2KSPA

Mechanism for the selective interaction of c-terminal eh-domain proteins with specific npf-containing partners
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
105
structure length
105
Chain Sequence
GPLGSDDVEWVVGKDKPTYDEIFYTLSPVNGKITGANAKKEMVKSKLPNTVLGKIWKLADVDKDGLLDDEEFALANHLIKVKLEGHELPADLPPHLVPPSKRRHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EH domain-containing protein 1
publication title Mechanism for the selective interaction of C-terminal Eps15 homology domain proteins with specific Asn-Pro-Phe-containing partners.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 32
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2010-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12763 EF-hand_4 Cytoskeletal-regulatory complex EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2kspA00
3I5GC 1K90D 1SCMB 5AANA 3HX4A 3SG4A 2KSPA 3JTDC 4IL1A 2ZN8A 4FQOA 2JRFA 2JWWA 1R6PA 3NSLA 3SG6A 2JT8A 1CMFA 2BCAA 3AKBA 1TCOB 3WHUB 2PVBA 1B8LA 1A2XA 1NX2A 1SK6D 1W7JB 3BUOB 4YGAA 1HQVA 3E3RA 2M7NA 1ALVA 1NCXA 2F3YA 3FWCA 2F2PA 1UHHA 2CXJA 1FI6A 2LNKA 1UUSA 3PSRA 3QRXA 1W7IB 3KO0A 1MXLC 4ORCB 5HKWA 1WDCB 2HQ8A 3DVKA 1RJVA 1YVHA 3BUWB 3TS5B 2CCMA 1UP5A 1QLKA 1L7ZA 2H2KA 4XJKB 2H61C 2WCBA 4YGEB 2CBLA 1CLBA 1DJIA 1DJYA 3RM1A 3A8RA 5B8IB 4ZCUA 1QS7A 5IBWA 1ZMZA 2A4JA 2K7CA 1FF1A 3BUMB 1F8HA 1MF8B 5DKNA 4PCWA 4YI9A 2JZIA 1S36A 2LUCA 5CSJA 3KPXA 3DVJA 3TUYC 1QATA 1J1DA 2AMIA 1BU3A 1PULA 1NX0A 1BT6A 5KSZA 4YGBB 2WC8A 1RTP1 1A4PA 1CM4A 3K21A 1A75A 1XK4C 4A4BA 1J7PA 1YX7A 2KQ6A 1Y1AA 1EH2A 1MR8A 1NYAA 1B8CA 2CT9A 1K96A 2LMVA 5ER5A 1JUOA 1WRKA 1FW4A 2Q91A 2I2RE 1TOPA 2LM5A 4GAOA 1U5IA 1JF0A 2L4HA 2M29A 3M0WA 4NQGA 1JFKA 4MZJA 3VRQA 1L2OC 1B8RA 1XFUO 1SW8A 1V1FA 1NSHA 1AJ4A 2WORA 4I5LB 4JQ0D 1B9AA 5AERA 1MHOA 3OB2B 2EGDA 2ZNDA 1EL4A 1WY9A 1Y1XA 1XO5A 1YUTA 2V53A 5K89A 1QV1A 1SBJA 2LMUA 3CR2A 3VRNA 3EVUA 1PALA 2JT3A 1KWOB 4CPVA 2KAYA 2L0PA 1YX8A 3I5IB 2PRUA 5HKZA 4N1GA 1OZOA 5G08A 5JJGA 1FI5A 1X02A 1XVJA 4MSPA 1K9UA 4QJ4B 3OB1B 5DKRA 5J3XA 1SYMA 2KGRA 2KYFA 2M9GA 2ZRTA 1K94A 3SIBA 1QX5B 3VRRA 3JVTB 2L98A 2WCFA 1KFXL 1JBAA 3EVRA 3FS7A 1S6IA 3LLEA 1SR6C 4PE7A 2BE6A 4M2PA 2Y1MA 1CFCA 5CSNA 1S26D 1ALWA 1ZUZA 1OQPA 1MQ1A 2LC5A 4C0JA 2G9BA 1IG5A 1DJGA 3CGAA 4Q04A 1OSAA 3TDIA 1K9KA 1BMOA 5KU1A 2F3ZA 1SCVA 2OPOA 1TNWA 1J7OA 1ZFSA 1NX1A 3O2PA 1RECA 2NCOA 3I5HC 1M46A 3AAKA 3DD4A 1TTXA 4HRGA 3NSKA 1S6CA 2BL0C 2KI6D 3H4SE 1S5GZ 3I5GB 4BY5A 1PVAA 4CIDA 2KAXA 1CMGA 1MUXA 1AHRA 3JTDB 1SPYA 1QXPA 2FCEA 4OR9B 1DJWA 2PSRA 1K95A 1XFXO 1LA3A 1JF2A 1S6JA 1SY9A 1NIWA 4XJKA 1DJZA 3AAJA 4OCIA 1GQMA 2ZRSA 1KQVA 3TDUA 1OZSA 4GGFC 2OTGC 2KNEA 5D7FA 4U8DA 1DF0A 3CR4X 1AJ5A 1SRAA 1M39A 2LP2A 3NSIA 1OOJA 1YURA 2OS8C 3PALA 1AP4A 2KFHA 4P2YB 1KCYA 4PHMA 1XK4A 5I2OA 1B7TY 1M45A 4P5OE 2JXLA 4NDBA 1JSAA 2JNFA 2LVKA 3ICBA 2KFFA 3PN7C 3CLNA 1QLSA 2NZ0A 3ZNIA 1KQMC 1H4BA 1QV0A 1SL7A 2KHNA 4M2OA 3TZ1A 2NLNA 2GV5A 1CKKA 4C0KA 2M8UA 1N65A 2BECA 4DRWA 3NXAA 1Y0VH 2HF5A 1J55A 2FCDA 3EK7A 5D69A 1J1EA 4AQIA 1LKJA 2HETA 3TUYB 4E68A 1DF0B 2PALA 4I5JA 1CFDA 1RROA 4ORBB 2RGIA 1C7VA 1IJ5A 1UHKA 3EK4A 3HCMA 4XYNA 1BR1B 4MRYA 1NWDA 2COLB 3SJSA 4GBAA 3GK1A 1IGVA 2KI4C 3D0YB 1S1EA 1UURA 1DT7B 1B1GA 2F2OA 1GJYA 4ZCVA 1LINA 2MBXA 2KI6C 2JNXA 1TNXA 2KAVA 4QJ3B 1L2OB 3PFVA 2MJWB 1SL9A 3F45A 1TN4A 1ZOTB 2BBNA 1V1GA 4USLA 1BOCA 1LVCD 3OP0A 1BR4B 1DJXA 4YBHB 2BKIB 1QVIY 2EHBA 2WCEA 1OE9B 3O6BA 3TDZA 3I5FC 2L4IA 1AUIB 5CSIA 1A29A 2GGZA 1CDNA 1GGZA 3LK1A 1XFWO 2LLSA 1MWNA 5F6TA 4C0LA 1XFYO 1DTLA 2QPTA 1EJ3A 3EKJA 1UHNA 2K7BA 5FYXA 4L9MA 1ZACA 4NDDA 1PSBA 1SR6B 5ER4X 5TNCA 1SNLA 2JQ6A 1TNQA 2KGBC 3CZTX 1NX3A 4GGFA 5JOLA 1NCZA 5BPJA 2HQWA 3PLFB 4MZKA 3EVVA 1IWQA 3OX6A 1YVLA 3WNXB 5AXIA 1DVIA 1IRJA 1JWDA 1CNPA 1KFUS 1KK7Y 2I7AA 3DVEA 2L50A 1CM1A 2JU0A 5AFPA 1J7RA 1UHIA 2EC6C 3FWBA 1M63B 3I5HB 1QASA 2KFGA 2L5XB 2BL0B 2MLFC 1TRFA 2M3WA 4MZLA 3SG3A 2M97A 1PRWA 3SG7A 2Y4QA 4YGCB 5I2LA 3RLZA 1G8IA 1RWYA 1NP8A 1LA0A 1KK8C 1Y6WA 1YRTB 5CPVA 3OX5A 2H61A 4MEWA 2KBMA 2KBIA 1BODA 4JPZB 2OTGB 2JXCA 2M49B 2O5GA 1YUSA 3BYAA 2ZNEA 3BOWA 1EXRA 2FOTA 4MBEA 1ODBA 1K9PA 2QACA 2B1UA 2K0JA 4N5XA 1XFVO 2ZKMX 2LCPA 2JTZA 3GOFA 4PHNA 5GQQC 4TNCA 2OS8B 3NSOA 2AUCA 2SASA 1AVSA 1N2DA 2KYCA 2LVJA 1TNPA 1CFFA 1HT9A 2LUXA 2ISDA 5I2QA 5HLVA 2WOSA 1WLMA 2IS9A 3DF0B 3BUNB 4CLNA 2D8NA 1BG1A 2JT0A 1N0YA 3PN7B 1NCYA 2NCPA 2LMTA 1KQMB 1YRUB 1C07A 2PASA 1CTRA 2PMYA 4I5KA 2JC2A 3GK2A 3O4YA 1LXFC 2LHLA 1F54A 3D0YA 4GGNA 4A4CA 1EG4A 3KHEA 3MSEB 1CLLA 5CSFA 1XA5A 1OMRA 3BOWB 4HREE 1M31A 2LLTA 2K8MB 3IQQA 1PVBA 1OMDA 1SCMC 1Y1UA 2K2AA 3A4UB 3CWGA 3IQOA 4OVNF 4FTGA 2AAOA 2JTTA 2M0RA 3LCPC 3CTNA 1F71A 2KI4B 1BLQA 1PSRA 2M7LA 1B7TZ 2O60A 1WLZA 3VGOA 2MLEC 1MXEA 3IF7A 3GK4X 2K7OA 2TN4A 2LP3A 3PM8A 1CFPA 1QIWA 2F33A 3SIAA 4YGDB 2JULA 1CDMA 2M1KB 4PE4A 4I5NB 1WDCC 3AKAA 5AEQA 3TS5C 4PE0A 3I5FB 4HRHA 1K2HA 1NPQA 3LK0A 1YTZC 4PALA 3VRPA 2BCXA 3VROA 2F8PA 2GGMA 1B4CA 1DMOA 2E30A 2JOJA 1J7QA 4GPLB 1CDLA 2K2FA 4NDCA 1GGWA 2R2IA 2ZN9A 3EK8A 2Q4UA 1XFZO 4HSZA 4GFTA 4ICBA 1TIZA 2CTNA 4R1EA 4JWQA 2LLUA 3WXAA 1BJFA 2LVVA 5KTYA 1S3PA 2CNPA 1FBVA 3EKHA 4DIRA 1IKUA 2BBMA 1SMGA 4DUQA 1DGUA 1KFXS 1SKTA 3BUXB 1F55A 1YUUA 1F4QA 2MHHA 1DGVA 3LL8B 4AQJA 1A03A 1EG3A 1KSMA 1WRLA 3BXKA 1R2UA 1FPWA 2Y5IA 1XYDA 2VRGA 4PHKA 1D1OA 3SG2A 2L51A 1QIVA 2K61A 2LE9B 1OMVA 2I18A 1E8AA 4D1EA 5I8NA 3OHMB 2EC6B 4DCKA 4ETOA 1K93D 1UWOA 2KOTA 3FIAA 2LHIA 1AK8A 1KSOA 1IQ5A 4MVFA 1B47A 1QVIZ 2KQYA 2MRDA 3D10A 4WQ3A 1UHJA 3ZWHA 1BF5A 1CB1A 2L2EA 1PK0D 1IQ3A 2E6WA 1SL8A 4WQ2A 1IJ6A 3KF9A 1K8UA 1CDPA 2LANA 4WRIA 4MN0A 3DF0A 2BKHB 1KK8B 1QTXA 2LAPA 1A75B 3C1VA 3KEVA 1QX7A 1QX2A 2FJUB 4BY4A 1S5GY 4GNKB 4UPGA 1KWOC 3BQ3A 2JPTA 3CR5X 3I5IC 1F4OA 2WNDA 4ORAB 4QJ5B 2M1UA 3WHTB 2I94A 1IH0A 1F70A 2G2BA 2MAZA 1U5IB 5HKYA 1H8BA 1JFJA 5DKQA 3SG5A 1RFJA 4CFRA 4YI8A 3JVTC 2BCBA 1C7WA 4DS7A 3CS1A 1RK9A 4CFQA 3PATA 5HYDA 2DOQA 1YR5A 2BE4A 4MLWA 4GUKA 4YRUA 2MA2A 1KK7Z 2LVIA 2P6BB 3DVMA 4MRXA 1JC2A 4PDZA 1WRZA 4PE1A 1KFUL 3O78A 2K7DA 1Q80A 2ZFDA 1QJTA 1G33A 4N1FA 2KDHA 1VRKA 4OV2A 1G4YR 5HLOA 2NXQA 1TCFA 2SCPA 1DJHA 5PALA 2LV7A 4OKHA 4PHJA 4AOMA 1CLMA 2HPSA 4F0ZB 1NUBA 2Y1NA 4M2QA
chains in the Genus database with same CATH superfamily
3I5GC 1K90D 1SCMB 2FJYA 5AANA 3HX4A 3SG4A 2KSPA 3JTDC 4IL1A 2ZN8A 1T14A 2JRFA 4FQOA 2JWWA 1R6PA 3V2LA 1DC1A 3NSLA 3SG6A 2JT8A 3BJHA 1CMFA 2BCAA 3AKBA 1TCOB 3WHUB 2PVBA 1B8LA 1A2XA 1NX2A 1SK6D 1W7JB 3BUOB 4YGAA 1HQVA 3DZTA 3E3RA 2M7NA 1ALVA 1NCXA 1CB1A 2F3YA 3FWCA 2F2PA 1UHHA 2CXJA 1FI6A 2LNKA 1UUSA 3PSRA 3QRXA 1W7IB 3KO0A 1MXLC 4ORCB 5HKWA 1WDCB 2HQ8A 3DVKA 1RJVA 1YVHA 3BUWB 3TS5B 2CCMA 1UP5A 1QLKA 1L7ZA 2H2KA 2BNXA 4XJKB 2H61C 2WCBA 4YGEB 2CBLA 1OOFA 5DICA 1CLBA 1DJIA 1DJYA 3BFHA 3RM1A 3A8RA 5B8IB 4ZCUA 1QS7A 3DXLA 5IBWA 1ZMZA 2A4JA 2K7CA 1FF1A 3BUMB 3DYEA 1MF8B 5DKNA 1F8HA 4PCWA 4YI9A 5I94A 2JZIA 1S36A 2LUCA 5CSJA 3KPXA 3DVJA 2QEBA 3TUYC 1QATA 1J1DA 2AMIA 1BU3A 1PULA 1NX0A 1BT6A 2YGUA 5KSZA 4YGBB 2WC8A 1RTP1 1A4PA 1CM4A 3K21A 1A75A 1XK4C 4A4BA 1J7PA 1YX7A 2KQ6A 1Y1AA 4OZDA 1EH2A 3FE8A 1MR8A 1NYAA 1B8CA 5FI6A 2CT9A 1K96A 2LMVA 5ER5A 1JUOA 1WRKA 1FW4A 2Q91A 2I2RE 1TOPA 2LM5A 4GAOA 1U5IA 1JF0A 3CZ2A 2L4HA 2M29A 3M0WA 4NQGA 1JFKA 3L4AA 4MZJA 3VRQA 1L2OC 1B8RA 1XFUO 1SW8A 1V1FA 1NSHA 1AJ4A 2WORA 4I5LB 4JQ0D 1B9AA 5AERA 1MHOA 3OB2B 2EGDA 2ZNDA 1EL4A 1WY9A 1Y1XA 1XO5A 1YUTA 2V53A 5K89A 1QV1A 1SBJA 2LMUA 3CR2A 3VRNA 3EVUA 1PALA 2JT3A 1KWOB 4CPVA 2KAYA 3B6XA 2L0PA 1YX8A 3I5IB 2WC6A 2PRUA 1SSEB 5HKZA 4N1GA 1OZOA 5G08A 5JJGA 1FI5A 1X02A 1XVJA 4MSPA 1K9UA 3D73A 3OB1B 4QJ4B 5DKRA 5J3XA 1SYMA 2KGRA 2KYFA 2M9GA 2ZRTA 3DY9A 1K94A 3SIBA 1QX5B 1DELA 3JVTB 3VRRA 2L98A 2WCFA 1KFXL 1JBAA 3EVRA 3FS7A 1S6IA 3LLEA 1SR6C 4PE7A 2BE6A 4M2PA 2Y1MA 1CFCA 2WCHA 5CSNA 1S26D 1ALWA 1ZUZA 5FI7A 1OQPA 1MQ1A 2LC5A 4C0JA 2G9BA 1IG5A 3CDNA 1DJGA 3CGAA 4Q04A 1OSAA 3TDIA 1K9KA 1BMOA 5KU1A 2F3ZA 1SCVA 2OPOA 2L2CA 1TNWA 1J7OA 1ZFSA 1NX1A 3O2PA 2ERBA 1RECA 2NCOA 3I5HC 2L5YA 1XFRA 1M46A 3AAKA 3D75A 3DD4A 1TTXA 4HRGA 3NSKA 1S6CA 2BL0C 2KI6D 3H4SE 1S5GZ 3I5GB 4BY5A 1PVAA 4CIDA 2KAXA 1CMGA 2K60A 1MUXA 1AHRA 3JTDB 3B7AA 1SPYA 1LS8A 1QXPA 4BY4A 2FCEA 4OR9B 1DJWA 2PSRA 1K95A 1XFXO 1LA3A 1JF2A 1S6JA 1SY9A 1NIWA 4XJKA 1DJZA 3AAJA 4OCIA 3S0BA 1GQMA 2ZRSA 1KQVA 3TDUA 1OZSA 4GGFC 2OTGC 2KNEA 5D7FA 4U8DA 1DF0A 3CR4X 1AJ5A 1SRAA 1M39A 2LP2A 3NSIA 1OOJA 1YURA 2OS8C 3PALA 1AP4A 2KFHA 4P2YB 1KCYA 3B88A 1XK4A 4PHMA 5I2OA 1B7TY 1M45A 4P5OE 1DQEA 2JXLA 4NDBA 1JSAA 2JNFA 2LVKA 3ICBA 2KFFA 3PN7C 3CLNA 1QLSA 2NZ0A 3EG5B 1KQMC 3ZNIA 1H4BA 1QV0A 1SL7A 2KHNA 1C3YA 4M2OA 3TZ1A 2NLNA 2GV5A 1CKKA 4C0KA 2BAPA 2M8UA 1N65A 2BECA 4DRWA 3NXAA 1Y0VH 2HF5A 1J55A 2FCDA 3EK7A 3FE6A 2QEVA 5D69A 1J1EA 4AQIA 2WCLA 1LKJA 2HETA 3TUYB 4E68A 1TUJA 2WCKA 1DF0B 2P71A 2PALA 4I5JA 1CFDA 5FI2A 1RROA 4ORBB 2RGIA 1C7VA 1IJ5A 1UHKA 3EK4A 3HCMA 4XYNA 1BR1B 4MRYA 1NWDA 2COLB 3SJSA 4GBAA 3GK1A 1IGVA 2KI4C 3D0YB 1S1EA 1UURA 1DT7B 1B1GA 2F2OA 4INWA 1GJYA 3NHIA 4ZCVA 1LINA 3Q8IA 2MBXA 2KI6C 2JNXA 1TNXA 3FE9A 2KAVA 4QJ3B 1L2OB 3PFVA 2MJWB 1SL9A 3F45A 1TN4A 1ZOTB 2BBNA 1V1GA 4USLA 1BOCA 1LVCD 3OP0A 1BR4B 1DJXA 4YBHB 3VB1A 2BKIB 1QVIY 2EHBA 2WCEA 4INXA 1OE9B 3O6BA 3TDZA 3I5FC 2L4IA 1AUIB 5CSIA 1A29A 3D78A 3L47A 3B86A 2GGZA 1IIOA 1CDNA 1GGZA 3LK1A 1XFWO 2LLSA 1MWNA 5F6TA 4C0LA 1XFYO 1DTLA 2QPTA 1EJ3A 3EKJA 1UHNA 2K7BA 5FYXA 4L9MA 1ZACA 4NDDA 1PSBA 1SR6B 3R1VA 4JD9A 4KYNA 5ER4X 1SNLA 5TNCA 3RZSA 2JQ6A 1TNQA 2KGBC 3L4LA 4F7FA 3CZTX 1NX3A 4GGFA 5JOLA 1NCZA 5BPJA 2HQWA 3PLFB 4MZKA 3EVVA 1IWQA 3OX6A 1YVLA 3WNXB 3PJIA 5AXIA 1DVIA 1IRJA 1JWDA 1CNPA 1KFUS 1KK7Y 3SS5A 2I7AA 3DVEA 2L50A 1CM1A 2JU0A 3UNWA 5AFPA 3SS4A 1J7RA 1UHIA 2EC6C 2WCMA 3FWBA 1M63B 3I5HB 1QASA 2KFGA 3D77A 2L5XB 2BL0B 2MLFC 1TRFA 2M3WA 4MZLA 3SG3A 2M97A 1QWVA 1PRWA 3SG7A 2Y4QA 4YGCB 5I2LA 3RLZA 3S0DA 1G8IA 1RWYA 1GM0A 1NP8A 5HL1A 1LA0A 1KK8C 1Y6WA 1YRTB 5CPVA 3OX5A 2H61A 3NGVA 4MEWA 2KBMA 2KBIA 1BODA 4JPZB 2OTGB 2JXCA 2M49B 2O5GA 1YUSA 3BYAA 2ZNEA 3BOWA 1EXRA 2FOTA 4MBEA 1ODBA 3S0AA 1K9PA 2QACA 2B1UA 2K0JA 2KLDA 1XFVO 4FQTA 2ZKMX 2LCPA 2JTZA 3GOFA 4PHNA 5GQQC 4TNCA 2OS8B 3NSOA 2AUCA 1Z4HA 2SASA 1AVSA 1N2DA 2KYCA 2LVJA 1TNPA 1CFFA 3B87A 3R72A 1HT9A 2LUXA 2ISDA 5I2QA 5HLVA 2WOSA 1WLMA 2IS9A 3DF0B 3BUNB 4CLNA 2D8NA 1BG1A 2JT0A 1N0YA 3PN7B 2H8VA 1NCYA 2JPOA 2NCPA 3IVTA 2LMTA 1KQMB 1YRUB 1C07A 2PASA 1CTRA 3N7HA 3QMEA 2PMYA 3OBVA 4I5KA 2JC2A 3GK2A 3O4YA 1LXFC 1OOIX 2LHLA 1F54A 3O4XA 3D0YA 4GGNA 4A4CA 1EG4A 3KHEA 3S0EA 3MSEB 1CLLA 5CSFA 1ORGA 5EL2A 1XA5A 1OMRA 3BOWB 3S0GA 4HREE 1M31A 2LLTA 2K8MB 3R1OA 2PQLA 3IQQA 1PVBA 2GTEA 1OMDA 1OW4A 1SCMC 1Y1UA 2K2AA 3A4UB 3CWGA 3IQOA 3OGNA 3UO9A 4OVNF 4FTGA 2AAOA 2JTTA 2M0RA 3LCPC 3CTNA 1F71A 2KI4B 1BLQA 1PSRA 2M7LA 3BFBA 1B7TZ 2O60A 1TWOA 1WLZA 3VGOA 2MLEC 1MXEA 3IF7A 3GK4X 2K7OA 2TN4A 2LP3A 3D76A 3PM8A 1C3ZA 3BFAA 1QIWA 1CFPA 2F33A 3SIAA 2QEHA 4YGDB 2JULA 1CDMA 2M1KB 4PE4A 4I5NB 1WDCC 3AKAA 5AEQA 3TS5C 4PE0A 3I5FB 1DEKA 4HRHA 1K2HA 1NPQA 3LK0A 1YTZC 4PALA 3VRPA 2BCXA 3VROA 2F8PA 2GGMA 1B4CA 1DMOA 2E30A 2JOJA 3SS3A 1J7QA 2KLEA 4PT1A 4GPLB 1CDLA 2K2FA 4NDCA 1GGWA 2R2IA 2ZN9A 3EK8A 2Q4UA 1XFZO 3R1PA 4HSZA 4GFTA 4ICBA 1TIZA 2CTNA 4R1EA 4JWQA 2LLUA 3WXAA 1BJFA 2LVVA 5KTYA 1S3PA 2CNPA 1FBVA 2P70A 3EKHA 4DIRA 1IKUA 2BBMA 1SMGA 4DUQA 1DGUA 1KFXS 1SKTA 3BUXB 1F55A 1YUUA 1F4QA 2MHHA 1DGVA 3LL8B 4IJ7A 4AQJA 1A03A 1EG3A 5D3OA 1KSMA 1WRLA 3BXKA 1R2UA 1FPWA 2Y5IA 1XYDA 2VRGA 4PHKA 1D1OA 3D74A 3SG2A 2L51A 1QIVA 2K61A 2LE9B 1OMVA 2I18A 4N5XA 1E8AA 4D1EA 5I8NA 3OHMB 3CZ1A 2EC6B 4DCKA 4ETOA 1K93D 1UWOA 2KOTA 3FIAA 3PM2A 2LHIA 1AK8A 1KSOA 1IQ5A 4MVFA 1B47A 1QVIZ 2KQYA 2MRDA 3D10A 4WQ3A 1UHJA 3ZWHA 1BF5A 3CABA 4JKTA 2L2EA 1PK0D 1IQ3A 3CYZA 2E6WA 1SL8A 3NHTA 4WQ2A 1IJ6A 3KF9A 1K8UA 1CDPA 2LANA 4WRIA 4MN0A 3DF0A 2BKHB 1KK8B 1QTXA 2LAPA 1A75B 3C1VA 1W9ZA 1QX7A 1QX2A 2FJUB 3KEVA 1P28A 1S5GY 3K1EA 4GNKB 2WCJA 4UPGA 1KWOC 3BQ3A 2JPTA 3CR5X 3I5IC 1F4OA 2WNDA 3CZ0A 4ORAB 4QJ5B 2M1UA 2PYQA 2I94A 3WHTB 1IH0A 1F70A 2G2BA 2KPHA 2MAZA 1U5IB 5HKYA 1H8BA 1JFJA 5DKQA 3SG5A 1RFJA 2QDIA 4CFRA 4YI8A 3JVTC 2BCBA 1C7WA 4DS7A 3CS1A 1RK9A 4CFQA 3PATA 5HYDA 2DOQA 1YR5A 2BE4A 4MLWA 4GUKA 4YRUA 2MA2A 2QEOA 1KK7Z 2LVIA 2P6BB 3DVMA 4MRXA 1JC2A 1OOGA 4PDZA 1WRZA 4PE1A 1KFUL 3O78A 2K7DA 1Q80A 2ZFDA 1QJTA 1G33A 4N1FA 2KDHA 1VRKA 4OV2A 1G4YR 5HLOA 2NXQA 1TCFA 2SCPA 1DJHA 1OOHA 5PALA 2LV7A 1TUZA 4OKHA 1Z2CB 4PHJA 3S0FA 4AOMA 2WC5A 1CLMA 2HPSA 4F0ZB 1NUBA 2Y1NA 4M2QA
chains in the Genus database with same CATH topology
3I5GC 1K90D 1SCMB 5AANA 3HX4A 3SG4A 2KSPA 3JTDC 4IL1A 2ZN8A 4FQOA 2JRFA 2JWWA 1R6PA 3NSLA 3SG6A 2JT8A 1CMFA 2BCAA 3AKBA 1TCOB 3WHUB 2PVBA 1B8LA 1A2XA 1NX2A 1SK6D 1W7JB 3BUOB 4YGAA 1HQVA 3E3RA 2M7NA 1ALVA 1NCXA 2F3YA 3FWCA 2F2PA 1UHHA 2CXJA 1FI6A 2LNKA 1UUSA 3PSRA 3QRXA 1W7IB 3KO0A 1MXLC 4ORCB 5HKWA 1WDCB 2HQ8A 3DVKA 1RJVA 1YVHA 3BUWB 3TS5B 2CCMA 1UP5A 1QLKA 1L7ZA 2H2KA 4XJKB 2H61C 2WCBA 4YGEB 2CBLA 1CLBA 1DJIA 1DJYA 3RM1A 3A8RA 5B8IB 4ZCUA 1QS7A 5IBWA 1ZMZA 2A4JA 2K7CA 1FF1A 3BUMB 1F8HA 1MF8B 5DKNA 4PCWA 4YI9A 2JZIA 1S36A 2LUCA 5CSJA 3KPXA 3DVJA 3TUYC 1QATA 1J1DA 2AMIA 1BU3A 1PULA 1NX0A 1BT6A 5KSZA 4YGBB 2WC8A 1RTP1 1A4PA 1CM4A 3K21A 1A75A 1XK4C 4A4BA 1J7PA 1YX7A 2KQ6A 1Y1AA 1EH2A 1MR8A 1NYAA 1B8CA 2CT9A 1K96A 2LMVA 5ER5A 1JUOA 1WRKA 1FW4A 2Q91A 2I2RE 1TOPA 2LM5A 4GAOA 1U5IA 1JF0A 2L4HA 2M29A 3M0WA 4NQGA 1JFKA 4MZJA 3VRQA 1L2OC 1B8RA 1XFUO 1SW8A 1V1FA 1NSHA 1AJ4A 2WORA 4I5LB 4JQ0D 1B9AA 5AERA 1MHOA 3OB2B 2EGDA 2ZNDA 1EL4A 1WY9A 1Y1XA 1XO5A 1YUTA 2V53A 5K89A 1QV1A 1SBJA 2LMUA 3CR2A 3VRNA 3EVUA 1PALA 2JT3A 1KWOB 4CPVA 2KAYA 2L0PA 1YX8A 3I5IB 2PRUA 5HKZA 4N1GA 1OZOA 5G08A 5JJGA 1FI5A 1X02A 1XVJA 4MSPA 1K9UA 4QJ4B 3OB1B 5DKRA 5J3XA 1SYMA 2KGRA 2KYFA 2M9GA 2ZRTA 1K94A 3SIBA 1QX5B 3VRRA 3JVTB 2L98A 2WCFA 1KFXL 1JBAA 3EVRA 3FS7A 1S6IA 3LLEA 1SR6C 4PE7A 2BE6A 4M2PA 2Y1MA 1CFCA 5CSNA 1S26D 1ALWA 1ZUZA 1OQPA 1MQ1A 2LC5A 4C0JA 2G9BA 1IG5A 1DJGA 3CGAA 4Q04A 1OSAA 3TDIA 1K9KA 1BMOA 5KU1A 2F3ZA 1SCVA 2OPOA 1TNWA 1J7OA 1ZFSA 1NX1A 3O2PA 1RECA 2NCOA 3I5HC 1M46A 3AAKA 3DD4A 1TTXA 4HRGA 3NSKA 1S6CA 2BL0C 2KI6D 3H4SE 1S5GZ 3I5GB 4BY5A 1PVAA 4CIDA 2KAXA 1CMGA 1MUXA 1AHRA 3JTDB 1SPYA 1QXPA 2FCEA 4OR9B 1DJWA 2PSRA 1K95A 1XFXO 1LA3A 1JF2A 1S6JA 1SY9A 1NIWA 4XJKA 1DJZA 3AAJA 4OCIA 1GQMA 2ZRSA 1KQVA 3TDUA 1OZSA 4GGFC 2OTGC 2KNEA 5D7FA 4U8DA 1DF0A 3CR4X 1AJ5A 1SRAA 1M39A 2LP2A 3NSIA 1OOJA 1YURA 2OS8C 3PALA 1AP4A 2KFHA 4P2YB 1KCYA 4PHMA 1XK4A 5I2OA 1B7TY 1M45A 4P5OE 2JXLA 4NDBA 1JSAA 2JNFA 2LVKA 3ICBA 2KFFA 3PN7C 3CLNA 1QLSA 2NZ0A 3ZNIA 1KQMC 1H4BA 1QV0A 1SL7A 2KHNA 4M2OA 3TZ1A 2NLNA 2GV5A 1CKKA 4C0KA 2M8UA 1N65A 2BECA 4DRWA 3NXAA 1Y0VH 2HF5A 1J55A 2FCDA 3EK7A 5D69A 1J1EA 4AQIA 1LKJA 2HETA 3TUYB 4E68A 1DF0B 2PALA 4I5JA 1CFDA 1RROA 4ORBB 2RGIA 1C7VA 1IJ5A 1UHKA 3EK4A 3HCMA 4XYNA 1BR1B 4MRYA 1NWDA 2COLB 3SJSA 4GBAA 3GK1A 1IGVA 2KI4C 3D0YB 1S1EA 1UURA 1DT7B 1B1GA 2F2OA 1GJYA 4ZCVA 1LINA 2MBXA 2KI6C 2JNXA 1TNXA 2KAVA 4QJ3B 1L2OB 3PFVA 2MJWB 1SL9A 3F45A 1TN4A 1ZOTB 2BBNA 1V1GA 4USLA 1BOCA 1LVCD 3OP0A 1BR4B 1DJXA 4YBHB 2BKIB 1QVIY 2EHBA 2WCEA 1OE9B 3O6BA 3TDZA 3I5FC 2L4IA 1AUIB 5CSIA 1A29A 2GGZA 1CDNA 1GGZA 3LK1A 1XFWO 2LLSA 1MWNA 5F6TA 4C0LA 1XFYO 1DTLA 2QPTA 1EJ3A 3EKJA 1UHNA 2K7BA 5FYXA 4L9MA 1ZACA 4NDDA 1PSBA 1SR6B 5ER4X 5TNCA 1SNLA 2JQ6A 1TNQA 2KGBC 3CZTX 1NX3A 4GGFA 5JOLA 1NCZA 5BPJA 2HQWA 3PLFB 4MZKA 3EVVA 1IWQA 3OX6A 1YVLA 3WNXB 5AXIA 1DVIA 1IRJA 1JWDA 1CNPA 1KFUS 1KK7Y 2I7AA 3DVEA 2L50A 1CM1A 2JU0A 5AFPA 1J7RA 1UHIA 2EC6C 3FWBA 1M63B 3I5HB 1QASA 2KFGA 2L5XB 2BL0B 2MLFC 1TRFA 2M3WA 4MZLA 3SG3A 2M97A 1PRWA 3SG7A 2Y4QA 4YGCB 5I2LA 3RLZA 1G8IA 1RWYA 1NP8A 1LA0A 1KK8C 1Y6WA 1YRTB 5CPVA 3OX5A 2H61A 4MEWA 2KBMA 2KBIA 1BODA 4JPZB 2OTGB 2JXCA 2M49B 2O5GA 1YUSA 3BYAA 2ZNEA 3BOWA 1EXRA 2FOTA 4MBEA 1ODBA 1K9PA 2QACA 2B1UA 2K0JA 4N5XA 1XFVO 2ZKMX 2LCPA 2JTZA 3GOFA 4PHNA 5GQQC 4TNCA 2OS8B 3NSOA 2AUCA 2SASA 1AVSA 1N2DA 2KYCA 2LVJA 1TNPA 1CFFA 1HT9A 2LUXA 2ISDA 5I2QA 5HLVA 2WOSA 1WLMA 2IS9A 3DF0B 3BUNB 4CLNA 2D8NA 1BG1A 2JT0A 1N0YA 3PN7B 1NCYA 2NCPA 2LMTA 1KQMB 1YRUB 1C07A 2PASA 1CTRA 2PMYA 4I5KA 2JC2A 3GK2A 3O4YA 1LXFC 2LHLA 1F54A 3D0YA 4GGNA 4A4CA 1EG4A 3KHEA 3MSEB 1CLLA 5CSFA 1XA5A 1OMRA 3BOWB 4HREE 1M31A 2LLTA 2K8MB 3IQQA 1PVBA 1OMDA 1SCMC 1Y1UA 2K2AA 3A4UB 3CWGA 3IQOA 4OVNF 4FTGA 2AAOA 2JTTA 2M0RA 3LCPC 3CTNA 1F71A 2KI4B 1BLQA 1PSRA 2M7LA 1B7TZ 2O60A 1WLZA 3VGOA 2MLEC 1MXEA 3IF7A 3GK4X 2K7OA 2TN4A 2LP3A 3PM8A 1CFPA 1QIWA 2F33A 3SIAA 4YGDB 2JULA 1CDMA 2M1KB 4PE4A 4I5NB 1WDCC 3AKAA 5AEQA 3TS5C 4PE0A 3I5FB 4HRHA 1K2HA 1NPQA 3LK0A 1YTZC 4PALA 3VRPA 2BCXA 3VROA 2F8PA 2GGMA 1B4CA 1DMOA 2E30A 2JOJA 1J7QA 4GPLB 1CDLA 2K2FA 4NDCA 1GGWA 2R2IA 2ZN9A 3EK8A 2Q4UA 1XFZO 4HSZA 4GFTA 4ICBA 1TIZA 2CTNA 4R1EA 4JWQA 2LLUA 3WXAA 1BJFA 2LVVA 5KTYA 1S3PA 2CNPA 1FBVA 3EKHA 4DIRA 1IKUA 2BBMA 1SMGA 4DUQA 1DGUA 1KFXS 1SKTA 3BUXB 1F55A 1YUUA 1F4QA 2MHHA 1DGVA 3LL8B 4AQJA 1A03A 1EG3A 1KSMA 1WRLA 3BXKA 1R2UA 1FPWA 2Y5IA 1XYDA 2VRGA 4PHKA 1D1OA 3SG2A 2L51A 1QIVA 2K61A 2LE9B 1OMVA 2I18A 1E8AA 4D1EA 5I8NA 3OHMB 2EC6B 4DCKA 4ETOA 1K93D 1UWOA 2KOTA 3FIAA 2LHIA 1AK8A 1KSOA 1IQ5A 4MVFA 1B47A 1QVIZ 2KQYA 2MRDA 3D10A 4WQ3A 1UHJA 3ZWHA 1BF5A 1CB1A 2L2EA 1PK0D 1IQ3A 2E6WA 1SL8A 4WQ2A 1IJ6A 3KF9A 1K8UA 1CDPA 2LANA 4WRIA 4MN0A 3DF0A 2BKHB 1KK8B 1QTXA 2LAPA 1A75B 3C1VA 3KEVA 1QX7A 1QX2A 2FJUB 4BY4A 1S5GY 4GNKB 4UPGA 1KWOC 3BQ3A 2JPTA 3CR5X 3I5IC 1F4OA 2WNDA 4ORAB 4QJ5B 2M1UA 3WHTB 2I94A 1IH0A 1F70A 2G2BA 2MAZA 1U5IB 5HKYA 1H8BA 1JFJA 5DKQA 3SG5A 1RFJA 4CFRA 4YI8A 3JVTC 2BCBA 1C7WA 4DS7A 3CS1A 1RK9A 4CFQA 3PATA 5HYDA 2DOQA 1YR5A 2BE4A 4MLWA 4GUKA 4YRUA 2MA2A 1KK7Z 2LVIA 2P6BB 3DVMA 4MRXA 1JC2A 4PDZA 1WRZA 4PE1A 1KFUL 3O78A 2K7DA 1Q80A 2ZFDA 1QJTA 1G33A 4N1FA 2KDHA 1VRKA 4OV2A 1G4YR 5HLOA 2NXQA 1TCFA 2SCPA 1DJHA 5PALA 2LV7A 4OKHA 4PHJA 4AOMA 1CLMA 2HPSA 4F0ZB 1NUBA 2Y1NA 4M2QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I5G C;  1K90 D;  1SCM B;  5AAN A;  3HX4 A;  3SG4 A;  2KSP A;  3JTD C;  4IL1 A;  2ZN8 A;  4FQO A;  2JRF A;  2JWW A;  1R6P A;  3NSL A;  3SG6 A;  2JT8 A;  1CMF A;  2BCA A;  3AKB A;  1TCO B;  3WHU B;  2PVB A;  1B8L A;  1A2X A;  1NX2 A;  1SK6 D;  1W7J B;  3BUO B;  4YGA A;  1HQV A;  3E3R A;  2M7N A;  1ALV A;  1NCX A;  2F3Y A;  3FWC A;  2F2P A;  1UHH A;  2CXJ A;  1FI6 A;  2LNK A;  1UUS A;  3PSR A;  3QRX A;  1W7I B;  3KO0 A;  1MXL C;  4ORC B;  5HKW A;  1WDC B;  2HQ8 A;  3DVK A;  1RJV A;  1YVH A;  3BUW B;  3TS5 B;  2CCM A;  1UP5 A;  1QLK A;  1L7Z A;  2H2K A;  4XJK B;  2H61 C;  2WCB A;  4YGE B;  2CBL A;  1CLB A;  1DJI A;  1DJY A;  3RM1 A;  3A8R A;  5B8I B;  4ZCU A;  1QS7 A;  5IBW A;  1ZMZ A;  2A4J A;  2K7C A;  1FF1 A;  3BUM B;  1F8H A;  1MF8 B;  5DKN A;  4PCW A;  4YI9 A;  2JZI A;  1S36 A;  2LUC A;  5CSJ A;  3KPX A;  3DVJ A;  3TUY C;  1QAT A;  1J1D A;  2AMI A;  1BU3 A;  1PUL A;  1NX0 A;  1BT6 A;  5KSZ A;  4YGB B;  2WC8 A;  1RTP 1;  1A4P A;  1CM4 A;  3K21 A;  1A75 A;  1XK4 C;  4A4B A;  1J7P A;  1YX7 A;  2KQ6 A;  1Y1A A;  1EH2 A;  1MR8 A;  1NYA A;  1B8C A;  2CT9 A;  1K96 A;  2LMV A;  5ER5 A;  1JUO A;  1WRK A;  1FW4 A;  2Q91 A;  2I2R E;  1TOP A;  2LM5 A;  4GAO A;  1U5I A;  1JF0 A;  2L4H A;  2M29 A;  3M0W A;  4NQG A;  1JFK A;  4MZJ A;  3VRQ A;  1L2O C;  1B8R A;  1XFU O;  1SW8 A;  1V1F A;  1NSH A;  1AJ4 A;  2WOR A;  4I5L B;  4JQ0 D;  1B9A A;  5AER A;  1MHO A;  3OB2 B;  2EGD A;  2ZND A;  1EL4 A;  1WY9 A;  1Y1X A;  1XO5 A;  1YUT A;  2V53 A;  5K89 A;  1QV1 A;  1SBJ A;  2LMU A;  3CR2 A;  3VRN A;  3EVU A;  1PAL A;  2JT3 A;  1KWO B;  4CPV A;  2KAY A;  2L0P A;  1YX8 A;  3I5I B;  2PRU A;  5HKZ A;  4N1G A;  1OZO A;  5G08 A;  5JJG A;  1FI5 A;  1X02 A;  1XVJ A;  4MSP A;  1K9U A;  4QJ4 B;  3OB1 B;  5DKR A;  5J3X A;  1SYM A;  2KGR A;  2KYF A;  2M9G A;  2ZRT A;  1K94 A;  3SIB A;  1QX5 B;  3VRR A;  3JVT B;  2L98 A;  2WCF A;  1KFX L;  1JBA A;  3EVR A;  3FS7 A;  1S6I A;  3LLE A;  1SR6 C;  4PE7 A;  2BE6 A;  4M2P A;  2Y1M A;  1CFC A;  5CSN A;  1S26 D;  1ALW A;  1ZUZ A;  1OQP A;  1MQ1 A;  2LC5 A;  4C0J A;  2G9B A;  1IG5 A;  1DJG A;  3CGA A;  4Q04 A;  1OSA A;  3TDI A;  1K9K A;  1BMO A;  5KU1 A;  2F3Z A;  1SCV A;  2OPO A;  1TNW A;  1J7O A;  1ZFS A;  1NX1 A;  3O2P A;  1REC A;  2NCO A;  3I5H C;  1M46 A;  3AAK A;  3DD4 A;  1TTX A;  4HRG A;  3NSK A;  1S6C A;  2BL0 C;  2KI6 D;  3H4S E;  1S5G Z;  3I5G B;  4BY5 A;  1PVA A;  4CID A;  2KAX A;  1CMG A;  1MUX A;  1AHR A;  3JTD B;  1SPY A;  1QXP A;  2FCE A;  4OR9 B;  1DJW A;  2PSR A;  1K95 A;  1XFX O;  1LA3 A;  1JF2 A;  1S6J A;  1SY9 A;  1NIW A;  4XJK A;  1DJZ A;  3AAJ A;  4OCI A;  1GQM A;  2ZRS A;  1KQV A;  3TDU A;  1OZS A;  4GGF C;  2OTG C;  2KNE A;  5D7F A;  4U8D A;  1DF0 A;  3CR4 X;  1AJ5 A;  1SRA A;  1M39 A;  2LP2 A;  3NSI A;  1OOJ A;  1YUR A;  2OS8 C;  3PAL A;  1AP4 A;  2KFH A;  4P2Y B;  1KCY A;  4PHM A;  1XK4 A;  5I2O A;  1B7T Y;  1M45 A;  4P5O E;  2JXL A;  4NDB A;  1JSA A;  2JNF A;  2LVK A;  3ICB A;  2KFF A;  3PN7 C;  3CLN A;  1QLS A;  2NZ0 A;  3ZNI A;  1KQM C;  1H4B A;  1QV0 A;  1SL7 A;  2KHN A;  4M2O A;  3TZ1 A;  2NLN A;  2GV5 A;  1CKK A;  4C0K A;  2M8U A;  1N65 A;  2BEC A;  4DRW A;  3NXA A;  1Y0V H;  2HF5 A;  1J55 A;  2FCD A;  3EK7 A;  5D69 A;  1J1E A;  4AQI A;  1LKJ A;  2HET A;  3TUY B;  4E68 A;  1DF0 B;  2PAL A;  4I5J A;  1CFD A;  1RRO A;  4ORB B;  2RGI A;  1C7V A;  1IJ5 A;  1UHK A;  3EK4 A;  3HCM A;  4XYN A;  1BR1 B;  4MRY A;  1NWD A;  2COL B;  3SJS A;  4GBA A;  3GK1 A;  1IGV A;  2KI4 C;  3D0Y B;  1S1E A;  1UUR A;  1DT7 B;  1B1G A;  2F2O A;  1GJY A;  4ZCV A;  1LIN A;  2MBX A;  2KI6 C;  2JNX A;  1TNX A;  2KAV A;  4QJ3 B;  1L2O B;  3PFV A;  2MJW B;  1SL9 A;  3F45 A;  1TN4 A;  1ZOT B;  2BBN A;  1V1G A;  4USL A;  1BOC A;  1LVC D;  3OP0 A;  1BR4 B;  1DJX A;  4YBH B;  2BKI B;  1QVI Y;  2EHB A;  2WCE A;  1OE9 B;  3O6B A;  3TDZ A;  3I5F C;  2L4I A;  1AUI B;  5CSI A;  1A29 A;  2GGZ A;  1CDN A;  1GGZ A;  3LK1 A;  1XFW O;  2LLS A;  1MWN A;  5F6T A;  4C0L A;  1XFY O;  1DTL A;  2QPT A;  1EJ3 A;  3EKJ A;  1UHN A;  2K7B A;  5FYX A;  4L9M A;  1ZAC A;  4NDD A;  1PSB A;  1SR6 B;  5ER4 X;  5TNC A;  1SNL A;  2JQ6 A;  1TNQ A;  2KGB C;  3CZT X;  1NX3 A;  4GGF A;  5JOL A;  1NCZ A;  5BPJ A;  2HQW A;  3PLF B;  4MZK A;  3EVV A;  1IWQ A;  3OX6 A;  1YVL A;  3WNX B;  5AXI A;  1DVI A;  1IRJ A;  1JWD A;  1CNP A;  1KFU S;  1KK7 Y;  2I7A A;  3DVE A;  2L50 A;  1CM1 A;  2JU0 A;  5AFP A;  1J7R A;  1UHI A;  2EC6 C;  3FWB A;  1M63 B;  3I5H B;  1QAS A;  2KFG A;  2L5X B;  2BL0 B;  2MLF C;  1TRF A;  2M3W A;  4MZL A;  3SG3 A;  2M97 A;  1PRW A;  3SG7 A;  2Y4Q A;  4YGC B;  5I2L A;  3RLZ A;  1G8I A;  1RWY A;  1NP8 A;  1LA0 A;  1KK8 C;  1Y6W A;  1YRT B;  5CPV A;  3OX5 A;  2H61 A;  4MEW A;  2KBM A;  2KBI A;  1BOD A;  4JPZ B;  2OTG B;  2JXC A;  2M49 B;  2O5G A;  1YUS A;  3BYA A;  2ZNE A;  3BOW A;  1EXR A;  2FOT A;  4MBE A;  1ODB A;  1K9P A;  2QAC A;  2B1U A;  2K0J A;  4N5X A;  1XFV O;  2ZKM X;  2LCP A;  2JTZ A;  3GOF A;  4PHN A;  5GQQ C;  4TNC A;  2OS8 B;  3NSO A;  2AUC A;  2SAS A;  1AVS A;  1N2D A;  2KYC A;  2LVJ A;  1TNP A;  1CFF A;  1HT9 A;  2LUX A;  2ISD A;  5I2Q A;  5HLV A;  2WOS A;  1WLM A;  2IS9 A;  3DF0 B;  3BUN B;  4CLN A;  2D8N A;  1BG1 A;  2JT0 A;  1N0Y A;  3PN7 B;  1NCY A;  2NCP A;  2LMT A;  1KQM B;  1YRU B;  1C07 A;  2PAS A;  1CTR A;  2PMY A;  4I5K A;  2JC2 A;  3GK2 A;  3O4Y A;  1LXF C;  2LHL A;  1F54 A;  3D0Y A;  4GGN A;  4A4C A;  1EG4 A;  3KHE A;  3MSE B;  1CLL A;  5CSF A;  1XA5 A;  1OMR A;  3BOW B;  4HRE E;  1M31 A;  2LLT A;  2K8M B;  3IQQ A;  1PVB A;  1OMD A;  1SCM C;  1Y1U A;  2K2A A;  3A4U B;  3CWG A;  3IQO A;  4OVN F;  4FTG A;  2AAO A;  2JTT A;  2M0R A;  3LCP C;  3CTN A;  1F71 A;  2KI4 B;  1BLQ A;  1PSR A;  2M7L A;  1B7T Z;  2O60 A;  1WLZ A;  3VGO A;  2MLE C;  1MXE A;  3IF7 A;  3GK4 X;  2K7O A;  2TN4 A;  2LP3 A;  3PM8 A;  1CFP A;  1QIW A;  2F33 A;  3SIA A;  4YGD B;  2JUL A;  1CDM A;  2M1K B;  4PE4 A;  4I5N B;  1WDC C;  3AKA A;  5AEQ A;  3TS5 C;  4PE0 A;  3I5F B;  4HRH A;  1K2H A;  1NPQ A;  3LK0 A;  1YTZ C;  4PAL A;  3VRP A;  2BCX A;  3VRO A;  2F8P A;  2GGM A;  1B4C A;  1DMO A;  2E30 A;  2JOJ A;  1J7Q A;  4GPL B;  1CDL A;  2K2F A;  4NDC A;  1GGW A;  2R2I A;  2ZN9 A;  3EK8 A;  2Q4U A;  1XFZ O;  4HSZ A;  4GFT A;  4ICB A;  1TIZ A;  2CTN A;  4R1E A;  4JWQ A;  2LLU A;  3WXA A;  1BJF A;  2LVV A;  5KTY A;  1S3P A;  2CNP A;  1FBV A;  3EKH A;  4DIR A;  1IKU A;  2BBM A;  1SMG A;  4DUQ A;  1DGU A;  1KFX S;  1SKT A;  3BUX B;  1F55 A;  1YUU A;  1F4Q A;  2MHH A;  1DGV A;  3LL8 B;  4AQJ A;  1A03 A;  1EG3 A;  1KSM A;  1WRL A;  3BXK A;  1R2U A;  1FPW A;  2Y5I A;  1XYD A;  2VRG A;  4PHK A;  1D1O A;  3SG2 A;  2L51 A;  1QIV A;  2K61 A;  2LE9 B;  1OMV A;  2I18 A;  1E8A A;  4D1E A;  5I8N A;  3OHM B;  2EC6 B;  4DCK A;  4ETO A;  1K93 D;  1UWO A;  2KOT A;  3FIA A;  2LHI A;  1AK8 A;  1KSO A;  1IQ5 A;  4MVF A;  1B47 A;  1QVI Z;  2KQY A;  2MRD A;  3D10 A;  4WQ3 A;  1UHJ A;  3ZWH A;  1BF5 A;  1CB1 A;  2L2E A;  1PK0 D;  1IQ3 A;  2E6W A;  1SL8 A;  4WQ2 A;  1IJ6 A;  3KF9 A;  1K8U A;  1CDP A;  2LAN A;  4WRI A;  4MN0 A;  3DF0 A;  2BKH B;  1KK8 B;  1QTX A;  2LAP A;  1A75 B;  3C1V A;  3KEV A;  1QX7 A;  1QX2 A;  2FJU B;  4BY4 A;  1S5G Y;  4GNK B;  4UPG A;  1KWO C;  3BQ3 A;  2JPT A;  3CR5 X;  3I5I C;  1F4O A;  2WND A;  4ORA B;  4QJ5 B;  2M1U A;  3WHT B;  2I94 A;  1IH0 A;  1F70 A;  2G2B A;  2MAZ A;  1U5I B;  5HKY A;  1H8B A;  1JFJ A;  5DKQ A;  3SG5 A;  1RFJ A;  4CFR A;  4YI8 A;  3JVT C;  2BCB A;  1C7W A;  4DS7 A;  3CS1 A;  1RK9 A;  4CFQ A;  3PAT A;  5HYD A;  2DOQ A;  1YR5 A;  2BE4 A;  4MLW A;  4GUK A;  4YRU A;  2MA2 A;  1KK7 Z;  2LVI A;  2P6B B;  3DVM A;  4MRX A;  1JC2 A;  4PDZ A;  1WRZ A;  4PE1 A;  1KFU L;  3O78 A;  2K7D A;  1Q80 A;  2ZFD A;  1QJT A;  1G33 A;  4N1F A;  2KDH A;  1VRK A;  4OV2 A;  1G4Y R;  5HLO A;  2NXQ A;  1TCF A;  2SCP A;  1DJH A;  5PAL A;  2LV7 A;  4OKH A;  4PHJ A;  4AOM A;  1CLM A;  2HPS A;  4F0Z B;  1NUB A;  2Y1N A;  4M2Q A; 
#chains in the Genus database with same CATH topology
 3I5G C;  1K90 D;  1SCM B;  2FJY A;  5AAN A;  3HX4 A;  3SG4 A;  2KSP A;  3JTD C;  4IL1 A;  2ZN8 A;  1T14 A;  2JRF A;  4FQO A;  2JWW A;  1R6P A;  3V2L A;  1DC1 A;  3NSL A;  3SG6 A;  2JT8 A;  3BJH A;  1CMF A;  2BCA A;  3AKB A;  1TCO B;  3WHU B;  2PVB A;  1B8L A;  1A2X A;  1NX2 A;  1SK6 D;  1W7J B;  3BUO B;  4YGA A;  1HQV A;  3DZT A;  3E3R A;  2M7N A;  1ALV A;  1NCX A;  1CB1 A;  2F3Y A;  3FWC A;  2F2P A;  1UHH A;  2CXJ A;  1FI6 A;  2LNK A;  1UUS A;  3PSR A;  3QRX A;  1W7I B;  3KO0 A;  1MXL C;  4ORC B;  5HKW A;  1WDC B;  2HQ8 A;  3DVK A;  1RJV A;  1YVH A;  3BUW B;  3TS5 B;  2CCM A;  1UP5 A;  1QLK A;  1L7Z A;  2H2K A;  2BNX A;  4XJK B;  2H61 C;  2WCB A;  4YGE B;  2CBL A;  1OOF A;  5DIC A;  1CLB A;  1DJI A;  1DJY A;  3BFH A;  3RM1 A;  3A8R A;  5B8I B;  4ZCU A;  1QS7 A;  3DXL A;  5IBW A;  1ZMZ A;  2A4J A;  2K7C A;  1FF1 A;  3BUM B;  3DYE A;  1MF8 B;  5DKN A;  1F8H A;  4PCW A;  4YI9 A;  5I94 A;  2JZI A;  1S36 A;  2LUC A;  5CSJ A;  3KPX A;  3DVJ A;  2QEB A;  3TUY C;  1QAT A;  1J1D A;  2AMI A;  1BU3 A;  1PUL A;  1NX0 A;  1BT6 A;  2YGU A;  5KSZ A;  4YGB B;  2WC8 A;  1RTP 1;  1A4P A;  1CM4 A;  3K21 A;  1A75 A;  1XK4 C;  4A4B A;  1J7P A;  1YX7 A;  2KQ6 A;  1Y1A A;  4OZD A;  1EH2 A;  3FE8 A;  1MR8 A;  1NYA A;  1B8C A;  5FI6 A;  2CT9 A;  1K96 A;  2LMV A;  5ER5 A;  1JUO A;  1WRK A;  1FW4 A;  2Q91 A;  2I2R E;  1TOP A;  2LM5 A;  4GAO A;  1U5I A;  1JF0 A;  3CZ2 A;  2L4H A;  2M29 A;  3M0W A;  4NQG A;  1JFK A;  3L4A A;  4MZJ A;  3VRQ A;  1L2O C;  1B8R A;  1XFU O;  1SW8 A;  1V1F A;  1NSH A;  1AJ4 A;  2WOR A;  4I5L B;  4JQ0 D;  1B9A A;  5AER A;  1MHO A;  3OB2 B;  2EGD A;  2ZND A;  1EL4 A;  1WY9 A;  1Y1X A;  1XO5 A;  1YUT A;  2V53 A;  5K89 A;  1QV1 A;  1SBJ A;  2LMU A;  3CR2 A;  3VRN A;  3EVU A;  1PAL A;  2JT3 A;  1KWO B;  4CPV A;  2KAY A;  3B6X A;  2L0P A;  1YX8 A;  3I5I B;  2WC6 A;  2PRU A;  1SSE B;  5HKZ A;  4N1G A;  1OZO A;  5G08 A;  5JJG A;  1FI5 A;  1X02 A;  1XVJ A;  4MSP A;  1K9U A;  3D73 A;  3OB1 B;  4QJ4 B;  5DKR A;  5J3X A;  1SYM A;  2KGR A;  2KYF A;  2M9G A;  2ZRT A;  3DY9 A;  1K94 A;  3SIB A;  1QX5 B;  1DEL A;  3JVT B;  3VRR A;  2L98 A;  2WCF A;  1KFX L;  1JBA A;  3EVR A;  3FS7 A;  1S6I A;  3LLE A;  1SR6 C;  4PE7 A;  2BE6 A;  4M2P A;  2Y1M A;  1CFC A;  2WCH A;  5CSN A;  1S26 D;  1ALW A;  1ZUZ A;  5FI7 A;  1OQP A;  1MQ1 A;  2LC5 A;  4C0J A;  2G9B A;  1IG5 A;  3CDN A;  1DJG A;  3CGA A;  4Q04 A;  1OSA A;  3TDI A;  1K9K A;  1BMO A;  5KU1 A;  2F3Z A;  1SCV A;  2OPO A;  2L2C A;  1TNW A;  1J7O A;  1ZFS A;  1NX1 A;  3O2P A;  2ERB A;  1REC A;  2NCO A;  3I5H C;  2L5Y A;  1XFR A;  1M46 A;  3AAK A;  3D75 A;  3DD4 A;  1TTX A;  4HRG A;  3NSK A;  1S6C A;  2BL0 C;  2KI6 D;  3H4S E;  1S5G Z;  3I5G B;  4BY5 A;  1PVA A;  4CID A;  2KAX A;  1CMG A;  2K60 A;  1MUX A;  1AHR A;  3JTD B;  3B7A A;  1SPY A;  1LS8 A;  1QXP A;  4BY4 A;  2FCE A;  4OR9 B;  1DJW A;  2PSR A;  1K95 A;  1XFX O;  1LA3 A;  1JF2 A;  1S6J A;  1SY9 A;  1NIW A;  4XJK A;  1DJZ A;  3AAJ A;  4OCI A;  3S0B A;  1GQM A;  2ZRS A;  1KQV A;  3TDU A;  1OZS A;  4GGF C;  2OTG C;  2KNE A;  5D7F A;  4U8D A;  1DF0 A;  3CR4 X;  1AJ5 A;  1SRA A;  1M39 A;  2LP2 A;  3NSI A;  1OOJ A;  1YUR A;  2OS8 C;  3PAL A;  1AP4 A;  2KFH A;  4P2Y B;  1KCY A;  3B88 A;  1XK4 A;  4PHM A;  5I2O A;  1B7T Y;  1M45 A;  4P5O E;  1DQE A;  2JXL A;  4NDB A;  1JSA A;  2JNF A;  2LVK A;  3ICB A;  2KFF A;  3PN7 C;  3CLN A;  1QLS A;  2NZ0 A;  3EG5 B;  1KQM C;  3ZNI A;  1H4B A;  1QV0 A;  1SL7 A;  2KHN A;  1C3Y A;  4M2O A;  3TZ1 A;  2NLN A;  2GV5 A;  1CKK A;  4C0K A;  2BAP A;  2M8U A;  1N65 A;  2BEC A;  4DRW A;  3NXA A;  1Y0V H;  2HF5 A;  1J55 A;  2FCD A;  3EK7 A;  3FE6 A;  2QEV A;  5D69 A;  1J1E A;  4AQI A;  2WCL A;  1LKJ A;  2HET A;  3TUY B;  4E68 A;  1TUJ A;  2WCK A;  1DF0 B;  2P71 A;  2PAL A;  4I5J A;  1CFD A;  5FI2 A;  1RRO A;  4ORB B;  2RGI A;  1C7V A;  1IJ5 A;  1UHK A;  3EK4 A;  3HCM A;  4XYN A;  1BR1 B;  4MRY A;  1NWD A;  2COL B;  3SJS A;  4GBA A;  3GK1 A;  1IGV A;  2KI4 C;  3D0Y B;  1S1E A;  1UUR A;  1DT7 B;  1B1G A;  2F2O A;  4INW A;  1GJY A;  3NHI A;  4ZCV A;  1LIN A;  3Q8I A;  2MBX A;  2KI6 C;  2JNX A;  1TNX A;  3FE9 A;  2KAV A;  4QJ3 B;  1L2O B;  3PFV A;  2MJW B;  1SL9 A;  3F45 A;  1TN4 A;  1ZOT B;  2BBN A;  1V1G A;  4USL A;  1BOC A;  1LVC D;  3OP0 A;  1BR4 B;  1DJX A;  4YBH B;  3VB1 A;  2BKI B;  1QVI Y;  2EHB A;  2WCE A;  4INX A;  1OE9 B;  3O6B A;  3TDZ A;  3I5F C;  2L4I A;  1AUI B;  5CSI A;  1A29 A;  3D78 A;  3L47 A;  3B86 A;  2GGZ A;  1IIO A;  1CDN A;  1GGZ A;  3LK1 A;  1XFW O;  2LLS A;  1MWN A;  5F6T A;  4C0L A;  1XFY O;  1DTL A;  2QPT A;  1EJ3 A;  3EKJ A;  1UHN A;  2K7B A;  5FYX A;  4L9M A;  1ZAC A;  4NDD A;  1PSB A;  1SR6 B;  3R1V A;  4JD9 A;  4KYN A;  5ER4 X;  1SNL A;  5TNC A;  3RZS A;  2JQ6 A;  1TNQ A;  2KGB C;  3L4L A;  4F7F A;  3CZT X;  1NX3 A;  4GGF A;  5JOL A;  1NCZ A;  5BPJ A;  2HQW A;  3PLF B;  4MZK A;  3EVV A;  1IWQ A;  3OX6 A;  1YVL A;  3WNX B;  3PJI A;  5AXI A;  1DVI A;  1IRJ A;  1JWD A;  1CNP A;  1KFU S;  1KK7 Y;  3SS5 A;  2I7A A;  3DVE A;  2L50 A;  1CM1 A;  2JU0 A;  3UNW A;  5AFP A;  3SS4 A;  1J7R A;  1UHI A;  2EC6 C;  2WCM A;  3FWB A;  1M63 B;  3I5H B;  1QAS A;  2KFG A;  3D77 A;  2L5X B;  2BL0 B;  2MLF C;  1TRF A;  2M3W A;  4MZL A;  3SG3 A;  2M97 A;  1QWV A;  1PRW A;  3SG7 A;  2Y4Q A;  4YGC B;  5I2L A;  3RLZ A;  3S0D A;  1G8I A;  1RWY A;  1GM0 A;  1NP8 A;  5HL1 A;  1LA0 A;  1KK8 C;  1Y6W A;  1YRT B;  5CPV A;  3OX5 A;  2H61 A;  3NGV A;  4MEW A;  2KBM A;  2KBI A;  1BOD A;  4JPZ B;  2OTG B;  2JXC A;  2M49 B;  2O5G A;  1YUS A;  3BYA A;  2ZNE A;  3BOW A;  1EXR A;  2FOT A;  4MBE A;  1ODB A;  3S0A A;  1K9P A;  2QAC A;  2B1U A;  2K0J A;  2KLD A;  1XFV O;  4FQT A;  2ZKM X;  2LCP A;  2JTZ A;  3GOF A;  4PHN A;  5GQQ C;  4TNC A;  2OS8 B;  3NSO A;  2AUC A;  1Z4H A;  2SAS A;  1AVS A;  1N2D A;  2KYC A;  2LVJ A;  1TNP A;  1CFF A;  3B87 A;  3R72 A;  1HT9 A;  2LUX A;  2ISD A;  5I2Q A;  5HLV A;  2WOS A;  1WLM A;  2IS9 A;  3DF0 B;  3BUN B;  4CLN A;  2D8N A;  1BG1 A;  2JT0 A;  1N0Y A;  3PN7 B;  2H8V A;  1NCY A;  2JPO A;  2NCP A;  3IVT A;  2LMT A;  1KQM B;  1YRU B;  1C07 A;  2PAS A;  1CTR A;  3N7H A;  3QME A;  2PMY A;  3OBV A;  4I5K A;  2JC2 A;  3GK2 A;  3O4Y A;  1LXF C;  1OOI X;  2LHL A;  1F54 A;  3O4X A;  3D0Y A;  4GGN A;  4A4C A;  1EG4 A;  3KHE A;  3S0E A;  3MSE B;  1CLL A;  5CSF A;  1ORG A;  5EL2 A;  1XA5 A;  1OMR A;  3BOW B;  3S0G A;  4HRE E;  1M31 A;  2LLT A;  2K8M B;  3R1O A;  2PQL A;  3IQQ A;  1PVB A;  2GTE A;  1OMD A;  1OW4 A;  1SCM C;  1Y1U A;  2K2A A;  3A4U B;  3CWG A;  3IQO A;  3OGN A;  3UO9 A;  4OVN F;  4FTG A;  2AAO A;  2JTT A;  2M0R A;  3LCP C;  3CTN A;  1F71 A;  2KI4 B;  1BLQ A;  1PSR A;  2M7L A;  3BFB A;  1B7T Z;  2O60 A;  1TWO A;  1WLZ A;  3VGO A;  2MLE C;  1MXE A;  3IF7 A;  3GK4 X;  2K7O A;  2TN4 A;  2LP3 A;  3D76 A;  3PM8 A;  1C3Z A;  3BFA A;  1QIW A;  1CFP A;  2F33 A;  3SIA A;  2QEH A;  4YGD B;  2JUL A;  1CDM A;  2M1K B;  4PE4 A;  4I5N B;  1WDC C;  3AKA A;  5AEQ A;  3TS5 C;  4PE0 A;  3I5F B;  1DEK A;  4HRH A;  1K2H A;  1NPQ A;  3LK0 A;  1YTZ C;  4PAL A;  3VRP A;  2BCX A;  3VRO A;  2F8P A;  2GGM A;  1B4C A;  1DMO A;  2E30 A;  2JOJ A;  3SS3 A;  1J7Q A;  2KLE A;  4PT1 A;  4GPL B;  1CDL A;  2K2F A;  4NDC A;  1GGW A;  2R2I A;  2ZN9 A;  3EK8 A;  2Q4U A;  1XFZ O;  3R1P A;  4HSZ A;  4GFT A;  4ICB A;  1TIZ A;  2CTN A;  4R1E A;  4JWQ A;  2LLU A;  3WXA A;  1BJF A;  2LVV A;  5KTY A;  1S3P A;  2CNP A;  1FBV A;  2P70 A;  3EKH A;  4DIR A;  1IKU A;  2BBM A;  1SMG A;  4DUQ A;  1DGU A;  1KFX S;  1SKT A;  3BUX B;  1F55 A;  1YUU A;  1F4Q A;  2MHH A;  1DGV A;  3LL8 B;  4IJ7 A;  4AQJ A;  1A03 A;  1EG3 A;  5D3O A;  1KSM A;  1WRL A;  3BXK A;  1R2U A;  1FPW A;  2Y5I A;  1XYD A;  2VRG A;  4PHK A;  1D1O A;  3D74 A;  3SG2 A;  2L51 A;  1QIV A;  2K61 A;  2LE9 B;  1OMV A;  2I18 A;  4N5X A;  1E8A A;  4D1E A;  5I8N A;  3OHM B;  3CZ1 A;  2EC6 B;  4DCK A;  4ETO A;  1K93 D;  1UWO A;  2KOT A;  3FIA A;  3PM2 A;  2LHI A;  1AK8 A;  1KSO A;  1IQ5 A;  4MVF A;  1B47 A;  1QVI Z;  2KQY A;  2MRD A;  3D10 A;  4WQ3 A;  1UHJ A;  3ZWH A;  1BF5 A;  3CAB A;  4JKT A;  2L2E A;  1PK0 D;  1IQ3 A;  3CYZ A;  2E6W A;  1SL8 A;  3NHT A;  4WQ2 A;  1IJ6 A;  3KF9 A;  1K8U A;  1CDP A;  2LAN A;  4WRI A;  4MN0 A;  3DF0 A;  2BKH B;  1KK8 B;  1QTX A;  2LAP A;  1A75 B;  3C1V A;  1W9Z A;  1QX7 A;  1QX2 A;  2FJU B;  3KEV A;  1P28 A;  1S5G Y;  3K1E A;  4GNK B;  2WCJ A;  4UPG A;  1KWO C;  3BQ3 A;  2JPT A;  3CR5 X;  3I5I C;  1F4O A;  2WND A;  3CZ0 A;  4ORA B;  4QJ5 B;  2M1U A;  2PYQ A;  2I94 A;  3WHT B;  1IH0 A;  1F70 A;  2G2B A;  2KPH A;  2MAZ A;  1U5I B;  5HKY A;  1H8B A;  1JFJ A;  5DKQ A;  3SG5 A;  1RFJ A;  2QDI A;  4CFR A;  4YI8 A;  3JVT C;  2BCB A;  1C7W A;  4DS7 A;  3CS1 A;  1RK9 A;  4CFQ A;  3PAT A;  5HYD A;  2DOQ A;  1YR5 A;  2BE4 A;  4MLW A;  4GUK A;  4YRU A;  2MA2 A;  2QEO A;  1KK7 Z;  2LVI A;  2P6B B;  3DVM A;  4MRX A;  1JC2 A;  1OOG A;  4PDZ A;  1WRZ A;  4PE1 A;  1KFU L;  3O78 A;  2K7D A;  1Q80 A;  2ZFD A;  1QJT A;  1G33 A;  4N1F A;  2KDH A;  1VRK A;  4OV2 A;  1G4Y R;  5HLO A;  2NXQ A;  1TCF A;  2SCP A;  1DJH A;  1OOH A;  5PAL A;  2LV7 A;  1TUZ A;  4OKH A;  1Z2C B;  4PHJ A;  3S0F A;  4AOM A;  2WC5 A;  1CLM A;  2HPS A;  4F0Z B;  1NUB A;  2Y1N A;  4M2Q A; 
#chains in the Genus database with same CATH homology
 3I5G C;  1K90 D;  1SCM B;  5AAN A;  3HX4 A;  3SG4 A;  2KSP A;  3JTD C;  4IL1 A;  2ZN8 A;  4FQO A;  2JRF A;  2JWW A;  1R6P A;  3NSL A;  3SG6 A;  2JT8 A;  1CMF A;  2BCA A;  3AKB A;  1TCO B;  3WHU B;  2PVB A;  1B8L A;  1A2X A;  1NX2 A;  1SK6 D;  1W7J B;  3BUO B;  4YGA A;  1HQV A;  3E3R A;  2M7N A;  1ALV A;  1NCX A;  2F3Y A;  3FWC A;  2F2P A;  1UHH A;  2CXJ A;  1FI6 A;  2LNK A;  1UUS A;  3PSR A;  3QRX A;  1W7I B;  3KO0 A;  1MXL C;  4ORC B;  5HKW A;  1WDC B;  2HQ8 A;  3DVK A;  1RJV A;  1YVH A;  3BUW B;  3TS5 B;  2CCM A;  1UP5 A;  1QLK A;  1L7Z A;  2H2K A;  4XJK B;  2H61 C;  2WCB A;  4YGE B;  2CBL A;  1CLB A;  1DJI A;  1DJY A;  3RM1 A;  3A8R A;  5B8I B;  4ZCU A;  1QS7 A;  5IBW A;  1ZMZ A;  2A4J A;  2K7C A;  1FF1 A;  3BUM B;  1F8H A;  1MF8 B;  5DKN A;  4PCW A;  4YI9 A;  2JZI A;  1S36 A;  2LUC A;  5CSJ A;  3KPX A;  3DVJ A;  3TUY C;  1QAT A;  1J1D A;  2AMI A;  1BU3 A;  1PUL A;  1NX0 A;  1BT6 A;  5KSZ A;  4YGB B;  2WC8 A;  1RTP 1;  1A4P A;  1CM4 A;  3K21 A;  1A75 A;  1XK4 C;  4A4B A;  1J7P A;  1YX7 A;  2KQ6 A;  1Y1A A;  1EH2 A;  1MR8 A;  1NYA A;  1B8C A;  2CT9 A;  1K96 A;  2LMV A;  5ER5 A;  1JUO A;  1WRK A;  1FW4 A;  2Q91 A;  2I2R E;  1TOP A;  2LM5 A;  4GAO A;  1U5I A;  1JF0 A;  2L4H A;  2M29 A;  3M0W A;  4NQG A;  1JFK A;  4MZJ A;  3VRQ A;  1L2O C;  1B8R A;  1XFU O;  1SW8 A;  1V1F A;  1NSH A;  1AJ4 A;  2WOR A;  4I5L B;  4JQ0 D;  1B9A A;  5AER A;  1MHO A;  3OB2 B;  2EGD A;  2ZND A;  1EL4 A;  1WY9 A;  1Y1X A;  1XO5 A;  1YUT A;  2V53 A;  5K89 A;  1QV1 A;  1SBJ A;  2LMU A;  3CR2 A;  3VRN A;  3EVU A;  1PAL A;  2JT3 A;  1KWO B;  4CPV A;  2KAY A;  2L0P A;  1YX8 A;  3I5I B;  2PRU A;  5HKZ A;  4N1G A;  1OZO A;  5G08 A;  5JJG A;  1FI5 A;  1X02 A;  1XVJ A;  4MSP A;  1K9U A;  4QJ4 B;  3OB1 B;  5DKR A;  5J3X A;  1SYM A;  2KGR A;  2KYF A;  2M9G A;  2ZRT A;  1K94 A;  3SIB A;  1QX5 B;  3VRR A;  3JVT B;  2L98 A;  2WCF A;  1KFX L;  1JBA A;  3EVR A;  3FS7 A;  1S6I A;  3LLE A;  1SR6 C;  4PE7 A;  2BE6 A;  4M2P A;  2Y1M A;  1CFC A;  5CSN A;  1S26 D;  1ALW A;  1ZUZ A;  1OQP A;  1MQ1 A;  2LC5 A;  4C0J A;  2G9B A;  1IG5 A;  1DJG A;  3CGA A;  4Q04 A;  1OSA A;  3TDI A;  1K9K A;  1BMO A;  5KU1 A;  2F3Z A;  1SCV A;  2OPO A;  1TNW A;  1J7O A;  1ZFS A;  1NX1 A;  3O2P A;  1REC A;  2NCO A;  3I5H C;  1M46 A;  3AAK A;  3DD4 A;  1TTX A;  4HRG A;  3NSK A;  1S6C A;  2BL0 C;  2KI6 D;  3H4S E;  1S5G Z;  3I5G B;  4BY5 A;  1PVA A;  4CID A;  2KAX A;  1CMG A;  1MUX A;  1AHR A;  3JTD B;  1SPY A;  1QXP A;  2FCE A;  4OR9 B;  1DJW A;  2PSR A;  1K95 A;  1XFX O;  1LA3 A;  1JF2 A;  1S6J A;  1SY9 A;  1NIW A;  4XJK A;  1DJZ A;  3AAJ A;  4OCI A;  1GQM A;  2ZRS A;  1KQV A;  3TDU A;  1OZS A;  4GGF C;  2OTG C;  2KNE A;  5D7F A;  4U8D A;  1DF0 A;  3CR4 X;  1AJ5 A;  1SRA A;  1M39 A;  2LP2 A;  3NSI A;  1OOJ A;  1YUR A;  2OS8 C;  3PAL A;  1AP4 A;  2KFH A;  4P2Y B;  1KCY A;  4PHM A;  1XK4 A;  5I2O A;  1B7T Y;  1M45 A;  4P5O E;  2JXL A;  4NDB A;  1JSA A;  2JNF A;  2LVK A;  3ICB A;  2KFF A;  3PN7 C;  3CLN A;  1QLS A;  2NZ0 A;  3ZNI A;  1KQM C;  1H4B A;  1QV0 A;  1SL7 A;  2KHN A;  4M2O A;  3TZ1 A;  2NLN A;  2GV5 A;  1CKK A;  4C0K A;  2M8U A;  1N65 A;  2BEC A;  4DRW A;  3NXA A;  1Y0V H;  2HF5 A;  1J55 A;  2FCD A;  3EK7 A;  5D69 A;  1J1E A;  4AQI A;  1LKJ A;  2HET A;  3TUY B;  4E68 A;  1DF0 B;  2PAL A;  4I5J A;  1CFD A;  1RRO A;  4ORB B;  2RGI A;  1C7V A;  1IJ5 A;  1UHK A;  3EK4 A;  3HCM A;  4XYN A;  1BR1 B;  4MRY A;  1NWD A;  2COL B;  3SJS A;  4GBA A;  3GK1 A;  1IGV A;  2KI4 C;  3D0Y B;  1S1E A;  1UUR A;  1DT7 B;  1B1G A;  2F2O A;  1GJY A;  4ZCV A;  1LIN A;  2MBX A;  2KI6 C;  2JNX A;  1TNX A;  2KAV A;  4QJ3 B;  1L2O B;  3PFV A;  2MJW B;  1SL9 A;  3F45 A;  1TN4 A;  1ZOT B;  2BBN A;  1V1G A;  4USL A;  1BOC A;  1LVC D;  3OP0 A;  1BR4 B;  1DJX A;  4YBH B;  2BKI B;  1QVI Y;  2EHB A;  2WCE A;  1OE9 B;  3O6B A;  3TDZ A;  3I5F C;  2L4I A;  1AUI B;  5CSI A;  1A29 A;  2GGZ A;  1CDN A;  1GGZ A;  3LK1 A;  1XFW O;  2LLS A;  1MWN A;  5F6T A;  4C0L A;  1XFY O;  1DTL A;  2QPT A;  1EJ3 A;  3EKJ A;  1UHN A;  2K7B A;  5FYX A;  4L9M A;  1ZAC A;  4NDD A;  1PSB A;  1SR6 B;  5ER4 X;  5TNC A;  1SNL A;  2JQ6 A;  1TNQ A;  2KGB C;  3CZT X;  1NX3 A;  4GGF A;  5JOL A;  1NCZ A;  5BPJ A;  2HQW A;  3PLF B;  4MZK A;  3EVV A;  1IWQ A;  3OX6 A;  1YVL A;  3WNX B;  5AXI A;  1DVI A;  1IRJ A;  1JWD A;  1CNP A;  1KFU S;  1KK7 Y;  2I7A A;  3DVE A;  2L50 A;  1CM1 A;  2JU0 A;  5AFP A;  1J7R A;  1UHI A;  2EC6 C;  3FWB A;  1M63 B;  3I5H B;  1QAS A;  2KFG A;  2L5X B;  2BL0 B;  2MLF C;  1TRF A;  2M3W A;  4MZL A;  3SG3 A;  2M97 A;  1PRW A;  3SG7 A;  2Y4Q A;  4YGC B;  5I2L A;  3RLZ A;  1G8I A;  1RWY A;  1NP8 A;  1LA0 A;  1KK8 C;  1Y6W A;  1YRT B;  5CPV A;  3OX5 A;  2H61 A;  4MEW A;  2KBM A;  2KBI A;  1BOD A;  4JPZ B;  2OTG B;  2JXC A;  2M49 B;  2O5G A;  1YUS A;  3BYA A;  2ZNE A;  3BOW A;  1EXR A;  2FOT A;  4MBE A;  1ODB A;  1K9P A;  2QAC A;  2B1U A;  2K0J A;  4N5X A;  1XFV O;  2ZKM X;  2LCP A;  2JTZ A;  3GOF A;  4PHN A;  5GQQ C;  4TNC A;  2OS8 B;  3NSO A;  2AUC A;  2SAS A;  1AVS A;  1N2D A;  2KYC A;  2LVJ A;  1TNP A;  1CFF A;  1HT9 A;  2LUX A;  2ISD A;  5I2Q A;  5HLV A;  2WOS A;  1WLM A;  2IS9 A;  3DF0 B;  3BUN B;  4CLN A;  2D8N A;  1BG1 A;  2JT0 A;  1N0Y A;  3PN7 B;  1NCY A;  2NCP A;  2LMT A;  1KQM B;  1YRU B;  1C07 A;  2PAS A;  1CTR A;  2PMY A;  4I5K A;  2JC2 A;  3GK2 A;  3O4Y A;  1LXF C;  2LHL A;  1F54 A;  3D0Y A;  4GGN A;  4A4C A;  1EG4 A;  3KHE A;  3MSE B;  1CLL A;  5CSF A;  1XA5 A;  1OMR A;  3BOW B;  4HRE E;  1M31 A;  2LLT A;  2K8M B;  3IQQ A;  1PVB A;  1OMD A;  1SCM C;  1Y1U A;  2K2A A;  3A4U B;  3CWG A;  3IQO A;  4OVN F;  4FTG A;  2AAO A;  2JTT A;  2M0R A;  3LCP C;  3CTN A;  1F71 A;  2KI4 B;  1BLQ A;  1PSR A;  2M7L A;  1B7T Z;  2O60 A;  1WLZ A;  3VGO A;  2MLE C;  1MXE A;  3IF7 A;  3GK4 X;  2K7O A;  2TN4 A;  2LP3 A;  3PM8 A;  1CFP A;  1QIW A;  2F33 A;  3SIA A;  4YGD B;  2JUL A;  1CDM A;  2M1K B;  4PE4 A;  4I5N B;  1WDC C;  3AKA A;  5AEQ A;  3TS5 C;  4PE0 A;  3I5F B;  4HRH A;  1K2H A;  1NPQ A;  3LK0 A;  1YTZ C;  4PAL A;  3VRP A;  2BCX A;  3VRO A;  2F8P A;  2GGM A;  1B4C A;  1DMO A;  2E30 A;  2JOJ A;  1J7Q A;  4GPL B;  1CDL A;  2K2F A;  4NDC A;  1GGW A;  2R2I A;  2ZN9 A;  3EK8 A;  2Q4U A;  1XFZ O;  4HSZ A;  4GFT A;  4ICB A;  1TIZ A;  2CTN A;  4R1E A;  4JWQ A;  2LLU A;  3WXA A;  1BJF A;  2LVV A;  5KTY A;  1S3P A;  2CNP A;  1FBV A;  3EKH A;  4DIR A;  1IKU A;  2BBM A;  1SMG A;  4DUQ A;  1DGU A;  1KFX S;  1SKT A;  3BUX B;  1F55 A;  1YUU A;  1F4Q A;  2MHH A;  1DGV A;  3LL8 B;  4AQJ A;  1A03 A;  1EG3 A;  1KSM A;  1WRL A;  3BXK A;  1R2U A;  1FPW A;  2Y5I A;  1XYD A;  2VRG A;  4PHK A;  1D1O A;  3SG2 A;  2L51 A;  1QIV A;  2K61 A;  2LE9 B;  1OMV A;  2I18 A;  1E8A A;  4D1E A;  5I8N A;  3OHM B;  2EC6 B;  4DCK A;  4ETO A;  1K93 D;  1UWO A;  2KOT A;  3FIA A;  2LHI A;  1AK8 A;  1KSO A;  1IQ5 A;  4MVF A;  1B47 A;  1QVI Z;  2KQY A;  2MRD A;  3D10 A;  4WQ3 A;  1UHJ A;  3ZWH A;  1BF5 A;  1CB1 A;  2L2E A;  1PK0 D;  1IQ3 A;  2E6W A;  1SL8 A;  4WQ2 A;  1IJ6 A;  3KF9 A;  1K8U A;  1CDP A;  2LAN A;  4WRI A;  4MN0 A;  3DF0 A;  2BKH B;  1KK8 B;  1QTX A;  2LAP A;  1A75 B;  3C1V A;  3KEV A;  1QX7 A;  1QX2 A;  2FJU B;  4BY4 A;  1S5G Y;  4GNK B;  4UPG A;  1KWO C;  3BQ3 A;  2JPT A;  3CR5 X;  3I5I C;  1F4O A;  2WND A;  4ORA B;  4QJ5 B;  2M1U A;  3WHT B;  2I94 A;  1IH0 A;  1F70 A;  2G2B A;  2MAZ A;  1U5I B;  5HKY A;  1H8B A;  1JFJ A;  5DKQ A;  3SG5 A;  1RFJ A;  4CFR A;  4YI8 A;  3JVT C;  2BCB A;  1C7W A;  4DS7 A;  3CS1 A;  1RK9 A;  4CFQ A;  3PAT A;  5HYD A;  2DOQ A;  1YR5 A;  2BE4 A;  4MLW A;  4GUK A;  4YRU A;  2MA2 A;  1KK7 Z;  2LVI A;  2P6B B;  3DVM A;  4MRX A;  1JC2 A;  4PDZ A;  1WRZ A;  4PE1 A;  1KFU L;  3O78 A;  2K7D A;  1Q80 A;  2ZFD A;  1QJT A;  1G33 A;  4N1F A;  2KDH A;  1VRK A;  4OV2 A;  1G4Y R;  5HLO A;  2NXQ A;  1TCF A;  2SCP A;  1DJH A;  5PAL A;  2LV7 A;  4OKH A;  4PHJ A;  4AOM A;  1CLM A;  2HPS A;  4F0Z B;  1NUB A;  2Y1N A;  4M2Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...