA 4PE1A 3RM1A 3CDNA 4WQ3A 3L47A 4YRUA 3BFHA 4NDDA 2JXLA 1ZUZA 1GQMA 4NQGA 3RLZA 3N7HA 2Y4QA 2ZNDA 1R6PA 3CS1A 2EHBA 2LANA 1SR6B 5FI7A 2GTEA 1B1GA 1U5IB 1NWDA 2JNFA 1JF0A 1QVIY 3LK1A 4OV2A 2LMTA 2L4IA 3I5IC 1BR4B 1ALVA 2EC6C 3FE6A 1CTRA 2ZFDA 1NX3A 1BLQA 1E8AA 3B7AA 4QJ3B 1UWOA 1TUZA 2JC2A 2VRGA 3BUWB 2WCEA 3NSIA 2M49B 2MA2A 5I2QA 1SK6D 1NCXA 2LLSA 1WDCC 1LVCD 1B8CA 3DVJA 2QPTA 3S0AA 3WHUB 1AK8A 1V1GA 3EKHA 1M45A 3BFBA 1OZSA 1DQEA 3GOFA 4GGFC 4MZLA 4XJKA 5G08A 3TUYC 3IF7A 1L2OC 1KSMA 1RROA 4GAOA 4ORBB 1NX2A 3I5HB 3ZWHA 1LXFC 2ZNEA 2YGUA 3JTDC 1CLBA 1Q80A 2FCEA 2L5YA 4IJ7A 3SG7A 4AQJA 4ICBA 3B88A 5K89A 4N5XA 1A29A 2L2CA 1TCOB 2HETA 3DYEA 3CR2A 2LC5A 2K7CA 4IL1A 2NCOA 4N1FA 1DF0B 2BE6A 1IJ5A 3CABA 1KFUL 1QV0A 2H8VA 4I5NB 2KAVA 4JWQA 1NP8A 2L50A 4AQIA 1TNQA 1LINA 2ZRSA 1J7RA 1K94A 3D73A 4U8DA 3FIAA 1UP5A 4I5JA 4M2OA 1YVHA 3S0FA 2OTGB 1SL9A 2KAYA 4A4CA 4QJ4B 5JJGA 1SR6C 1V1FA 4PE7A 1QX7A 1YX7A 4GPLB 1ZFSA 2OS8B 3I5GB 4JKTA 3A4UB 3GK1A 3I5FC 3EVVA 2FOTA 2KOTA 3JVTC 3PN7B 5HLVA 2JTTA 1B47A 3SG3A 1D1OA 2KI6C 4GGNA 3K21A 2HQ8A 1KCYA 2LM5A 5FYXA 2NZ0A 1J7OA 1UHNA 5HKYA 3NGVA 1K96A 1TIZA 4GGFA 1BF5A 1OOFA 3D77A 2Y1MA 3PJIA 2JTZA 2Q4UA 3AAKA 2JPTA 1KK8C 2H61C 1SRAA 4N1GA 3SJSA 2WCKA 1KWOB 2NLNA 1PK0D 2LVKA 3PM2A 3VRNA 1NSHA 1J1EA 1F55A 2M1UA 5DKQA 3ZNIA 1IJ6A 2PASA 2LHIA 2KQYA 5HL1A 1JBAA 1ALWA 2L0PA 2K7BA 1WLZA 3HX4A 3O78A 1NUBA 1QASA 1DVIA 2H2KA 2I94A 2QACA 2L51A 1H4BA 3BQ3A 1QIVA 2WNDA 3VB1A 4GNKB 1TUJA 1OZOA 3VRRA 1CLLA 1MWNA 2CXJA 2BCBA 1OE9B 1MR8A 2JU0A 1BU3A 4INXA 1QVIZ 2M8UA 3M0WA 1KFXL 2MBXA 1RJVA 2KYCA 2M3WA 2ERBA 3R1PA 4YI9A 1T14A 5I2LA 1R2UA 3S0GA 4M2QA 1WRZA 2CNPA 2L98A 2QDIA 4DCKA 3LL8B 1EXRA 1B8RA 2PYQA 2I2RE 1IIOA 5B8IB 4HRHA 2WC5A 3DZTA 5BPJA 1ZOTB 1EH2A 4ZCVA 1IGVA 3SG4A 1BR1B 3BOWB 1VRKA 1S6IA 4MZKA 2BAPA 1NCZA 1EJ3A 2L4HA 1K95A 1P28A 3D76A 3EK7A 1S1EA 5CSJA 4YGBB 2WCMA 1JC2A 1M31A 2BL0B 1PVBA 1OW4A 3UO9A 1XK4C 1XFVO 1AUIB 1S6CA 2H61A 1YX8A 3CZ0A 3V2LA 4YGEB 2KI4C 2JOJA 3LLEA 3WNXB 2ZKMX 1KQMB 1Z2CB 1CM1A 2O60A 3E3RA 2K2FA 2KSPA 4MRYA 4DRWA 2JQ6A 5ER4X 1QS7A 2WCFA 2E6WA 5ER5A 2M9GA 1K9UA 2ZN9A 1OOHA 3EVRA 4OZDA 3B6XA 5D3OA 1FI5A 1LKJA 1FF1A 3OX5A 1SCVA 2KQ6A 2JPOA 2HPSA 2KPHA 2LAPA 3PSRA 2CTNA 2QEVA 1XA5A 1CDPA 2V53A 3L4LA 1N0YA 3S0EA 2M1KB 1F8HA 4PE0A 5CPVA 1Y6WA 1OOIX 5KU1A 3TS5B 1AHRA 1XFWO 1YUTA 1LS8A 1TNWA 1C7VA 2MAZA 2LMVA 1ORGA 2FJYA 4JPZB 4PHNA 4HREE 4INWA 1DGVA 1DJWA 2I18A 2KNEA 3D78A 1B8LA 2F2PA 2M7NA 2WC8A 5JOLA 1K9KA 1SCMC 1SW8A 3VRQA 3HCMA 1NX1A 1TWOA 1Y1XA 2WORA 3CYZA 1XVJA 3DXLA 1KQVA 2JT8A 3DF0B 1J7QA 1DJHA 1IH0A 3BXKA 3R72A 1DT7B 1RK9A 2K7OA 3B86A 4P2YB 2CBLA 2FCDA 2CCMA 4F0ZB 1NCYA 2BNXA 4OCIA 3RZSA 1AVSA 1A75A 1CFCA 3CLNA 4HRGA 4NDCA 4C0KA 2L5XB 3B87A 3QRXA 5F6TA 2WC6A 3SS3A 3TDUA 1QIWA 4PDZA 2I7AA 4JD9A 1KFXS 2LVVA 2MLEC 4I5LB 3BJHA 1SSEB 2PQLA 5J3XA 4MSPA 2TN4A 1XO5A 2QEHA 1K93D 1ZACA 5AFPA 1MUXA 3IQOA 5EL2A 2LP2A 1DC1A 1PALA 2LLTA 3SG6A 3KEVA 1GJYA 2KGRA 1GGWA 2AAOA 2O5GA 1SL7A 1FPWA 3S0DA 2M97A 2Q91A 3NXAA 3I5HC 4XJKB 1W9ZA 1M63B 5PALA 2BECA 1QXPA 1N65A 3NSOA 2KFGA 1QLKA 1A4PA 2ISDA 4BY4A 3TDIA 3AAJA 1G8IA 1S36A 4QJ5B 2AUCA 2MHHA 2MLFC 4PALA 3L4AA 1KK7Y 4L9MA 2LUXA 4DS7A 1K2HA 1F4QA 1W7JB 1WRKA 2LE9B 5CSFA 2KLEA 3GK2A 3A8RA 1JUOA 1UURA 3D75A 5CSIA 2F3YA 2ZN8A 4PE4A 5DICA 3NHIA 4MZJA 1K90D 1RWYA 1IQ5A 3OBVA 5FI6A 4D1EA 4UPGA 1CMGA 2D8NA 1BMOA 3OP0A 3SS5A 3O4XA 2OTGC 3TDZA 1IKUA 2K60A 3CTNA 3EG5B 3EVUA 3H4SE 1FW4A 1PVAA 3NHTA 4PCWA 1CFDA 2WCHA 3BUMB 3FS7A 1L7ZA 2OS8C 3FWCA 3I5GC 1FI6A 3CGAA 1K8UA 2AMIA 1QJTA
chains in the Genus database with same CATH topology
1N2DA 1OSAA 3PM8A 3ICBA 3EKJA 1S5GY 3PN7C 1UHKA 1XFXO 4OKHA 4GBAA 2PRUA 4YBHB 3I5IB 5DKRA 2EC6B 1JFJA 4JQ0D 3LK0A 1CFFA 2B1UA 1DGUA 1QLSA 5D69A 1B4CA 1LA3A 2M29A 4C0LA 3VGOA 1WDCB 4MVFA 2KI6D 2MRDA 2FJUB 2G9BA 4AOMA 1KFUS 3CWGA 1BG1A 3TUYB 2PALA 1AP4A 1J55A 3O6BA 1L2OB 4M2PA 4TNCA 1KWOC 2EGDA 1EL4A 1F4OA 1LA0A 2LVJA 1H8BA 3VRPA 3WXAA 1F70A 1AJ5A 1TN4A 2WOSA 3JTDB 4NDBA 1WRLA 1JSAA 2SASA 4ORAB 1YUSA 3CR5X 1C7WA 1DF0A 1WY9A 5KSZA 2RGIA 5HLOA 3VROA 1SYMA 4MLWA 4XYNA 2JT0A 2BBNA 2P6BB 3DVEA 3DD4A 1QX5B 1TNPA 1TCFA 3OB1B 3C1VA 5AXIA 2GV5A 3LCPC 4ORCB 1SKTA 5DKNA 1M46A 3KPXA 5KTYA 2KYFA 3SIAA 1X02A 3BYAA 4YGDB 2ZRTA 2JT3A 1SMGA 1UHJA 2CT9A 2K7DA 2A4JA 4USLA 2F2OA 1CKKA 1J1DA 1YTZC 2HQWA 4E68A 1DTLA 1UHIA 1CDLA 2KAXA 5IBWA 5AEQA 4MN0A 1ODBA 2IS9A 2LNKA 3D0YA 3I5FB 3TZ1A 3JVTB 2JRFA 1MXLC 2MJWB 2Y1NA 1PULA 3D10A 5TNCA 3WHTB 2JZIA 4GFTA 2HF5A 2K0JA 3NSKA 1QV1A 1S26D 2LHLA 2LLUA 2NXQA 4FTGA 1CM4A 3KF9A 2BL0C 1S3PA 1WLMA 4OR9B 1XK4A 1OQPA 1YUUA 1B7TY 3CZTX 3PFVA 3SG2A 1DJXA 1MQ1A 1IRJA 1KK8B 1KQMC 2LUCA 1KK7Z 1OOJA 1W7IB 4YGCB 1JFKA 1IWQA 4YI8A 3NSLA 3PALA 4P5OE 4CFQA 1CDNA 1OMDA 1SNLA 2BBMA 2BCXA 1QATA 1SBJA 1RECA 1YRTB 4PHMA 2LV7A 1YURA 1G4YR 1RTP1 4CFRA 3IQQA 1KSOA 1YR5A 3F45A 1CNPA 1UHHA 4MBEA 4DIRA 2PVBA 1Y0VH 3OX6A 4WRIA 2KFHA 1DJYA 2G2BA 4PHKA 2F3ZA 3DVMA 1XFYO 1S5GZ 3TS5C 3PATA 4BY5A 1S6JA 1M39A 1MF8B 3PLFB 5HYDA 2Y5IA 2M7LA 1TRFA 1ZMZA 1A03A 1FBVA 2DOQA 1G33A 4A4BA 2WCBA 2JULA 3D0YB 1BODA 1F71A 3AKAA 2F8PA 1NIWA 3BOWA 4ZCUA 3DVKA 1CB1A 1F54A 2K2AA 1NX0A 4OVNF 4WQ2A 2LP3A 5AERA 2BCAA 1NYAA 4GUKA 4R1EA 2GGZA 2LVIA 4ETOA 1EG3A 1YVLA 1RFJA 3FWBA 4HSZA 1TOPA 4C0JA 1HT9A 1BT6A 1OMVA 4YGAA 1J7PA 2KBMA 2R2IA 2F33A 4FQOA 1Y1UA 2KI4B 3CR4X 2BE4A 1U5IA 5I8NA 1B9AA 2E30A 2JWWA 1BJFA 3BUOB 1A75B 1C07A 1CFPA 2L2EA 5D7FA 4Q04A 1K9PA 1XYDA 3GK4X 1SPYA 5I2OA 1CDMA 2KBIA 1JF2A 1MHOA 3BUNB 1CMFA 2SCPA 1IG5A 2M0RA 1TNXA 1AJ4A 2BKHB 2COLB 1PSBA 1OMRA 1Y1AA 1QTXA 1TTXA 2K61A 5HKWA 3O2PA 3EK4A 1DJZA 2LCPA 1MXEA 2GGMA 2OPOA 1XFZO 2LMUA 1SL8A 2KHNA 3KHEA 2PSRA 1HQVA 1YRUB 1UUSA 1A2XA 1JWDA 1DJIA 1CLMA 5HKZA 1IQ3A 2K8MB 4CPVA 3SG5A 1DMOA 4DUQA 2NCPA 3O4YA 2JXCA 5GQQC 1PRWA 4MRXA 1DJGA 4I5KA 3OHMB 2KDHA 1QX2A 1PSRA 4PHJA 5CSNA 3EK8A 4CLNA 3BUXB 1EG4A 1XFUO 3MSEB 3OB2B 5AANA 3SIBA 2JNXA 1SCMB 3DF0A 1GGZA 1SY9A 2BKIB 2PMYA 1NPQA 3AKBA 1BOCA 1B7TZ 4CIDA 2KFFA 2KGBC 4MEWA 3KO0A 4PE1A 3RM1A 4WQ3A 4YRUA 4NDDA 2JXLA 1ZUZA 1GQMA 4NQGA 3RLZA 2Y4QA 2ZNDA 1R6PA 3CS1A 2EHBA 2LANA 1SR6B 1B1GA 1U5IB 1NWDA 2JNFA 1JF0A 1QVIY 3LK1A 4OV2A 2LMTA 2L4IA 3I5IC 1BR4B 1ALVA 2EC6C 1CTRA 2ZFDA 1NX3A 1BLQA 1E8AA 4QJ3B 1UWOA 2JC2A 2VRGA 3BUWB 3NSIA 2WCEA 2M49B 2MA2A 5I2QA 1SK6D 1NCXA 2LLSA 1WDCC 1LVCD 1B8CA 3DVJA 2QPTA 3WHUB 1AK8A 1V1GA 3EKHA 1M45A 3GOFA 1OZSA 4MZLA 4GGFC 3TUYC 4XJKA 5G08A 3IF7A 1L2OC 1KSMA 1RROA 4GAOA 4ORBB 1NX2A 3I5HB 3ZWHA 1LXFC 2ZNEA 3JTDC 1CLBA 1Q80A 2FCEA 3SG7A 4AQJA 4ICBA 5K89A 4N5XA 1A29A 1TCOB 2HETA 3CR2A 2LC5A 2K7CA 4IL1A 2NCOA 4N1FA 1DF0B 2BE6A 1IJ5A 1KFUL 1QV0A 4I5NB 4JWQA 2KAVA 1NP8A 2L50A 4AQIA 1TNQA 1LINA 2ZRSA 1J7RA 1K94A 4U8DA 3FIAA 1UP5A 4I5JA 4M2OA 1YVHA 2OTGB 1SL9A 2KAYA 4A4CA 4QJ4B 5JJGA 1SR6C 1V1FA 4PE7A 1QX7A 1YX7A 4GPLB 1ZFSA 2OS8B 3I5GB 3A4UB 3GK1A 3I5FC 3EVVA 2FOTA 2KOTA 3JVTC 3PN7B 5HLVA 2JTTA 1B47A 3SG3A 1D1OA 2KI6C 4GGNA 3K21A 2HQ8A 1KCYA 2LM5A 5FYXA 2NZ0A 1J7OA 1UHNA 5HKYA 1K96A 1TIZA 4GGFA 1BF5A 2Y1MA 2JTZA 2Q4UA 3AAKA 2JPTA 1KK8C 2H61C 1SRAA 4N1GA 3SJSA 1KWOB 2NLNA 1PK0D 2LVKA 3VRNA 1NSHA 1J1EA 1F55A 2M1UA 5DKQA 3ZNIA 1IJ6A 2PASA 2LHIA 2KQYA 1JBAA 1ALWA 2L0PA 2K7BA 1WLZA 3HX4A 3O78A 1NUBA 1QASA 1DVIA 2H2KA 2I94A 2QACA 2L51A 1H4BA 3BQ3A 1QIVA 2WNDA 4GNKB 1OZOA 3VRRA 1CLLA 1MWNA 2CXJA 2BCBA 1OE9B 1MR8A 2JU0A 1BU3A 1QVIZ 2M8UA 3M0WA 1KFXL 2MBXA 1RJVA 2KYCA 2M3WA 4YI9A 5I2LA 1R2UA 4M2QA 1WRZA 2CNPA 2L98A 4DCKA 3LL8B 1EXRA 1B8RA 2I2RE 5B8IB 4HRHA 5BPJA 1ZOTB 1EH2A 4ZCVA 1IGVA 3SG4A 1BR1B 3BOWB 1VRKA 1S6IA 4MZKA 2L4HA 1NCZA 1EJ3A 1K95A 3EK7A 1S1EA 5CSJA 4YGBB 1JC2A 1M31A 2BL0B 1PVBA 1XK4C 1XFVO 1AUIB 1S6CA 2H61A 1YX8A 4YGEB 2KI4C 2JOJA 3LLEA 3WNXB 2ZKMX 1KQMB 1CM1A 2O60A 3E3RA 2K2FA 2KSPA 4MRYA 4DRWA 2JQ6A 5ER4X 1QS7A 2WCFA 2E6WA 5ER5A 2M9GA 1K9UA 2ZN9A 3EVRA 1FI5A 1LKJA 1FF1A 3OX5A 1SCVA 2KQ6A 2HPSA 2LAPA 3PSRA 2CTNA 1XA5A 1CDPA 2V53A 1N0YA 2M1KB 1F8HA 4PE0A 5CPVA 1Y6WA 5KU1A 3TS5B 1AHRA 1XFWO 1YUTA 1C7VA 1TNWA 2MAZA 2LMVA 4JPZB 4PHNA 4HREE 1DGVA 1DJWA 2I18A 2KNEA 1B8LA 2F2PA 2M7NA 2WC8A 5JOLA 1K9KA 1SCMC 1SW8A 3VRQA 3HCMA 1NX1A 1KQVA 1Y1XA 2WORA 1XVJA 2JT8A 3DF0B 1J7QA 1DJHA 1IH0A 3BXKA 1DT7B 1RK9A 2K7OA 4P2YB 2CBLA 2FCDA 2CCMA 4F0ZB 1NCYA 4OCIA 1AVSA 1A75A 1CFCA 3CLNA 4HRGA 4NDCA 4C0KA 2L5XB 3QRXA 5F6TA 3TDUA 1QIWA 4PDZA 2I7AA 1KFXS 2LVVA 2MLEC 4I5LB 5J3XA 4MSPA 2TN4A 1XO5A 1K93D 1ZACA 5AFPA 1MUXA 3IQOA 2LP2A 1PALA 2LLTA 3SG6A 3KEVA 1GJYA 2KGRA 1GGWA 2AAOA 2O5GA 1SL7A 1FPWA 2M97A 2Q91A 3NXAA 3I5HC 4XJKB 1M63B 5PALA 2BECA 1QXPA 1N65A 3NSOA 2KFGA 1QLKA 1A4PA 2ISDA 4BY4A 3TDIA 3AAJA 1G8IA 1S36A 4QJ5B 2AUCA 2MHHA 2MLFC 4PALA 1K2HA 1KK7Y 4L9MA 2LUXA 4DS7A 1F4QA 1W7JB 1WRKA 2LE9B 5CSFA 3GK2A 3A8RA 1JUOA 1UURA 5CSIA 2F3YA 2ZN8A 4PE4A 4MZJA 1K90D 1RWYA 1IQ5A 4UPGA 4D1EA 1CMGA 2D8NA 1BMOA 3OP0A 2OTGC 3TDZA 1IKUA 3CTNA 3EVUA 3H4SE 1FW4A 1PVAA 4PCWA 1CFDA 3BUMB 3FS7A 1L7ZA 2OS8C 3FWCA 3I5GC 1FI6A 3CGAA 1K8UA 2AMIA 1QJTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N2D A;  1OSA A;  3PM8 A;  3ICB A;  3EKJ A;  1S5G Y;  3PN7 C;  1UHK A;  1XFX O;  4OKH A;  4GBA A;  2PRU A;  4YBH B;  3I5I B;  5DKR A;  2EC6 B;  1JFJ A;  4JQ0 D;  3LK0 A;  1CFF A;  2B1U A;  1DGU A;  1QLS A;  5D69 A;  1B4C A;  1LA3 A;  2M29 A;  4C0L A;  3VGO A;  1WDC B;  4MVF A;  2KI6 D;  2MRD A;  2FJU B;  2G9B A;  4AOM A;  1KFU S;  3CWG A;  1BG1 A;  3TUY B;  2PAL A;  1AP4 A;  1J55 A;  3O6B A;  1L2O B;  4M2P A;  4TNC A;  1KWO C;  2EGD A;  1EL4 A;  1F4O A;  1LA0 A;  2LVJ A;  1H8B A;  3VRP A;  3WXA A;  1F70 A;  1AJ5 A;  1TN4 A;  2WOS A;  3JTD B;  4NDB A;  1WRL A;  1JSA A;  2SAS A;  4ORA B;  1YUS A;  3CR5 X;  1C7W A;  1DF0 A;  1WY9 A;  5KSZ A;  2RGI A;  5HLO A;  3VRO A;  1SYM A;  4MLW A;  4XYN A;  2JT0 A;  2BBN A;  2P6B B;  3DVE A;  3DD4 A;  1QX5 B;  1TNP A;  1TCF A;  3OB1 B;  3C1V A;  5AXI A;  2GV5 A;  3LCP C;  4ORC B;  1SKT A;  5DKN A;  1M46 A;  3KPX A;  5KTY A;  2KYF A;  3SIA A;  1X02 A;  3BYA A;  4YGD B;  2ZRT A;  2JT3 A;  1SMG A;  1UHJ A;  2CT9 A;  2K7D A;  2A4J A;  4USL A;  2F2O A;  1CKK A;  1J1D A;  1YTZ C;  2HQW A;  4E68 A;  1DTL A;  1UHI A;  1CDL A;  2KAX A;  5IBW A;  5AEQ A;  4MN0 A;  1ODB A;  2IS9 A;  2LNK A;  3D0Y A;  3I5F B;  3TZ1 A;  3JVT B;  2JRF A;  1MXL C;  2MJW B;  2Y1N A;  1PUL A;  3D10 A;  5TNC A;  3WHT B;  2JZI A;  4GFT A;  2HF5 A;  2K0J A;  3NSK A;  1QV1 A;  1S26 D;  2LHL A;  2LLU A;  2NXQ A;  4FTG A;  1CM4 A;  3KF9 A;  2BL0 C;  1S3P A;  1WLM A;  4OR9 B;  1XK4 A;  1OQP A;  1YUU A;  1B7T Y;  3CZT X;  3PFV A;  3SG2 A;  1DJX A;  1MQ1 A;  1IRJ A;  1KK8 B;  1KQM C;  2LUC A;  1KK7 Z;  1OOJ A;  1W7I B;  4YGC B;  1JFK A;  1IWQ A;  4YI8 A;  3NSL A;  3PAL A;  4P5O E;  4CFQ A;  1CDN A;  1OMD A;  1SNL A;  2BBM A;  2BCX A;  1QAT A;  1SBJ A;  1REC A;  1YRT B;  4PHM A;  2LV7 A;  1YUR A;  1G4Y R;  1RTP 1;  4CFR A;  3IQQ A;  1KSO A;  1YR5 A;  3F45 A;  1CNP A;  1UHH A;  4MBE A;  4DIR A;  2PVB A;  1Y0V H;  3OX6 A;  4WRI A;  2KFH A;  1DJY A;  2G2B A;  4PHK A;  2F3Z A;  3DVM A;  1XFY O;  1S5G Z;  3TS5 C;  3PAT A;  4BY5 A;  1S6J A;  1M39 A;  1MF8 B;  3PLF B;  5HYD A;  2Y5I A;  2M7L A;  1TRF A;  1ZMZ A;  1A03 A;  1FBV A;  2DOQ A;  1G33 A;  4A4B A;  2WCB A;  2JUL A;  3D0Y B;  1BOD A;  1F71 A;  3AKA A;  2F8P A;  1NIW A;  3BOW A;  4ZCU A;  3DVK A;  1CB1 A;  1F54 A;  2K2A A;  1NX0 A;  4OVN F;  4WQ2 A;  2LP3 A;  5AER A;  2BCA A;  1NYA A;  4GUK A;  4R1E A;  2GGZ A;  2LVI A;  4ETO A;  1EG3 A;  1YVL A;  1RFJ A;  3FWB A;  4HSZ A;  1TOP A;  4C0J A;  1HT9 A;  1BT6 A;  1OMV A;  4YGA A;  1J7P A;  2KBM A;  2R2I A;  2F33 A;  4FQO A;  1Y1U A;  2KI4 B;  3CR4 X;  2BE4 A;  1U5I A;  5I8N A;  1B9A A;  2E30 A;  2JWW A;  1BJF A;  3BUO B;  1A75 B;  1C07 A;  1CFP A;  2L2E A;  5D7F A;  4Q04 A;  1K9P A;  1XYD A;  3GK4 X;  1SPY A;  5I2O A;  1CDM A;  2KBI A;  1JF2 A;  1MHO A;  3BUN B;  1CMF A;  2SCP A;  1IG5 A;  2M0R A;  1TNX A;  1AJ4 A;  2BKH B;  2COL B;  1PSB A;  1OMR A;  1Y1A A;  1QTX A;  1TTX A;  2K61 A;  5HKW A;  3O2P A;  3EK4 A;  1DJZ A;  2LCP A;  1MXE A;  2GGM A;  2OPO A;  1XFZ O;  2LMU A;  1SL8 A;  2KHN A;  3KHE A;  2PSR A;  1HQV A;  1YRU B;  1UUS A;  1A2X A;  1JWD A;  1DJI A;  1CLM A;  5HKZ A;  1IQ3 A;  2K8M B;  4CPV A;  3SG5 A;  1DMO A;  4DUQ A;  2NCP A;  3O4Y A;  2JXC A;  5GQQ C;  1PRW A;  4MRX A;  1DJG A;  4I5K A;  3OHM B;  2KDH A;  1QX2 A;  1PSR A;  4PHJ A;  5CSN A;  3EK8 A;  4CLN A;  3BUX B;  1EG4 A;  1XFU O;  3MSE B;  3OB2 B;  5AAN A;  3SIB A;  2JNX A;  1SCM B;  3DF0 A;  1GGZ A;  1SY9 A;  2BKI B;  2PMY A;  1NPQ A;  3AKB A;  1BOC A;  1B7T Z;  4CID A;  2KFF A;  2KGB C;  4MEW A;  3KO0 A;  4PE1 A;  3RM1 A;  4WQ3 A;  4YRU A;  4NDD A;  2JXL A;  1ZUZ A;  1GQM A;  4NQG A;  3RLZ A;  2Y4Q A;  2ZND A;  1R6P A;  3CS1 A;  2EHB A;  2LAN A;  1SR6 B;  1B1G A;  1U5I B;  1NWD A;  2JNF A;  1JF0 A;  1QVI Y;  3LK1 A;  4OV2 A;  2LMT A;  2L4I A;  3I5I C;  1BR4 B;  1ALV A;  2EC6 C;  1CTR A;  2ZFD A;  1NX3 A;  1BLQ A;  1E8A A;  4QJ3 B;  1UWO A;  2JC2 A;  2VRG A;  3BUW B;  3NSI A;  2WCE A;  2M49 B;  2MA2 A;  5I2Q A;  1SK6 D;  1NCX A;  2LLS A;  1WDC C;  1LVC D;  1B8C A;  3DVJ A;  2QPT A;  3WHU B;  1AK8 A;  1V1G A;  3EKH A;  1M45 A;  3GOF A;  1OZS A;  4MZL A;  4GGF C;  3TUY C;  4XJK A;  5G08 A;  3IF7 A;  1L2O C;  1KSM A;  1RRO A;  4GAO A;  4ORB B;  1NX2 A;  3I5H B;  3ZWH A;  1LXF C;  2ZNE A;  3JTD C;  1CLB A;  1Q80 A;  2FCE A;  3SG7 A;  4AQJ A;  4ICB A;  5K89 A;  4N5X A;  1A29 A;  1TCO B;  2HET A;  3CR2 A;  2LC5 A;  2K7C A;  4IL1 A;  2NCO A;  4N1F A;  1DF0 B;  2BE6 A;  1IJ5 A;  1KFU L;  1QV0 A;  4I5N B;  4JWQ A;  2KAV A;  1NP8 A;  2L50 A;  4AQI A;  1TNQ A;  1LIN A;  2ZRS A;  1J7R A;  1K94 A;  4U8D A;  3FIA A;  1UP5 A;  4I5J A;  4M2O A;  1YVH A;  2OTG B;  1SL9 A;  2KAY A;  4A4C A;  4QJ4 B;  5JJG A;  1SR6 C;  1V1F A;  4PE7 A;  1QX7 A;  1YX7 A;  4GPL B;  1ZFS A;  2OS8 B;  3I5G B;  3A4U B;  3GK1 A;  3I5F C;  3EVV A;  2FOT A;  2KOT A;  3JVT C;  3PN7 B;  5HLV A;  2JTT A;  1B47 A;  3SG3 A;  1D1O A;  2KI6 C;  4GGN A;  3K21 A;  2HQ8 A;  1KCY A;  2LM5 A;  5FYX A;  2NZ0 A;  1J7O A;  1UHN A;  5HKY A;  1K96 A;  1TIZ A;  4GGF A;  1BF5 A;  2Y1M A;  2JTZ A;  2Q4U A;  3AAK A;  2JPT A;  1KK8 C;  2H61 C;  1SRA A;  4N1G A;  3SJS A;  1KWO B;  2NLN A;  1PK0 D;  2LVK A;  3VRN A;  1NSH A;  1J1E A;  1F55 A;  2M1U A;  5DKQ A;  3ZNI A;  1IJ6 A;  2PAS A;  2LHI A;  2KQY A;  1JBA A;  1ALW A;  2L0P A;  2K7B A;  1WLZ A;  3HX4 A;  3O78 A;  1NUB A;  1QAS A;  1DVI A;  2H2K A;  2I94 A;  2QAC A;  2L51 A;  1H4B A;  3BQ3 A;  1QIV A;  2WND A;  4GNK B;  1OZO A;  3VRR A;  1CLL A;  1MWN A;  2CXJ A;  2BCB A;  1OE9 B;  1MR8 A;  2JU0 A;  1BU3 A;  1QVI Z;  2M8U A;  3M0W A;  1KFX L;  2MBX A;  1RJV A;  2KYC A;  2M3W A;  4YI9 A;  5I2L A;  1R2U A;  4M2Q A;  1WRZ A;  2CNP A;  2L98 A;  4DCK A;  3LL8 B;  1EXR A;  1B8R A;  2I2R E;  5B8I B;  4HRH A;  5BPJ A;  1ZOT B;  1EH2 A;  4ZCV A;  1IGV A;  3SG4 A;  1BR1 B;  3BOW B;  1VRK A;  1S6I A;  4MZK A;  2L4H A;  1NCZ A;  1EJ3 A;  1K95 A;  3EK7 A;  1S1E A;  5CSJ A;  4YGB B;  1JC2 A;  1M31 A;  2BL0 B;  1PVB A;  1XK4 C;  1XFV O;  1AUI B;  1S6C A;  2H61 A;  1YX8 A;  4YGE B;  2KI4 C;  2JOJ A;  3LLE A;  3WNX B;  2ZKM X;  1KQM B;  1CM1 A;  2O60 A;  3E3R A;  2K2F A;  2KSP A;  4MRY A;  4DRW A;  2JQ6 A;  5ER4 X;  1QS7 A;  2WCF A;  2E6W A;  5ER5 A;  2M9G A;  1K9U A;  2ZN9 A;  3EVR A;  1FI5 A;  1LKJ A;  1FF1 A;  3OX5 A;  1SCV A;  2KQ6 A;  2HPS A;  2LAP A;  3PSR A;  2CTN A;  1XA5 A;  1CDP A;  2V53 A;  1N0Y A;  2M1K B;  1F8H A;  4PE0 A;  5CPV A;  1Y6W A;  5KU1 A;  3TS5 B;  1AHR A;  1XFW O;  1YUT A;  1C7V A;  1TNW A;  2MAZ A;  2LMV A;  4JPZ B;  4PHN A;  4HRE E;  1DGV A;  1DJW A;  2I18 A;  2KNE A;  1B8L A;  2F2P A;  2M7N A;  2WC8 A;  5JOL A;  1K9K A;  1SCM C;  1SW8 A;  3VRQ A;  3HCM A;  1NX1 A;  1KQV A;  1Y1X A;  2WOR A;  1XVJ A;  2JT8 A;  3DF0 B;  1J7Q A;  1DJH A;  1IH0 A;  3BXK A;  1DT7 B;  1RK9 A;  2K7O A;  4P2Y B;  2CBL A;  2FCD A;  2CCM A;  4F0Z B;  1NCY A;  4OCI A;  1AVS A;  1A75 A;  1CFC A;  3CLN A;  4HRG A;  4NDC A;  4C0K A;  2L5X B;  3QRX A;  5F6T A;  3TDU A;  1QIW A;  4PDZ A;  2I7A A;  1KFX S;  2LVV A;  2MLE C;  4I5L B;  5J3X A;  4MSP A;  2TN4 A;  1XO5 A;  1K93 D;  1ZAC A;  5AFP A;  1MUX A;  3IQO A;  2LP2 A;  1PAL A;  2LLT A;  3SG6 A;  3KEV A;  1GJY A;  2KGR A;  1GGW A;  2AAO A;  2O5G A;  1SL7 A;  1FPW A;  2M97 A;  2Q91 A;  3NXA A;  3I5H C;  4XJK B;  1M63 B;  5PAL A;  2BEC A;  1QXP A;  1N65 A;  3NSO A;  2KFG A;  1QLK A;  1A4P A;  2ISD A;  4BY4 A;  3TDI A;  3AAJ A;  1G8I A;  1S36 A;  4QJ5 B;  2AUC A;  2MHH A;  2MLF C;  4PAL A;  1K2H A;  1KK7 Y;  4L9M A;  2LUX A;  4DS7 A;  1F4Q A;  1W7J B;  1WRK A;  2LE9 B;  5CSF A;  3GK2 A;  3A8R A;  1JUO A;  1UUR A;  5CSI A;  2F3Y A;  2ZN8 A;  4PE4 A;  4MZJ A;  1K90 D;  1RWY A;  1IQ5 A;  4UPG A;  4D1E A;  1CMG A;  2D8N A;  1BMO A;  3OP0 A;  2OTG C;  3TDZ A;  1IKU A;  3CTN A;  3EVU A;  3H4S E;  1FW4 A;  1PVA A;  4PCW A;  1CFD A;  3BUM B;  3FS7 A;  1L7Z A;  2OS8 C;  3FWC A;  3I5G C;  1FI6 A;  3CGA A;  1K8U A;  2AMI A;  1QJT A; 
#chains in the Genus database with same CATH topology
 1N2D A;  1OSA A;  3PM8 A;  3ICB A;  3EKJ A;  1S5G Y;  3PN7 C;  1UHK A;  1XFX O;  4OKH A;  4GBA A;  2PRU A;  4YBH B;  3I5I B;  5DKR A;  2EC6 B;  1JFJ A;  4JQ0 D;  3LK0 A;  1CFF A;  2B1U A;  3Q8I A;  1DGU A;  1QLS A;  5D69 A;  1B4C A;  1LA3 A;  2M29 A;  4C0L A;  3VGO A;  1WDC B;  3DY9 A;  4MVF A;  2KI6 D;  2MRD A;  2FJU B;  4F7F A;  2G9B A;  4AOM A;  1KFU S;  2WCL A;  3CWG A;  1BG1 A;  3TUY B;  2PAL A;  3D74 A;  1AP4 A;  1J55 A;  3O6B A;  1L2O B;  4M2P A;  4TNC A;  1OOG A;  1KWO C;  2EGD A;  1EL4 A;  1F4O A;  1LA0 A;  2LVJ A;  1H8B A;  3VRP A;  3WXA A;  1F70 A;  1AJ5 A;  3K1E A;  1TN4 A;  2WOS A;  3JTD B;  4NDB A;  1WRL A;  1JSA A;  2SAS A;  4ORA B;  1YUS A;  3CR5 X;  1C7W A;  1DF0 A;  1WY9 A;  5KSZ A;  2RGI A;  5HLO A;  3VRO A;  1SYM A;  4MLW A;  4XYN A;  2JT0 A;  2BBN A;  2P6B B;  3DVE A;  3DD4 A;  1QX5 B;  1TNP A;  1TCF A;  3OB1 B;  3C1V A;  5AXI A;  2GV5 A;  3LCP C;  4ORC B;  1SKT A;  5DKN A;  1M46 A;  5I94 A;  1GM0 A;  3KPX A;  3UNW A;  5KTY A;  2KYF A;  3SIA A;  1X02 A;  3BYA A;  4YGD B;  2ZRT A;  2JT3 A;  1SMG A;  1UHJ A;  2CT9 A;  3BFA A;  2K7D A;  2A4J A;  4USL A;  2F2O A;  1CKK A;  1J1D A;  1YTZ C;  2HQW A;  4E68 A;  1DTL A;  1UHI A;  1CDL A;  2KAX A;  5IBW A;  5AEQ A;  4MN0 A;  1ODB A;  2IS9 A;  2LNK A;  3D0Y A;  3I5F B;  3TZ1 A;  3JVT B;  2JRF A;  1MXL C;  2MJW B;  2Y1N A;  1PUL A;  3D10 A;  5TNC A;  3WHT B;  2JZI A;  4GFT A;  2HF5 A;  2K0J A;  3NSK A;  1QV1 A;  1S26 D;  1QWV A;  2LHL A;  2LLU A;  2NXQ A;  1C3Y A;  4FTG A;  1CM4 A;  3KF9 A;  4PT1 A;  2BL0 C;  1S3P A;  1WLM A;  4OR9 B;  1XK4 A;  1OQP A;  3R1V A;  1YUU A;  1B7T Y;  3CZT X;  3PFV A;  3SG2 A;  1DJX A;  1MQ1 A;  1XFR A;  1IRJ A;  1KK8 B;  1KQM C;  2LUC A;  1KK7 Z;  1OOJ A;  1W7I B;  4YGC B;  1JFK A;  1IWQ A;  3R1O A;  4YI8 A;  3NSL A;  3PAL A;  4P5O E;  4CFQ A;  1CDN A;  1OMD A;  1SNL A;  2BBM A;  2BCX A;  1QAT A;  1SBJ A;  1REC A;  1YRT B;  4PHM A;  2LV7 A;  1YUR A;  1G4Y R;  1RTP 1;  4CFR A;  3SS4 A;  3IQQ A;  1KSO A;  1YR5 A;  3F45 A;  1CNP A;  1UHH A;  2KLD A;  4MBE A;  4DIR A;  2PVB A;  1Y0V H;  3OX6 A;  4WRI A;  2KFH A;  1DJY A;  2G2B A;  4PHK A;  2F3Z A;  3DVM A;  1XFY O;  5FI2 A;  1S5G Z;  1C3Z A;  3TS5 C;  2P70 A;  2QEB A;  3PAT A;  4BY5 A;  1S6J A;  1M39 A;  1MF8 B;  3PLF B;  5HYD A;  2Y5I A;  2M7L A;  1TRF A;  1ZMZ A;  1A03 A;  4FQT A;  1FBV A;  2DOQ A;  1G33 A;  4A4B A;  2WCB A;  3CZ2 A;  3IVT A;  2JUL A;  3D0Y B;  1BOD A;  1F71 A;  3AKA A;  2F8P A;  1NIW A;  3BOW A;  4ZCU A;  3DVK A;  1CB1 A;  1F54 A;  2K2A A;  1NX0 A;  4OVN F;  3CZ1 A;  4WQ2 A;  2LP3 A;  5AER A;  2BCA A;  1NYA A;  4GUK A;  4R1E A;  2GGZ A;  2LVI A;  4ETO A;  1EG3 A;  1YVL A;  1RFJ A;  2P71 A;  3FWB A;  4HSZ A;  1TOP A;  2WCJ A;  4C0J A;  1HT9 A;  1BT6 A;  1OMV A;  4YGA A;  1J7P A;  2KBM A;  2R2I A;  2F33 A;  4FQO A;  1Y1U A;  2KI4 B;  3CR4 X;  2BE4 A;  1U5I A;  3S0B A;  1B9A A;  2E30 A;  5I8N A;  2JWW A;  1BJF A;  3BUO B;  1A75 B;  1C07 A;  1CFP A;  2L2E A;  5D7F A;  4Q04 A;  1K9P A;  1XYD A;  3GK4 X;  1SPY A;  2QEO A;  5I2O A;  1CDM A;  2KBI A;  1JF2 A;  1MHO A;  3FE9 A;  3BUN B;  1CMF A;  2SCP A;  1IG5 A;  2M0R A;  1TNX A;  1AJ4 A;  2BKH B;  2COL B;  1PSB A;  1OMR A;  1Y1A A;  1QTX A;  1TTX A;  2K61 A;  5HKW A;  3O2P A;  3EK4 A;  1DJZ A;  2LCP A;  1MXE A;  2GGM A;  2OPO A;  1XFZ O;  1Z4H A;  2LMU A;  1SL8 A;  2KHN A;  3KHE A;  2PSR A;  1HQV A;  1YRU B;  1UUS A;  1A2X A;  4KYN A;  1JWD A;  1DJI A;  1CLM A;  5HKZ A;  1IQ3 A;  3FE8 A;  2K8M B;  4CPV A;  3SG5 A;  1DMO A;  4DUQ A;  2NCP A;  1DEL A;  3O4Y A;  2JXC A;  5GQQ C;  3QME A;  1DEK A;  1PRW A;  4MRX A;  1DJG A;  4I5K A;  3OHM B;  2KDH A;  1QX2 A;  1PSR A;  4PHJ A;  5CSN A;  3EK8 A;  4CLN A;  3BUX B;  1EG4 A;  1XFU O;  3MSE B;  3OB2 B;  5AAN A;  3SIB A;  2JNX A;  1SCM B;  3DF0 A;  1GGZ A;  1SY9 A;  2BKI B;  2PMY A;  1NPQ A;  3AKB A;  1BOC A;  1B7T Z;  4CID A;  2KFF A;  2KGB C;  3OGN A;  3KO0 A;  4MEW A;  4PE1 A;  3RM1 A;  3CDN A;  4WQ3 A;  3L47 A;  4YRU A;  3BFH A;  4NDD A;  2JXL A;  1ZUZ A;  1GQM A;  4NQG A;  3RLZ A;  3N7H A;  2Y4Q A;  2ZND A;  1R6P A;  3CS1 A;  2EHB A;  2LAN A;  1SR6 B;  5FI7 A;  2GTE A;  1B1G A;  1U5I B;  1NWD A;  2JNF A;  1JF0 A;  1QVI Y;  3LK1 A;  4OV2 A;  2LMT A;  2L4I A;  3I5I C;  1BR4 B;  1ALV A;  2EC6 C;  3FE6 A;  1CTR A;  2ZFD A;  1NX3 A;  1BLQ A;  1E8A A;  3B7A A;  4QJ3 B;  1UWO A;  1TUZ A;  2JC2 A;  2VRG A;  3BUW B;  2WCE A;  3NSI A;  2M49 B;  2MA2 A;  5I2Q A;  1SK6 D;  1NCX A;  2LLS A;  1WDC C;  1LVC D;  1B8C A;  3DVJ A;  2QPT A;  3S0A A;  3WHU B;  1AK8 A;  1V1G A;  3EKH A;  1M45 A;  3BFB A;  1OZS A;  1DQE A;  3GOF A;  4GGF C;  4MZL A;  4XJK A;  5G08 A;  3TUY C;  3IF7 A;  1L2O C;  1KSM A;  1RRO A;  4GAO A;  4ORB B;  1NX2 A;  3I5H B;  3ZWH A;  1LXF C;  2ZNE A;  2YGU A;  3JTD C;  1CLB A;  1Q80 A;  2FCE A;  2L5Y A;  4IJ7 A;  3SG7 A;  4AQJ A;  4ICB A;  3B88 A;  5K89 A;  4N5X A;  1A29 A;  2L2C A;  1TCO B;  2HET A;  3DYE A;  3CR2 A;  2LC5 A;  2K7C A;  4IL1 A;  2NCO A;  4N1F A;  1DF0 B;  2BE6 A;  1IJ5 A;  3CAB A;  1KFU L;  1QV0 A;  2H8V A;  4I5N B;  2KAV A;  4JWQ A;  1NP8 A;  2L50 A;  4AQI A;  1TNQ A;  1LIN A;  2ZRS A;  1J7R A;  1K94 A;  3D73 A;  4U8D A;  3FIA A;  1UP5 A;  4I5J A;  4M2O A;  1YVH A;  3S0F A;  2OTG B;  1SL9 A;  2KAY A;  4A4C A;  4QJ4 B;  5JJG A;  1SR6 C;  1V1F A;  4PE7 A;  1QX7 A;  1YX7 A;  4GPL B;  1ZFS A;  2OS8 B;  3I5G B;  4JKT A;  3A4U B;  3GK1 A;  3I5F C;  3EVV A;  2FOT A;  2KOT A;  3JVT C;  3PN7 B;  5HLV A;  2JTT A;  1B47 A;  3SG3 A;  1D1O A;  2KI6 C;  4GGN A;  3K21 A;  2HQ8 A;  1KCY A;  2LM5 A;  5FYX A;  2NZ0 A;  1J7O A;  1UHN A;  5HKY A;  3NGV A;  1K96 A;  1TIZ A;  4GGF A;  1BF5 A;  1OOF A;  3D77 A;  2Y1M A;  3PJI A;  2JTZ A;  2Q4U A;  3AAK A;  2JPT A;  1KK8 C;  2H61 C;  1SRA A;  4N1G A;  3SJS A;  2WCK A;  1KWO B;  2NLN A;  1PK0 D;  2LVK A;  3PM2 A;  3VRN A;  1NSH A;  1J1E A;  1F55 A;  2M1U A;  5DKQ A;  3ZNI A;  1IJ6 A;  2PAS A;  2LHI A;  2KQY A;  5HL1 A;  1JBA A;  1ALW A;  2L0P A;  2K7B A;  1WLZ A;  3HX4 A;  3O78 A;  1NUB A;  1QAS A;  1DVI A;  2H2K A;  2I94 A;  2QAC A;  2L51 A;  1H4B A;  3BQ3 A;  1QIV A;  2WND A;  3VB1 A;  4GNK B;  1TUJ A;  1OZO A;  3VRR A;  1CLL A;  1MWN A;  2CXJ A;  2BCB A;  1OE9 B;  1MR8 A;  2JU0 A;  1BU3 A;  4INX A;  1QVI Z;  2M8U A;  3M0W A;  1KFX L;  2MBX A;  1RJV A;  2KYC A;  2M3W A;  2ERB A;  3R1P A;  4YI9 A;  1T14 A;  5I2L A;  1R2U A;  3S0G A;  4M2Q A;  1WRZ A;  2CNP A;  2L98 A;  2QDI A;  4DCK A;  3LL8 B;  1EXR A;  1B8R A;  2PYQ A;  2I2R E;  1IIO A;  5B8I B;  4HRH A;  2WC5 A;  3DZT A;  5BPJ A;  1ZOT B;  1EH2 A;  4ZCV A;  1IGV A;  3SG4 A;  1BR1 B;  3BOW B;  1VRK A;  1S6I A;  4MZK A;  2BAP A;  1NCZ A;  1EJ3 A;  2L4H A;  1K95 A;  1P28 A;  3D76 A;  3EK7 A;  1S1E A;  5CSJ A;  4YGB B;  2WCM A;  1JC2 A;  1M31 A;  2BL0 B;  1PVB A;  1OW4 A;  3UO9 A;  1XK4 C;  1XFV O;  1AUI B;  1S6C A;  2H61 A;  1YX8 A;  3CZ0 A;  3V2L A;  4YGE B;  2KI4 C;  2JOJ A;  3LLE A;  3WNX B;  2ZKM X;  1KQM B;  1Z2C B;  1CM1 A;  2O60 A;  3E3R A;  2K2F A;  2KSP A;  4MRY A;  4DRW A;  2JQ6 A;  5ER4 X;  1QS7 A;  2WCF A;  2E6W A;  5ER5 A;  2M9G A;  1K9U A;  2ZN9 A;  1OOH A;  3EVR A;  4OZD A;  3B6X A;  5D3O A;  1FI5 A;  1LKJ A;  1FF1 A;  3OX5 A;  1SCV A;  2KQ6 A;  2JPO A;  2HPS A;  2KPH A;  2LAP A;  3PSR A;  2CTN A;  2QEV A;  1XA5 A;  1CDP A;  2V53 A;  3L4L A;  1N0Y A;  3S0E A;  2M1K B;  1F8H A;  4PE0 A;  5CPV A;  1Y6W A;  1OOI X;  5KU1 A;  3TS5 B;  1AHR A;  1XFW O;  1YUT A;  1LS8 A;  1TNW A;  1C7V A;  2MAZ A;  2LMV A;  1ORG A;  2FJY A;  4JPZ B;  4PHN A;  4HRE E;  4INW A;  1DGV A;  1DJW A;  2I18 A;  2KNE A;  3D78 A;  1B8L A;  2F2P A;  2M7N A;  2WC8 A;  5JOL A;  1K9K A;  1SCM C;  1SW8 A;  3VRQ A;  3HCM A;  1NX1 A;  1TWO A;  1Y1X A;  2WOR A;  3CYZ A;  1XVJ A;  3DXL A;  1KQV A;  2JT8 A;  3DF0 B;  1J7Q A;  1DJH A;  1IH0 A;  3BXK A;  3R72 A;  1DT7 B;  1RK9 A;  2K7O A;  3B86 A;  4P2Y B;  2CBL A;  2FCD A;  2CCM A;  4F0Z B;  1NCY A;  2BNX A;  4OCI A;  3RZS A;  1AVS A;  1A75 A;  1CFC A;  3CLN A;  4HRG A;  4NDC A;  4C0K A;  2L5X B;  3B87 A;  3QRX A;  5F6T A;  2WC6 A;  3SS3 A;  3TDU A;  1QIW A;  4PDZ A;  2I7A A;  4JD9 A;  1KFX S;  2LVV A;  2MLE C;  4I5L B;  3BJH A;  1SSE B;  2PQL A;  5J3X A;  4MSP A;  2TN4 A;  1XO5 A;  2QEH A;  1K93 D;  1ZAC A;  5AFP A;  1MUX A;  3IQO A;  5EL2 A;  2LP2 A;  1DC1 A;  1PAL A;  2LLT A;  3SG6 A;  3KEV A;  1GJY A;  2KGR A;  1GGW A;  2AAO A;  2O5G A;  1SL7 A;  1FPW A;  3S0D A;  2M97 A;  2Q91 A;  3NXA A;  3I5H C;  4XJK B;  1W9Z A;  1M63 B;  5PAL A;  2BEC A;  1QXP A;  1N65 A;  3NSO A;  2KFG A;  1QLK A;  1A4P A;  2ISD A;  4BY4 A;  3TDI A;  3AAJ A;  1G8I A;  1S36 A;  4QJ5 B;  2AUC A;  2MHH A;  2MLF C;  4PAL A;  3L4A A;  1KK7 Y;  4L9M A;  2LUX A;  4DS7 A;  1K2H A;  1F4Q A;  1W7J B;  1WRK A;  2LE9 B;  5CSF A;  2KLE A;  3GK2 A;  3A8R A;  1JUO A;  1UUR A;  3D75 A;  5CSI A;  2F3Y A;  2ZN8 A;  4PE4 A;  5DIC A;  3NHI A;  4MZJ A;  1K90 D;  1RWY A;  1IQ5 A;  3OBV A;  5FI6 A;  4D1E A;  4UPG A;  1CMG A;  2D8N A;  1BMO A;  3OP0 A;  3SS5 A;  3O4X A;  2OTG C;  3TDZ A;  1IKU A;  2K60 A;  3CTN A;  3EG5 B;  3EVU A;  3H4S E;  1FW4 A;  1PVA A;  3NHT A;  4PCW A;  1CFD A;  2WCH A;  3BUM B;  3FS7 A;  1L7Z A;  2OS8 C;  3FWC A;  3I5G C;  1FI6 A;  3CGA A;  1K8U A;  2AMI A;  1QJT A; 
#chains in the Genus database with same CATH homology
 1N2D A;  1OSA A;  3PM8 A;  3ICB A;  3EKJ A;  1S5G Y;  3PN7 C;  1UHK A;  1XFX O;  4OKH A;  4GBA A;  2PRU A;  4YBH B;  3I5I B;  5DKR A;  2EC6 B;  1JFJ A;  4JQ0 D;  3LK0 A;  1CFF A;  2B1U A;  1DGU A;  1QLS A;  5D69 A;  1B4C A;  1LA3 A;  2M29 A;  4C0L A;  3VGO A;  1WDC B;  4MVF A;  2KI6 D;  2MRD A;  2FJU B;  2G9B A;  4AOM A;  1KFU S;  3CWG A;  1BG1 A;  3TUY B;  2PAL A;  1AP4 A;  1J55 A;  3O6B A;  1L2O B;  4M2P A;  4TNC A;  1KWO C;  2EGD A;  1EL4 A;  1F4O A;  1LA0 A;  2LVJ A;  1H8B A;  3VRP A;  3WXA A;  1F70 A;  1AJ5 A;  1TN4 A;  2WOS A;  3JTD B;  4NDB A;  1WRL A;  1JSA A;  2SAS A;  4ORA B;  1YUS A;  3CR5 X;  1C7W A;  1DF0 A;  1WY9 A;  5KSZ A;  2RGI A;  5HLO A;  3VRO A;  1SYM A;  4MLW A;  4XYN A;  2JT0 A;  2BBN A;  2P6B B;  3DVE A;  3DD4 A;  1QX5 B;  1TNP A;  1TCF A;  3OB1 B;  3C1V A;  5AXI A;  2GV5 A;  3LCP C;  4ORC B;  1SKT A;  5DKN A;  1M46 A;  3KPX A;  5KTY A;  2KYF A;  3SIA A;  1X02 A;  3BYA A;  4YGD B;  2ZRT A;  2JT3 A;  1SMG A;  1UHJ A;  2CT9 A;  2K7D A;  2A4J A;  4USL A;  2F2O A;  1CKK A;  1J1D A;  1YTZ C;  2HQW A;  4E68 A;  1DTL A;  1UHI A;  1CDL A;  2KAX A;  5IBW A;  5AEQ A;  4MN0 A;  1ODB A;  2IS9 A;  2LNK A;  3D0Y A;  3I5F B;  3TZ1 A;  3JVT B;  2JRF A;  1MXL C;  2MJW B;  2Y1N A;  1PUL A;  3D10 A;  5TNC A;  3WHT B;  2JZI A;  4GFT A;  2HF5 A;  2K0J A;  3NSK A;  1QV1 A;  1S26 D;  2LHL A;  2LLU A;  2NXQ A;  4FTG A;  1CM4 A;  3KF9 A;  2BL0 C;  1S3P A;  1WLM A;  4OR9 B;  1XK4 A;  1OQP A;  1YUU A;  1B7T Y;  3CZT X;  3PFV A;  3SG2 A;  1DJX A;  1MQ1 A;  1IRJ A;  1KK8 B;  1KQM C;  2LUC A;  1KK7 Z;  1OOJ A;  1W7I B;  4YGC B;  1JFK A;  1IWQ A;  4YI8 A;  3NSL A;  3PAL A;  4P5O E;  4CFQ A;  1CDN A;  1OMD A;  1SNL A;  2BBM A;  2BCX A;  1QAT A;  1SBJ A;  1REC A;  1YRT B;  4PHM A;  2LV7 A;  1YUR A;  1G4Y R;  1RTP 1;  4CFR A;  3IQQ A;  1KSO A;  1YR5 A;  3F45 A;  1CNP A;  1UHH A;  4MBE A;  4DIR A;  2PVB A;  1Y0V H;  3OX6 A;  4WRI A;  2KFH A;  1DJY A;  2G2B A;  4PHK A;  2F3Z A;  3DVM A;  1XFY O;  1S5G Z;  3TS5 C;  3PAT A;  4BY5 A;  1S6J A;  1M39 A;  1MF8 B;  3PLF B;  5HYD A;  2Y5I A;  2M7L A;  1TRF A;  1ZMZ A;  1A03 A;  1FBV A;  2DOQ A;  1G33 A;  4A4B A;  2WCB A;  2JUL A;  3D0Y B;  1BOD A;  1F71 A;  3AKA A;  2F8P A;  1NIW A;  3BOW A;  4ZCU A;  3DVK A;  1CB1 A;  1F54 A;  2K2A A;  1NX0 A;  4OVN F;  4WQ2 A;  2LP3 A;  5AER A;  2BCA A;  1NYA A;  4GUK A;  4R1E A;  2GGZ A;  2LVI A;  4ETO A;  1EG3 A;  1YVL A;  1RFJ A;  3FWB A;  4HSZ A;  1TOP A;  4C0J A;  1HT9 A;  1BT6 A;  1OMV A;  4YGA A;  1J7P A;  2KBM A;  2R2I A;  2F33 A;  4FQO A;  1Y1U A;  2KI4 B;  3CR4 X;  2BE4 A;  1U5I A;  5I8N A;  1B9A A;  2E30 A;  2JWW A;  1BJF A;  3BUO B;  1A75 B;  1C07 A;  1CFP A;  2L2E A;  5D7F A;  4Q04 A;  1K9P A;  1XYD A;  3GK4 X;  1SPY A;  5I2O A;  1CDM A;  2KBI A;  1JF2 A;  1MHO A;  3BUN B;  1CMF A;  2SCP A;  1IG5 A;  2M0R A;  1TNX A;  1AJ4 A;  2BKH B;  2COL B;  1PSB A;  1OMR A;  1Y1A A;  1QTX A;  1TTX A;  2K61 A;  5HKW A;  3O2P A;  3EK4 A;  1DJZ A;  2LCP A;  1MXE A;  2GGM A;  2OPO A;  1XFZ O;  2LMU A;  1SL8 A;  2KHN A;  3KHE A;  2PSR A;  1HQV A;  1YRU B;  1UUS A;  1A2X A;  1JWD A;  1DJI A;  1CLM A;  5HKZ A;  1IQ3 A;  2K8M B;  4CPV A;  3SG5 A;  1DMO A;  4DUQ A;  2NCP A;  3O4Y A;  2JXC A;  5GQQ C;  1PRW A;  4MRX A;  1DJG A;  4I5K A;  3OHM B;  2KDH A;  1QX2 A;  1PSR A;  4PHJ A;  5CSN A;  3EK8 A;  4CLN A;  3BUX B;  1EG4 A;  1XFU O;  3MSE B;  3OB2 B;  5AAN A;  3SIB A;  2JNX A;  1SCM B;  3DF0 A;  1GGZ A;  1SY9 A;  2BKI B;  2PMY A;  1NPQ A;  3AKB A;  1BOC A;  1B7T Z;  4CID A;  2KFF A;  2KGB C;  4MEW A;  3KO0 A;  4PE1 A;  3RM1 A;  4WQ3 A;  4YRU A;  4NDD A;  2JXL A;  1ZUZ A;  1GQM A;  4NQG A;  3RLZ A;  2Y4Q A;  2ZND A;  1R6P A;  3CS1 A;  2EHB A;  2LAN A;  1SR6 B;  1B1G A;  1U5I B;  1NWD A;  2JNF A;  1JF0 A;  1QVI Y;  3LK1 A;  4OV2 A;  2LMT A;  2L4I A;  3I5I C;  1BR4 B;  1ALV A;  2EC6 C;  1CTR A;  2ZFD A;  1NX3 A;  1BLQ A;  1E8A A;  4QJ3 B;  1UWO A;  2JC2 A;  2VRG A;  3BUW B;  3NSI A;  2WCE A;  2M49 B;  2MA2 A;  5I2Q A;  1SK6 D;  1NCX A;  2LLS A;  1WDC C;  1LVC D;  1B8C A;  3DVJ A;  2QPT A;  3WHU B;  1AK8 A;  1V1G A;  3EKH A;  1M45 A;  3GOF A;  1OZS A;  4MZL A;  4GGF C;  3TUY C;  4XJK A;  5G08 A;  3IF7 A;  1L2O C;  1KSM A;  1RRO A;  4GAO A;  4ORB B;  1NX2 A;  3I5H B;  3ZWH A;  1LXF C;  2ZNE A;  3JTD C;  1CLB A;  1Q80 A;  2FCE A;  3SG7 A;  4AQJ A;  4ICB A;  5K89 A;  4N5X A;  1A29 A;  1TCO B;  2HET A;  3CR2 A;  2LC5 A;  2K7C A;  4IL1 A;  2NCO A;  4N1F A;  1DF0 B;  2BE6 A;  1IJ5 A;  1KFU L;  1QV0 A;  4I5N B;  4JWQ A;  2KAV A;  1NP8 A;  2L50 A;  4AQI A;  1TNQ A;  1LIN A;  2ZRS A;  1J7R A;  1K94 A;  4U8D A;  3FIA A;  1UP5 A;  4I5J A;  4M2O A;  1YVH A;  2OTG B;  1SL9 A;  2KAY A;  4A4C A;  4QJ4 B;  5JJG A;  1SR6 C;  1V1F A;  4PE7 A;  1QX7 A;  1YX7 A;  4GPL B;  1ZFS A;  2OS8 B;  3I5G B;  3A4U B;  3GK1 A;  3I5F C;  3EVV A;  2FOT A;  2KOT A;  3JVT C;  3PN7 B;  5HLV A;  2JTT A;  1B47 A;  3SG3 A;  1D1O A;  2KI6 C;  4GGN A;  3K21 A;  2HQ8 A;  1KCY A;  2LM5 A;  5FYX A;  2NZ0 A;  1J7O A;  1UHN A;  5HKY A;  1K96 A;  1TIZ A;  4GGF A;  1BF5 A;  2Y1M A;  2JTZ A;  2Q4U A;  3AAK A;  2JPT A;  1KK8 C;  2H61 C;  1SRA A;  4N1G A;  3SJS A;  1KWO B;  2NLN A;  1PK0 D;  2LVK A;  3VRN A;  1NSH A;  1J1E A;  1F55 A;  2M1U A;  5DKQ A;  3ZNI A;  1IJ6 A;  2PAS A;  2LHI A;  2KQY A;  1JBA A;  1ALW A;  2L0P A;  2K7B A;  1WLZ A;  3HX4 A;  3O78 A;  1NUB A;  1QAS A;  1DVI A;  2H2K A;  2I94 A;  2QAC A;  2L51 A;  1H4B A;  3BQ3 A;  1QIV A;  2WND A;  4GNK B;  1OZO A;  3VRR A;  1CLL A;  1MWN A;  2CXJ A;  2BCB A;  1OE9 B;  1MR8 A;  2JU0 A;  1BU3 A;  1QVI Z;  2M8U A;  3M0W A;  1KFX L;  2MBX A;  1RJV A;  2KYC A;  2M3W A;  4YI9 A;  5I2L A;  1R2U A;  4M2Q A;  1WRZ A;  2CNP A;  2L98 A;  4DCK A;  3LL8 B;  1EXR A;  1B8R A;  2I2R E;  5B8I B;  4HRH A;  5BPJ A;  1ZOT B;  1EH2 A;  4ZCV A;  1IGV A;  3SG4 A;  1BR1 B;  3BOW B;  1VRK A;  1S6I A;  4MZK A;  2L4H A;  1NCZ A;  1EJ3 A;  1K95 A;  3EK7 A;  1S1E A;  5CSJ A;  4YGB B;  1JC2 A;  1M31 A;  2BL0 B;  1PVB A;  1XK4 C;  1XFV O;  1AUI B;  1S6C A;  2H61 A;  1YX8 A;  4YGE B;  2KI4 C;  2JOJ A;  3LLE A;  3WNX B;  2ZKM X;  1KQM B;  1CM1 A;  2O60 A;  3E3R A;  2K2F A;  2KSP A;  4MRY A;  4DRW A;  2JQ6 A;  5ER4 X;  1QS7 A;  2WCF A;  2E6W A;  5ER5 A;  2M9G A;  1K9U A;  2ZN9 A;  3EVR A;  1FI5 A;  1LKJ A;  1FF1 A;  3OX5 A;  1SCV A;  2KQ6 A;  2HPS A;  2LAP A;  3PSR A;  2CTN A;  1XA5 A;  1CDP A;  2V53 A;  1N0Y A;  2M1K B;  1F8H A;  4PE0 A;  5CPV A;  1Y6W A;  5KU1 A;  3TS5 B;  1AHR A;  1XFW O;  1YUT A;  1C7V A;  1TNW A;  2MAZ A;  2LMV A;  4JPZ B;  4PHN A;  4HRE E;  1DGV A;  1DJW A;  2I18 A;  2KNE A;  1B8L A;  2F2P A;  2M7N A;  2WC8 A;  5JOL A;  1K9K A;  1SCM C;  1SW8 A;  3VRQ A;  3HCM A;  1NX1 A;  1KQV A;  1Y1X A;  2WOR A;  1XVJ A;  2JT8 A;  3DF0 B;  1J7Q A;  1DJH A;  1IH0 A;  3BXK A;  1DT7 B;  1RK9 A;  2K7O A;  4P2Y B;  2CBL A;  2FCD A;  2CCM A;  4F0Z B;  1NCY A;  4OCI A;  1AVS A;  1A75 A;  1CFC A;  3CLN A;  4HRG A;  4NDC A;  4C0K A;  2L5X B;  3QRX A;  5F6T A;  3TDU A;  1QIW A;  4PDZ A;  2I7A A;  1KFX S;  2LVV A;  2MLE C;  4I5L B;  5J3X A;  4MSP A;  2TN4 A;  1XO5 A;  1K93 D;  1ZAC A;  5AFP A;  1MUX A;  3IQO A;  2LP2 A;  1PAL A;  2LLT A;  3SG6 A;  3KEV A;  1GJY A;  2KGR A;  1GGW A;  2AAO A;  2O5G A;  1SL7 A;  1FPW A;  2M97 A;  2Q91 A;  3NXA A;  3I5H C;  4XJK B;  1M63 B;  5PAL A;  2BEC A;  1QXP A;  1N65 A;  3NSO A;  2KFG A;  1QLK A;  1A4P A;  2ISD A;  4BY4 A;  3TDI A;  3AAJ A;  1G8I A;  1S36 A;  4QJ5 B;  2AUC A;  2MHH A;  2MLF C;  4PAL A;  1K2H A;  1KK7 Y;  4L9M A;  2LUX A;  4DS7 A;  1F4Q A;  1W7J B;  1WRK A;  2LE9 B;  5CSF A;  3GK2 A;  3A8R A;  1JUO A;  1UUR A;  5CSI A;  2F3Y A;  2ZN8 A;  4PE4 A;  4MZJ A;  1K90 D;  1RWY A;  1IQ5 A;  4UPG A;  4D1E A;  1CMG A;  2D8N A;  1BMO A;  3OP0 A;  2OTG C;  3TDZ A;  1IKU A;  3CTN A;  3EVU A;  3H4S E;  1FW4 A;  1PVA A;  4PCW A;  1CFD A;  3BUM B;  3FS7 A;  1L7Z A;  2OS8 C;  3FWC A;  3I5G C;  1FI6 A;  3CGA A;  1K8U A;  2AMI A;  1QJT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...