4YGEB

Crystal structure of ergic-53/mcfd2, trigonal calcium-bound form 2
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
78
structure length
66
Chain Sequence
MSPQELQLHYFKMHDYDGNNLLDGLELSTAITHMSEDELINIIDGVLRDDDKNNDGYIDYAEFAKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Interaction mode of coagulation factors V and VIII with the cargo receptor MCFD2/ERGIC-53 complex
rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Protein ERGIC-53
total genus 27
structure length 66
sequence length 78
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2015-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4ygeB00
2LMVA 2FJUB 2ZNDA 1SL8A 1J7PA 1DTLA 1Y1XA 4DUQA 3RLZA 3VRRA 1EG3A 4ORCB 1UHIA 1BODA 1R2UA 3FWCA 1KFXS 1CFCA 1F55A 2HQWA 1J55A 2ZN9A 4CPVA 2Y1NA 4ZCUA 1K94A 2JT0A 1J1EA 5FYXA 4C0KA 2K7CA 1AHRA 2CBLA 3EKHA 4N5XA 2KYFA 1AJ5A 4YGDB 1QV1A 1KFUL 1W7JB 1F71A 1GGWA 1L2OB 1FI6A 1LVCD 1XFUO 2O5GA 2M8UA 1XFXO 1R6PA 1WRKA 2LCPA 5AFPA 1PVBA 4QJ4B 3BYAA 1XYDA 1XVJA 1JF0A 4YGEB 1TNXA 2K61A 1QX7A 2M7NA 4PE7A 3JTDC 2MBXA 2MA2A 1SR6C 4NDBA 1L7ZA 2LVIA 2P6BB 4I5NB 1B4CA 3EK8A 2Y5IA 1DVIA 1NX3A 2JU0A 1XO5A 3NSLA 4MBEA 1SPYA 1F70A 3BUWB 3KHEA 4M2PA 1BT6A 4DRWA 1OE9B 1SNLA 1G33A 2MRDA 4R1EA 3OB1B 2COLB 3KPXA 2AMIA 1BMOA 2QACA 1OMRA 3PFVA 1YUSA 4TNCA 1JBAA 1LXFC 1YTZC 2B1UA 1MF8B 2K7OA 2KI4C 1NWDA 5D69A 2L50A 3BQ3A 4OKHA 1B8RA 2EC6C 1AK8A 2F3YA 1S5GZ 1IGVA 3NSKA 2KYCA 1QATA 1TOPA 2LVJA 3LLEA 3EVUA 1WRZA 4XJKB 1M63B 2KBMA 2G2BA 2F2PA 3EKJA 1FF1A 2L0PA 1OOJA 1CLLA 1SR6B 3ZNIA 1Y1UA 2PASA 2I7AA 3PLFB 1QV0A 1TNPA 3CWGA 4HRGA 2KNEA 4MSPA 1NP8A 4WRIA 1W7IB 3C1VA 3OP0A 2DOQA 1J1DA 1NX1A 1KK7Y 1PSRA 5HKWA 1YUTA 3SG4A 4DIRA 1BU3A 2LMTA 2OTGC 5KTYA 1L2OC 2LNKA 2PALA 1IJ5A 1EG4A 1XFZO 3PATA 3A4UB 3SJSA 2G9BA 1S6IA 2KAXA 1Y6WA 2RGIA 1S6JA 1K90D 1QTXA 1DJXA 1AUIB 5AEQA 2JXLA 3JVTC 4XJKA 1NPQA 1SL7A 1YRUB 4BY4A 1CB1A 2BE4A 2KAYA 2KDHA 1K9UA 3K21A 4E68A 1S3PA 4PE0A 4GGFA 1RK9A 2KAVA 1CDMA 2BBMA 2JXCA 3EVVA 4D1EA 1CM4A 3SIAA 2HPSA 2EGDA 1YURA 1FI5A 1JWDA 4JQ0D 4C0JA 1ODBA 1UHJA 1DT7B 1PK0D 3WNXB 2JT3A 1BG1A 3BOWB 5DKNA 1MQ1A 1CLMA 1S36A 1UWOA 1S26D 2LLTA 1FBVA 3AAKA 3I5HC 4AQJA 1A75B 1YVLA 2KFHA 2AAOA 4HRHA 1M39A 2QPTA 1ALVA 1CDPA 1FW4A 1SBJA 2MAZA 4ORBB 3O6BA 3VRPA 4ZCVA 1IQ5A 4BY5A 3SG2A 1F54A 5CSIA 1AP4A 1A4PA 1JFKA 4PHNA 1WLMA 1UURA 2WORA 3TUYC 2TN4A 1IWQA 3TDUA 4I5KA 1CNPA 3KEVA 4GUKA 5CSNA 2M7LA 4N1GA 3DF0B 2KOTA 1N2DA 2PMYA 1QX5B 4JPZB 1IRJA 2BBNA 3JTDB 3CR4X 1YVHA 1UHKA 1NCZA 3CR2A 4A4BA 1K2HA 4U8DA 1BF5A 5JJGA 1JC2A 4NQGA 2BCBA 1G4YR 1B8CA 3MSEB 4GFTA 5G08A 1DJIA 2OTGB 3I5HB 3GK4X 2O60A 1A2XA 1J7OA 3SG5A 5D7FA 3FIAA 1E8AA 3WXAA 1NCXA 2JOJA 1LA3A 2NXQA 2WNDA 3PN7C 1B47A 2LUXA 4GGNA 3A8RA 4CFRA 1RJVA 2JULA 1QXPA 4MN0A 1WRLA 1PRWA 1Y0VH 1QASA 5ER5A 1KFUS 1PVAA 1XK4C 4OR9B 1BR4B 2Y4QA 1JSAA 4PALA 2GGZA 2F3ZA 1BLQA 1A75A 2L4HA 1CM1A 1ZFSA 2BECA 3I5GC 2K2AA 1U5IB 2JPTA 3LL8B 2JT8A 5HKZA 2MJWB 1PSBA 3OX6A 2BCXA 3I5IB 2NCOA 2K7BA 1KSMA 2KHNA 4PHMA 3VRQA 1FPWA 2WCBA 5AANA 2LUCA 1RTP1 3AKBA 1YUUA 2CTNA 3O78A 2JNXA 3SIBA 1QLKA 1IH0A 2KI6D 3BUXB 4YRUA 5B8IB 3VRNA 2HF5A 1XA5A 3NSOA 2M9GA 1ALWA 1S5GY 2K2FA 3D0YB 2SCPA 1DGUA 1LKJA 2OS8B 3I5FB 2L51A 3CLNA 3KF9A 1NIWA 2M97A 1N0YA 2LV7A 5HKYA 1J7QA 4M2QA 1SK6D 4PDZA 2KSPA 4USLA 2LE9B 1GGZA 1RECA 1C7WA 1XFVO 3TUYB 1F4QA 5DKQA 3H4SE 1DJWA 2M49B 5CPVA 5I8NA 2L98A 4PE1A 4YGCB 4MVFA 1K95A 1UUSA 1TIZA 1TTXA 2LLUA 1DGVA 2OPOA 4AOMA 1IKUA 2L4IA 1V1GA 3OX5A 1CMGA 2M1UA 3LCPC 5KSZA 2ISDA 1EH2A 3NXAA 1A03A 1OMVA 4YI8A 3EVRA 3HCMA 1B8LA 2KFFA 4CIDA 1S1EA 3LK0A 4UPGA 2EHBA 4GGFC 1CLBA 2FCEA 5GQQC 4A4CA 1MWNA 1RFJA 2A4JA 2BL0C 4ORAB 4ETOA 1SCVA 5ER4X 3TZ1A 3DVMA 4JWQA 1KWOB 3NSIA 1KK7Z 2I18A 1XFWO 4PHKA 1EL4A 1IG5A 1SCMB 3QRXA 4AQIA 3DD4A 1DJZA 3OHMB 2PSRA 4CLNA 3D0YA 2VRGA 2BE6A 1B7TY 3BUNB 2FOTA 4NDCA 5BPJA 5HYDA 1QS7A 4HSZA 1SL9A 1DJYA 1NYAA 1UHNA 5CSJA 1OQPA 2KQYA 1CDLA 5DKRA 2M29A 4GNKB 1TNQA 1M46A 1ZOTB 2Q4UA 3JVTB 1TRFA 2E6WA 3CGAA 4OV2A 2KBIA 3BOWA 4OVNF 4I5LB 1QIWA 1BOCA 2LVVA 2NCPA 1EXRA 3BUOB 5KU1A 1IJ6A 1SCMC 4MEWA 1HQVA 1ZMZA 4N1FA 4YGAA 1QVIZ 1DF0B 2F8PA 3AKAA 1KFXL 3SG3A 1BJFA 3VROA 3CZTX 1KQVA 1Q80A 2Y1MA 2MHHA 1AJ4A 3I5IC 1OSAA 1F8HA 1KWOC 2M1KB 3IQQA 3TS5C 1EJ3A 1K9PA 1G8IA 3GK2A 5I2QA 5TNCA 1K8UA 1RROA 4MRXA 1S6CA 3BXKA 4PHJA 2HQ8A 3KO0A 1SW8A 1OMDA 1UP5A 2JWWA 2M0RA 1YR5A 2I94A 1JUOA 2LANA 2OS8C 2CT9A 5AERA 1SMGA 3FS7A 2ZN8A 2WCFA 4OCIA 5I2OA 2ZRTA 3PN7B 1QX2A 2KI4B 1AVSA 2AUCA 4XYNA 3SG6A 2JNFA 4CFQA 5IBWA 1CFDA 1WLZA 2LAPA 4YBHB 2WOSA 1C07A 4GPLB 3GK1A 3GOFA 1B1GA 1OZSA 1SY9A 4GBAA 1MXLC 2GV5A 1TCOB 2KQ6A 2CCMA 3WHUB 3I5GB 3VGOA 1GQMA 2LP2A 5HLVA 1XK4A 1JF2A 3LK1A 3ZWHA 2JTZA 2KFGA 1CTRA 4MZJA 4C0LA 4QJ3B 2R2IA 1MHOA 4MZKA 3F45A 3CS1A 2HETA 4HREE 1BR1B 2CNPA 3O4YA 1J7RA 2LVKA 2IS9A 5HLOA 1QIVA 1HT9A 2CXJA 1U5IA 3EK7A 2WCEA 1DF0A 1YX7A 1TN4A 1ZUZA 2EC6B 2SASA 4DCKA 2NLNA 2M3WA 2GGMA 4FQOA 1H8BA 1DJHA 1PALA 1CDNA 4GAOA 2LMUA 4NDDA 3AAJA 4YGBB 2LC5A 5PALA 4YI9A 2ZFDA 1KSOA 1PULA 2MLEC 4PCWA 4F0ZB 1K93D 2K8MB 5I2LA 1K9KA 2F2OA 2I2RE 3O2PA 1NCYA 3CTNA 2L5XB 2F33A 2LP3A 2LLSA 4WQ3A 4DS7A 1UHHA 2V53A 3DVKA 1KK8C 2JQ6A 4FTGA 1QLSA 2D8NA 1KQMC 3DVEA 1SYMA 1Y1AA 1ZACA 3EK4A 1LA0A 3CR5X 1MR8A 1VRKA 3ICBA 1QJTA 1C7VA 1CKKA 2MLFC 3TS5B 2BCAA 3I5FC 5J3XA 5CSFA 2L2EA 3SG7A 3TDZA 5JOLA 1NX2A 2K7DA 3TDIA 4P5OE 1CFFA 2ZNEA 2BKHB 4WQ2A 3FWBA 1KCYA 1M45A 2BKIB 1WDCB 2JTTA 4M2OA 1WDCC 5AXIA 2H61C 2H61A 2H2KA 2E30A 4IL1A 1CMFA 2FCDA 1QVIY 2LM5A 1LINA 2BL0B 1H4BA 1GJYA 1TCFA 2JC2A 2ZKMX 1RWYA 3D10A 1IQ3A 1K96A 2LHIA 1X02A 1TNWA 4QJ5B 4ICBA 3DF0A 2KI6C 1M31A 3E3RA 1F4OA 1D1OA 3HX4A 3BUMB 1KK8B 4L9MA 1V1FA 1SRAA 3WHTB 1NSHA 3DVJA 1NX0A 4MZLA 1CFPA 1KQMB 2LHLA 1WY9A 2Q91A 1B7TZ 1JFJA 4I5JA 2NZ0A 5F6TA 3PM8A 4MLWA 1DJGA 1B9AA 3PALA 1YRTB 4MRYA 1XFYO 1A29A 3RM1A 2KGBC 3M0WA 1SKTA 4PE4A 2JRFA 2KGRA 2WC8A 1NUBA 1OZOA 4P2YB 4Q04A 2JZIA 2PRUA 1MUXA 1MXEA 2K0JA 3OB2B 5K89A 3IF7A 1N65A 2ZRSA 1DMOA 2PVBA 1YX8A 3IQOA 3PSRA
chains in the Genus database with same CATH superfamily
4OZDA 2LMVA 2FJUB 4PT1A 2ZNDA 1SL8A 1J7PA 1DTLA 1Y1XA 4DUQA 3RLZA 2KLEA 3VRRA 3D77A 1EG3A 4ORCB 1UHIA 1BODA 1R2UA 3FWCA 1KFXS 1W9ZA 1CFCA 1F55A 2HQWA 1J55A 2ZN9A 4CPVA 2Y1NA 4ZCUA 1K94A 2JT0A 1J1EA 3CZ1A 5FYXA 4C0KA 2K7CA 1AHRA 2CBLA 3EKHA 4N5XA 2KYFA 1AJ5A 4YGDB 1QV1A 1KFUL 3NHIA 5FI2A 1W7JB 1F71A 1GGWA 1L2OB 1FI6A 1LVCD 4INXA 1XFUO 2O5GA 2M8UA 1XFXO 1Z4HA 1R6PA 1WRKA 2LCPA 5AFPA 1PVBA 4QJ4B 3CYZA 2WC5A 3BYAA 1XYDA 1XVJA 1JF0A 4YGEB 1TNXA 2K61A 1QX7A 2M7NA 4PE7A 3JTDC 2MBXA 2MA2A 1SR6C 3S0EA 4NDBA 1L7ZA 2LVIA 2P6BB 4I5NB 1B4CA 3EK8A 2Y5IA 1DVIA 3DZTA 1NX3A 3L4LA 3QMEA 2JU0A 1XO5A 3CABA 3S0AA 3NSLA 4MBEA 1SPYA 1F70A 3BUWB 3KHEA 4M2PA 1BT6A 4DRWA 1OE9B 1SNLA 1G33A 2MRDA 4R1EA 3OB1B 2COLB 3KPXA 2AMIA 1BMOA 2QACA 1OMRA 3PFVA 1YUSA 4TNCA 2K60A 2L2CA 1JBAA 1LXFC 1YTZC 2B1UA 1MF8B 2K7OA 2KI4C 1NWDA 5D69A 2QEHA 3PM2A 2L50A 3BQ3A 1TUZA 4OKHA 1B8RA 2EC6C 1AK8A 2F3YA 1S5GZ 1IGVA 3NSKA 2KYCA 1QATA 1TOPA 3FE8A 2LVJA 3LLEA 3EVUA 1WRZA 4XJKB 1M63B 2KBMA 2G2BA 2F2PA 3EKJA 1FF1A 2L0PA 1OOJA 3FE9A 1CLLA 1SR6B 3ZNIA 1Y1UA 2PASA 2I7AA 3PLFB 1QV0A 1TNPA 3CDNA 3CWGA 4HRGA 2KNEA 4MSPA 1NP8A 4WRIA 1W7IB 3C1VA 3OP0A 2DOQA 1J1DA 1NX1A 1KK7Y 1PSRA 3RZSA 5HKWA 1YUTA 3SG4A 4DIRA 1BU3A 2LMTA 2OTGC 5KTYA 1L2OC 2LNKA 2PALA 1IJ5A 1EG4A 1XFZO 3PATA 3A4UB 3SJSA 2G9BA 1S6IA 2KAXA 5FI7A 1Y6WA 2RGIA 1S6JA 1K90D 1QTXA 1DJXA 1AUIB 5AEQA 2JXLA 3JVTC 4XJKA 1NPQA 1SL7A 1YRUB 4BY4A 1CB1A 2BE4A 2KAYA 2KDHA 1K9UA 1DELA 3K21A 1S3PA 5FI6A 4E68A 4PE0A 2KLDA 1RK9A 2KAVA 1CDMA 2BBMA 2JXCA 3EVVA 4GGFA 1CM4A 3SIAA 2HPSA 1OOFA 2EGDA 1YURA 1FI5A 1JWDA 4JQ0D 4C0JA 1ODBA 1UHJA 1DT7B 1PK0D 3WNXB 3SS4A 2JT3A 1BG1A 3BOWB 5DKNA 1MQ1A 5D3OA 1CLMA 1S36A 1UWOA 1S26D 2LLTA 1FBVA 2WCJA 3AAKA 3I5HC 1A75B 4AQJA 1OOGA 3BFAA 1YVLA 2KFHA 2AAOA 4HRHA 4F7FA 1QWVA 1M39A 3DY9A 2QPTA 1ALVA 1CDPA 1FW4A 1SBJA 2MAZA 4ORBB 3BFHA 3O6BA 3VRPA 4ZCVA 1IQ5A 4BY5A 3SG2A 1F54A 5CSIA 1AP4A 1A4PA 1JFKA 4PHNA 1WLMA 1UURA 2WORA 3TUYC 2TN4A 1IWQA 3TDUA 4I5KA 1CNPA 3KEVA 4GUKA 5CSNA 2M7LA 2H8VA 4INWA 4N1GA 3DF0B 2KPHA 2KOTA 1N2DA 2PMYA 1QX5B 4JPZB 2PQLA 1IRJA 2BBNA 3JTDB 3CR4X 1YVHA 1T14A 1UHKA 1NCZA 1TWOA 3CR2A 4A4BA 1K2HA 4U8DA 1IIOA 2WC6A 3B86A 1BF5A 5JJGA 1JC2A 1ORGA 4NQGA 2BCBA 1G4YR 1B8CA 3MSEB 4GFTA 3D76A 3VB1A 1OW4A 5G08A 1DJIA 2OTGB 3I5HB 4JD9A 3GK4X 2O60A 1A2XA 1J7OA 3SG5A 5D7FA 3FIAA 1E8AA 3WXAA 1NCXA 2JOJA 1LA3A 2NXQA 2WNDA 3PN7C 3SS5A 1B47A 2LUXA 4GGNA 3A8RA 4CFRA 5DICA 1RJVA 2JULA 1QXPA 4MN0A 3PJIA 1WRLA 1PRWA 1Y0VH 1QASA 5ER5A 3L47A 1KFUS 1PVAA 1XK4C 4OR9B 1BR4B 2Y4QA 1JSAA 4PALA 2GGZA 2F3ZA 1BLQA 1A75A 2L4HA 1CM1A 1ZFSA 2BECA 3I5GC 2K2AA 1U5IB 2JPTA 3LL8B 3N7HA 3V2LA 2JT8A 5HKZA 1DEKA 2MJWB 1PSBA 3OX6A 2BCXA 3I5IB 2NCOA 3OGNA 2K7BA 1KSMA 2KHNA 1TUJA 3IVTA 4PHMA 2WCBA 3VRQA 5AANA 2LUCA 1FPWA 1RTP1 3AKBA 1YUUA 2CTNA 3O78A 2JNXA 3SIBA 1QLKA 1IH0A 2KI6D 3BUXB 4YRUA 5B8IB 3R1PA 2HF5A 3VRNA 1XA5A 3NSOA 2QEBA 2M9GA 1ALWA 1S5GY 2K2FA 3D0YB 2SCPA 1DGUA 1LKJA 2OS8B 3EG5B 3I5FB 2L51A 3CLNA 3KF9A 1NIWA 2PYQA 2M97A 1N0YA 2LV7A 5HKYA 1J7QA 2WCLA 2ERBA 4M2QA 1SK6D 2GTEA 2KSPA 4PDZA 4USLA 2LE9B 1GGZA 1RECA 1C7WA 1XFVO 3TUYB 1F4QA 5DKQA 1C3YA 3H4SE 1DJWA 2M49B 5CPVA 5I8NA 2L98A 4PE1A 4YGCB 4MVFA 1K95A 1UUSA 1TIZA 1TTXA 2LLUA 1GM0A 1DGVA 2OPOA 2WCHA 4AOMA 3O4XA 3S0GA 1IKUA 2L4IA 1V1GA 3R1VA 3OX5A 1CMGA 5I94A 2M1UA 3LCPC 5KSZA 2ISDA 1EH2A 3NXAA 1A03A 1OMVA 4YI8A 3EVRA 3HCMA 1B8LA 2KFFA 4CIDA 1S1EA 3LK0A 4UPGA 2EHBA 4GGFC 1CLBA 2FCEA 2FJYA 4JKTA 2JPOA 3FE6A 1MWNA 5GQQC 1RFJA 4A4CA 2A4JA 2BL0C 3Q8IA 4ORAB 4ETOA 1SCVA 5ER4X 3TZ1A 3DVMA 4JWQA 1KWOB 3CZ2A 3NSIA 1KK7Z 1C3ZA 2I18A 3BFBA 1XFWO 4PHKA 1EL4A 1IG5A 1SCMB 3B7AA 3NGVA 3QRXA 4AQIA 3DD4A 1DJZA 1OOHA 2PSRA 3OHMB 4CLNA 3D0YA 2VRGA 2BE6A 1B7TY 3BUNB 2FOTA 4NDCA 5BPJA 5HYDA 1QS7A 4HSZA 1SL9A 1DJYA 1NYAA 1UHNA 5CSJA 3B6XA 1OQPA 2KQYA 1CDLA 5DKRA 2M29A 4GNKB 1TNQA 1M46A 1ZOTB 2Q4UA 3JVTB 1TRFA 2E6WA 3CGAA 4OV2A 2KBIA 3BOWA 4OVNF 4I5LB 1QIWA 1BOCA 2LVVA 2NCPA 1EXRA 3BUOB 1LS8A 5KU1A 1IJ6A 1SCMC 4MEWA 1HQVA 1ZMZA 4N1FA 4D1EA 4YGAA 3R1OA 1QVIZ 1DF0B 2F8PA 3AKAA 1KFXL 3SG3A 1BJFA 3VROA 3CZTX 1KQVA 1Q80A 2Y1MA 2MHHA 1AJ4A 3I5IC 1OSAA 1F8HA 1KWOC 2M1KB 4IJ7A 2BAPA 3IQQA 3TS5C 1EJ3A 1K9PA 2QEVA 1G8IA 3GK2A 5I2QA 1SSEB 5TNCA 1K8UA 3DYEA 3S0FA 1RROA 2QDIA 4MRXA 1S6CA 3BXKA 4PHJA 2HQ8A 3KO0A 1SW8A 1OMDA 1UP5A 2JWWA 2M0RA 1YR5A 3CZ0A 2I94A 1JUOA 2LANA 2OS8C 2CT9A 5AERA 1SMGA 3FS7A 3K1EA 2ZN8A 4FQTA 2WCFA 4OCIA 5I2OA 2ZRTA 3NHTA 3PN7B 1QX2A 2KI4B 1AVSA 2AUCA 4XYNA 3D75A 3SG6A 2JNFA 4CFQA 5IBWA 1CFDA 1WLZA 2LAPA 4YBHB 2WOSA 1C07A 4GPLB 3GK1A 3GOFA 1B1GA 1OZSA 1SY9A 4GBAA 1MXLC 2GV5A 1TCOB 2KQ6A 2CCMA 3WHUB 3I5GB 1OOIX 3SS3A 3VGOA 1GQMA 2LP2A 3B88A 1XK4A 5HLVA 1JF2A 3LK1A 3ZWHA 2JTZA 2KFGA 1CTRA 4MZJA 4C0LA 4KYNA 2R2IA 4QJ3B 1MHOA 4MZKA 3F45A 3CS1A 2HETA 4HREE 1BR1B 2CNPA 3S0DA 3O4YA 1J7RA 2LVKA 2IS9A 2L5YA 5HLOA 1QIVA 1HT9A 2P70A 2CXJA 1U5IA 3EK7A 2WCEA 1DF0A 1YX7A 1TN4A 1ZUZA 2EC6B 2SASA 4DCKA 2NLNA 2M3WA 2GGMA 4FQOA 1H8BA 1DJHA 1PALA 1CDNA 4GAOA 2LMUA 4NDDA 3AAJA 4YGBB 2LC5A 5PALA 4YI9A 2ZFDA 3UNWA 1KSOA 1PULA 2MLEC 4PCWA 4F0ZB 1K93D 2K8MB 3DXLA 5I2LA 1K9KA 2F2OA 2I2RE 3O2PA 1NCYA 3CTNA 2L5XB 2F33A 2LP3A 3BJHA 2LLSA 4WQ3A 4DS7A 1UHHA 2V53A 3L4AA 3DVKA 2BNXA 1KK8C 2JQ6A 4FTGA 1QLSA 2D8NA 1KQMC 3DVEA 1SYMA 1Y1AA 1ZACA 3EK4A 1LA0A 3CR5X 1MR8A 1VRKA 3ICBA 1QJTA 1C7VA 1CKKA 2MLFC 2YGUA 2BCAA 3TS5B 3I5FC 5J3XA 5CSFA 2L2EA 3SG7A 3D78A 3D73A 3TDZA 5JOLA 1NX2A 2K7DA 3TDIA 4P5OE 1CFFA 2ZNEA 2BKHB 3S0BA 4WQ2A 2QEOA 3FWBA 1KCYA 2WCKA 1M45A 2BKIB 3UO9A 1WDCB 2JTTA 4M2OA 1WDCC 5AXIA 2H61C 2H61A 2H2KA 2E30A 1DC1A 4IL1A 1CMFA 5EL2A 2FCDA 1QVIY 2LM5A 1LINA 2BL0B 3OBVA 1H4BA 1GJYA 1TCFA 2JC2A 3B87A 2ZKMX 3D74A 1RWYA 3D10A 1IQ3A 1K96A 2LHIA 1X02A 1TNWA 4QJ5B 5HL1A 1XFRA 4ICBA 3DF0A 2KI6C 1M31A 3E3RA 2WCMA 1F4OA 1D1OA 3HX4A 3BUMB 1KK8B 4L9MA 1V1FA 1SRAA 3WHTB 1NSHA 1P28A 1NX0A 3DVJA 4MZLA 1Z2CB 1CFPA 1KQMB 2LHLA 1WY9A 2Q91A 1B7TZ 1JFJA 4I5JA 2NZ0A 5F6TA 3PM8A 4MLWA 1DJGA 1B9AA 3PALA 1DQEA 1YRTB 1XFYO 1A29A 4MRYA 2KGBC 3RM1A 3M0WA 1SKTA 4PE4A 2JRFA 2KGRA 3R72A 2P71A 2WC8A 1NUBA 1OZOA 4P2YB 4Q04A 2JZIA 2PRUA 1MUXA 1MXEA 2K0JA 3OB2B 5K89A 3IF7A 1N65A 2ZRSA 1DMOA 2PVBA 1YX8A 3IQOA 3PSRA
chains in the Genus database with same CATH topology
2LMVA 2FJUB 2ZNDA 1SL8A 1J7PA 1DTLA 1Y1XA 4DUQA 3RLZA 3VRRA 1EG3A 4ORCB 1UHIA 1BODA 1R2UA 3FWCA 1KFXS 1CFCA 1F55A 2HQWA 1J55A 2ZN9A 4CPVA 2Y1NA 4ZCUA 1K94A 2JT0A 1J1EA 5FYXA 4C0KA 2K7CA 1AHRA 2CBLA 3EKHA 4N5XA 2KYFA 1AJ5A 4YGDB 1QV1A 1KFUL 1W7JB 1F71A 1GGWA 1L2OB 1FI6A 1LVCD 1XFUO 2O5GA 2M8UA 1XFXO 1R6PA 1WRKA 2LCPA 5AFPA 1PVBA 4QJ4B 3BYAA 1XYDA 1XVJA 1JF0A 4YGEB 1TNXA 2K61A 1QX7A 2M7NA 4PE7A 3JTDC 2MBXA 2MA2A 1SR6C 4NDBA 1L7ZA 2LVIA 2P6BB 4I5NB 1B4CA 3EK8A 2Y5IA 1DVIA 1NX3A 2JU0A 1XO5A 3NSLA 4MBEA 1SPYA 1F70A 3BUWB 3KHEA 4M2PA 1BT6A 4DRWA 1OE9B 1SNLA 1G33A 2MRDA 4R1EA 3OB1B 2COLB 3KPXA 2AMIA 1BMOA 2QACA 1OMRA 3PFVA 1YUSA 4TNCA 1JBAA 1LXFC 1YTZC 2B1UA 1MF8B 2K7OA 2KI4C 1NWDA 5D69A 2L50A 3BQ3A 4OKHA 1B8RA 2EC6C 1AK8A 2F3YA 1S5GZ 1IGVA 3NSKA 2KYCA 1QATA 1TOPA 2LVJA 3LLEA 3EVUA 1WRZA 4XJKB 1M63B 2KBMA 2G2BA 2F2PA 3EKJA 1FF1A 2L0PA 1OOJA 1CLLA 1SR6B 3ZNIA 1Y1UA 2PASA 2I7AA 3PLFB 1QV0A 1TNPA 3CWGA 4HRGA 2KNEA 4MSPA 1NP8A 4WRIA 1W7IB 3C1VA 3OP0A 2DOQA 1J1DA 1NX1A 1KK7Y 1PSRA 5HKWA 1YUTA 3SG4A 4DIRA 1BU3A 2LMTA 2OTGC 5KTYA 1L2OC 2LNKA 2PALA 1IJ5A 1EG4A 1XFZO 3PATA 3A4UB 3SJSA 2G9BA 1S6IA 2KAXA 1Y6WA 2RGIA 1S6JA 1K90D 1QTXA 1DJXA 1AUIB 5AEQA 2JXLA 3JVTC 4XJKA 1NPQA 1SL7A 1YRUB 4BY4A 1CB1A 2BE4A 2KAYA 2KDHA 1K9UA 3K21A 4E68A 1S3PA 4PE0A 4GGFA 1RK9A 2KAVA 1CDMA 2BBMA 2JXCA 3EVVA 4D1EA 1CM4A 3SIAA 2HPSA 2EGDA 1YURA 1FI5A 1JWDA 4JQ0D 4C0JA 1ODBA 1UHJA 1DT7B 1PK0D 3WNXB 2JT3A 1BG1A 3BOWB 5DKNA 1MQ1A 1CLMA 1S36A 1UWOA 1S26D 2LLTA 1FBVA 3AAKA 3I5HC 4AQJA 1A75B 1YVLA 2KFHA 2AAOA 4HRHA 1M39A 2QPTA 1ALVA 1CDPA 1FW4A 1SBJA 2MAZA 4ORBB 3O6BA 3VRPA 4ZCVA 1IQ5A 4BY5A 3SG2A 1F54A 5CSIA 1AP4A 1A4PA 1JFKA 4PHNA 1WLMA 1UURA 2WORA 3TUYC 2TN4A 1IWQA 3TDUA 4I5KA 1CNPA 3KEVA 4GUKA 5CSNA 2M7LA 4N1GA 3DF0B 2KOTA 1N2DA 2PMYA 1QX5B 4JPZB 1IRJA 2BBNA 3JTDB 3CR4X 1YVHA 1UHKA 1NCZA 3CR2A 4A4BA 1K2HA 4U8DA 1BF5A 5JJGA 1JC2A 4NQGA 2BCBA 1G4YR 1B8CA 3MSEB 4GFTA 5G08A 1DJIA 2OTGB 3I5HB 3GK4X 2O60A 1A2XA 1J7OA 3SG5A 5D7FA 3FIAA 1E8AA 3WXAA 1NCXA 2JOJA 1LA3A 2NXQA 2WNDA 3PN7C 1B47A 2LUXA 4GGNA 3A8RA 4CFRA 1RJVA 2JULA 1QXPA 4MN0A 1WRLA 1PRWA 1Y0VH 1QASA 5ER5A 1KFUS 1PVAA 1XK4C 4OR9B 1BR4B 2Y4QA 1JSAA 4PALA 2GGZA 2F3ZA 1BLQA 1A75A 2L4HA 1CM1A 1ZFSA 2BECA 3I5GC 2K2AA 1U5IB 2JPTA 3LL8B 2JT8A 5HKZA 2MJWB 1PSBA 3OX6A 2BCXA 3I5IB 2NCOA 2K7BA 1KSMA 2KHNA 4PHMA 3VRQA 1FPWA 2WCBA 5AANA 2LUCA 1RTP1 3AKBA 1YUUA 2CTNA 3O78A 2JNXA 3SIBA 1QLKA 1IH0A 2KI6D 3BUXB 4YRUA 5B8IB 3VRNA 2HF5A 1XA5A 3NSOA 2M9GA 1ALWA 1S5GY 2K2FA 3D0YB 2SCPA 1DGUA 1LKJA 2OS8B 3I5FB 2L51A 3CLNA 3KF9A 1NIWA 2M97A 1N0YA 2LV7A 5HKYA 1J7QA 4M2QA 1SK6D 4PDZA 2KSPA 4USLA 2LE9B 1GGZA 1RECA 1C7WA 1XFVO 3TUYB 1F4QA 5DKQA 3H4SE 1DJWA 2M49B 5CPVA 5I8NA 2L98A 4PE1A 4YGCB 4MVFA 1K95A 1UUSA 1TIZA 1TTXA 2LLUA 1DGVA 2OPOA 4AOMA 1IKUA 2L4IA 1V1GA 3OX5A 1CMGA 2M1UA 3LCPC 5KSZA 2ISDA 1EH2A 3NXAA 1A03A 1OMVA 4YI8A 3EVRA 3HCMA 1B8LA 2KFFA 4CIDA 1S1EA 3LK0A 4UPGA 2EHBA 4GGFC 1CLBA 2FCEA 5GQQC 4A4CA 1MWNA 1RFJA 2A4JA 2BL0C 4ORAB 4ETOA 1SCVA 5ER4X 3TZ1A 3DVMA 4JWQA 1KWOB 3NSIA 1KK7Z 2I18A 1XFWO 4PHKA 1EL4A 1IG5A 1SCMB 3QRXA 4AQIA 3DD4A 1DJZA 3OHMB 2PSRA 4CLNA 3D0YA 2VRGA 2BE6A 1B7TY 3BUNB 2FOTA 4NDCA 5BPJA 5HYDA 1QS7A 4HSZA 1SL9A 1DJYA 1NYAA 1UHNA 5CSJA 1OQPA 2KQYA 1CDLA 5DKRA 2M29A 4GNKB 1TNQA 1M46A 1ZOTB 2Q4UA 3JVTB 1TRFA 2E6WA 3CGAA 4OV2A 2KBIA 3BOWA 4OVNF 4I5LB 1QIWA 1BOCA 2LVVA 2NCPA 1EXRA 3BUOB 5KU1A 1IJ6A 1SCMC 4MEWA 1HQVA 1ZMZA 4N1FA 4YGAA 1QVIZ 1DF0B 2F8PA 3AKAA 1KFXL 3SG3A 1BJFA 3VROA 3CZTX 1KQVA 1Q80A 2Y1MA 2MHHA 1AJ4A 3I5IC 1OSAA 1F8HA 1KWOC 2M1KB 3IQQA 3TS5C 1EJ3A 1K9PA 1G8IA 3GK2A 5I2QA 5TNCA 1K8UA 1RROA 4MRXA 1S6CA 3BXKA 4PHJA 2HQ8A 3KO0A 1SW8A 1OMDA 1UP5A 2JWWA 2M0RA 1YR5A 2I94A 1JUOA 2LANA 2OS8C 2CT9A 5AERA 1SMGA 3FS7A 2ZN8A 2WCFA 4OCIA 5I2OA 2ZRTA 3PN7B 1QX2A 2KI4B 1AVSA 2AUCA 4XYNA 3SG6A 2JNFA 4CFQA 5IBWA 1CFDA 1WLZA 2LAPA 4YBHB 2WOSA 1C07A 4GPLB 3GK1A 3GOFA 1B1GA 1OZSA 1SY9A 4GBAA 1MXLC 2GV5A 1TCOB 2KQ6A 2CCMA 3WHUB 3I5GB 3VGOA 1GQMA 2LP2A 5HLVA 1XK4A 1JF2A 3LK1A 3ZWHA 2JTZA 2KFGA 1CTRA 4MZJA 4C0LA 4QJ3B 2R2IA 1MHOA 4MZKA 3F45A 3CS1A 2HETA 4HREE 1BR1B 2CNPA 3O4YA 1J7RA 2LVKA 2IS9A 5HLOA 1QIVA 1HT9A 2CXJA 1U5IA 3EK7A 2WCEA 1DF0A 1YX7A 1TN4A 1ZUZA 2EC6B 2SASA 4DCKA 2NLNA 2M3WA 2GGMA 4FQOA 1H8BA 1DJHA 1PALA 1CDNA 4GAOA 2LMUA 4NDDA 3AAJA 4YGBB 2LC5A 5PALA 4YI9A 2ZFDA 1KSOA 1PULA 2MLEC 4PCWA 4F0ZB 1K93D 2K8MB 5I2LA 1K9KA 2F2OA 2I2RE 3O2PA 1NCYA 3CTNA 2L5XB 2F33A 2LP3A 2LLSA 4WQ3A 4DS7A 1UHHA 2V53A 3DVKA 1KK8C 2JQ6A 4FTGA 1QLSA 2D8NA 1KQMC 3DVEA 1SYMA 1Y1AA 1ZACA 3EK4A 1LA0A 3CR5X 1MR8A 1VRKA 3ICBA 1QJTA 1C7VA 1CKKA 2MLFC 3TS5B 2BCAA 3I5FC 5J3XA 5CSFA 2L2EA 3SG7A 3TDZA 5JOLA 1NX2A 2K7DA 3TDIA 4P5OE 1CFFA 2ZNEA 2BKHB 4WQ2A 3FWBA 1KCYA 1M45A 2BKIB 1WDCB 2JTTA 4M2OA 1WDCC 5AXIA 2H61C 2H61A 2H2KA 2E30A 4IL1A 1CMFA 2FCDA 1QVIY 2LM5A 1LINA 2BL0B 1H4BA 1GJYA 1TCFA 2JC2A 2ZKMX 1RWYA 3D10A 1IQ3A 1K96A 2LHIA 1X02A 1TNWA 4QJ5B 4ICBA 3DF0A 2KI6C 1M31A 3E3RA 1F4OA 1D1OA 3HX4A 3BUMB 1KK8B 4L9MA 1V1FA 1SRAA 3WHTB 1NSHA 3DVJA 1NX0A 4MZLA 1CFPA 1KQMB 2LHLA 1WY9A 2Q91A 1B7TZ 1JFJA 4I5JA 2NZ0A 5F6TA 3PM8A 4MLWA 1DJGA 1B9AA 3PALA 1YRTB 4MRYA 1XFYO 1A29A 3RM1A 2KGBC 3M0WA 1SKTA 4PE4A 2JRFA 2KGRA 2WC8A 1NUBA 1OZOA 4P2YB 4Q04A 2JZIA 2PRUA 1MUXA 1MXEA 2K0JA 3OB2B 5K89A 3IF7A 1N65A 2ZRSA 1DMOA 2PVBA 1YX8A 3IQOA 3PSRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LMV A;  2FJU B;  2ZND A;  1SL8 A;  1J7P A;  1DTL A;  1Y1X A;  4DUQ A;  3RLZ A;  3VRR A;  1EG3 A;  4ORC B;  1UHI A;  1BOD A;  1R2U A;  3FWC A;  1KFX S;  1CFC A;  1F55 A;  2HQW A;  1J55 A;  2ZN9 A;  4CPV A;  2Y1N A;  4ZCU A;  1K94 A;  2JT0 A;  1J1E A;  5FYX A;  4C0K A;  2K7C A;  1AHR A;  2CBL A;  3EKH A;  4N5X A;  2KYF A;  1AJ5 A;  4YGD B;  1QV1 A;  1KFU L;  1W7J B;  1F71 A;  1GGW A;  1L2O B;  1FI6 A;  1LVC D;  1XFU O;  2O5G A;  2M8U A;  1XFX O;  1R6P A;  1WRK A;  2LCP A;  5AFP A;  1PVB A;  4QJ4 B;  3BYA A;  1XYD A;  1XVJ A;  1JF0 A;  4YGE B;  1TNX A;  2K61 A;  1QX7 A;  2M7N A;  4PE7 A;  3JTD C;  2MBX A;  2MA2 A;  1SR6 C;  4NDB A;  1L7Z A;  2LVI A;  2P6B B;  4I5N B;  1B4C A;  3EK8 A;  2Y5I A;  1DVI A;  1NX3 A;  2JU0 A;  1XO5 A;  3NSL A;  4MBE A;  1SPY A;  1F70 A;  3BUW B;  3KHE A;  4M2P A;  1BT6 A;  4DRW A;  1OE9 B;  1SNL A;  1G33 A;  2MRD A;  4R1E A;  3OB1 B;  2COL B;  3KPX A;  2AMI A;  1BMO A;  2QAC A;  1OMR A;  3PFV A;  1YUS A;  4TNC A;  1JBA A;  1LXF C;  1YTZ C;  2B1U A;  1MF8 B;  2K7O A;  2KI4 C;  1NWD A;  5D69 A;  2L50 A;  3BQ3 A;  4OKH A;  1B8R A;  2EC6 C;  1AK8 A;  2F3Y A;  1S5G Z;  1IGV A;  3NSK A;  2KYC A;  1QAT A;  1TOP A;  2LVJ A;  3LLE A;  3EVU A;  1WRZ A;  4XJK B;  1M63 B;  2KBM A;  2G2B A;  2F2P A;  3EKJ A;  1FF1 A;  2L0P A;  1OOJ A;  1CLL A;  1SR6 B;  3ZNI A;  1Y1U A;  2PAS A;  2I7A A;  3PLF B;  1QV0 A;  1TNP A;  3CWG A;  4HRG A;  2KNE A;  4MSP A;  1NP8 A;  4WRI A;  1W7I B;  3C1V A;  3OP0 A;  2DOQ A;  1J1D A;  1NX1 A;  1KK7 Y;  1PSR A;  5HKW A;  1YUT A;  3SG4 A;  4DIR A;  1BU3 A;  2LMT A;  2OTG C;  5KTY A;  1L2O C;  2LNK A;  2PAL A;  1IJ5 A;  1EG4 A;  1XFZ O;  3PAT A;  3A4U B;  3SJS A;  2G9B A;  1S6I A;  2KAX A;  1Y6W A;  2RGI A;  1S6J A;  1K90 D;  1QTX A;  1DJX A;  1AUI B;  5AEQ A;  2JXL A;  3JVT C;  4XJK A;  1NPQ A;  1SL7 A;  1YRU B;  4BY4 A;  1CB1 A;  2BE4 A;  2KAY A;  2KDH A;  1K9U A;  3K21 A;  4E68 A;  1S3P A;  4PE0 A;  4GGF A;  1RK9 A;  2KAV A;  1CDM A;  2BBM A;  2JXC A;  3EVV A;  4D1E A;  1CM4 A;  3SIA A;  2HPS A;  2EGD A;  1YUR A;  1FI5 A;  1JWD A;  4JQ0 D;  4C0J A;  1ODB A;  1UHJ A;  1DT7 B;  1PK0 D;  3WNX B;  2JT3 A;  1BG1 A;  3BOW B;  5DKN A;  1MQ1 A;  1CLM A;  1S36 A;  1UWO A;  1S26 D;  2LLT A;  1FBV A;  3AAK A;  3I5H C;  4AQJ A;  1A75 B;  1YVL A;  2KFH A;  2AAO A;  4HRH A;  1M39 A;  2QPT A;  1ALV A;  1CDP A;  1FW4 A;  1SBJ A;  2MAZ A;  4ORB B;  3O6B A;  3VRP A;  4ZCV A;  1IQ5 A;  4BY5 A;  3SG2 A;  1F54 A;  5CSI A;  1AP4 A;  1A4P A;  1JFK A;  4PHN A;  1WLM A;  1UUR A;  2WOR A;  3TUY C;  2TN4 A;  1IWQ A;  3TDU A;  4I5K A;  1CNP A;  3KEV A;  4GUK A;  5CSN A;  2M7L A;  4N1G A;  3DF0 B;  2KOT A;  1N2D A;  2PMY A;  1QX5 B;  4JPZ B;  1IRJ A;  2BBN A;  3JTD B;  3CR4 X;  1YVH A;  1UHK A;  1NCZ A;  3CR2 A;  4A4B A;  1K2H A;  4U8D A;  1BF5 A;  5JJG A;  1JC2 A;  4NQG A;  2BCB A;  1G4Y R;  1B8C A;  3MSE B;  4GFT A;  5G08 A;  1DJI A;  2OTG B;  3I5H B;  3GK4 X;  2O60 A;  1A2X A;  1J7O A;  3SG5 A;  5D7F A;  3FIA A;  1E8A A;  3WXA A;  1NCX A;  2JOJ A;  1LA3 A;  2NXQ A;  2WND A;  3PN7 C;  1B47 A;  2LUX A;  4GGN A;  3A8R A;  4CFR A;  1RJV A;  2JUL A;  1QXP A;  4MN0 A;  1WRL A;  1PRW A;  1Y0V H;  1QAS A;  5ER5 A;  1KFU S;  1PVA A;  1XK4 C;  4OR9 B;  1BR4 B;  2Y4Q A;  1JSA A;  4PAL A;  2GGZ A;  2F3Z A;  1BLQ A;  1A75 A;  2L4H A;  1CM1 A;  1ZFS A;  2BEC A;  3I5G C;  2K2A A;  1U5I B;  2JPT A;  3LL8 B;  2JT8 A;  5HKZ A;  2MJW B;  1PSB A;  3OX6 A;  2BCX A;  3I5I B;  2NCO A;  2K7B A;  1KSM A;  2KHN A;  4PHM A;  3VRQ A;  1FPW A;  2WCB A;  5AAN A;  2LUC A;  1RTP 1;  3AKB A;  1YUU A;  2CTN A;  3O78 A;  2JNX A;  3SIB A;  1QLK A;  1IH0 A;  2KI6 D;  3BUX B;  4YRU A;  5B8I B;  3VRN A;  2HF5 A;  1XA5 A;  3NSO A;  2M9G A;  1ALW A;  1S5G Y;  2K2F A;  3D0Y B;  2SCP A;  1DGU A;  1LKJ A;  2OS8 B;  3I5F B;  2L51 A;  3CLN A;  3KF9 A;  1NIW A;  2M97 A;  1N0Y A;  2LV7 A;  5HKY A;  1J7Q A;  4M2Q A;  1SK6 D;  4PDZ A;  2KSP A;  4USL A;  2LE9 B;  1GGZ A;  1REC A;  1C7W A;  1XFV O;  3TUY B;  1F4Q A;  5DKQ A;  3H4S E;  1DJW A;  2M49 B;  5CPV A;  5I8N A;  2L98 A;  4PE1 A;  4YGC B;  4MVF A;  1K95 A;  1UUS A;  1TIZ A;  1TTX A;  2LLU A;  1DGV A;  2OPO A;  4AOM A;  1IKU A;  2L4I A;  1V1G A;  3OX5 A;  1CMG A;  2M1U A;  3LCP C;  5KSZ A;  2ISD A;  1EH2 A;  3NXA A;  1A03 A;  1OMV A;  4YI8 A;  3EVR A;  3HCM A;  1B8L A;  2KFF A;  4CID A;  1S1E A;  3LK0 A;  4UPG A;  2EHB A;  4GGF C;  1CLB A;  2FCE A;  5GQQ C;  4A4C A;  1MWN A;  1RFJ A;  2A4J A;  2BL0 C;  4ORA B;  4ETO A;  1SCV A;  5ER4 X;  3TZ1 A;  3DVM A;  4JWQ A;  1KWO B;  3NSI A;  1KK7 Z;  2I18 A;  1XFW O;  4PHK A;  1EL4 A;  1IG5 A;  1SCM B;  3QRX A;  4AQI A;  3DD4 A;  1DJZ A;  3OHM B;  2PSR A;  4CLN A;  3D0Y A;  2VRG A;  2BE6 A;  1B7T Y;  3BUN B;  2FOT A;  4NDC A;  5BPJ A;  5HYD A;  1QS7 A;  4HSZ A;  1SL9 A;  1DJY A;  1NYA A;  1UHN A;  5CSJ A;  1OQP A;  2KQY A;  1CDL A;  5DKR A;  2M29 A;  4GNK B;  1TNQ A;  1M46 A;  1ZOT B;  2Q4U A;  3JVT B;  1TRF A;  2E6W A;  3CGA A;  4OV2 A;  2KBI A;  3BOW A;  4OVN F;  4I5L B;  1QIW A;  1BOC A;  2LVV A;  2NCP A;  1EXR A;  3BUO B;  5KU1 A;  1IJ6 A;  1SCM C;  4MEW A;  1HQV A;  1ZMZ A;  4N1F A;  4YGA A;  1QVI Z;  1DF0 B;  2F8P A;  3AKA A;  1KFX L;  3SG3 A;  1BJF A;  3VRO A;  3CZT X;  1KQV A;  1Q80 A;  2Y1M A;  2MHH A;  1AJ4 A;  3I5I C;  1OSA A;  1F8H A;  1KWO C;  2M1K B;  3IQQ A;  3TS5 C;  1EJ3 A;  1K9P A;  1G8I A;  3GK2 A;  5I2Q A;  5TNC A;  1K8U A;  1RRO A;  4MRX A;  1S6C A;  3BXK A;  4PHJ A;  2HQ8 A;  3KO0 A;  1SW8 A;  1OMD A;  1UP5 A;  2JWW A;  2M0R A;  1YR5 A;  2I94 A;  1JUO A;  2LAN A;  2OS8 C;  2CT9 A;  5AER A;  1SMG A;  3FS7 A;  2ZN8 A;  2WCF A;  4OCI A;  5I2O A;  2ZRT A;  3PN7 B;  1QX2 A;  2KI4 B;  1AVS A;  2AUC A;  4XYN A;  3SG6 A;  2JNF A;  4CFQ A;  5IBW A;  1CFD A;  1WLZ A;  2LAP A;  4YBH B;  2WOS A;  1C07 A;  4GPL B;  3GK1 A;  3GOF A;  1B1G A;  1OZS A;  1SY9 A;  4GBA A;  1MXL C;  2GV5 A;  1TCO B;  2KQ6 A;  2CCM A;  3WHU B;  3I5G B;  3VGO A;  1GQM A;  2LP2 A;  5HLV A;  1XK4 A;  1JF2 A;  3LK1 A;  3ZWH A;  2JTZ A;  2KFG A;  1CTR A;  4MZJ A;  4C0L A;  4QJ3 B;  2R2I A;  1MHO A;  4MZK A;  3F45 A;  3CS1 A;  2HET A;  4HRE E;  1BR1 B;  2CNP A;  3O4Y A;  1J7R A;  2LVK A;  2IS9 A;  5HLO A;  1QIV A;  1HT9 A;  2CXJ A;  1U5I A;  3EK7 A;  2WCE A;  1DF0 A;  1YX7 A;  1TN4 A;  1ZUZ A;  2EC6 B;  2SAS A;  4DCK A;  2NLN A;  2M3W A;  2GGM A;  4FQO A;  1H8B A;  1DJH A;  1PAL A;  1CDN A;  4GAO A;  2LMU A;  4NDD A;  3AAJ A;  4YGB B;  2LC5 A;  5PAL A;  4YI9 A;  2ZFD A;  1KSO A;  1PUL A;  2MLE C;  4PCW A;  4F0Z B;  1K93 D;  2K8M B;  5I2L A;  1K9K A;  2F2O A;  2I2R E;  3O2P A;  1NCY A;  3CTN A;  2L5X B;  2F33 A;  2LP3 A;  2LLS A;  4WQ3 A;  4DS7 A;  1UHH A;  2V53 A;  3DVK A;  1KK8 C;  2JQ6 A;  4FTG A;  1QLS A;  2D8N A;  1KQM C;  3DVE A;  1SYM A;  1Y1A A;  1ZAC A;  3EK4 A;  1LA0 A;  3CR5 X;  1MR8 A;  1VRK A;  3ICB A;  1QJT A;  1C7V A;  1CKK A;  2MLF C;  3TS5 B;  2BCA A;  3I5F C;  5J3X A;  5CSF A;  2L2E A;  3SG7 A;  3TDZ A;  5JOL A;  1NX2 A;  2K7D A;  3TDI A;  4P5O E;  1CFF A;  2ZNE A;  2BKH B;  4WQ2 A;  3FWB A;  1KCY A;  1M45 A;  2BKI B;  1WDC B;  2JTT A;  4M2O A;  1WDC C;  5AXI A;  2H61 C;  2H61 A;  2H2K A;  2E30 A;  4IL1 A;  1CMF A;  2FCD A;  1QVI Y;  2LM5 A;  1LIN A;  2BL0 B;  1H4B A;  1GJY A;  1TCF A;  2JC2 A;  2ZKM X;  1RWY A;  3D10 A;  1IQ3 A;  1K96 A;  2LHI A;  1X02 A;  1TNW A;  4QJ5 B;  4ICB A;  3DF0 A;  2KI6 C;  1M31 A;  3E3R A;  1F4O A;  1D1O A;  3HX4 A;  3BUM B;  1KK8 B;  4L9M A;  1V1F A;  1SRA A;  3WHT B;  1NSH A;  3DVJ A;  1NX0 A;  4MZL A;  1CFP A;  1KQM B;  2LHL A;  1WY9 A;  2Q91 A;  1B7T Z;  1JFJ A;  4I5J A;  2NZ0 A;  5F6T A;  3PM8 A;  4MLW A;  1DJG A;  1B9A A;  3PAL A;  1YRT B;  4MRY A;  1XFY O;  1A29 A;  3RM1 A;  2KGB C;  3M0W A;  1SKT A;  4PE4 A;  2JRF A;  2KGR A;  2WC8 A;  1NUB A;  1OZO A;  4P2Y B;  4Q04 A;  2JZI A;  2PRU A;  1MUX A;  1MXE A;  2K0J A;  3OB2 B;  5K89 A;  3IF7 A;  1N65 A;  2ZRS A;  1DMO A;  2PVB A;  1YX8 A;  3IQO A;  3PSR A; 
#chains in the Genus database with same CATH topology
 4OZD A;  2LMV A;  2FJU B;  4PT1 A;  2ZND A;  1SL8 A;  1J7P A;  1DTL A;  1Y1X A;  4DUQ A;  3RLZ A;  2KLE A;  3VRR A;  3D77 A;  1EG3 A;  4ORC B;  1UHI A;  1BOD A;  1R2U A;  3FWC A;  1KFX S;  1W9Z A;  1CFC A;  1F55 A;  2HQW A;  1J55 A;  2ZN9 A;  4CPV A;  2Y1N A;  4ZCU A;  1K94 A;  2JT0 A;  1J1E A;  3CZ1 A;  5FYX A;  4C0K A;  2K7C A;  1AHR A;  2CBL A;  3EKH A;  4N5X A;  2KYF A;  1AJ5 A;  4YGD B;  1QV1 A;  1KFU L;  3NHI A;  5FI2 A;  1W7J B;  1F71 A;  1GGW A;  1L2O B;  1FI6 A;  1LVC D;  4INX A;  1XFU O;  2O5G A;  2M8U A;  1XFX O;  1Z4H A;  1R6P A;  1WRK A;  2LCP A;  5AFP A;  1PVB A;  4QJ4 B;  3CYZ A;  2WC5 A;  3BYA A;  1XYD A;  1XVJ A;  1JF0 A;  4YGE B;  1TNX A;  2K61 A;  1QX7 A;  2M7N A;  4PE7 A;  3JTD C;  2MBX A;  2MA2 A;  1SR6 C;  3S0E A;  4NDB A;  1L7Z A;  2LVI A;  2P6B B;  4I5N B;  1B4C A;  3EK8 A;  2Y5I A;  1DVI A;  3DZT A;  1NX3 A;  3L4L A;  3QME A;  2JU0 A;  1XO5 A;  3CAB A;  3S0A A;  3NSL A;  4MBE A;  1SPY A;  1F70 A;  3BUW B;  3KHE A;  4M2P A;  1BT6 A;  4DRW A;  1OE9 B;  1SNL A;  1G33 A;  2MRD A;  4R1E A;  3OB1 B;  2COL B;  3KPX A;  2AMI A;  1BMO A;  2QAC A;  1OMR A;  3PFV A;  1YUS A;  4TNC A;  2K60 A;  2L2C A;  1JBA A;  1LXF C;  1YTZ C;  2B1U A;  1MF8 B;  2K7O A;  2KI4 C;  1NWD A;  5D69 A;  2QEH A;  3PM2 A;  2L50 A;  3BQ3 A;  1TUZ A;  4OKH A;  1B8R A;  2EC6 C;  1AK8 A;  2F3Y A;  1S5G Z;  1IGV A;  3NSK A;  2KYC A;  1QAT A;  1TOP A;  3FE8 A;  2LVJ A;  3LLE A;  3EVU A;  1WRZ A;  4XJK B;  1M63 B;  2KBM A;  2G2B A;  2F2P A;  3EKJ A;  1FF1 A;  2L0P A;  1OOJ A;  3FE9 A;  1CLL A;  1SR6 B;  3ZNI A;  1Y1U A;  2PAS A;  2I7A A;  3PLF B;  1QV0 A;  1TNP A;  3CDN A;  3CWG A;  4HRG A;  2KNE A;  4MSP A;  1NP8 A;  4WRI A;  1W7I B;  3C1V A;  3OP0 A;  2DOQ A;  1J1D A;  1NX1 A;  1KK7 Y;  1PSR A;  3RZS A;  5HKW A;  1YUT A;  3SG4 A;  4DIR A;  1BU3 A;  2LMT A;  2OTG C;  5KTY A;  1L2O C;  2LNK A;  2PAL A;  1IJ5 A;  1EG4 A;  1XFZ O;  3PAT A;  3A4U B;  3SJS A;  2G9B A;  1S6I A;  2KAX A;  5FI7 A;  1Y6W A;  2RGI A;  1S6J A;  1K90 D;  1QTX A;  1DJX A;  1AUI B;  5AEQ A;  2JXL A;  3JVT C;  4XJK A;  1NPQ A;  1SL7 A;  1YRU B;  4BY4 A;  1CB1 A;  2BE4 A;  2KAY A;  2KDH A;  1K9U A;  1DEL A;  3K21 A;  1S3P A;  5FI6 A;  4E68 A;  4PE0 A;  2KLD A;  1RK9 A;  2KAV A;  1CDM A;  2BBM A;  2JXC A;  3EVV A;  4GGF A;  1CM4 A;  3SIA A;  2HPS A;  1OOF A;  2EGD A;  1YUR A;  1FI5 A;  1JWD A;  4JQ0 D;  4C0J A;  1ODB A;  1UHJ A;  1DT7 B;  1PK0 D;  3WNX B;  3SS4 A;  2JT3 A;  1BG1 A;  3BOW B;  5DKN A;  1MQ1 A;  5D3O A;  1CLM A;  1S36 A;  1UWO A;  1S26 D;  2LLT A;  1FBV A;  2WCJ A;  3AAK A;  3I5H C;  1A75 B;  4AQJ A;  1OOG A;  3BFA A;  1YVL A;  2KFH A;  2AAO A;  4HRH A;  4F7F A;  1QWV A;  1M39 A;  3DY9 A;  2QPT A;  1ALV A;  1CDP A;  1FW4 A;  1SBJ A;  2MAZ A;  4ORB B;  3BFH A;  3O6B A;  3VRP A;  4ZCV A;  1IQ5 A;  4BY5 A;  3SG2 A;  1F54 A;  5CSI A;  1AP4 A;  1A4P A;  1JFK A;  4PHN A;  1WLM A;  1UUR A;  2WOR A;  3TUY C;  2TN4 A;  1IWQ A;  3TDU A;  4I5K A;  1CNP A;  3KEV A;  4GUK A;  5CSN A;  2M7L A;  2H8V A;  4INW A;  4N1G A;  3DF0 B;  2KPH A;  2KOT A;  1N2D A;  2PMY A;  1QX5 B;  4JPZ B;  2PQL A;  1IRJ A;  2BBN A;  3JTD B;  3CR4 X;  1YVH A;  1T14 A;  1UHK A;  1NCZ A;  1TWO A;  3CR2 A;  4A4B A;  1K2H A;  4U8D A;  1IIO A;  2WC6 A;  3B86 A;  1BF5 A;  5JJG A;  1JC2 A;  1ORG A;  4NQG A;  2BCB A;  1G4Y R;  1B8C A;  3MSE B;  4GFT A;  3D76 A;  3VB1 A;  1OW4 A;  5G08 A;  1DJI A;  2OTG B;  3I5H B;  4JD9 A;  3GK4 X;  2O60 A;  1A2X A;  1J7O A;  3SG5 A;  5D7F A;  3FIA A;  1E8A A;  3WXA A;  1NCX A;  2JOJ A;  1LA3 A;  2NXQ A;  2WND A;  3PN7 C;  3SS5 A;  1B47 A;  2LUX A;  4GGN A;  3A8R A;  4CFR A;  5DIC A;  1RJV A;  2JUL A;  1QXP A;  4MN0 A;  3PJI A;  1WRL A;  1PRW A;  1Y0V H;  1QAS A;  5ER5 A;  3L47 A;  1KFU S;  1PVA A;  1XK4 C;  4OR9 B;  1BR4 B;  2Y4Q A;  1JSA A;  4PAL A;  2GGZ A;  2F3Z A;  1BLQ A;  1A75 A;  2L4H A;  1CM1 A;  1ZFS A;  2BEC A;  3I5G C;  2K2A A;  1U5I B;  2JPT A;  3LL8 B;  3N7H A;  3V2L A;  2JT8 A;  5HKZ A;  1DEK A;  2MJW B;  1PSB A;  3OX6 A;  2BCX A;  3I5I B;  2NCO A;  3OGN A;  2K7B A;  1KSM A;  2KHN A;  1TUJ A;  3IVT A;  4PHM A;  2WCB A;  3VRQ A;  5AAN A;  2LUC A;  1FPW A;  1RTP 1;  3AKB A;  1YUU A;  2CTN A;  3O78 A;  2JNX A;  3SIB A;  1QLK A;  1IH0 A;  2KI6 D;  3BUX B;  4YRU A;  5B8I B;  3R1P A;  2HF5 A;  3VRN A;  1XA5 A;  3NSO A;  2QEB A;  2M9G A;  1ALW A;  1S5G Y;  2K2F A;  3D0Y B;  2SCP A;  1DGU A;  1LKJ A;  2OS8 B;  3EG5 B;  3I5F B;  2L51 A;  3CLN A;  3KF9 A;  1NIW A;  2PYQ A;  2M97 A;  1N0Y A;  2LV7 A;  5HKY A;  1J7Q A;  2WCL A;  2ERB A;  4M2Q A;  1SK6 D;  2GTE A;  2KSP A;  4PDZ A;  4USL A;  2LE9 B;  1GGZ A;  1REC A;  1C7W A;  1XFV O;  3TUY B;  1F4Q A;  5DKQ A;  1C3Y A;  3H4S E;  1DJW A;  2M49 B;  5CPV A;  5I8N A;  2L98 A;  4PE1 A;  4YGC B;  4MVF A;  1K95 A;  1UUS A;  1TIZ A;  1TTX A;  2LLU A;  1GM0 A;  1DGV A;  2OPO A;  2WCH A;  4AOM A;  3O4X A;  3S0G A;  1IKU A;  2L4I A;  1V1G A;  3R1V A;  3OX5 A;  1CMG A;  5I94 A;  2M1U A;  3LCP C;  5KSZ A;  2ISD A;  1EH2 A;  3NXA A;  1A03 A;  1OMV A;  4YI8 A;  3EVR A;  3HCM A;  1B8L A;  2KFF A;  4CID A;  1S1E A;  3LK0 A;  4UPG A;  2EHB A;  4GGF C;  1CLB A;  2FCE A;  2FJY A;  4JKT A;  2JPO A;  3FE6 A;  1MWN A;  5GQQ C;  1RFJ A;  4A4C A;  2A4J A;  2BL0 C;  3Q8I A;  4ORA B;  4ETO A;  1SCV A;  5ER4 X;  3TZ1 A;  3DVM A;  4JWQ A;  1KWO B;  3CZ2 A;  3NSI A;  1KK7 Z;  1C3Z A;  2I18 A;  3BFB A;  1XFW O;  4PHK A;  1EL4 A;  1IG5 A;  1SCM B;  3B7A A;  3NGV A;  3QRX A;  4AQI A;  3DD4 A;  1DJZ A;  1OOH A;  2PSR A;  3OHM B;  4CLN A;  3D0Y A;  2VRG A;  2BE6 A;  1B7T Y;  3BUN B;  2FOT A;  4NDC A;  5BPJ A;  5HYD A;  1QS7 A;  4HSZ A;  1SL9 A;  1DJY A;  1NYA A;  1UHN A;  5CSJ A;  3B6X A;  1OQP A;  2KQY A;  1CDL A;  5DKR A;  2M29 A;  4GNK B;  1TNQ A;  1M46 A;  1ZOT B;  2Q4U A;  3JVT B;  1TRF A;  2E6W A;  3CGA A;  4OV2 A;  2KBI A;  3BOW A;  4OVN F;  4I5L B;  1QIW A;  1BOC A;  2LVV A;  2NCP A;  1EXR A;  3BUO B;  1LS8 A;  5KU1 A;  1IJ6 A;  1SCM C;  4MEW A;  1HQV A;  1ZMZ A;  4N1F A;  4D1E A;  4YGA A;  3R1O A;  1QVI Z;  1DF0 B;  2F8P A;  3AKA A;  1KFX L;  3SG3 A;  1BJF A;  3VRO A;  3CZT X;  1KQV A;  1Q80 A;  2Y1M A;  2MHH A;  1AJ4 A;  3I5I C;  1OSA A;  1F8H A;  1KWO C;  2M1K B;  4IJ7 A;  2BAP A;  3IQQ A;  3TS5 C;  1EJ3 A;  1K9P A;  2QEV A;  1G8I A;  3GK2 A;  5I2Q A;  1SSE B;  5TNC A;  1K8U A;  3DYE A;  3S0F A;  1RRO A;  2QDI A;  4MRX A;  1S6C A;  3BXK A;  4PHJ A;  2HQ8 A;  3KO0 A;  1SW8 A;  1OMD A;  1UP5 A;  2JWW A;  2M0R A;  1YR5 A;  3CZ0 A;  2I94 A;  1JUO A;  2LAN A;  2OS8 C;  2CT9 A;  5AER A;  1SMG A;  3FS7 A;  3K1E A;  2ZN8 A;  4FQT A;  2WCF A;  4OCI A;  5I2O A;  2ZRT A;  3NHT A;  3PN7 B;  1QX2 A;  2KI4 B;  1AVS A;  2AUC A;  4XYN A;  3D75 A;  3SG6 A;  2JNF A;  4CFQ A;  5IBW A;  1CFD A;  1WLZ A;  2LAP A;  4YBH B;  2WOS A;  1C07 A;  4GPL B;  3GK1 A;  3GOF A;  1B1G A;  1OZS A;  1SY9 A;  4GBA A;  1MXL C;  2GV5 A;  1TCO B;  2KQ6 A;  2CCM A;  3WHU B;  3I5G B;  1OOI X;  3SS3 A;  3VGO A;  1GQM A;  2LP2 A;  3B88 A;  1XK4 A;  5HLV A;  1JF2 A;  3LK1 A;  3ZWH A;  2JTZ A;  2KFG A;  1CTR A;  4MZJ A;  4C0L A;  4KYN A;  2R2I A;  4QJ3 B;  1MHO A;  4MZK A;  3F45 A;  3CS1 A;  2HET A;  4HRE E;  1BR1 B;  2CNP A;  3S0D A;  3O4Y A;  1J7R A;  2LVK A;  2IS9 A;  2L5Y A;  5HLO A;  1QIV A;  1HT9 A;  2P70 A;  2CXJ A;  1U5I A;  3EK7 A;  2WCE A;  1DF0 A;  1YX7 A;  1TN4 A;  1ZUZ A;  2EC6 B;  2SAS A;  4DCK A;  2NLN A;  2M3W A;  2GGM A;  4FQO A;  1H8B A;  1DJH A;  1PAL A;  1CDN A;  4GAO A;  2LMU A;  4NDD A;  3AAJ A;  4YGB B;  2LC5 A;  5PAL A;  4YI9 A;  2ZFD A;  3UNW A;  1KSO A;  1PUL A;  2MLE C;  4PCW A;  4F0Z B;  1K93 D;  2K8M B;  3DXL A;  5I2L A;  1K9K A;  2F2O A;  2I2R E;  3O2P A;  1NCY A;  3CTN A;  2L5X B;  2F33 A;  2LP3 A;  3BJH A;  2LLS A;  4WQ3 A;  4DS7 A;  1UHH A;  2V53 A;  3L4A A;  3DVK A;  2BNX A;  1KK8 C;  2JQ6 A;  4FTG A;  1QLS A;  2D8N A;  1KQM C;  3DVE A;  1SYM A;  1Y1A A;  1ZAC A;  3EK4 A;  1LA0 A;  3CR5 X;  1MR8 A;  1VRK A;  3ICB A;  1QJT A;  1C7V A;  1CKK A;  2MLF C;  2YGU A;  2BCA A;  3TS5 B;  3I5F C;  5J3X A;  5CSF A;  2L2E A;  3SG7 A;  3D78 A;  3D73 A;  3TDZ A;  5JOL A;  1NX2 A;  2K7D A;  3TDI A;  4P5O E;  1CFF A;  2ZNE A;  2BKH B;  3S0B A;  4WQ2 A;  2QEO A;  3FWB A;  1KCY A;  2WCK A;  1M45 A;  2BKI B;  3UO9 A;  1WDC B;  2JTT A;  4M2O A;  1WDC C;  5AXI A;  2H61 C;  2H61 A;  2H2K A;  2E30 A;  1DC1 A;  4IL1 A;  1CMF A;  5EL2 A;  2FCD A;  1QVI Y;  2LM5 A;  1LIN A;  2BL0 B;  3OBV A;  1H4B A;  1GJY A;  1TCF A;  2JC2 A;  3B87 A;  2ZKM X;  3D74 A;  1RWY A;  3D10 A;  1IQ3 A;  1K96 A;  2LHI A;  1X02 A;  1TNW A;  4QJ5 B;  5HL1 A;  1XFR A;  4ICB A;  3DF0 A;  2KI6 C;  1M31 A;  3E3R A;  2WCM A;  1F4O A;  1D1O A;  3HX4 A;  3BUM B;  1KK8 B;  4L9M A;  1V1F A;  1SRA A;  3WHT B;  1NSH A;  1P28 A;  1NX0 A;  3DVJ A;  4MZL A;  1Z2C B;  1CFP A;  1KQM B;  2LHL A;  1WY9 A;  2Q91 A;  1B7T Z;  1JFJ A;  4I5J A;  2NZ0 A;  5F6T A;  3PM8 A;  4MLW A;  1DJG A;  1B9A A;  3PAL A;  1DQE A;  1YRT B;  1XFY O;  1A29 A;  4MRY A;  2KGB C;  3RM1 A;  3M0W A;  1SKT A;  4PE4 A;  2JRF A;  2KGR A;  3R72 A;  2P71 A;  2WC8 A;  1NUB A;  1OZO A;  4P2Y B;  4Q04 A;  2JZI A;  2PRU A;  1MUX A;  1MXE A;  2K0J A;  3OB2 B;  5K89 A;  3IF7 A;  1N65 A;  2ZRS A;  1DMO A;  2PVB A;  1YX8 A;  3IQO A;  3PSR A; 
#chains in the Genus database with same CATH homology
 2LMV A;  2FJU B;  2ZND A;  1SL8 A;  1J7P A;  1DTL A;  1Y1X A;  4DUQ A;  3RLZ A;  3VRR A;  1EG3 A;  4ORC B;  1UHI A;  1BOD A;  1R2U A;  3FWC A;  1KFX S;  1CFC A;  1F55 A;  2HQW A;  1J55 A;  2ZN9 A;  4CPV A;  2Y1N A;  4ZCU A;  1K94 A;  2JT0 A;  1J1E A;  5FYX A;  4C0K A;  2K7C A;  1AHR A;  2CBL A;  3EKH A;  4N5X A;  2KYF A;  1AJ5 A;  4YGD B;  1QV1 A;  1KFU L;  1W7J B;  1F71 A;  1GGW A;  1L2O B;  1FI6 A;  1LVC D;  1XFU O;  2O5G A;  2M8U A;  1XFX O;  1R6P A;  1WRK A;  2LCP A;  5AFP A;  1PVB A;  4QJ4 B;  3BYA A;  1XYD A;  1XVJ A;  1JF0 A;  4YGE B;  1TNX A;  2K61 A;  1QX7 A;  2M7N A;  4PE7 A;  3JTD C;  2MBX A;  2MA2 A;  1SR6 C;  4NDB A;  1L7Z A;  2LVI A;  2P6B B;  4I5N B;  1B4C A;  3EK8 A;  2Y5I A;  1DVI A;  1NX3 A;  2JU0 A;  1XO5 A;  3NSL A;  4MBE A;  1SPY A;  1F70 A;  3BUW B;  3KHE A;  4M2P A;  1BT6 A;  4DRW A;  1OE9 B;  1SNL A;  1G33 A;  2MRD A;  4R1E A;  3OB1 B;  2COL B;  3KPX A;  2AMI A;  1BMO A;  2QAC A;  1OMR A;  3PFV A;  1YUS A;  4TNC A;  1JBA A;  1LXF C;  1YTZ C;  2B1U A;  1MF8 B;  2K7O A;  2KI4 C;  1NWD A;  5D69 A;  2L50 A;  3BQ3 A;  4OKH A;  1B8R A;  2EC6 C;  1AK8 A;  2F3Y A;  1S5G Z;  1IGV A;  3NSK A;  2KYC A;  1QAT A;  1TOP A;  2LVJ A;  3LLE A;  3EVU A;  1WRZ A;  4XJK B;  1M63 B;  2KBM A;  2G2B A;  2F2P A;  3EKJ A;  1FF1 A;  2L0P A;  1OOJ A;  1CLL A;  1SR6 B;  3ZNI A;  1Y1U A;  2PAS A;  2I7A A;  3PLF B;  1QV0 A;  1TNP A;  3CWG A;  4HRG A;  2KNE A;  4MSP A;  1NP8 A;  4WRI A;  1W7I B;  3C1V A;  3OP0 A;  2DOQ A;  1J1D A;  1NX1 A;  1KK7 Y;  1PSR A;  5HKW A;  1YUT A;  3SG4 A;  4DIR A;  1BU3 A;  2LMT A;  2OTG C;  5KTY A;  1L2O C;  2LNK A;  2PAL A;  1IJ5 A;  1EG4 A;  1XFZ O;  3PAT A;  3A4U B;  3SJS A;  2G9B A;  1S6I A;  2KAX A;  1Y6W A;  2RGI A;  1S6J A;  1K90 D;  1QTX A;  1DJX A;  1AUI B;  5AEQ A;  2JXL A;  3JVT C;  4XJK A;  1NPQ A;  1SL7 A;  1YRU B;  4BY4 A;  1CB1 A;  2BE4 A;  2KAY A;  2KDH A;  1K9U A;  3K21 A;  4E68 A;  1S3P A;  4PE0 A;  4GGF A;  1RK9 A;  2KAV A;  1CDM A;  2BBM A;  2JXC A;  3EVV A;  4D1E A;  1CM4 A;  3SIA A;  2HPS A;  2EGD A;  1YUR A;  1FI5 A;  1JWD A;  4JQ0 D;  4C0J A;  1ODB A;  1UHJ A;  1DT7 B;  1PK0 D;  3WNX B;  2JT3 A;  1BG1 A;  3BOW B;  5DKN A;  1MQ1 A;  1CLM A;  1S36 A;  1UWO A;  1S26 D;  2LLT A;  1FBV A;  3AAK A;  3I5H C;  4AQJ A;  1A75 B;  1YVL A;  2KFH A;  2AAO A;  4HRH A;  1M39 A;  2QPT A;  1ALV A;  1CDP A;  1FW4 A;  1SBJ A;  2MAZ A;  4ORB B;  3O6B A;  3VRP A;  4ZCV A;  1IQ5 A;  4BY5 A;  3SG2 A;  1F54 A;  5CSI A;  1AP4 A;  1A4P A;  1JFK A;  4PHN A;  1WLM A;  1UUR A;  2WOR A;  3TUY C;  2TN4 A;  1IWQ A;  3TDU A;  4I5K A;  1CNP A;  3KEV A;  4GUK A;  5CSN A;  2M7L A;  4N1G A;  3DF0 B;  2KOT A;  1N2D A;  2PMY A;  1QX5 B;  4JPZ B;  1IRJ A;  2BBN A;  3JTD B;  3CR4 X;  1YVH A;  1UHK A;  1NCZ A;  3CR2 A;  4A4B A;  1K2H A;  4U8D A;  1BF5 A;  5JJG A;  1JC2 A;  4NQG A;  2BCB A;  1G4Y R;  1B8C A;  3MSE B;  4GFT A;  5G08 A;  1DJI A;  2OTG B;  3I5H B;  3GK4 X;  2O60 A;  1A2X A;  1J7O A;  3SG5 A;  5D7F A;  3FIA A;  1E8A A;  3WXA A;  1NCX A;  2JOJ A;  1LA3 A;  2NXQ A;  2WND A;  3PN7 C;  1B47 A;  2LUX A;  4GGN A;  3A8R A;  4CFR A;  1RJV A;  2JUL A;  1QXP A;  4MN0 A;  1WRL A;  1PRW A;  1Y0V H;  1QAS A;  5ER5 A;  1KFU S;  1PVA A;  1XK4 C;  4OR9 B;  1BR4 B;  2Y4Q A;  1JSA A;  4PAL A;  2GGZ A;  2F3Z A;  1BLQ A;  1A75 A;  2L4H A;  1CM1 A;  1ZFS A;  2BEC A;  3I5G C;  2K2A A;  1U5I B;  2JPT A;  3LL8 B;  2JT8 A;  5HKZ A;  2MJW B;  1PSB A;  3OX6 A;  2BCX A;  3I5I B;  2NCO A;  2K7B A;  1KSM A;  2KHN A;  4PHM A;  3VRQ A;  1FPW A;  2WCB A;  5AAN A;  2LUC A;  1RTP 1;  3AKB A;  1YUU A;  2CTN A;  3O78 A;  2JNX A;  3SIB A;  1QLK A;  1IH0 A;  2KI6 D;  3BUX B;  4YRU A;  5B8I B;  3VRN A;  2HF5 A;  1XA5 A;  3NSO A;  2M9G A;  1ALW A;  1S5G Y;  2K2F A;  3D0Y B;  2SCP A;  1DGU A;  1LKJ A;  2OS8 B;  3I5F B;  2L51 A;  3CLN A;  3KF9 A;  1NIW A;  2M97 A;  1N0Y A;  2LV7 A;  5HKY A;  1J7Q A;  4M2Q A;  1SK6 D;  4PDZ A;  2KSP A;  4USL A;  2LE9 B;  1GGZ A;  1REC A;  1C7W A;  1XFV O;  3TUY B;  1F4Q A;  5DKQ A;  3H4S E;  1DJW A;  2M49 B;  5CPV A;  5I8N A;  2L98 A;  4PE1 A;  4YGC B;  4MVF A;  1K95 A;  1UUS A;  1TIZ A;  1TTX A;  2LLU A;  1DGV A;  2OPO A;  4AOM A;  1IKU A;  2L4I A;  1V1G A;  3OX5 A;  1CMG A;  2M1U A;  3LCP C;  5KSZ A;  2ISD A;  1EH2 A;  3NXA A;  1A03 A;  1OMV A;  4YI8 A;  3EVR A;  3HCM A;  1B8L A;  2KFF A;  4CID A;  1S1E A;  3LK0 A;  4UPG A;  2EHB A;  4GGF C;  1CLB A;  2FCE A;  5GQQ C;  4A4C A;  1MWN A;  1RFJ A;  2A4J A;  2BL0 C;  4ORA B;  4ETO A;  1SCV A;  5ER4 X;  3TZ1 A;  3DVM A;  4JWQ A;  1KWO B;  3NSI A;  1KK7 Z;  2I18 A;  1XFW O;  4PHK A;  1EL4 A;  1IG5 A;  1SCM B;  3QRX A;  4AQI A;  3DD4 A;  1DJZ A;  3OHM B;  2PSR A;  4CLN A;  3D0Y A;  2VRG A;  2BE6 A;  1B7T Y;  3BUN B;  2FOT A;  4NDC A;  5BPJ A;  5HYD A;  1QS7 A;  4HSZ A;  1SL9 A;  1DJY A;  1NYA A;  1UHN A;  5CSJ A;  1OQP A;  2KQY A;  1CDL A;  5DKR A;  2M29 A;  4GNK B;  1TNQ A;  1M46 A;  1ZOT B;  2Q4U A;  3JVT B;  1TRF A;  2E6W A;  3CGA A;  4OV2 A;  2KBI A;  3BOW A;  4OVN F;  4I5L B;  1QIW A;  1BOC A;  2LVV A;  2NCP A;  1EXR A;  3BUO B;  5KU1 A;  1IJ6 A;  1SCM C;  4MEW A;  1HQV A;  1ZMZ A;  4N1F A;  4YGA A;  1QVI Z;  1DF0 B;  2F8P A;  3AKA A;  1KFX L;  3SG3 A;  1BJF A;  3VRO A;  3CZT X;  1KQV A;  1Q80 A;  2Y1M A;  2MHH A;  1AJ4 A;  3I5I C;  1OSA A;  1F8H A;  1KWO C;  2M1K B;  3IQQ A;  3TS5 C;  1EJ3 A;  1K9P A;  1G8I A;  3GK2 A;  5I2Q A;  5TNC A;  1K8U A;  1RRO A;  4MRX A;  1S6C A;  3BXK A;  4PHJ A;  2HQ8 A;  3KO0 A;  1SW8 A;  1OMD A;  1UP5 A;  2JWW A;  2M0R A;  1YR5 A;  2I94 A;  1JUO A;  2LAN A;  2OS8 C;  2CT9 A;  5AER A;  1SMG A;  3FS7 A;  2ZN8 A;  2WCF A;  4OCI A;  5I2O A;  2ZRT A;  3PN7 B;  1QX2 A;  2KI4 B;  1AVS A;  2AUC A;  4XYN A;  3SG6 A;  2JNF A;  4CFQ A;  5IBW A;  1CFD A;  1WLZ A;  2LAP A;  4YBH B;  2WOS A;  1C07 A;  4GPL B;  3GK1 A;  3GOF A;  1B1G A;  1OZS A;  1SY9 A;  4GBA A;  1MXL C;  2GV5 A;  1TCO B;  2KQ6 A;  2CCM A;  3WHU B;  3I5G B;  3VGO A;  1GQM A;  2LP2 A;  5HLV A;  1XK4 A;  1JF2 A;  3LK1 A;  3ZWH A;  2JTZ A;  2KFG A;  1CTR A;  4MZJ A;  4C0L A;  4QJ3 B;  2R2I A;  1MHO A;  4MZK A;  3F45 A;  3CS1 A;  2HET A;  4HRE E;  1BR1 B;  2CNP A;  3O4Y A;  1J7R A;  2LVK A;  2IS9 A;  5HLO A;  1QIV A;  1HT9 A;  2CXJ A;  1U5I A;  3EK7 A;  2WCE A;  1DF0 A;  1YX7 A;  1TN4 A;  1ZUZ A;  2EC6 B;  2SAS A;  4DCK A;  2NLN A;  2M3W A;  2GGM A;  4FQO A;  1H8B A;  1DJH A;  1PAL A;  1CDN A;  4GAO A;  2LMU A;  4NDD A;  3AAJ A;  4YGB B;  2LC5 A;  5PAL A;  4YI9 A;  2ZFD A;  1KSO A;  1PUL A;  2MLE C;  4PCW A;  4F0Z B;  1K93 D;  2K8M B;  5I2L A;  1K9K A;  2F2O A;  2I2R E;  3O2P A;  1NCY A;  3CTN A;  2L5X B;  2F33 A;  2LP3 A;  2LLS A;  4WQ3 A;  4DS7 A;  1UHH A;  2V53 A;  3DVK A;  1KK8 C;  2JQ6 A;  4FTG A;  1QLS A;  2D8N A;  1KQM C;  3DVE A;  1SYM A;  1Y1A A;  1ZAC A;  3EK4 A;  1LA0 A;  3CR5 X;  1MR8 A;  1VRK A;  3ICB A;  1QJT A;  1C7V A;  1CKK A;  2MLF C;  3TS5 B;  2BCA A;  3I5F C;  5J3X A;  5CSF A;  2L2E A;  3SG7 A;  3TDZ A;  5JOL A;  1NX2 A;  2K7D A;  3TDI A;  4P5O E;  1CFF A;  2ZNE A;  2BKH B;  4WQ2 A;  3FWB A;  1KCY A;  1M45 A;  2BKI B;  1WDC B;  2JTT A;  4M2O A;  1WDC C;  5AXI A;  2H61 C;  2H61 A;  2H2K A;  2E30 A;  4IL1 A;  1CMF A;  2FCD A;  1QVI Y;  2LM5 A;  1LIN A;  2BL0 B;  1H4B A;  1GJY A;  1TCF A;  2JC2 A;  2ZKM X;  1RWY A;  3D10 A;  1IQ3 A;  1K96 A;  2LHI A;  1X02 A;  1TNW A;  4QJ5 B;  4ICB A;  3DF0 A;  2KI6 C;  1M31 A;  3E3R A;  1F4O A;  1D1O A;  3HX4 A;  3BUM B;  1KK8 B;  4L9M A;  1V1F A;  1SRA A;  3WHT B;  1NSH A;  3DVJ A;  1NX0 A;  4MZL A;  1CFP A;  1KQM B;  2LHL A;  1WY9 A;  2Q91 A;  1B7T Z;  1JFJ A;  4I5J A;  2NZ0 A;  5F6T A;  3PM8 A;  4MLW A;  1DJG A;  1B9A A;  3PAL A;  1YRT B;  4MRY A;  1XFY O;  1A29 A;  3RM1 A;  2KGB C;  3M0W A;  1SKT A;  4PE4 A;  2JRF A;  2KGR A;  2WC8 A;  1NUB A;  1OZO A;  4P2Y B;  4Q04 A;  2JZI A;  2PRU A;  1MUX A;  1MXE A;  2K0J A;  3OB2 B;  5K89 A;  3IF7 A;  1N65 A;  2ZRS A;  1DMO A;  2PVB A;  1YX8 A;  3IQO A;  3PSR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...