2KSPA

Mechanism for the selective interaction of c-terminal eh-domain proteins with specific npf-containing partners
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
105
structure length
105
Chain Sequence
GPLGSDDVEWVVGKDKPTYDEIFYTLSPVNGKITGANAKKEMVKSKLPNTVLGKIWKLADVDKDGLLDDEEFALANHLIKVKLEGHELPADLPPHLVPPSKRRHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords EH domain-containing protein 1
publication title Mechanism for the selective interaction of C-terminal Eps15 homology domain proteins with specific Asn-Pro-Phe-containing partners.
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2010-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12763 EF-hand_4 Cytoskeletal-regulatory complex EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2kspA00
1PK0D 1IJ5A 1TNWA 5J3XA 1DJXA 4A4CA 3EVVA 4UPGA 4MZJA 2LP3A 3PN7B 3IQOA 1WRKA 1ZMZA 1SYMA 2WORA 1K9PA 1SKTA 1VRKA 2ZRTA 1G4YR 2KNEA 2JWWA 1QX2A 1UHJA 2BL0C 2JT8A 3I5HC 4JQ0D 1TOPA 4GFTA 1AVSA 3FWBA 3WHUB 1SBJA 4WRIA 3ZWHA 5I2LA 1YURA 1ALWA 1SCMB 1Y6WA 3GK4X 4CPVA 1S26D 2LUXA 4XYNA 1MF8B 2G2BA 3GK2A 1IG5A 2KI6C 1NSHA 1R2UA 1B4CA 1AK8A 4OR9B 1QIVA 1ZUZA 4NDBA 3EKJA 4JPZB 1LVCD 2Y4QA 4CIDA 2D8NA 3BYAA 4YGEB 3A4UB 2PMYA 2Y1MA 5HKYA 1XVJA 4CFQA 1WRZA 5CSJA 4YGAA 1MQ1A 4Q04A 1SR6B 1QV1A 2BCXA 1PALA 2L4HA 4P5OE 1KK8B 1FF1A 1IQ3A 3DF0B 1WRLA 1C7WA 1TNQA 1ZOTB 2L50A 1RECA 1K95A 2M49B 1M46A 2F2PA 1F70A 1DJZA 1UHNA 1DJYA 3BOWA 3F45A 4C0JA 1M63B 1GGZA 1YVLA 5DKRA 1H4BA 1S5GZ 1EG4A 4HRHA 2MAZA 1FBVA 3BUMB 1EL4A 1RWYA 2FCEA 1N65A 1JFKA 1F55A 4ORCB 1OSAA 2KSPA 1WLZA 2TN4A 3BUXB 1D1OA 1KFUS 3DVKA 5BPJA 1S6JA 2LVIA 4PE7A 1A03A 2K7CA 2LM5A 1TNXA 3K21A 1TTXA 4GBAA 2PALA 4ZCUA 1PSRA 2KI4C 2QPTA 5I2OA 2BKHB 1NX1A 2I94A 3LCPC 2M7LA 4PHJA 4I5NB 2NCPA 4XJKA 2JT0A 2KGBC 4CFRA 2Y5IA 1DJGA 1TRFA 4YBHB 3ZNIA 4DIRA 2LMTA 1FW4A 1A75B 2K0JA 2PSRA 4YGBB 4D1EA 1KWOB 3MSEB 1CFDA 2BCBA 4N5XA 1J7RA 1QJTA 2LLSA 2Y1NA 1NP8A 3BQ3A 2F2OA 5DKNA 3JTDC 3SG4A 1KCYA 5HLVA 3SJSA 2I18A 2MHHA 3OP0A 2JXCA 2LVJA 2EC6B 1KQVA 3O78A 3CR5X 2M7NA 1WY9A 4PALA 1SRAA 5ER5A 1MWNA 2L5XB 1KK7Z 3KF9A 3IF7A 2SASA 5K89A 2COLB 3IQQA 1GGWA 2KI4B 4PDZA 1BMOA 5AFPA 2JQ6A 1CFPA 1JF0A 3O4YA 2L2EA 2NZ0A 4PCWA 1SMGA 2WCEA 3BUWB 3TS5B 1G8IA 3GOFA 3TDZA 4OCIA 2EGDA 1J7QA 1X02A 1JFJA 1OOJA 3DVEA 1KFXL 4NQGA 3TUYC 1S3PA 4M2PA 2A4JA 2KOTA 3PFVA 1OQPA 1RTP1 2LMVA 5DKQA 3O6BA 4MZKA 2K8MB 1TCOB 1XFXO 1C07A 1SK6D 1K94A 2B1UA 1BODA 2BE4A 2PVBA 2KBIA 1J55A 1KQMC 1QLSA 2K2FA 5F6TA 3OX6A 1DGVA 3H4SE 1CTRA 2GGZA 4N1GA 1RJVA 1JC2A 3AKBA 2OTGC 3OB2B 4MSPA 1UHHA 1OMVA 2KI6D 4F0ZB 4QJ3B 1SL9A 2KYCA 1MUXA 2I2RE 2HPSA 1DT7B 3BUNB 4ZCVA 1KSMA 2JNXA 2HETA 1NX3A 3D10A 2E6WA 4HREE 4PHNA 1E8AA 1CM1A 2KHNA 2K7OA 1F54A 4FTGA 1B7TZ 2KAYA 1YUUA 2MJWB 3FWCA 4OVNF 1WLMA 4AQIA 1OZSA 1AP4A 4YGCB 3I5FC 1DTLA 3KHEA 1CLLA 4MEWA 1HT9A 1NYAA 1AUIB 2KQYA 1IWQA 3BOWB 2MA2A 1CLMA 1HQVA 4E68A 2O60A 3VGOA 1Q80A 1W7IB 5D7FA 1XA5A 1BOCA 2L4IA 1A4PA 1S5GY 1XFYO 2EHBA 2PRUA 2BL0B 2MLFC 3I5HB 4I5JA 4PHKA 3AAJA 5JJGA 4BY4A 2KFGA 2NLNA 1NCXA 2GGMA 2OS8C 1WDCC 5TNCA 1J7OA 2M3WA 3VROA 2KFFA 3DD4A 2LVKA 3VRNA 2WCFA 4YI9A 2L51A 2LVVA 2WCBA 2MRDA 2KFHA 2JU0A 3OX5A 5ER4X 5HYDA 2M29A 3NXAA 4PHMA 4TNCA 1FI5A 3E3RA 1FPWA 1G33A 1AJ4A 1YUTA 3OHMB 2M97A 1YX7A 4I5LB 3SG5A 1JUOA 1NX2A 2LANA 5I2QA 4XJKB 1SCVA 1AJ5A 1QATA 2KGRA 2CCMA 3SIAA 3D0YA 3JVTC 3AKAA 1UUSA 1PRWA 1L2OC 1BR4B 3C1VA 2LAPA 3LK0A 4MZLA 1FI6A 1KSOA 2LLUA 2GV5A 2G9BA 3CLNA 1CDPA 1QASA 1NX0A 3LLEA 1YUSA 1LXFC 2MBXA 4PE0A 1K9UA 1TCFA 2M8UA 2PASA 1MR8A 1QLKA 2OS8B 2K61A 3TDUA 1PULA 1IH0A 5CSNA 3SG6A 1CMFA 1SNLA 1N0YA 2AAOA 1YVHA 4WQ3A 1R6PA 2JZIA 2QACA 4I5KA 5FYXA 5AERA 1F71A 1GJYA 2AUCA 2WNDA 3ICBA 4GPLB 2M9GA 4MRYA 4MN0A 2ZNDA 4GGNA 2FCDA 3I5GC 3WNXB 2HQ8A 2V53A 2K2AA 4L9MA 4ORBB 2BBMA 1RROA 2ZKMX 3TDIA 3I5IC 2KBMA 1B1GA 1S1EA 3NSKA 1CNPA 5HKWA 1JF2A 2ZN8A 1JSAA 2Q4UA 4BY5A 4M2OA 4AOMA 4ETOA 5KTYA 4U8DA 1M45A 1LA3A 3FIAA 4GAOA 1OE9B 2LMUA 1LA0A 1CM4A 2JPTA 1CFCA 5HKZA 5D69A 3PN7C 1Y1XA 2CNPA 1QVIZ 1YR5A 4R1EA 1CMGA 3HCMA 2JTZA 2L0PA 1DF0A 2FOTA 3DVMA 1XFWO 4YRUA 1SL7A 3JTDB 1OMRA 1W7JB 4ORAB 3BXKA 1A2XA 2L98A 2OPOA 2F8PA 3RM1A 3NSOA 3A8RA 5CSFA 1OMDA 1QTXA 1EH2A 1ALVA 1ZFSA 2LE9B 3CTNA 1N2DA 1YX8A 3EVUA 1Y1AA 3KO0A 4NDCA 1IKUA 3DVJA 5I8NA 1XFUO 1BF5A 2LV7A 2RGIA 1J1DA 1B7TY 2JC2A 1CDLA 1U5IA 2M0RA 2F3ZA 1YRTB 2KYFA 4GGFC 3WHTB 3CZTX 3PATA 1J1EA 1CDMA 1XFVO 3GK1A 1L7ZA 2BCAA 3VRPA 1CKKA 1M31A 1JWDA 5CPVA 3EK7A 2ZNEA 2VRGA 1TN4A 3TUYB 1XYDA 2K7DA 2KAVA 1CLBA 4OKHA 1SR6C 3KPXA 1XK4C 2H2KA 2BBNA 1KK8C 1NUBA 2LLTA 3PALA 1BR1B 2LUCA 1F4QA 2O5GA 1KFUL 3EKHA 4DCKA 3PM8A 1DVIA 2MLEC 3PSRA 4YI8A 2JT3A 5GQQC 1KQMB 2I7AA 1BLQA 3OB1B 3VRRA 1PVBA 3AAKA 2LNKA 2BE6A 2OTGB 1KFXS 1IQ5A 2AMIA 4QJ4B 3QRXA 1EG3A 4MRXA 3CS1A 1SW8A 2WC8A 2KQ6A 2E30A 1Y0VH 4MLWA 3D0YB 2CBLA 1B8CA 4ICBA 3EK8A 1IJ6A 1TIZA 1V1GA 1QX5B 1XFZO 3CGAA 2H61C 4MBEA 1M39A 1QXPA 4C0LA 1K2HA 1DJIA 1BT6A 1UHKA 4N1FA 3SIBA 4GGFA 1DJHA 1PVAA 1B47A 3I5FB 2NCOA 4GNKB 1K9KA 5AXIA 2HQWA 2P6BB 4HSZA 2F3YA 4DUQA 1UP5A 2BECA 4M2QA 1LINA 1KWOC 2JTTA 2ZN9A 4PE4A 1GQMA 1NCYA 2FJUB 4C0KA 1Y1UA 4IL1A 5JOLA 3EK4A 1S6CA 2LHLA 5KSZA 1XK4A 1ZACA 1LKJA 4OV2A 3TZ1A 3DF0A 1UHIA 2JXLA 1S36A 1WDCB 5G08A 2F33A 3SG2A 2CTNA 1QV0A 4FQOA 4AQJA 1F4OA 2LHIA 1CDNA 2CT9A 1MHOA 2EC6C 1B8RA 1CB1A 5AANA 5IBWA 5HLOA 1KK7Y 1IGVA 3SG3A 1JBAA 3FS7A 1AHRA 1B8LA 3CR4X 2ZRSA 4WQ2A 4JWQA 2JNFA 2R2IA 3WXAA 1K8UA 1OZOA 1RFJA 1ODBA 1IRJA 1B9AA 5PALA 2JRFA 5KU1A 2BKIB 2LP2A 3RLZA 3TS5C 3VRQA 3M0WA 1EJ3A 3JVTB 2M1UA 1K90D 1QVIY 1L2OB 1MXEA 4HRGA 1UWOA 1XO5A 1QX7A 1YTZC 4GUKA 3LK1A 4NDDA 4PE1A 4USLA 1BG1A 1NWDA 1DF0B 2H61A 2M1KB 2JOJA 4A4BA 1RK9A 1C7VA 1UURA 2KAXA 2K7BA 3CWGA 3SG7A 1YRUB 2SCPA 3HX4A 1SY9A 2JULA 1V1FA 1QIWA 1A75A 1DGUA 3CR2A 3PLFB 1A29A 2DOQA 1F8HA 1NIWA 4DRWA 3NSLA 2Q91A 2CXJA 2ZFDA 1K93D 4MVFA 4DS7A 1NCZA 2ISDA 3LL8B 3BUOB 5AEQA 2LCPA 1TNPA 1U5IB 3I5GB 2LC5A 1QS7A 4CLNA 2KDHA 1SL8A 1SCMC 3I5IB 4YGDB 3KEVA 1EXRA 3NSIA 4QJ5B 1DMOA 2HF5A 1SPYA 5CSIA 3O2PA 3EVRA 2NXQA 1BU3A 1H8BA 5B8IB 1CFFA 1BJFA 1MXLC 4P2YB 1S6IA 2IS9A 1J7PA 1K96A 2WOSA 1DJWA 1PSBA 1NPQA
chains in the Genus database with same CATH superfamily
1PK0D 1IJ5A 1TNWA 5J3XA 1DJXA 4A4CA 3EVVA 4UPGA 4MZJA 2LP3A 3PN7B 3IQOA 1WRKA 1ZMZA 1SYMA 2WORA 4INWA 1K9PA 1SKTA 1VRKA 2ZRTA 1G4YR 2KNEA 2L2CA 2ERBA 2JWWA 1QX2A 1UHJA 2BL0C 2JT8A 3I5HC 4JQ0D 1TOPA 4GFTA 1AVSA 2QEOA 3FWBA 3WHUB 1SBJA 3BFHA 4WRIA 3ZWHA 5I2LA 3R1PA 3L4AA 3SS5A 1YURA 1ALWA 1SCMB 1Y6WA 3GK4X 4CPVA 1SSEB 1S26D 2LUXA 4XYNA 1MF8B 2G2BA 3GK2A 1IG5A 2KI6C 1C3YA 1NSHA 1R2UA 1B4CA 1AK8A 4OR9B 1QIVA 1ZUZA 2QEVA 4NDBA 3EKJA 3OGNA 4JPZB 1LVCD 2Y4QA 3D74A 4CIDA 2D8NA 1OOIX 3BYAA 3S0GA 4YGEB 3A4UB 2PMYA 2Y1MA 5HKYA 1XVJA 4CFQA 1WRZA 2FJYA 3SS4A 5CSJA 4YGAA 1MQ1A 1DELA 4Q04A 1SR6B 1QV1A 2BCXA 4PT1A 1PALA 2L4HA 4P5OE 1KK8B 4INXA 1FF1A 1IQ3A 3DF0B 1IIOA 1WRLA 1C7WA 1TNQA 1ZOTB 2L50A 1RECA 1K95A 2M49B 1M46A 2F2PA 1F70A 1DJZA 1TUJA 1UHNA 1DJYA 3BOWA 3F45A 4C0JA 1M63B 1GGZA 1YVLA 5DKRA 4OZDA 3Q8IA 1S5GZ 1H4BA 1EG4A 4HRHA 2MAZA 1FBVA 3BUMB 1EL4A 1RWYA 2FCEA 1N65A 1JFKA 1F55A 4ORCB 1OSAA 2KSPA 1WLZA 2TN4A 3BUXB 1D1OA 1KFUS 3DVKA 5BPJA 1S6JA 2LVIA 4PE7A 1A03A 2K7CA 2LM5A 1TNXA 3K21A 1TTXA 4GBAA 2PALA 4ZCUA 1PSRA 2KI4C 2QPTA 5I2OA 2BKHB 1NX1A 2I94A 3LCPC 2M7LA 4PHJA 4I5NB 3OBVA 2NCPA 4XJKA 2JT0A 2WCKA 2KGBC 4CFRA 2Y5IA 1DJGA 1TRFA 4KYNA 4YBHB 3ZNIA 3D78A 4DIRA 2LMTA 1FW4A 1A75B 2K0JA 2PSRA 4YGBB 4D1EA 1KWOB 3MSEB 1CFDA 2BCBA 1T14A 4N5XA 1J7RA 1QJTA 2LLSA 3VB1A 3DZTA 2Y1NA 1NP8A 3NGVA 3BQ3A 2F2OA 5DKNA 2PQLA 3JTDC 3SG4A 1KCYA 3RZSA 5HLVA 1TUZA 3SJSA 2I18A 2MHHA 3OP0A 2JXCA 2LVJA 2EC6B 1KQVA 3O78A 3CR5X 2BAPA 2M7NA 1WY9A 5EL2A 4PALA 1SRAA 5ER5A 1MWNA 2L5XB 1KK7Z 3KF9A 3IF7A 2SASA 5K89A 2COLB 3D73A 3IQQA 1GGWA 2KI4B 4PDZA 1BMOA 5AFPA 2JQ6A 1CFPA 1JF0A 3O4YA 2WCMA 2L2EA 2NZ0A 4PCWA 1SMGA 2WCEA 3BUWB 3TS5B 1G8IA 3B6XA 3GOFA 3TDZA 1XFRA 4OCIA 2EGDA 5FI6A 1J7QA 3FE8A 1X02A 1DEKA 1JFJA 1OOJA 3DVEA 1KFXL 4NQGA 3TUYC 1S3PA 4M2PA 2A4JA 2KOTA 3PFVA 1OQPA 1RTP1 1W9ZA 2LMVA 3O4XA 3O6BA 5DKQA 2QEBA 4MZKA 2K8MB 1TCOB 1XFXO 1C07A 1SK6D 3CDNA 1K94A 2B1UA 1BODA 2BE4A 2PVBA 3FE6A 2KBIA 1J55A 1KQMC 1QLSA 5FI7A 2K2FA 3BFAA 5F6TA 3NHIA 3OX6A 1DGVA 3H4SE 1CTRA 2GGZA 4N1GA 1RJVA 1JC2A 1LS8A 3AKBA 2OTGC 3OB2B 4MSPA 1UHHA 1OMVA 2KI6D 4F0ZB 4QJ3B 1SL9A 2KYCA 3N7HA 1MUXA 2I2RE 2HPSA 1DT7B 3BUNB 4ZCVA 1KSMA 2JNXA 2HETA 1NX3A 3D10A 2E6WA 2P70A 4HREE 4PHNA 1E8AA 3BJHA 1CM1A 2KHNA 2K7OA 1F54A 4FTGA 1B7TZ 3PJIA 2KAYA 1YUUA 2MJWB 3FWCA 4OVNF 1WLMA 4AQIA 1OZSA 1AP4A 4YGCB 2YGUA 3I5FC 3S0EA 1DTLA 3KHEA 1CLLA 4MEWA 1HT9A 1NYAA 1AUIB 2KQYA 1IWQA 3BOWB 2MA2A 1CLMA 1HQVA 4E68A 2O60A 3VGOA 3B7AA 1Q80A 1W7IB 5D7FA 1XA5A 3UNWA 1BOCA 2L4IA 1A4PA 1S5GY 1XFYO 2EHBA 2PRUA 2BL0B 2MLFC 3I5HB 4I5JA 4PHKA 3AAJA 5JJGA 4BY4A 2KFGA 2NLNA 1NCXA 2GGMA 2OS8C 1WDCC 5TNCA 1J7OA 2M3WA 3VROA 2KFFA 3DD4A 2LVKA 3VRNA 2WCFA 4YI9A 2L51A 3B88A 2LVVA 2WCBA 2MRDA 2KFHA 2JU0A 2WC6A 3OX5A 1DQEA 1P28A 5ER4X 5HYDA 2M29A 3NXAA 1ORGA 4PHMA 4TNCA 1FI5A 3E3RA 1FPWA 1G33A 1AJ4A 1YUTA 3OHMB 2M97A 1YX7A 4F7FA 4I5LB 3SG5A 3D77A 1JUOA 1NX2A 2LANA 5I2QA 4XJKB 1SCVA 1AJ5A 1QATA 2KGRA 2CCMA 3SIAA 3D0YA 3JVTC 3AKAA 1UUSA 1PRWA 1L2OC 1BR4B 2KLDA 3CZ0A 3C1VA 3B86A 2LAPA 3LK0A 4MZLA 1FI6A 1KSOA 2LLUA 2GV5A 2G9BA 3CLNA 1CDPA 1QASA 1NX0A 3LLEA 1YUSA 1LXFC 2MBXA 4PE0A 1K9UA 1TCFA 2M8UA 2PASA 1MR8A 3BFBA 1QLKA 2OS8B 2K61A 3TDUA 1PULA 1OW4A 1IH0A 5CSNA 3SG6A 1CMFA 1GM0A 2WCJA 1SNLA 1N0YA 2AAOA 1YVHA 2KLEA 1R6PA 2JZIA 2QACA 4I5KA 4WQ3A 5FYXA 5AERA 1DC1A 3DY9A 1F71A 1GJYA 2AUCA 2WNDA 3ICBA 4GPLB 5HL1A 2M9GA 4MRYA 4MN0A 4IJ7A 2ZNDA 4GGNA 2FCDA 3I5GC 3WNXB 2HQ8A 2V53A 2K2AA 2BNXA 4L9MA 4ORBB 2BBMA 1RROA 2ZKMX 3TDIA 3I5IC 2KBMA 1B1GA 1S1EA 3NSKA 1CNPA 5DICA 3PM2A 2P71A 5HKWA 1JF2A 2ZN8A 1JSAA 2Q4UA 4BY5A 4M2OA 4AOMA 5FI2A 4ETOA 5KTYA 4U8DA 1M45A 1LA3A 2WCHA 3FIAA 4GAOA 1OE9B 2LMUA 1LA0A 1CM4A 2JPTA 2PYQA 1CFCA 5HKZA 5D69A 3PN7C 1Y1XA 2CNPA 1QVIZ 1YR5A 3D76A 4R1EA 1CMGA 3HCMA 2JTZA 2L0PA 1DF0A 2FOTA 3DVMA 3L4LA 1XFWO 4YRUA 2KPHA 1SL7A 3JTDB 1OMRA 1W7JB 4ORAB 2L5YA 3BXKA 1A2XA 2L98A 2OPOA 2F8PA 3RM1A 3NSOA 3DYEA 3A8RA 1OOGA 5CSFA 1OMDA 1QTXA 1EH2A 1ALVA 1ZFSA 2LE9B 3CTNA 1N2DA 1YX8A 3EVUA 1Y1AA 3KO0A 4NDCA 1IKUA 3DVJA 5I8NA 1XFUO 1BF5A 2LV7A 2RGIA 1J1DA 1B7TY 2JC2A 1CDLA 1U5IA 2M0RA 2F3ZA 1YRTB 2KYFA 4GGFC 3WHTB 3CZTX 3PATA 1J1EA 1CDMA 1XFVO 3GK1A 1L7ZA 2BCAA 3VRPA 1CKKA 1M31A 1JWDA 4JD9A 5CPVA 3L47A 3EK7A 2ZNEA 3CYZA 2VRGA 1TN4A 3R1OA 1XYDA 3TUYB 2K7DA 2KAVA 1CLBA 4OKHA 1SR6C 2GTEA 3CABA 1XK4C 2H2KA 3KPXA 2BBNA 1KK8C 1NUBA 2JPOA 2K60A 2LLTA 1BR1B 3PALA 2LUCA 1F4QA 2O5GA 1KFUL 3EKHA 4DCKA 3PM8A 1DVIA 2MLEC 3PSRA 3S0BA 4YI8A 2JT3A 5GQQC 1KQMB 2I7AA 1BLQA 3OB1B 3VRRA 1PVBA 3IVTA 3AAKA 2LNKA 2BE6A 2OTGB 3NHTA 1KFXS 1IQ5A 2AMIA 4QJ4B 3QRXA 1OOFA 1EG3A 4MRXA 3CS1A 1SW8A 2WC8A 2KQ6A 2E30A 3SS3A 2QDIA 1Y0VH 4MLWA 3D0YB 2CBLA 5I94A 1B8CA 4ICBA 3EK8A 1IJ6A 1Z2CB 1TIZA 1V1GA 1QX5B 1XFZO 3CGAA 2H61C 4MBEA 1M39A 1QXPA 4C0LA 1K2HA 2H8VA 1DJIA 1BT6A 1UHKA 3FE9A 4N1FA 1Z4HA 4GGFA 1DJHA 3SIBA 1PVAA 1B47A 3I5FB 2NCOA 4GNKB 1K9KA 5AXIA 2HQWA 2P6BB 4HSZA 2F3YA 4DUQA 1UP5A 2BECA 4M2QA 1LINA 1KWOC 1OOHA 2JTTA 2ZN9A 4PE4A 1GQMA 1NCYA 2FJUB 4C0KA 1Y1UA 4IL1A 5JOLA 3EK4A 1S6CA 2LHLA 5KSZA 1XK4A 1ZACA 3EG5B 1LKJA 4JKTA 4OV2A 3TZ1A 1TWOA 3DF0A 1UHIA 1QWVA 2JXLA 1S36A 1WDCB 5G08A 2F33A 3S0FA 3D75A 3SG2A 2CTNA 1QV0A 4FQOA 4AQJA 1F4OA 2LHIA 3S0DA 2CT9A 1CDNA 3QMEA 1MHOA 2EC6C 1B8RA 1CB1A 5AANA 5IBWA 5HLOA 1KK7Y 1IGVA 3SG3A 1JBAA 3FS7A 1AHRA 2WC5A 1B8LA 3CR4X 2ZRSA 4WQ2A 4JWQA 2JNFA 2R2IA 2WCLA 3WXAA 1K8UA 1OZOA 1RFJA 3S0AA 1ODBA 1IRJA 1B9AA 5D3OA 5PALA 2JRFA 5KU1A 3K1EA 2BKIB 2LP2A 3R72A 3RLZA 3TS5C 3VRQA 3M0WA 1EJ3A 3JVTB 2M1UA 1K90D 1QVIY 1L2OB 1MXEA 4HRGA 1UWOA 1XO5A 1QX7A 1YTZC 4GUKA 3LK1A 4NDDA 4PE1A 4USLA 1BG1A 1NWDA 1DF0B 2H61A 2M1KB 2JOJA 4A4BA 1RK9A 1C7VA 1UURA 3CZ1A 2KAXA 2K7BA 3UO9A 3CWGA 3SG7A 1YRUB 2SCPA 3HX4A 1SY9A 1C3ZA 3V2LA 2JULA 1V1FA 1QIWA 1A75A 1DGUA 3CR2A 3PLFB 1A29A 2DOQA 1F8HA 1NIWA 4DRWA 3NSLA 2Q91A 2CXJA 2ZFDA 1K93D 4MVFA 4DS7A 1NCZA 2ISDA 3LL8B 3BUOB 3B87A 5AEQA 2LCPA 1TNPA 1U5IB 3I5GB 2LC5A 1QS7A 4CLNA 2KDHA 2QEHA 1SL8A 1SCMC 3I5IB 4YGDB 3KEVA 1EXRA 3NSIA 3DXLA 4QJ5B 1DMOA 2HF5A 1SPYA 5CSIA 3O2PA 3EVRA 3CZ2A 3R1VA 2NXQA 1BU3A 1H8BA 5B8IB 1CFFA 1BJFA 1MXLC 4P2YB 1S6IA 4FQTA 2IS9A 1J7PA 1K96A 2WOSA 1DJWA 1PSBA 1NPQA
chains in the Genus database with same CATH topology
1PK0D 1IJ5A 1TNWA 5J3XA 1DJXA 4A4CA 3EVVA 4UPGA 4MZJA 2LP3A 3PN7B 3IQOA 1WRKA 1ZMZA 1SYMA 2WORA 1K9PA 1SKTA 1VRKA 2ZRTA 1G4YR 2KNEA 2JWWA 1QX2A 1UHJA 2BL0C 2JT8A 3I5HC 4JQ0D 1TOPA 4GFTA 1AVSA 3FWBA 3WHUB 1SBJA 4WRIA 3ZWHA 5I2LA 1YURA 1ALWA 1SCMB 1Y6WA 3GK4X 4CPVA 1S26D 2LUXA 4XYNA 1MF8B 2G2BA 3GK2A 1IG5A 2KI6C 1NSHA 1R2UA 1B4CA 1AK8A 4OR9B 1QIVA 1ZUZA 4NDBA 3EKJA 4JPZB 1LVCD 2Y4QA 4CIDA 2D8NA 3BYAA 4YGEB 3A4UB 2PMYA 2Y1MA 5HKYA 1XVJA 4CFQA 1WRZA 5CSJA 4YGAA 1MQ1A 4Q04A 1SR6B 1QV1A 2BCXA 1PALA 2L4HA 4P5OE 1KK8B 1FF1A 1IQ3A 3DF0B 1WRLA 1C7WA 1TNQA 1ZOTB 2L50A 1RECA 1K95A 2M49B 1M46A 2F2PA 1F70A 1DJZA 1UHNA 1DJYA 3BOWA 3F45A 4C0JA 1M63B 1GGZA 1YVLA 5DKRA 1H4BA 1S5GZ 1EG4A 4HRHA 2MAZA 1FBVA 3BUMB 1EL4A 1RWYA 2FCEA 1N65A 1JFKA 1F55A 4ORCB 1OSAA 2KSPA 1WLZA 2TN4A 3BUXB 1D1OA 1KFUS 3DVKA 5BPJA 1S6JA 2LVIA 4PE7A 1A03A 2K7CA 2LM5A 1TNXA 3K21A 1TTXA 4GBAA 2PALA 4ZCUA 1PSRA 2KI4C 2QPTA 5I2OA 2BKHB 1NX1A 2I94A 3LCPC 2M7LA 4PHJA 4I5NB 2NCPA 4XJKA 2JT0A 2KGBC 4CFRA 2Y5IA 1DJGA 1TRFA 4YBHB 3ZNIA 4DIRA 2LMTA 1FW4A 1A75B 2K0JA 2PSRA 4YGBB 4D1EA 1KWOB 3MSEB 1CFDA 2BCBA 4N5XA 1J7RA 1QJTA 2LLSA 2Y1NA 1NP8A 3BQ3A 2F2OA 5DKNA 3JTDC 3SG4A 1KCYA 5HLVA 3SJSA 2I18A 2MHHA 3OP0A 2JXCA 2LVJA 2EC6B 1KQVA 3O78A 3CR5X 2M7NA 1WY9A 4PALA 1SRAA 5ER5A 1MWNA 2L5XB 1KK7Z 3KF9A 3IF7A 2SASA 5K89A 2COLB 3IQQA 1GGWA 2KI4B 4PDZA 1BMOA 5AFPA 2JQ6A 1CFPA 1JF0A 3O4YA 2L2EA 2NZ0A 4PCWA 1SMGA 2WCEA 3BUWB 3TS5B 1G8IA 3GOFA 3TDZA 4OCIA 2EGDA 1J7QA 1X02A 1JFJA 1OOJA 3DVEA 1KFXL 4NQGA 3TUYC 1S3PA 4M2PA 2A4JA 2KOTA 3PFVA 1OQPA 1RTP1 2LMVA 5DKQA 3O6BA 4MZKA 2K8MB 1TCOB 1XFXO 1C07A 1SK6D 1K94A 2B1UA 1BODA 2BE4A 2PVBA 2KBIA 1J55A 1KQMC 1QLSA 2K2FA 5F6TA 3OX6A 1DGVA 3H4SE 1CTRA 2GGZA 4N1GA 1RJVA 1JC2A 3AKBA 2OTGC 3OB2B 4MSPA 1UHHA 1OMVA 2KI6D 4F0ZB 4QJ3B 1SL9A 2KYCA 1MUXA 2I2RE 2HPSA 1DT7B 3BUNB 4ZCVA 1KSMA 2JNXA 2HETA 1NX3A 3D10A 2E6WA 4HREE 4PHNA 1E8AA 1CM1A 2KHNA 2K7OA 1F54A 4FTGA 1B7TZ 2KAYA 1YUUA 2MJWB 3FWCA 4OVNF 1WLMA 4AQIA 1OZSA 1AP4A 4YGCB 3I5FC 1DTLA 3KHEA 1CLLA 4MEWA 1HT9A 1NYAA 1AUIB 2KQYA 1IWQA 3BOWB 2MA2A 1CLMA 1HQVA 4E68A 2O60A 3VGOA 1Q80A 1W7IB 5D7FA 1XA5A 1BOCA 2L4IA 1A4PA 1S5GY 1XFYO 2EHBA 2PRUA 2BL0B 2MLFC 3I5HB 4I5JA 4PHKA 3AAJA 5JJGA 4BY4A 2KFGA 2NLNA 1NCXA 2GGMA 2OS8C 1WDCC 5TNCA 1J7OA 2M3WA 3VROA 2KFFA 3DD4A 2LVKA 3VRNA 2WCFA 4YI9A 2L51A 2LVVA 2WCBA 2MRDA 2KFHA 2JU0A 3OX5A 5ER4X 5HYDA 2M29A 3NXAA 4PHMA 4TNCA 1FI5A 3E3RA 1FPWA 1G33A 1AJ4A 1YUTA 3OHMB 2M97A 1YX7A 4I5LB 3SG5A 1JUOA 1NX2A 2LANA 5I2QA 4XJKB 1SCVA 1AJ5A 1QATA 2KGRA 2CCMA 3SIAA 3D0YA 3JVTC 3AKAA 1UUSA 1PRWA 1L2OC 1BR4B 3C1VA 2LAPA 3LK0A 4MZLA 1FI6A 1KSOA 2LLUA 2GV5A 2G9BA 3CLNA 1CDPA 1QASA 1NX0A 3LLEA 1YUSA 1LXFC 2MBXA 4PE0A 1K9UA 1TCFA 2M8UA 2PASA 1MR8A 1QLKA 2OS8B 2K61A 3TDUA 1PULA 1IH0A 5CSNA 3SG6A 1CMFA 1SNLA 1N0YA 2AAOA 1YVHA 4WQ3A 1R6PA 2JZIA 2QACA 4I5KA 5FYXA 5AERA 1F71A 1GJYA 2AUCA 2WNDA 3ICBA 4GPLB 2M9GA 4MRYA 4MN0A 2ZNDA 4GGNA 2FCDA 3I5GC 3WNXB 2HQ8A 2V53A 2K2AA 4L9MA 4ORBB 2BBMA 1RROA 2ZKMX 3TDIA 3I5IC 2KBMA 1B1GA 1S1EA 3NSKA 1CNPA 5HKWA 1JF2A 2ZN8A 1JSAA 2Q4UA 4BY5A 4M2OA 4AOMA 4ETOA 5KTYA 4U8DA 1M45A 1LA3A 3FIAA 4GAOA 1OE9B 2LMUA 1LA0A 1CM4A 2JPTA 1CFCA 5HKZA 5D69A 3PN7C 1Y1XA 2CNPA 1QVIZ 1YR5A 4R1EA 1CMGA 3HCMA 2JTZA 2L0PA 1DF0A 2FOTA 3DVMA 1XFWO 4YRUA 1SL7A 3JTDB 1OMRA 1W7JB 4ORAB 3BXKA 1A2XA 2L98A 2OPOA 2F8PA 3RM1A 3NSOA 3A8RA 5CSFA 1OMDA 1QTXA 1EH2A 1ALVA 1ZFSA 2LE9B 3CTNA 1N2DA 1YX8A 3EVUA 1Y1AA 3KO0A 4NDCA 1IKUA 3DVJA 5I8NA 1XFUO 1BF5A 2LV7A 2RGIA 1J1DA 1B7TY 2JC2A 1CDLA 1U5IA 2M0RA 2F3ZA 1YRTB 2KYFA 4GGFC 3WHTB 3CZTX 3PATA 1J1EA 1CDMA 1XFVO 3GK1A 1L7ZA 2BCAA 3VRPA 1CKKA 1M31A 1JWDA 5CPVA 3EK7A 2ZNEA 2VRGA 1TN4A 3TUYB 1XYDA 2K7DA 2KAVA 1CLBA 4OKHA 1SR6C 3KPXA 1XK4C 2H2KA 2BBNA 1KK8C 1NUBA 2LLTA 3PALA 1BR1B 2LUCA 1F4QA 2O5GA 1KFUL 3EKHA 4DCKA 3PM8A 1DVIA 2MLEC 3PSRA 4YI8A 2JT3A 5GQQC 1KQMB 2I7AA 1BLQA 3OB1B 3VRRA 1PVBA 3AAKA 2LNKA 2BE6A 2OTGB 1KFXS 1IQ5A 2AMIA 4QJ4B 3QRXA 1EG3A 4MRXA 3CS1A 1SW8A 2WC8A 2KQ6A 2E30A 1Y0VH 4MLWA 3D0YB 2CBLA 1B8CA 4ICBA 3EK8A 1IJ6A 1TIZA 1V1GA 1QX5B 1XFZO 3CGAA 2H61C 4MBEA 1M39A 1QXPA 4C0LA 1K2HA 1DJIA 1BT6A 1UHKA 4N1FA 3SIBA 4GGFA 1DJHA 1PVAA 1B47A 3I5FB 2NCOA 4GNKB 1K9KA 5AXIA 2HQWA 2P6BB 4HSZA 2F3YA 4DUQA 1UP5A 2BECA 4M2QA 1LINA 1KWOC 2JTTA 2ZN9A 4PE4A 1GQMA 1NCYA 2FJUB 4C0KA 1Y1UA 4IL1A 5JOLA 3EK4A 1S6CA 2LHLA 5KSZA 1XK4A 1ZACA 1LKJA 4OV2A 3TZ1A 3DF0A 1UHIA 2JXLA 1S36A 1WDCB 5G08A 2F33A 3SG2A 2CTNA 1QV0A 4FQOA 4AQJA 1F4OA 2LHIA 1CDNA 2CT9A 1MHOA 2EC6C 1B8RA 1CB1A 5AANA 5IBWA 5HLOA 1KK7Y 1IGVA 3SG3A 1JBAA 3FS7A 1AHRA 1B8LA 3CR4X 2ZRSA 4WQ2A 4JWQA 2JNFA 2R2IA 3WXAA 1K8UA 1OZOA 1RFJA 1ODBA 1IRJA 1B9AA 5PALA 2JRFA 5KU1A 2BKIB 2LP2A 3RLZA 3TS5C 3VRQA 3M0WA 1EJ3A 3JVTB 2M1UA 1K90D 1QVIY 1L2OB 1MXEA 4HRGA 1UWOA 1XO5A 1QX7A 1YTZC 4GUKA 3LK1A 4NDDA 4PE1A 4USLA 1BG1A 1NWDA 1DF0B 2H61A 2M1KB 2JOJA 4A4BA 1RK9A 1C7VA 1UURA 2KAXA 2K7BA 3CWGA 3SG7A 1YRUB 2SCPA 3HX4A 1SY9A 2JULA 1V1FA 1QIWA 1A75A 1DGUA 3CR2A 3PLFB 1A29A 2DOQA 1F8HA 1NIWA 4DRWA 3NSLA 2Q91A 2CXJA 2ZFDA 1K93D 4MVFA 4DS7A 1NCZA 2ISDA 3LL8B 3BUOB 5AEQA 2LCPA 1TNPA 1U5IB 3I5GB 2LC5A 1QS7A 4CLNA 2KDHA 1SL8A 1SCMC 3I5IB 4YGDB 3KEVA 1EXRA 3NSIA 4QJ5B 1DMOA 2HF5A 1SPYA 5CSIA 3O2PA 3EVRA 2NXQA 1BU3A 1H8BA 5B8IB 1CFFA 1BJFA 1MXLC 4P2YB 1S6IA 2IS9A 1J7PA 1K96A 2WOSA 1DJWA 1PSBA 1NPQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PK0 D;  1IJ5 A;  1TNW A;  5J3X A;  1DJX A;  4A4C A;  3EVV A;  4UPG A;  4MZJ A;  2LP3 A;  3PN7 B;  3IQO A;  1WRK A;  1ZMZ A;  1SYM A;  2WOR A;  1K9P A;  1SKT A;  1VRK A;  2ZRT A;  1G4Y R;  2KNE A;  2JWW A;  1QX2 A;  1UHJ A;  2BL0 C;  2JT8 A;  3I5H C;  4JQ0 D;  1TOP A;  4GFT A;  1AVS A;  3FWB A;  3WHU B;  1SBJ A;  4WRI A;  3ZWH A;  5I2L A;  1YUR A;  1ALW A;  1SCM B;  1Y6W A;  3GK4 X;  4CPV A;  1S26 D;  2LUX A;  4XYN A;  1MF8 B;  2G2B A;  3GK2 A;  1IG5 A;  2KI6 C;  1NSH A;  1R2U A;  1B4C A;  1AK8 A;  4OR9 B;  1QIV A;  1ZUZ A;  4NDB A;  3EKJ A;  4JPZ B;  1LVC D;  2Y4Q A;  4CID A;  2D8N A;  3BYA A;  4YGE B;  3A4U B;  2PMY A;  2Y1M A;  5HKY A;  1XVJ A;  4CFQ A;  1WRZ A;  5CSJ A;  4YGA A;  1MQ1 A;  4Q04 A;  1SR6 B;  1QV1 A;  2BCX A;  1PAL A;  2L4H A;  4P5O E;  1KK8 B;  1FF1 A;  1IQ3 A;  3DF0 B;  1WRL A;  1C7W A;  1TNQ A;  1ZOT B;  2L50 A;  1REC A;  1K95 A;  2M49 B;  1M46 A;  2F2P A;  1F70 A;  1DJZ A;  1UHN A;  1DJY A;  3BOW A;  3F45 A;  4C0J A;  1M63 B;  1GGZ A;  1YVL A;  5DKR A;  1H4B A;  1S5G Z;  1EG4 A;  4HRH A;  2MAZ A;  1FBV A;  3BUM B;  1EL4 A;  1RWY A;  2FCE A;  1N65 A;  1JFK A;  1F55 A;  4ORC B;  1OSA A;  2KSP A;  1WLZ A;  2TN4 A;  3BUX B;  1D1O A;  1KFU S;  3DVK A;  5BPJ A;  1S6J A;  2LVI A;  4PE7 A;  1A03 A;  2K7C A;  2LM5 A;  1TNX A;  3K21 A;  1TTX A;  4GBA A;  2PAL A;  4ZCU A;  1PSR A;  2KI4 C;  2QPT A;  5I2O A;  2BKH B;  1NX1 A;  2I94 A;  3LCP C;  2M7L A;  4PHJ A;  4I5N B;  2NCP A;  4XJK A;  2JT0 A;  2KGB C;  4CFR A;  2Y5I A;  1DJG A;  1TRF A;  4YBH B;  3ZNI A;  4DIR A;  2LMT A;  1FW4 A;  1A75 B;  2K0J A;  2PSR A;  4YGB B;  4D1E A;  1KWO B;  3MSE B;  1CFD A;  2BCB A;  4N5X A;  1J7R A;  1QJT A;  2LLS A;  2Y1N A;  1NP8 A;  3BQ3 A;  2F2O A;  5DKN A;  3JTD C;  3SG4 A;  1KCY A;  5HLV A;  3SJS A;  2I18 A;  2MHH A;  3OP0 A;  2JXC A;  2LVJ A;  2EC6 B;  1KQV A;  3O78 A;  3CR5 X;  2M7N A;  1WY9 A;  4PAL A;  1SRA A;  5ER5 A;  1MWN A;  2L5X B;  1KK7 Z;  3KF9 A;  3IF7 A;  2SAS A;  5K89 A;  2COL B;  3IQQ A;  1GGW A;  2KI4 B;  4PDZ A;  1BMO A;  5AFP A;  2JQ6 A;  1CFP A;  1JF0 A;  3O4Y A;  2L2E A;  2NZ0 A;  4PCW A;  1SMG A;  2WCE A;  3BUW B;  3TS5 B;  1G8I A;  3GOF A;  3TDZ A;  4OCI A;  2EGD A;  1J7Q A;  1X02 A;  1JFJ A;  1OOJ A;  3DVE A;  1KFX L;  4NQG A;  3TUY C;  1S3P A;  4M2P A;  2A4J A;  2KOT A;  3PFV A;  1OQP A;  1RTP 1;  2LMV A;  5DKQ A;  3O6B A;  4MZK A;  2K8M B;  1TCO B;  1XFX O;  1C07 A;  1SK6 D;  1K94 A;  2B1U A;  1BOD A;  2BE4 A;  2PVB A;  2KBI A;  1J55 A;  1KQM C;  1QLS A;  2K2F A;  5F6T A;  3OX6 A;  1DGV A;  3H4S E;  1CTR A;  2GGZ A;  4N1G A;  1RJV A;  1JC2 A;  3AKB A;  2OTG C;  3OB2 B;  4MSP A;  1UHH A;  1OMV A;  2KI6 D;  4F0Z B;  4QJ3 B;  1SL9 A;  2KYC A;  1MUX A;  2I2R E;  2HPS A;  1DT7 B;  3BUN B;  4ZCV A;  1KSM A;  2JNX A;  2HET A;  1NX3 A;  3D10 A;  2E6W A;  4HRE E;  4PHN A;  1E8A A;  1CM1 A;  2KHN A;  2K7O A;  1F54 A;  4FTG A;  1B7T Z;  2KAY A;  1YUU A;  2MJW B;  3FWC A;  4OVN F;  1WLM A;  4AQI A;  1OZS A;  1AP4 A;  4YGC B;  3I5F C;  1DTL A;  3KHE A;  1CLL A;  4MEW A;  1HT9 A;  1NYA A;  1AUI B;  2KQY A;  1IWQ A;  3BOW B;  2MA2 A;  1CLM A;  1HQV A;  4E68 A;  2O60 A;  3VGO A;  1Q80 A;  1W7I B;  5D7F A;  1XA5 A;  1BOC A;  2L4I A;  1A4P A;  1S5G Y;  1XFY O;  2EHB A;  2PRU A;  2BL0 B;  2MLF C;  3I5H B;  4I5J A;  4PHK A;  3AAJ A;  5JJG A;  4BY4 A;  2KFG A;  2NLN A;  1NCX A;  2GGM A;  2OS8 C;  1WDC C;  5TNC A;  1J7O A;  2M3W A;  3VRO A;  2KFF A;  3DD4 A;  2LVK A;  3VRN A;  2WCF A;  4YI9 A;  2L51 A;  2LVV A;  2WCB A;  2MRD A;  2KFH A;  2JU0 A;  3OX5 A;  5ER4 X;  5HYD A;  2M29 A;  3NXA A;  4PHM A;  4TNC A;  1FI5 A;  3E3R A;  1FPW A;  1G33 A;  1AJ4 A;  1YUT A;  3OHM B;  2M97 A;  1YX7 A;  4I5L B;  3SG5 A;  1JUO A;  1NX2 A;  2LAN A;  5I2Q A;  4XJK B;  1SCV A;  1AJ5 A;  1QAT A;  2KGR A;  2CCM A;  3SIA A;  3D0Y A;  3JVT C;  3AKA A;  1UUS A;  1PRW A;  1L2O C;  1BR4 B;  3C1V A;  2LAP A;  3LK0 A;  4MZL A;  1FI6 A;  1KSO A;  2LLU A;  2GV5 A;  2G9B A;  3CLN A;  1CDP A;  1QAS A;  1NX0 A;  3LLE A;  1YUS A;  1LXF C;  2MBX A;  4PE0 A;  1K9U A;  1TCF A;  2M8U A;  2PAS A;  1MR8 A;  1QLK A;  2OS8 B;  2K61 A;  3TDU A;  1PUL A;  1IH0 A;  5CSN A;  3SG6 A;  1CMF A;  1SNL A;  1N0Y A;  2AAO A;  1YVH A;  4WQ3 A;  1R6P A;  2JZI A;  2QAC A;  4I5K A;  5FYX A;  5AER A;  1F71 A;  1GJY A;  2AUC A;  2WND A;  3ICB A;  4GPL B;  2M9G A;  4MRY A;  4MN0 A;  2ZND A;  4GGN A;  2FCD A;  3I5G C;  3WNX B;  2HQ8 A;  2V53 A;  2K2A A;  4L9M A;  4ORB B;  2BBM A;  1RRO A;  2ZKM X;  3TDI A;  3I5I C;  2KBM A;  1B1G A;  1S1E A;  3NSK A;  1CNP A;  5HKW A;  1JF2 A;  2ZN8 A;  1JSA A;  2Q4U A;  4BY5 A;  4M2O A;  4AOM A;  4ETO A;  5KTY A;  4U8D A;  1M45 A;  1LA3 A;  3FIA A;  4GAO A;  1OE9 B;  2LMU A;  1LA0 A;  1CM4 A;  2JPT A;  1CFC A;  5HKZ A;  5D69 A;  3PN7 C;  1Y1X A;  2CNP A;  1QVI Z;  1YR5 A;  4R1E A;  1CMG A;  3HCM A;  2JTZ A;  2L0P A;  1DF0 A;  2FOT A;  3DVM A;  1XFW O;  4YRU A;  1SL7 A;  3JTD B;  1OMR A;  1W7J B;  4ORA B;  3BXK A;  1A2X A;  2L98 A;  2OPO A;  2F8P A;  3RM1 A;  3NSO A;  3A8R A;  5CSF A;  1OMD A;  1QTX A;  1EH2 A;  1ALV A;  1ZFS A;  2LE9 B;  3CTN A;  1N2D A;  1YX8 A;  3EVU A;  1Y1A A;  3KO0 A;  4NDC A;  1IKU A;  3DVJ A;  5I8N A;  1XFU O;  1BF5 A;  2LV7 A;  2RGI A;  1J1D A;  1B7T Y;  2JC2 A;  1CDL A;  1U5I A;  2M0R A;  2F3Z A;  1YRT B;  2KYF A;  4GGF C;  3WHT B;  3CZT X;  3PAT A;  1J1E A;  1CDM A;  1XFV O;  3GK1 A;  1L7Z A;  2BCA A;  3VRP A;  1CKK A;  1M31 A;  1JWD A;  5CPV A;  3EK7 A;  2ZNE A;  2VRG A;  1TN4 A;  3TUY B;  1XYD A;  2K7D A;  2KAV A;  1CLB A;  4OKH A;  1SR6 C;  3KPX A;  1XK4 C;  2H2K A;  2BBN A;  1KK8 C;  1NUB A;  2LLT A;  3PAL A;  1BR1 B;  2LUC A;  1F4Q A;  2O5G A;  1KFU L;  3EKH A;  4DCK A;  3PM8 A;  1DVI A;  2MLE C;  3PSR A;  4YI8 A;  2JT3 A;  5GQQ C;  1KQM B;  2I7A A;  1BLQ A;  3OB1 B;  3VRR A;  1PVB A;  3AAK A;  2LNK A;  2BE6 A;  2OTG B;  1KFX S;  1IQ5 A;  2AMI A;  4QJ4 B;  3QRX A;  1EG3 A;  4MRX A;  3CS1 A;  1SW8 A;  2WC8 A;  2KQ6 A;  2E30 A;  1Y0V H;  4MLW A;  3D0Y B;  2CBL A;  1B8C A;  4ICB A;  3EK8 A;  1IJ6 A;  1TIZ A;  1V1G A;  1QX5 B;  1XFZ O;  3CGA A;  2H61 C;  4MBE A;  1M39 A;  1QXP A;  4C0L A;  1K2H A;  1DJI A;  1BT6 A;  1UHK A;  4N1F A;  3SIB A;  4GGF A;  1DJH A;  1PVA A;  1B47 A;  3I5F B;  2NCO A;  4GNK B;  1K9K A;  5AXI A;  2HQW A;  2P6B B;  4HSZ A;  2F3Y A;  4DUQ A;  1UP5 A;  2BEC A;  4M2Q A;  1LIN A;  1KWO C;  2JTT A;  2ZN9 A;  4PE4 A;  1GQM A;  1NCY A;  2FJU B;  4C0K A;  1Y1U A;  4IL1 A;  5JOL A;  3EK4 A;  1S6C A;  2LHL A;  5KSZ A;  1XK4 A;  1ZAC A;  1LKJ A;  4OV2 A;  3TZ1 A;  3DF0 A;  1UHI A;  2JXL A;  1S36 A;  1WDC B;  5G08 A;  2F33 A;  3SG2 A;  2CTN A;  1QV0 A;  4FQO A;  4AQJ A;  1F4O A;  2LHI A;  1CDN A;  2CT9 A;  1MHO A;  2EC6 C;  1B8R A;  1CB1 A;  5AAN A;  5IBW A;  5HLO A;  1KK7 Y;  1IGV A;  3SG3 A;  1JBA A;  3FS7 A;  1AHR A;  1B8L A;  3CR4 X;  2ZRS A;  4WQ2 A;  4JWQ A;  2JNF A;  2R2I A;  3WXA A;  1K8U A;  1OZO A;  1RFJ A;  1ODB A;  1IRJ A;  1B9A A;  5PAL A;  2JRF A;  5KU1 A;  2BKI B;  2LP2 A;  3RLZ A;  3TS5 C;  3VRQ A;  3M0W A;  1EJ3 A;  3JVT B;  2M1U A;  1K90 D;  1QVI Y;  1L2O B;  1MXE A;  4HRG A;  1UWO A;  1XO5 A;  1QX7 A;  1YTZ C;  4GUK A;  3LK1 A;  4NDD A;  4PE1 A;  4USL A;  1BG1 A;  1NWD A;  1DF0 B;  2H61 A;  2M1K B;  2JOJ A;  4A4B A;  1RK9 A;  1C7V A;  1UUR A;  2KAX A;  2K7B A;  3CWG A;  3SG7 A;  1YRU B;  2SCP A;  3HX4 A;  1SY9 A;  2JUL A;  1V1F A;  1QIW A;  1A75 A;  1DGU A;  3CR2 A;  3PLF B;  1A29 A;  2DOQ A;  1F8H A;  1NIW A;  4DRW A;  3NSL A;  2Q91 A;  2CXJ A;  2ZFD A;  1K93 D;  4MVF A;  4DS7 A;  1NCZ A;  2ISD A;  3LL8 B;  3BUO B;  5AEQ A;  2LCP A;  1TNP A;  1U5I B;  3I5G B;  2LC5 A;  1QS7 A;  4CLN A;  2KDH A;  1SL8 A;  1SCM C;  3I5I B;  4YGD B;  3KEV A;  1EXR A;  3NSI A;  4QJ5 B;  1DMO A;  2HF5 A;  1SPY A;  5CSI A;  3O2P A;  3EVR A;  2NXQ A;  1BU3 A;  1H8B A;  5B8I B;  1CFF A;  1BJF A;  1MXL C;  4P2Y B;  1S6I A;  2IS9 A;  1J7P A;  1K96 A;  2WOS A;  1DJW A;  1PSB A;  1NPQ A; 
#chains in the Genus database with same CATH topology
 1PK0 D;  1IJ5 A;  1TNW A;  5J3X A;  1DJX A;  4A4C A;  3EVV A;  4UPG A;  4MZJ A;  2LP3 A;  3PN7 B;  3IQO A;  1WRK A;  1ZMZ A;  1SYM A;  2WOR A;  4INW A;  1K9P A;  1SKT A;  1VRK A;  2ZRT A;  1G4Y R;  2KNE A;  2L2C A;  2ERB A;  2JWW A;  1QX2 A;  1UHJ A;  2BL0 C;  2JT8 A;  3I5H C;  4JQ0 D;  1TOP A;  4GFT A;  1AVS A;  2QEO A;  3FWB A;  3WHU B;  1SBJ A;  3BFH A;  4WRI A;  3ZWH A;  5I2L A;  3R1P A;  3L4A A;  3SS5 A;  1YUR A;  1ALW A;  1SCM B;  1Y6W A;  3GK4 X;  4CPV A;  1SSE B;  1S26 D;  2LUX A;  4XYN A;  1MF8 B;  2G2B A;  3GK2 A;  1IG5 A;  2KI6 C;  1C3Y A;  1NSH A;  1R2U A;  1B4C A;  1AK8 A;  4OR9 B;  1QIV A;  1ZUZ A;  2QEV A;  4NDB A;  3EKJ A;  3OGN A;  4JPZ B;  1LVC D;  2Y4Q A;  3D74 A;  4CID A;  2D8N A;  1OOI X;  3BYA A;  3S0G A;  4YGE B;  3A4U B;  2PMY A;  2Y1M A;  5HKY A;  1XVJ A;  4CFQ A;  1WRZ A;  2FJY A;  3SS4 A;  5CSJ A;  4YGA A;  1MQ1 A;  1DEL A;  4Q04 A;  1SR6 B;  1QV1 A;  2BCX A;  4PT1 A;  1PAL A;  2L4H A;  4P5O E;  1KK8 B;  4INX A;  1FF1 A;  1IQ3 A;  3DF0 B;  1IIO A;  1WRL A;  1C7W A;  1TNQ A;  1ZOT B;  2L50 A;  1REC A;  1K95 A;  2M49 B;  1M46 A;  2F2P A;  1F70 A;  1DJZ A;  1TUJ A;  1UHN A;  1DJY A;  3BOW A;  3F45 A;  4C0J A;  1M63 B;  1GGZ A;  1YVL A;  5DKR A;  4OZD A;  3Q8I A;  1S5G Z;  1H4B A;  1EG4 A;  4HRH A;  2MAZ A;  1FBV A;  3BUM B;  1EL4 A;  1RWY A;  2FCE A;  1N65 A;  1JFK A;  1F55 A;  4ORC B;  1OSA A;  2KSP A;  1WLZ A;  2TN4 A;  3BUX B;  1D1O A;  1KFU S;  3DVK A;  5BPJ A;  1S6J A;  2LVI A;  4PE7 A;  1A03 A;  2K7C A;  2LM5 A;  1TNX A;  3K21 A;  1TTX A;  4GBA A;  2PAL A;  4ZCU A;  1PSR A;  2KI4 C;  2QPT A;  5I2O A;  2BKH B;  1NX1 A;  2I94 A;  3LCP C;  2M7L A;  4PHJ A;  4I5N B;  3OBV A;  2NCP A;  4XJK A;  2JT0 A;  2WCK A;  2KGB C;  4CFR A;  2Y5I A;  1DJG A;  1TRF A;  4KYN A;  4YBH B;  3ZNI A;  3D78 A;  4DIR A;  2LMT A;  1FW4 A;  1A75 B;  2K0J A;  2PSR A;  4YGB B;  4D1E A;  1KWO B;  3MSE B;  1CFD A;  2BCB A;  1T14 A;  4N5X A;  1J7R A;  1QJT A;  2LLS A;  3VB1 A;  3DZT A;  2Y1N A;  1NP8 A;  3NGV A;  3BQ3 A;  2F2O A;  5DKN A;  2PQL A;  3JTD C;  3SG4 A;  1KCY A;  3RZS A;  5HLV A;  1TUZ A;  3SJS A;  2I18 A;  2MHH A;  3OP0 A;  2JXC A;  2LVJ A;  2EC6 B;  1KQV A;  3O78 A;  3CR5 X;  2BAP A;  2M7N A;  1WY9 A;  5EL2 A;  4PAL A;  1SRA A;  5ER5 A;  1MWN A;  2L5X B;  1KK7 Z;  3KF9 A;  3IF7 A;  2SAS A;  5K89 A;  2COL B;  3D73 A;  3IQQ A;  1GGW A;  2KI4 B;  4PDZ A;  1BMO A;  5AFP A;  2JQ6 A;  1CFP A;  1JF0 A;  3O4Y A;  2WCM A;  2L2E A;  2NZ0 A;  4PCW A;  1SMG A;  2WCE A;  3BUW B;  3TS5 B;  1G8I A;  3B6X A;  3GOF A;  3TDZ A;  1XFR A;  4OCI A;  2EGD A;  5FI6 A;  1J7Q A;  3FE8 A;  1X02 A;  1DEK A;  1JFJ A;  1OOJ A;  3DVE A;  1KFX L;  4NQG A;  3TUY C;  1S3P A;  4M2P A;  2A4J A;  2KOT A;  3PFV A;  1OQP A;  1RTP 1;  1W9Z A;  2LMV A;  3O4X A;  3O6B A;  5DKQ A;  2QEB A;  4MZK A;  2K8M B;  1TCO B;  1XFX O;  1C07 A;  1SK6 D;  3CDN A;  1K94 A;  2B1U A;  1BOD A;  2BE4 A;  2PVB A;  3FE6 A;  2KBI A;  1J55 A;  1KQM C;  1QLS A;  5FI7 A;  2K2F A;  3BFA A;  5F6T A;  3NHI A;  3OX6 A;  1DGV A;  3H4S E;  1CTR A;  2GGZ A;  4N1G A;  1RJV A;  1JC2 A;  1LS8 A;  3AKB A;  2OTG C;  3OB2 B;  4MSP A;  1UHH A;  1OMV A;  2KI6 D;  4F0Z B;  4QJ3 B;  1SL9 A;  2KYC A;  3N7H A;  1MUX A;  2I2R E;  2HPS A;  1DT7 B;  3BUN B;  4ZCV A;  1KSM A;  2JNX A;  2HET A;  1NX3 A;  3D10 A;  2E6W A;  2P70 A;  4HRE E;  4PHN A;  1E8A A;  3BJH A;  1CM1 A;  2KHN A;  2K7O A;  1F54 A;  4FTG A;  1B7T Z;  3PJI A;  2KAY A;  1YUU A;  2MJW B;  3FWC A;  4OVN F;  1WLM A;  4AQI A;  1OZS A;  1AP4 A;  4YGC B;  2YGU A;  3I5F C;  3S0E A;  1DTL A;  3KHE A;  1CLL A;  4MEW A;  1HT9 A;  1NYA A;  1AUI B;  2KQY A;  1IWQ A;  3BOW B;  2MA2 A;  1CLM A;  1HQV A;  4E68 A;  2O60 A;  3VGO A;  3B7A A;  1Q80 A;  1W7I B;  5D7F A;  1XA5 A;  3UNW A;  1BOC A;  2L4I A;  1A4P A;  1S5G Y;  1XFY O;  2EHB A;  2PRU A;  2BL0 B;  2MLF C;  3I5H B;  4I5J A;  4PHK A;  3AAJ A;  5JJG A;  4BY4 A;  2KFG A;  2NLN A;  1NCX A;  2GGM A;  2OS8 C;  1WDC C;  5TNC A;  1J7O A;  2M3W A;  3VRO A;  2KFF A;  3DD4 A;  2LVK A;  3VRN A;  2WCF A;  4YI9 A;  2L51 A;  3B88 A;  2LVV A;  2WCB A;  2MRD A;  2KFH A;  2JU0 A;  2WC6 A;  3OX5 A;  1DQE A;  1P28 A;  5ER4 X;  5HYD A;  2M29 A;  3NXA A;  1ORG A;  4PHM A;  4TNC A;  1FI5 A;  3E3R A;  1FPW A;  1G33 A;  1AJ4 A;  1YUT A;  3OHM B;  2M97 A;  1YX7 A;  4F7F A;  4I5L B;  3SG5 A;  3D77 A;  1JUO A;  1NX2 A;  2LAN A;  5I2Q A;  4XJK B;  1SCV A;  1AJ5 A;  1QAT A;  2KGR A;  2CCM A;  3SIA A;  3D0Y A;  3JVT C;  3AKA A;  1UUS A;  1PRW A;  1L2O C;  1BR4 B;  2KLD A;  3CZ0 A;  3C1V A;  3B86 A;  2LAP A;  3LK0 A;  4MZL A;  1FI6 A;  1KSO A;  2LLU A;  2GV5 A;  2G9B A;  3CLN A;  1CDP A;  1QAS A;  1NX0 A;  3LLE A;  1YUS A;  1LXF C;  2MBX A;  4PE0 A;  1K9U A;  1TCF A;  2M8U A;  2PAS A;  1MR8 A;  3BFB A;  1QLK A;  2OS8 B;  2K61 A;  3TDU A;  1PUL A;  1OW4 A;  1IH0 A;  5CSN A;  3SG6 A;  1CMF A;  1GM0 A;  2WCJ A;  1SNL A;  1N0Y A;  2AAO A;  1YVH A;  2KLE A;  1R6P A;  2JZI A;  2QAC A;  4I5K A;  4WQ3 A;  5FYX A;  5AER A;  1DC1 A;  3DY9 A;  1F71 A;  1GJY A;  2AUC A;  2WND A;  3ICB A;  4GPL B;  5HL1 A;  2M9G A;  4MRY A;  4MN0 A;  4IJ7 A;  2ZND A;  4GGN A;  2FCD A;  3I5G C;  3WNX B;  2HQ8 A;  2V53 A;  2K2A A;  2BNX A;  4L9M A;  4ORB B;  2BBM A;  1RRO A;  2ZKM X;  3TDI A;  3I5I C;  2KBM A;  1B1G A;  1S1E A;  3NSK A;  1CNP A;  5DIC A;  3PM2 A;  2P71 A;  5HKW A;  1JF2 A;  2ZN8 A;  1JSA A;  2Q4U A;  4BY5 A;  4M2O A;  4AOM A;  5FI2 A;  4ETO A;  5KTY A;  4U8D A;  1M45 A;  1LA3 A;  2WCH A;  3FIA A;  4GAO A;  1OE9 B;  2LMU A;  1LA0 A;  1CM4 A;  2JPT A;  2PYQ A;  1CFC A;  5HKZ A;  5D69 A;  3PN7 C;  1Y1X A;  2CNP A;  1QVI Z;  1YR5 A;  3D76 A;  4R1E A;  1CMG A;  3HCM A;  2JTZ A;  2L0P A;  1DF0 A;  2FOT A;  3DVM A;  3L4L A;  1XFW O;  4YRU A;  2KPH A;  1SL7 A;  3JTD B;  1OMR A;  1W7J B;  4ORA B;  2L5Y A;  3BXK A;  1A2X A;  2L98 A;  2OPO A;  2F8P A;  3RM1 A;  3NSO A;  3DYE A;  3A8R A;  1OOG A;  5CSF A;  1OMD A;  1QTX A;  1EH2 A;  1ALV A;  1ZFS A;  2LE9 B;  3CTN A;  1N2D A;  1YX8 A;  3EVU A;  1Y1A A;  3KO0 A;  4NDC A;  1IKU A;  3DVJ A;  5I8N A;  1XFU O;  1BF5 A;  2LV7 A;  2RGI A;  1J1D A;  1B7T Y;  2JC2 A;  1CDL A;  1U5I A;  2M0R A;  2F3Z A;  1YRT B;  2KYF A;  4GGF C;  3WHT B;  3CZT X;  3PAT A;  1J1E A;  1CDM A;  1XFV O;  3GK1 A;  1L7Z A;  2BCA A;  3VRP A;  1CKK A;  1M31 A;  1JWD A;  4JD9 A;  5CPV A;  3L47 A;  3EK7 A;  2ZNE A;  3CYZ A;  2VRG A;  1TN4 A;  3R1O A;  1XYD A;  3TUY B;  2K7D A;  2KAV A;  1CLB A;  4OKH A;  1SR6 C;  2GTE A;  3CAB A;  1XK4 C;  2H2K A;  3KPX A;  2BBN A;  1KK8 C;  1NUB A;  2JPO A;  2K60 A;  2LLT A;  1BR1 B;  3PAL A;  2LUC A;  1F4Q A;  2O5G A;  1KFU L;  3EKH A;  4DCK A;  3PM8 A;  1DVI A;  2MLE C;  3PSR A;  3S0B A;  4YI8 A;  2JT3 A;  5GQQ C;  1KQM B;  2I7A A;  1BLQ A;  3OB1 B;  3VRR A;  1PVB A;  3IVT A;  3AAK A;  2LNK A;  2BE6 A;  2OTG B;  3NHT A;  1KFX S;  1IQ5 A;  2AMI A;  4QJ4 B;  3QRX A;  1OOF A;  1EG3 A;  4MRX A;  3CS1 A;  1SW8 A;  2WC8 A;  2KQ6 A;  2E30 A;  3SS3 A;  2QDI A;  1Y0V H;  4MLW A;  3D0Y B;  2CBL A;  5I94 A;  1B8C A;  4ICB A;  3EK8 A;  1IJ6 A;  1Z2C B;  1TIZ A;  1V1G A;  1QX5 B;  1XFZ O;  3CGA A;  2H61 C;  4MBE A;  1M39 A;  1QXP A;  4C0L A;  1K2H A;  2H8V A;  1DJI A;  1BT6 A;  1UHK A;  3FE9 A;  4N1F A;  1Z4H A;  4GGF A;  1DJH A;  3SIB A;  1PVA A;  1B47 A;  3I5F B;  2NCO A;  4GNK B;  1K9K A;  5AXI A;  2HQW A;  2P6B B;  4HSZ A;  2F3Y A;  4DUQ A;  1UP5 A;  2BEC A;  4M2Q A;  1LIN A;  1KWO C;  1OOH A;  2JTT A;  2ZN9 A;  4PE4 A;  1GQM A;  1NCY A;  2FJU B;  4C0K A;  1Y1U A;  4IL1 A;  5JOL A;  3EK4 A;  1S6C A;  2LHL A;  5KSZ A;  1XK4 A;  1ZAC A;  3EG5 B;  1LKJ A;  4JKT A;  4OV2 A;  3TZ1 A;  1TWO A;  3DF0 A;  1UHI A;  1QWV A;  2JXL A;  1S36 A;  1WDC B;  5G08 A;  2F33 A;  3S0F A;  3D75 A;  3SG2 A;  2CTN A;  1QV0 A;  4FQO A;  4AQJ A;  1F4O A;  2LHI A;  3S0D A;  2CT9 A;  1CDN A;  3QME A;  1MHO A;  2EC6 C;  1B8R A;  1CB1 A;  5AAN A;  5IBW A;  5HLO A;  1KK7 Y;  1IGV A;  3SG3 A;  1JBA A;  3FS7 A;  1AHR A;  2WC5 A;  1B8L A;  3CR4 X;  2ZRS A;  4WQ2 A;  4JWQ A;  2JNF A;  2R2I A;  2WCL A;  3WXA A;  1K8U A;  1OZO A;  1RFJ A;  3S0A A;  1ODB A;  1IRJ A;  1B9A A;  5D3O A;  5PAL A;  2JRF A;  5KU1 A;  3K1E A;  2BKI B;  2LP2 A;  3R72 A;  3RLZ A;  3TS5 C;  3VRQ A;  3M0W A;  1EJ3 A;  3JVT B;  2M1U A;  1K90 D;  1QVI Y;  1L2O B;  1MXE A;  4HRG A;  1UWO A;  1XO5 A;  1QX7 A;  1YTZ C;  4GUK A;  3LK1 A;  4NDD A;  4PE1 A;  4USL A;  1BG1 A;  1NWD A;  1DF0 B;  2H61 A;  2M1K B;  2JOJ A;  4A4B A;  1RK9 A;  1C7V A;  1UUR A;  3CZ1 A;  2KAX A;  2K7B A;  3UO9 A;  3CWG A;  3SG7 A;  1YRU B;  2SCP A;  3HX4 A;  1SY9 A;  1C3Z A;  3V2L A;  2JUL A;  1V1F A;  1QIW A;  1A75 A;  1DGU A;  3CR2 A;  3PLF B;  1A29 A;  2DOQ A;  1F8H A;  1NIW A;  4DRW A;  3NSL A;  2Q91 A;  2CXJ A;  2ZFD A;  1K93 D;  4MVF A;  4DS7 A;  1NCZ A;  2ISD A;  3LL8 B;  3BUO B;  3B87 A;  5AEQ A;  2LCP A;  1TNP A;  1U5I B;  3I5G B;  2LC5 A;  1QS7 A;  4CLN A;  2KDH A;  2QEH A;  1SL8 A;  1SCM C;  3I5I B;  4YGD B;  3KEV A;  1EXR A;  3NSI A;  3DXL A;  4QJ5 B;  1DMO A;  2HF5 A;  1SPY A;  5CSI A;  3O2P A;  3EVR A;  3CZ2 A;  3R1V A;  2NXQ A;  1BU3 A;  1H8B A;  5B8I B;  1CFF A;  1BJF A;  1MXL C;  4P2Y B;  1S6I A;  4FQT A;  2IS9 A;  1J7P A;  1K96 A;  2WOS A;  1DJW A;  1PSB A;  1NPQ A; 
#chains in the Genus database with same CATH homology
 1PK0 D;  1IJ5 A;  1TNW A;  5J3X A;  1DJX A;  4A4C A;  3EVV A;  4UPG A;  4MZJ A;  2LP3 A;  3PN7 B;  3IQO A;  1WRK A;  1ZMZ A;  1SYM A;  2WOR A;  1K9P A;  1SKT A;  1VRK A;  2ZRT A;  1G4Y R;  2KNE A;  2JWW A;  1QX2 A;  1UHJ A;  2BL0 C;  2JT8 A;  3I5H C;  4JQ0 D;  1TOP A;  4GFT A;  1AVS A;  3FWB A;  3WHU B;  1SBJ A;  4WRI A;  3ZWH A;  5I2L A;  1YUR A;  1ALW A;  1SCM B;  1Y6W A;  3GK4 X;  4CPV A;  1S26 D;  2LUX A;  4XYN A;  1MF8 B;  2G2B A;  3GK2 A;  1IG5 A;  2KI6 C;  1NSH A;  1R2U A;  1B4C A;  1AK8 A;  4OR9 B;  1QIV A;  1ZUZ A;  4NDB A;  3EKJ A;  4JPZ B;  1LVC D;  2Y4Q A;  4CID A;  2D8N A;  3BYA A;  4YGE B;  3A4U B;  2PMY A;  2Y1M A;  5HKY A;  1XVJ A;  4CFQ A;  1WRZ A;  5CSJ A;  4YGA A;  1MQ1 A;  4Q04 A;  1SR6 B;  1QV1 A;  2BCX A;  1PAL A;  2L4H A;  4P5O E;  1KK8 B;  1FF1 A;  1IQ3 A;  3DF0 B;  1WRL A;  1C7W A;  1TNQ A;  1ZOT B;  2L50 A;  1REC A;  1K95 A;  2M49 B;  1M46 A;  2F2P A;  1F70 A;  1DJZ A;  1UHN A;  1DJY A;  3BOW A;  3F45 A;  4C0J A;  1M63 B;  1GGZ A;  1YVL A;  5DKR A;  1H4B A;  1S5G Z;  1EG4 A;  4HRH A;  2MAZ A;  1FBV A;  3BUM B;  1EL4 A;  1RWY A;  2FCE A;  1N65 A;  1JFK A;  1F55 A;  4ORC B;  1OSA A;  2KSP A;  1WLZ A;  2TN4 A;  3BUX B;  1D1O A;  1KFU S;  3DVK A;  5BPJ A;  1S6J A;  2LVI A;  4PE7 A;  1A03 A;  2K7C A;  2LM5 A;  1TNX A;  3K21 A;  1TTX A;  4GBA A;  2PAL A;  4ZCU A;  1PSR A;  2KI4 C;  2QPT A;  5I2O A;  2BKH B;  1NX1 A;  2I94 A;  3LCP C;  2M7L A;  4PHJ A;  4I5N B;  2NCP A;  4XJK A;  2JT0 A;  2KGB C;  4CFR A;  2Y5I A;  1DJG A;  1TRF A;  4YBH B;  3ZNI A;  4DIR A;  2LMT A;  1FW4 A;  1A75 B;  2K0J A;  2PSR A;  4YGB B;  4D1E A;  1KWO B;  3MSE B;  1CFD A;  2BCB A;  4N5X A;  1J7R A;  1QJT A;  2LLS A;  2Y1N A;  1NP8 A;  3BQ3 A;  2F2O A;  5DKN A;  3JTD C;  3SG4 A;  1KCY A;  5HLV A;  3SJS A;  2I18 A;  2MHH A;  3OP0 A;  2JXC A;  2LVJ A;  2EC6 B;  1KQV A;  3O78 A;  3CR5 X;  2M7N A;  1WY9 A;  4PAL A;  1SRA A;  5ER5 A;  1MWN A;  2L5X B;  1KK7 Z;  3KF9 A;  3IF7 A;  2SAS A;  5K89 A;  2COL B;  3IQQ A;  1GGW A;  2KI4 B;  4PDZ A;  1BMO A;  5AFP A;  2JQ6 A;  1CFP A;  1JF0 A;  3O4Y A;  2L2E A;  2NZ0 A;  4PCW A;  1SMG A;  2WCE A;  3BUW B;  3TS5 B;  1G8I A;  3GOF A;  3TDZ A;  4OCI A;  2EGD A;  1J7Q A;  1X02 A;  1JFJ A;  1OOJ A;  3DVE A;  1KFX L;  4NQG A;  3TUY C;  1S3P A;  4M2P A;  2A4J A;  2KOT A;  3PFV A;  1OQP A;  1RTP 1;  2LMV A;  5DKQ A;  3O6B A;  4MZK A;  2K8M B;  1TCO B;  1XFX O;  1C07 A;  1SK6 D;  1K94 A;  2B1U A;  1BOD A;  2BE4 A;  2PVB A;  2KBI A;  1J55 A;  1KQM C;  1QLS A;  2K2F A;  5F6T A;  3OX6 A;  1DGV A;  3H4S E;  1CTR A;  2GGZ A;  4N1G A;  1RJV A;  1JC2 A;  3AKB A;  2OTG C;  3OB2 B;  4MSP A;  1UHH A;  1OMV A;  2KI6 D;  4F0Z B;  4QJ3 B;  1SL9 A;  2KYC A;  1MUX A;  2I2R E;  2HPS A;  1DT7 B;  3BUN B;  4ZCV A;  1KSM A;  2JNX A;  2HET A;  1NX3 A;  3D10 A;  2E6W A;  4HRE E;  4PHN A;  1E8A A;  1CM1 A;  2KHN A;  2K7O A;  1F54 A;  4FTG A;  1B7T Z;  2KAY A;  1YUU A;  2MJW B;  3FWC A;  4OVN F;  1WLM A;  4AQI A;  1OZS A;  1AP4 A;  4YGC B;  3I5F C;  1DTL A;  3KHE A;  1CLL A;  4MEW A;  1HT9 A;  1NYA A;  1AUI B;  2KQY A;  1IWQ A;  3BOW B;  2MA2 A;  1CLM A;  1HQV A;  4E68 A;  2O60 A;  3VGO A;  1Q80 A;  1W7I B;  5D7F A;  1XA5 A;  1BOC A;  2L4I A;  1A4P A;  1S5G Y;  1XFY O;  2EHB A;  2PRU A;  2BL0 B;  2MLF C;  3I5H B;  4I5J A;  4PHK A;  3AAJ A;  5JJG A;  4BY4 A;  2KFG A;  2NLN A;  1NCX A;  2GGM A;  2OS8 C;  1WDC C;  5TNC A;  1J7O A;  2M3W A;  3VRO A;  2KFF A;  3DD4 A;  2LVK A;  3VRN A;  2WCF A;  4YI9 A;  2L51 A;  2LVV A;  2WCB A;  2MRD A;  2KFH A;  2JU0 A;  3OX5 A;  5ER4 X;  5HYD A;  2M29 A;  3NXA A;  4PHM A;  4TNC A;  1FI5 A;  3E3R A;  1FPW A;  1G33 A;  1AJ4 A;  1YUT A;  3OHM B;  2M97 A;  1YX7 A;  4I5L B;  3SG5 A;  1JUO A;  1NX2 A;  2LAN A;  5I2Q A;  4XJK B;  1SCV A;  1AJ5 A;  1QAT A;  2KGR A;  2CCM A;  3SIA A;  3D0Y A;  3JVT C;  3AKA A;  1UUS A;  1PRW A;  1L2O C;  1BR4 B;  3C1V A;  2LAP A;  3LK0 A;  4MZL A;  1FI6 A;  1KSO A;  2LLU A;  2GV5 A;  2G9B A;  3CLN A;  1CDP A;  1QAS A;  1NX0 A;  3LLE A;  1YUS A;  1LXF C;  2MBX A;  4PE0 A;  1K9U A;  1TCF A;  2M8U A;  2PAS A;  1MR8 A;  1QLK A;  2OS8 B;  2K61 A;  3TDU A;  1PUL A;  1IH0 A;  5CSN A;  3SG6 A;  1CMF A;  1SNL A;  1N0Y A;  2AAO A;  1YVH A;  4WQ3 A;  1R6P A;  2JZI A;  2QAC A;  4I5K A;  5FYX A;  5AER A;  1F71 A;  1GJY A;  2AUC A;  2WND A;  3ICB A;  4GPL B;  2M9G A;  4MRY A;  4MN0 A;  2ZND A;  4GGN A;  2FCD A;  3I5G C;  3WNX B;  2HQ8 A;  2V53 A;  2K2A A;  4L9M A;  4ORB B;  2BBM A;  1RRO A;  2ZKM X;  3TDI A;  3I5I C;  2KBM A;  1B1G A;  1S1E A;  3NSK A;  1CNP A;  5HKW A;  1JF2 A;  2ZN8 A;  1JSA A;  2Q4U A;  4BY5 A;  4M2O A;  4AOM A;  4ETO A;  5KTY A;  4U8D A;  1M45 A;  1LA3 A;  3FIA A;  4GAO A;  1OE9 B;  2LMU A;  1LA0 A;  1CM4 A;  2JPT A;  1CFC A;  5HKZ A;  5D69 A;  3PN7 C;  1Y1X A;  2CNP A;  1QVI Z;  1YR5 A;  4R1E A;  1CMG A;  3HCM A;  2JTZ A;  2L0P A;  1DF0 A;  2FOT A;  3DVM A;  1XFW O;  4YRU A;  1SL7 A;  3JTD B;  1OMR A;  1W7J B;  4ORA B;  3BXK A;  1A2X A;  2L98 A;  2OPO A;  2F8P A;  3RM1 A;  3NSO A;  3A8R A;  5CSF A;  1OMD A;  1QTX A;  1EH2 A;  1ALV A;  1ZFS A;  2LE9 B;  3CTN A;  1N2D A;  1YX8 A;  3EVU A;  1Y1A A;  3KO0 A;  4NDC A;  1IKU A;  3DVJ A;  5I8N A;  1XFU O;  1BF5 A;  2LV7 A;  2RGI A;  1J1D A;  1B7T Y;  2JC2 A;  1CDL A;  1U5I A;  2M0R A;  2F3Z A;  1YRT B;  2KYF A;  4GGF C;  3WHT B;  3CZT X;  3PAT A;  1J1E A;  1CDM A;  1XFV O;  3GK1 A;  1L7Z A;  2BCA A;  3VRP A;  1CKK A;  1M31 A;  1JWD A;  5CPV A;  3EK7 A;  2ZNE A;  2VRG A;  1TN4 A;  3TUY B;  1XYD A;  2K7D A;  2KAV A;  1CLB A;  4OKH A;  1SR6 C;  3KPX A;  1XK4 C;  2H2K A;  2BBN A;  1KK8 C;  1NUB A;  2LLT A;  3PAL A;  1BR1 B;  2LUC A;  1F4Q A;  2O5G A;  1KFU L;  3EKH A;  4DCK A;  3PM8 A;  1DVI A;  2MLE C;  3PSR A;  4YI8 A;  2JT3 A;  5GQQ C;  1KQM B;  2I7A A;  1BLQ A;  3OB1 B;  3VRR A;  1PVB A;  3AAK A;  2LNK A;  2BE6 A;  2OTG B;  1KFX S;  1IQ5 A;  2AMI A;  4QJ4 B;  3QRX A;  1EG3 A;  4MRX A;  3CS1 A;  1SW8 A;  2WC8 A;  2KQ6 A;  2E30 A;  1Y0V H;  4MLW A;  3D0Y B;  2CBL A;  1B8C A;  4ICB A;  3EK8 A;  1IJ6 A;  1TIZ A;  1V1G A;  1QX5 B;  1XFZ O;  3CGA A;  2H61 C;  4MBE A;  1M39 A;  1QXP A;  4C0L A;  1K2H A;  1DJI A;  1BT6 A;  1UHK A;  4N1F A;  3SIB A;  4GGF A;  1DJH A;  1PVA A;  1B47 A;  3I5F B;  2NCO A;  4GNK B;  1K9K A;  5AXI A;  2HQW A;  2P6B B;  4HSZ A;  2F3Y A;  4DUQ A;  1UP5 A;  2BEC A;  4M2Q A;  1LIN A;  1KWO C;  2JTT A;  2ZN9 A;  4PE4 A;  1GQM A;  1NCY A;  2FJU B;  4C0K A;  1Y1U A;  4IL1 A;  5JOL A;  3EK4 A;  1S6C A;  2LHL A;  5KSZ A;  1XK4 A;  1ZAC A;  1LKJ A;  4OV2 A;  3TZ1 A;  3DF0 A;  1UHI A;  2JXL A;  1S36 A;  1WDC B;  5G08 A;  2F33 A;  3SG2 A;  2CTN A;  1QV0 A;  4FQO A;  4AQJ A;  1F4O A;  2LHI A;  1CDN A;  2CT9 A;  1MHO A;  2EC6 C;  1B8R A;  1CB1 A;  5AAN A;  5IBW A;  5HLO A;  1KK7 Y;  1IGV A;  3SG3 A;  1JBA A;  3FS7 A;  1AHR A;  1B8L A;  3CR4 X;  2ZRS A;  4WQ2 A;  4JWQ A;  2JNF A;  2R2I A;  3WXA A;  1K8U A;  1OZO A;  1RFJ A;  1ODB A;  1IRJ A;  1B9A A;  5PAL A;  2JRF A;  5KU1 A;  2BKI B;  2LP2 A;  3RLZ A;  3TS5 C;  3VRQ A;  3M0W A;  1EJ3 A;  3JVT B;  2M1U A;  1K90 D;  1QVI Y;  1L2O B;  1MXE A;  4HRG A;  1UWO A;  1XO5 A;  1QX7 A;  1YTZ C;  4GUK A;  3LK1 A;  4NDD A;  4PE1 A;  4USL A;  1BG1 A;  1NWD A;  1DF0 B;  2H61 A;  2M1K B;  2JOJ A;  4A4B A;  1RK9 A;  1C7V A;  1UUR A;  2KAX A;  2K7B A;  3CWG A;  3SG7 A;  1YRU B;  2SCP A;  3HX4 A;  1SY9 A;  2JUL A;  1V1F A;  1QIW A;  1A75 A;  1DGU A;  3CR2 A;  3PLF B;  1A29 A;  2DOQ A;  1F8H A;  1NIW A;  4DRW A;  3NSL A;  2Q91 A;  2CXJ A;  2ZFD A;  1K93 D;  4MVF A;  4DS7 A;  1NCZ A;  2ISD A;  3LL8 B;  3BUO B;  5AEQ A;  2LCP A;  1TNP A;  1U5I B;  3I5G B;  2LC5 A;  1QS7 A;  4CLN A;  2KDH A;  1SL8 A;  1SCM C;  3I5I B;  4YGD B;  3KEV A;  1EXR A;  3NSI A;  4QJ5 B;  1DMO A;  2HF5 A;  1SPY A;  5CSI A;  3O2P A;  3EVR A;  2NXQ A;  1BU3 A;  1H8B A;  5B8I B;  1CFF A;  1BJF A;  1MXL C;  4P2Y B;  1S6I A;  2IS9 A;  1J7P A;  1K96 A;  2WOS A;  1DJW A;  1PSB A;  1NPQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...