1TIZA

Solution structure of a calmodulin-like calcium-binding domain from arabidopsis thaliana
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
67
structure length
67
Chain Sequence
SSAKRVFEKFDKNKDGKLSLDEFREVALAFSPYFTQEDIVKFFEEIDVDGNGELNADEFTSCIEKML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords calmodulin-related protein, putative
publication title Letter to the Editor: Solution structure of a calmodulin-like calcium-binding domain from Arabidopsis thaliana
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Calcium-binding protein
total genus 16
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2004-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1tizA00
3LLEA 3AKBA 1IH0A 2LHIA 1BOCA 2CBLA 3F45A 1MHOA 1QX5B 2KNEA 2BECA 1OMRA 4PHJA 1YR5A 1TCFA 1YURA 2B1UA 1CDNA 3TUYB 3FWCA 1JC2A 4OVNF 4I5JA 1CLMA 2BCXA 2JNFA 2PVBA 4MVFA 2L0PA 1K9PA 1KK8B 2ZN8A 3I5FC 3BOWA 3NSOA 4AQIA 3CR5X 2PMYA 3PATA 5GQQC 2F3ZA 4MBEA 4HRGA 2OTGC 1CFCA 2OS8C 2MBXA 1WRZA 4DCKA 1DTLA 1KQMB 1CMFA 5HKZA 2ZNDA 1J7PA 1H8BA 4C0JA 3FIAA 2PRUA 4ETOA 4WQ3A 3EKHA 4I5KA 4L9MA 1SK6D 3IF7A 1WRLA 1NX1A 3SG6A 3DF0A 1EL4A 3WHTB 4C0KA 1AJ5A 1XYDA 2K8MB 3KPXA 4GBAA 3H4SE 1YUUA 2KAYA 1CFFA 4NDBA 3A4UB 5DKNA 3WXAA 2F2PA 3I5IC 1LA0A 2L5XB 4CIDA 3PLFB 2AUCA 3CGAA 1GQMA 1OE9B 1TNPA 2LP3A 2KGBC 2VRGA 3C1VA 2F8PA 5B8IB 5K89A 1K96A 4ORBB 1TNXA 2F33A 1KFXS 1E8AA 1CLBA 3HX4A 1TNWA 2LUXA 1F4OA 1B47A 1CDPA 1A75B 1NCZA 1QVIY 1B8LA 1YTZC 2KQYA 3IQQA 4PHKA 1DJZA 1ALVA 1KWOC 4DUQA 2M7NA 3GK1A 1Q80A 3NSLA 1B9AA 3DVKA 3PM8A 1MR8A 1SR6C 1U5IA 2F2OA 2D8NA 1DF0B 5G08A 5ER5A 2KYCA 2JU0A 3EK8A 1DJHA 3HCMA 2K61A 2LVVA 2Y1NA 2E30A 2ZKMX 1SKTA 4I5NB 1DJIA 1MF8B 2HQWA 1QATA 1KSMA 2JT3A 2KAVA 4MZLA 5I8NA 1SYMA 2F3YA 1FI5A 4PCWA 1BJFA 4YGEB 4C0LA 4CLNA 1JSAA 3CR2A 2KOTA 3K21A 1D1OA 1LVCD 1J1EA 4GPLB 3TS5C 4BY5A 1NUBA 1S3PA 1CFPA 1J55A 1R6PA 2OS8B 1J1DA 2LCPA 1IJ5A 1QV0A 2M7LA 2NCPA 1EH2A 1NX0A 1S5GZ 1BR4B 1NX3A 2PALA 1F54A 2KFGA 5ER4X 3SG3A 1BMOA 1B8RA 2LHLA 1NYAA 1PULA 1PALA 1A03A 2K7BA 2MJWB 3VRNA 1B1GA 1Y6WA 1IRJA 2K0JA 1S26D 1SNLA 1W7JB 1M46A 1RFJA 3ICBA 4OR9B 5DKQA 5HYDA 3I5IB 2BBNA 3FWBA 2KI4C 2JXCA 5AFPA 1YX8A 3KEVA 1SBJA 1UHIA 1CLLA 4P2YB 2G9BA 3TZ1A 1KQVA 1X02A 4M2OA 1OMVA 1QTXA 1SL9A 5I2LA 3RM1A 4YGCB 1RWYA 2BCBA 1ZOTB 2M29A 1BODA 1B7TZ 1V1FA 5I2QA 1JFKA 1QIVA 1IGVA 2NCOA 1TRFA 2L2EA 1PVAA 1DJXA 1OSAA 3CS1A 3BUOB 5HKWA 2CCMA 1UHKA 1PRWA 2EC6B 2M8UA 4PE7A 1WDCC 1KWOB 1WLMA 4GGFA 1NIWA 5J3XA 1SL7A 5HKYA 2BCAA 3PALA 1J7QA 1MWNA 1AJ4A 2H61A 1CM1A 4PALA 3BUXB 1SR6B 2OPOA 1QLKA 4ORCB 2HQ8A 1IKUA 1M45A 1NX2A 2L98A 1FPWA 1IQ5A 5HLVA 3I5HB 2ZRSA 1MUXA 4MZKA 3O6BA 2M1KB 1TTXA 1UWOA 2BE6A 1KFUS 5D69A 1F70A 4ZCVA 3TS5B 1BT6A 4M2QA 2IS9A 3O4YA 1SPYA 2KSPA 4YRUA 1XO5A 4M2PA 4CFRA 3DVMA 5TNCA 3OP0A 1IJ6A 1NP8A 1JFJA 2WCEA 3OX6A 2M3WA 2Y4QA 1G33A 1XFXO 1JUOA 2LUCA 5JJGA 2PSRA 1A4PA 2JQ6A 2Y5IA 1JF2A 1ODBA 2TN4A 1YVHA 4MSPA 2BKHB 2JC2A 3VROA 1ZACA 4JQ0D 2KBMA 3D0YA 1RROA 2HETA 1IG5A 1RTP1 2KBIA 1JWDA 1SRAA 3SG4A 1K2HA 1CDMA 2I7AA 4YGBB 2KI4B 5KU1A 2JULA 3BQ3A 5IBWA 1OOJA 1QVIZ 2ZRTA 5CSNA 2MRDA 4MN0A 1GJYA 2WCFA 1KCYA 2KFHA 2EC6C 3CZTX 3TDZA 1QX2A 2EGDA 2K7OA 3TDIA 3TDUA 4GGNA 1NWDA 1BU3A 5FYXA 4MZJA 2LANA 3BUMB 1H4BA 3VRPA 4MLWA 1TN4A 1K9KA 4CFQA 3LK0A 1AVSA 3CLNA 1PVBA 3OHMB 4PDZA 4YBHB 1A75A 5HLOA 5AANA 1L2OC 2O60A 2L4IA 2LAPA 1C07A 1WDCB 1C7VA 4XJKB 2P6BB 2LC5A 1J7RA 1Y1AA 3I5HC 1XVJA 1ALWA 2JXLA 2LP2A 3D10A 1XK4A 5D7FA 2ZN9A 2H2KA 2E6WA 4HRHA 4HREE 2JWWA 1WLZA 2MHHA 1BF5A 1QV1A 3CTNA 4GFTA 1F8HA 1C7WA 1DF0A 1QLSA 1XFZO 1JBAA 1QXPA 1F71A 2R2IA 1N2DA 4BY4A 1AK8A 4UPGA 1G4YR 1CKKA 1K93D 1YX7A 4D1EA 1CMGA 1DGUA 1RK9A 4CPVA 2FJUB 4AQJA 3JTDC 1PSBA 4JPZB 4JWQA 3ZWHA 2QACA 1DGVA 3EK7A 1F4QA 1TCOB 2BL0B 4MEWA 1CB1A 3M0WA 2HPSA 5CSJA 2A4JA 3AKAA 2KDHA 1XA5A 2Y1MA 4OCIA 2MA2A 3BUNB 3GK4X 3VRRA 2LMUA 2Q4UA 4XYNA 1ZUZA 4N1GA 2LLTA 5CPVA 3DVEA 1CFDA 1FF1A 2JTZA 1KK7Y 1K8UA 1WY9A 2AAOA 2MLEC 2PASA 4FQOA 4NDCA 3SJSA 4OV2A 1R2UA 2CT9A 2KI6C 3CWGA 1SCMC 1KSOA 5AXIA 2KI6D 2DOQA 1Y1UA 2KAXA 2KHNA 4Q04A 2KYFA 5I2OA 4WRIA 1WRKA 1CDLA 4P5OE 1TNQA 1NSHA 1UURA 2M9GA 3BYAA 2M49B 4ORAB 2JOJA 2WCBA 4N1FA 4YGAA 1XFVO 2LLSA 2CTNA 4DS7A 4GNKB 4GUKA 2O5GA 1EG4A 1SY9A 1DVIA 4YI9A 3AAKA 4NQGA 1L2OB 1YUSA 2EHBA 1UUSA 2L50A 2L51A 2LVKA 2WOSA 1DJGA 2WORA 5DKRA 1LA3A 3BOWB 3EVRA 4R1EA 1EXRA 3MSEB 1JF0A 3LK1A 3OB2B 5AEQA 4YGDB 1TOPA 2K7CA 4QJ5B 2MLFC 2BBMA 1RECA 2BL0C 1YVLA 3EKJA 3EVUA 2CXJA 2I94A 2LVIA 2HF5A 1FW4A 1AP4A 3EK4A 3SG5A 3PN7C 2I2RE 2JRFA 2KQ6A 4TNCA 3JTDB 4WQ2A 1K95A 1YUTA 2K7DA 1N0YA 2FOTA 3I5GC 3LL8B 1KFXL 3PSRA 1GGZA 1YRUB 3DF0B 1S1EA 2NXQA 1ZMZA 4PE4A 3VRQA 4ZCUA 1HQVA 3SG2A 1SW8A 1K9UA 1LKJA 1L7ZA 2ZFDA 3NXAA 2LE9B 1N65A 2K2AA 5BPJA 1HT9A 4YI8A 1SMGA 3D0YB 1S6CA 1OZOA 2AMIA 2L4HA 2M0RA 2LMTA 2BKIB 3A8RA 4GAOA 3CR4X 2JNXA 4A4CA 3JVTB 2SASA 1B8CA 4AOMA 1VRKA 3OB1B 1MQ1A 1QS7A 1MXLC 4FTGA 1OQPA 1LXFC 1SCMB 2GGZA 2NZ0A 3OX5A 2GV5A 2LMVA 2LNKA 1NCYA 1UHHA 5PALA 1YRTB 3RLZA 2COLB 2M1UA 4ICBA 3SIAA 5CSFA 4MRXA 2LVJA 4GGFC 3BXKA 2LLUA 4QJ3B 1M31A 1PK0D 2FCEA 4USLA 1EG3A 1QASA 1J7OA 2H61C 2I18A 1U5IB 1M39A 3BUWB 1DJYA 5KTYA 1DMOA 2NLNA 2M97A 4A4BA 1K90D 2ZNEA 1QX7A 1RJVA 1XFUO 1FI6A 2LV7A 2KFFA 3SIBA 1BLQA 2FCDA 1AUIB 3TUYC 1FBVA 4NDDA 1SCVA 3SG7A 5KSZA 3LCPC 4I5LB 5CSIA 1AHRA 5JOLA 1IQ3A 1KK8C 4HSZA 1NCXA 3DVJA 4XJKA 1K94A 4E68A 3WHUB 3ZNIA 3GOFA 4QJ4B 3KO0A 1V1GA 2V53A 4IL1A 2JT8A 1CNPA 1A29A 1BG1A 3DD4A 2QPTA 3KHEA 4U8DA 2Q91A 1CM4A 1KQMC 1SL8A 2KGRA 3PN7B 3I5FB 2SCPA 1DJWA 2MAZA 1NPQA 1QJTA 1XFYO 2JTTA 3I5GB 2K2FA 2BE4A 1UHNA 1MXEA 1QIWA 1W7IB 1Y0VH 3NSKA 4N5XA 2WNDA 3O78A 2OTGB 1S6JA 4PE0A 3NSIA 1TIZA 3EVVA 1OZSA 1KK7Z 1IWQA 1S5GY 3JVTC 1M63B 2JPTA 3O2PA 1UHJA 2LM5A 3IQOA 4PHMA 5F6TA 3QRXA 2G2BA 3GK2A 3AAJA 2JT0A 2WC8A 4PE1A 4DRWA 1LINA 2JZIA 4OKHA 4F0ZB 1CTRA 1GGWA 1EJ3A 4PHNA 1OMDA 1G8IA 1A2XA 1ZFSA 4MRYA 2ISDA 1F55A 2CNPA 3E3RA 3VGOA 1S36A 1PSRA 1BR1B 4DIRA 5AERA 1XFWO 3FS7A 1KFUL 2RGIA 3WNXB 1DT7B 1UP5A 2GGMA 1Y1XA 3PFVA 3KF9A 1S6IA 1B4CA 1XK4C 1B7TY
chains in the Genus database with same CATH superfamily
3LLEA 3AKBA 1IH0A 2LHIA 1BOCA 2CBLA 3F45A 4F7FA 1SSEB 1MHOA 1QX5B 3OGNA 1QWVA 2KNEA 2BECA 1OMRA 4PHJA 1YR5A 1W9ZA 1TCFA 1YURA 2B1UA 1CDNA 3TUYB 3FWCA 1JC2A 4OVNF 4I5JA 1CLMA 2BCXA 2JNFA 2PVBA 4MVFA 2L0PA 1K9PA 1KK8B 2ZN8A 1DEKA 3I5FC 3BOWA 3NSOA 2K60A 4AQIA 2QEOA 3CR5X 2PMYA 3PATA 5GQQC 2F3ZA 2KLDA 4MBEA 4HRGA 2OTGC 1CFCA 2OS8C 2MBXA 1WRZA 4DCKA 1DTLA 1KQMB 1CMFA 5HKZA 2ZNDA 1J7PA 1H8BA 1C3YA 4C0JA 3FIAA 2PRUA 4ETOA 4WQ3A 2WCKA 3EKHA 4I5KA 4L9MA 1SK6D 3IF7A 1WRLA 1NX1A 3SG6A 3DF0A 1EL4A 3WHTB 4C0KA 1AJ5A 1XYDA 2K8MB 3KPXA 4GBAA 3H4SE 1YUUA 2KAYA 1CFFA 4NDBA 3A4UB 5DKNA 3WXAA 2F2PA 3I5IC 1LA0A 2L5XB 4CIDA 3CYZA 3R1VA 3PLFB 2AUCA 3CGAA 1GQMA 1OE9B 1TNPA 2LP3A 2KGBC 2VRGA 3C1VA 2F8PA 5B8IB 5K89A 2H8VA 1K96A 4ORBB 1TNXA 2F33A 1KFXS 1E8AA 1CLBA 3HX4A 1OOGA 1TNWA 2LUXA 1F4OA 1B47A 1CDPA 1A75B 1NCZA 1QVIY 2WC6A 1B8LA 1YTZC 2KQYA 2QEBA 3IQQA 1DJZA 4PHKA 1ALVA 1KWOC 1TUZA 4DUQA 2M7NA 3GK1A 2ERBA 1Q80A 3NSLA 1B9AA 3DVKA 3PM8A 1MR8A 1SR6C 1U5IA 2F2OA 2D8NA 1DF0B 1Z2CB 5G08A 5ER5A 2KYCA 2JU0A 3EK8A 1DJHA 3HCMA 5D3OA 2K61A 2LVVA 2Y1NA 2E30A 2ZKMX 1SKTA 4I5NB 1DJIA 1MF8B 2HQWA 1QATA 1KSMA 2JT3A 2KAVA 3N7HA 4MZLA 1SYMA 2F3YA 3D74A 5I8NA 3BFAA 1BJFA 4PCWA 4YGEB 1FI5A 4C0LA 4CLNA 1JSAA 3CR2A 2KOTA 3K21A 3NHIA 1D1OA 1LVCD 1J1EA 4GPLB 3TS5C 3R1OA 4BY5A 1NUBA 1S3PA 1CFPA 1J55A 1R6PA 2OS8B 5FI7A 2QEHA 1J1DA 2LCPA 1IJ5A 1QV0A 2M7LA 2NCPA 1EH2A 3PM2A 1NX0A 1S5GZ 1BR4B 3L4LA 1NX3A 2PALA 4JKTA 1F54A 2KFGA 5ER4X 3SG3A 1DC1A 1BMOA 1B8RA 2LHLA 1NYAA 1PULA 1PALA 1A03A 2K7BA 2MJWB 3VRNA 1B1GA 1Y6WA 1IRJA 2K0JA 1S26D 1SNLA 1W7JB 1M46A 2WCJA 1FF1A 1RFJA 3ICBA 4OR9B 5DKQA 5HYDA 3I5IB 2BBNA 3FWBA 2KI4C 2JXCA 2L2CA 5AFPA 1YX8A 3KEVA 2BAPA 1SBJA 1UHIA 1CLLA 4P2YB 2G9BA 3TZ1A 1KQVA 1X02A 4M2OA 1OMVA 1QTXA 1SL9A 5I2LA 3RM1A 4YGCB 1RWYA 2BCBA 1ZOTB 2M29A 1BODA 1B7TZ 1V1FA 5I2QA 1JFKA 1QIVA 3BFHA 1IGVA 2NCOA 1TRFA 2L2EA 1PVAA 1DJXA 1OSAA 3CS1A 3BUOB 5HKWA 2CCMA 1UHKA 1PRWA 2EC6B 2M8UA 3D77A 1WDCC 3FE9A 1KWOB 1WLMA 4GGFA 4PE7A 1NIWA 5J3XA 1SL7A 5HKYA 2BCAA 3PALA 1J7QA 1MWNA 1AJ4A 2H61A 3RZSA 1CM1A 4PALA 3BUXB 1SR6B 3DXLA 3UO9A 2OPOA 1QLKA 2PYQA 2HQ8A 4ORCB 1IKUA 1M45A 1NX2A 2L5YA 2L98A 3NHTA 1FPWA 1IQ5A 5HLVA 3I5HB 2ZRSA 1MUXA 4MZKA 3V2LA 3O6BA 2M1KB 1TTXA 1UWOA 2BE6A 1KFUS 5D69A 1F70A 4ZCVA 3OBVA 3TS5B 1BT6A 4M2QA 2IS9A 2JPOA 3O4YA 1SPYA 2KSPA 4YRUA 2WCLA 1XO5A 4M2PA 4CFRA 3DVMA 5TNCA 3OP0A 1IJ6A 1NP8A 1JFJA 2WCMA 2WCEA 3OX6A 2M3WA 2Y4QA 1G33A 1XFXO 2YGUA 1JUOA 2LUCA 3QMEA 2PSRA 1A4PA 2JQ6A 3D76A 2Y5IA 5JJGA 1JF2A 1ODBA 2TN4A 1YVHA 4MSPA 5I94A 2BKHB 1Z4HA 2JC2A 3VROA 1ZACA 2P70A 4JQ0D 2KBMA 3D0YA 1RROA 2HETA 1IG5A 1RTP1 2KBIA 1JWDA 1SRAA 3SG4A 1K2HA 1CDMA 2I7AA 4YGBB 2KI4B 1OOFA 5KU1A 3CDNA 2JULA 3BQ3A 5IBWA 1OOJA 1QVIZ 2ZRTA 5CSNA 2MRDA 4MN0A 1GJYA 2WCFA 1KCYA 2KFHA 2EC6C 3CZTX 3TDZA 1QX2A 2EGDA 2K7OA 3TDIA 1C3ZA 3TDUA 3IVTA 4GGNA 1NWDA 1BU3A 1OW4A 4MZJA 5FYXA 2LANA 3BUMB 1H4BA 3VRPA 4MLWA 1TN4A 1K9KA 3FE6A 4CFQA 2BNXA 3LK0A 1AVSA 3CLNA 1PVBA 3OHMB 4PDZA 4YBHB 1A75A 5HLOA 5AANA 1L2OC 2O60A 2L4IA 2LAPA 1C07A 1WDCB 1C7VA 4XJKB 2P6BB 2LC5A 1J7RA 1Y1AA 3I5HC 1XVJA 1ALWA 2JXLA 2LP2A 3D10A 1XK4A 3B7AA 5D7FA 2ZN9A 2H2KA 2E6WA 4HRHA 4HREE 4OZDA 2QEVA 2JWWA 1WLZA 2MHHA 1BF5A 1QV1A 3CTNA 4GFTA 1F8HA 1C7WA 1DF0A 1QLSA 1XFZO 2QDIA 1QXPA 1JBAA 1F71A 2R2IA 1N2DA 4BY4A 4INWA 4UPGA 1AK8A 1G4YR 1CKKA 1K93D 1YX7A 4D1EA 1CMGA 1DGUA 1RK9A 4CPVA 2FJUB 4FQTA 3JTDC 1PSBA 4JPZB 4JWQA 3ZWHA 4AQJA 2QACA 1DGVA 3EK7A 1DQEA 1F4QA 1TCOB 2BL0B 4MEWA 1CB1A 3M0WA 2HPSA 5CSJA 3B87A 2A4JA 3AKAA 2KDHA 1XA5A 2Y1MA 4OCIA 2MA2A 3BUNB 5FI6A 3S0GA 3GK4X 3VRRA 3EG5B 3D75A 2LMUA 2Q4UA 4XYNA 1ZUZA 3PJIA 4N1GA 2PQLA 2LLTA 1GM0A 5CPVA 4JD9A 3DVEA 1CFDA 2WC5A 2JTZA 1KK7Y 1K8UA 1WY9A 2AAOA 2MLEC 2PASA 4FQOA 4NDCA 3SJSA 4OV2A 1R2UA 2CT9A 2KI6C 3DYEA 3CWGA 3DY9A 1SCMC 1KSOA 5AXIA 2KI6D 2DOQA 3BFBA 1ORGA 1Y1UA 2P71A 2KAXA 2KHNA 1LS8A 4Q04A 2KYFA 5I2OA 4WRIA 1WRKA 1CDLA 4P5OE 1TNQA 1NSHA 1UURA 2M9GA 3BYAA 4PT1A 2M49B 4ORAB 2JOJA 2WCBA 4N1FA 4YGAA 1XFVO 2LLSA 2CTNA 4DS7A 3O4XA 4GNKB 4GUKA 2O5GA 1EG4A 1SY9A 1DVIA 4YI9A 3AAKA 4NQGA 3L47A 1L2OB 1YUSA 2EHBA 1UUSA 2L50A 2L51A 2LVKA 2WOSA 1DJGA 2WORA 5DKRA 1LA3A 3SS3A 3BOWB 3EVRA 4R1EA 1EXRA 3MSEB 1JF0A 3LK1A 3CABA 3B86A 3OB2B 5AEQA 4YGDB 1TOPA 2K7CA 4QJ5B 3S0FA 2MLFC 2BBMA 1RECA 2BL0C 1YVLA 3EKJA 3EVUA 2CXJA 2I94A 2LVIA 2HF5A 3S0BA 1FW4A 1AP4A 3EK4A 3SG5A 3PN7C 2I2RE 2JRFA 2KQ6A 4TNCA 3JTDB 4WQ2A 1K95A 1YUTA 2K7DA 1N0YA 2FOTA 3I5GC 3LL8B 5HL1A 1KFXL 3PSRA 1GGZA 1YRUB 3B88A 1XFRA 3DF0B 1S1EA 2NXQA 1ZMZA 4PE4A 3VRQA 3BJHA 4ZCUA 3K1EA 1HQVA 3SG2A 1SW8A 1K9UA 1LKJA 5DICA 1L7ZA 1OOHA 4INXA 2ZFDA 3NXAA 2LE9B 1N65A 2K2AA 5BPJA 1HT9A 4YI8A 3FE8A 1SMGA 3CZ2A 1S6CA 3D0YB 1OZOA 2AMIA 2L4HA 2M0RA 4IJ7A 2LMTA 2BKIB 3R72A 3A8RA 4GAOA 1TUJA 2JNXA 3CR4X 3JVTB 2SASA 1B8CA 4A4CA 4AOMA 1VRKA 3OB1B 1T14A 1MQ1A 1QS7A 1MXLC 4FTGA 1OQPA 1LXFC 1SCMB 2GGZA 2NZ0A 3OX5A 2GV5A 2LMVA 2LNKA 1NCYA 1UHHA 2WCHA 5PALA 1YRTB 3RLZA 2COLB 2M1UA 4ICBA 3SIAA 5CSFA 4MRXA 2LVJA 4GGFC 3BXKA 2LLUA 4QJ3B 3B6XA 1M31A 1PK0D 2FCEA 4USLA 1EG3A 1QASA 1J7OA 4KYNA 2H61C 2I18A 1U5IB 1M39A 3D73A 3BUWB 1DJYA 5KTYA 1DMOA 2NLNA 2M97A 2GTEA 4A4BA 1K90D 2ZNEA 1QX7A 1RJVA 1XFUO 1FI6A 3Q8IA 2LV7A 2KFFA 3SIBA 1BLQA 3NGVA 2FCDA 1AUIB 3TUYC 1FBVA 4NDDA 1SCVA 3SG7A 5KSZA 3LCPC 4I5LB 5CSIA 1AHRA 5JOLA 1IQ3A 1KK8C 1P28A 1NCXA 3DVJA 4HSZA 1K94A 4XJKA 3WHUB 4E68A 3ZNIA 3GOFA 4QJ4B 3KO0A 1V1GA 2V53A 4IL1A 2JT8A 1CNPA 1A29A 1BG1A 3DD4A 2QPTA 3KHEA 3S0AA 4U8DA 3SS4A 2Q91A 3S0EA 1CM4A 3CZ1A 3VB1A 1KQMC 1SL8A 2KGRA 3PN7B 3I5FB 2SCPA 1DJWA 2FJYA 2MAZA 1NPQA 1QJTA 1XFYO 2JTTA 3I5GB 2K2FA 2BE4A 1UHNA 1MXEA 1QIWA 1W7IB 1Y0VH 3NSKA 4N5XA 5FI2A 2WNDA 3O78A 2OTGB 1S6JA 2KLEA 3R1PA 4PE0A 1IIOA 3NSIA 1TIZA 3EVVA 1OZSA 1KK7Z 5EL2A 1IWQA 1OOIX 1S5GY 3JVTC 1M63B 2JPTA 3O2PA 3S0DA 1UHJA 2LM5A 2KPHA 3IQOA 4PHMA 5F6TA 3QRXA 2G2BA 3GK2A 3AAJA 2JT0A 3D78A 2WC8A 4PE1A 4DRWA 1LINA 2JZIA 4OKHA 4F0ZB 1CTRA 1GGWA 1EJ3A 3CZ0A 4PHNA 1OMDA 1TWOA 1G8IA 1A2XA 1ZFSA 3DZTA 4MRYA 2ISDA 1F55A 2CNPA 3E3RA 3VGOA 3L4AA 1S36A 1PSRA 1BR1B 4DIRA 5AERA 1XFWO 3UNWA 3FS7A 1KFUL 2RGIA 3WNXB 1DT7B 1UP5A 2GGMA 1DELA 1Y1XA 3PFVA 3KF9A 3SS5A 1S6IA 1B4CA 1XK4C 1B7TY
chains in the Genus database with same CATH topology
3LLEA 3AKBA 1IH0A 2LHIA 1BOCA 2CBLA 3F45A 1MHOA 1QX5B 2KNEA 2BECA 1OMRA 4PHJA 1YR5A 1TCFA 1YURA 2B1UA 1CDNA 3TUYB 3FWCA 1JC2A 4OVNF 4I5JA 1CLMA 2BCXA 2JNFA 2PVBA 4MVFA 2L0PA 1K9PA 1KK8B 2ZN8A 3I5FC 3BOWA 3NSOA 4AQIA 3CR5X 2PMYA 3PATA 5GQQC 2F3ZA 4MBEA 4HRGA 2OTGC 1CFCA 2OS8C 2MBXA 1WRZA 4DCKA 1DTLA 1KQMB 1CMFA 5HKZA 2ZNDA 1J7PA 1H8BA 4C0JA 3FIAA 2PRUA 4ETOA 4WQ3A 3EKHA 4I5KA 4L9MA 1SK6D 3IF7A 1WRLA 1NX1A 3SG6A 3DF0A 1EL4A 3WHTB 4C0KA 1AJ5A 1XYDA 2K8MB 3KPXA 4GBAA 3H4SE 1YUUA 2KAYA 1CFFA 4NDBA 3A4UB 5DKNA 3WXAA 2F2PA 3I5IC 1LA0A 2L5XB 4CIDA 3PLFB 2AUCA 3CGAA 1GQMA 1OE9B 1TNPA 2LP3A 2KGBC 2VRGA 3C1VA 2F8PA 5B8IB 5K89A 1K96A 4ORBB 1TNXA 2F33A 1KFXS 1E8AA 1CLBA 3HX4A 1TNWA 2LUXA 1F4OA 1B47A 1CDPA 1A75B 1NCZA 1QVIY 1B8LA 1YTZC 2KQYA 3IQQA 4PHKA 1DJZA 1ALVA 1KWOC 4DUQA 2M7NA 3GK1A 1Q80A 3NSLA 1B9AA 3DVKA 3PM8A 1MR8A 1SR6C 1U5IA 2F2OA 2D8NA 1DF0B 5G08A 5ER5A 2KYCA 2JU0A 3EK8A 1DJHA 3HCMA 2K61A 2LVVA 2Y1NA 2E30A 2ZKMX 1SKTA 4I5NB 1DJIA 1MF8B 2HQWA 1QATA 1KSMA 2JT3A 2KAVA 4MZLA 5I8NA 1SYMA 2F3YA 1FI5A 4PCWA 1BJFA 4YGEB 4C0LA 4CLNA 1JSAA 3CR2A 2KOTA 3K21A 1D1OA 1LVCD 1J1EA 4GPLB 3TS5C 4BY5A 1NUBA 1S3PA 1CFPA 1J55A 1R6PA 2OS8B 1J1DA 2LCPA 1IJ5A 1QV0A 2M7LA 2NCPA 1EH2A 1NX0A 1S5GZ 1BR4B 1NX3A 2PALA 1F54A 2KFGA 5ER4X 3SG3A 1BMOA 1B8RA 2LHLA 1NYAA 1PULA 1PALA 1A03A 2K7BA 2MJWB 3VRNA 1B1GA 1Y6WA 1IRJA 2K0JA 1S26D 1SNLA 1W7JB 1M46A 1RFJA 3ICBA 4OR9B 5DKQA 5HYDA 3I5IB 2BBNA 3FWBA 2KI4C 2JXCA 5AFPA 1YX8A 3KEVA 1SBJA 1UHIA 1CLLA 4P2YB 2G9BA 3TZ1A 1KQVA 1X02A 4M2OA 1OMVA 1QTXA 1SL9A 5I2LA 3RM1A 4YGCB 1RWYA 2BCBA 1ZOTB 2M29A 1BODA 1B7TZ 1V1FA 5I2QA 1JFKA 1QIVA 1IGVA 2NCOA 1TRFA 2L2EA 1PVAA 1DJXA 1OSAA 3CS1A 3BUOB 5HKWA 2CCMA 1UHKA 1PRWA 2EC6B 2M8UA 4PE7A 1WDCC 1KWOB 1WLMA 4GGFA 1NIWA 5J3XA 1SL7A 5HKYA 2BCAA 3PALA 1J7QA 1MWNA 1AJ4A 2H61A 1CM1A 4PALA 3BUXB 1SR6B 2OPOA 1QLKA 4ORCB 2HQ8A 1IKUA 1M45A 1NX2A 2L98A 1FPWA 1IQ5A 5HLVA 3I5HB 2ZRSA 1MUXA 4MZKA 3O6BA 2M1KB 1TTXA 1UWOA 2BE6A 1KFUS 5D69A 1F70A 4ZCVA 3TS5B 1BT6A 4M2QA 2IS9A 3O4YA 1SPYA 2KSPA 4YRUA 1XO5A 4M2PA 4CFRA 3DVMA 5TNCA 3OP0A 1IJ6A 1NP8A 1JFJA 2WCEA 3OX6A 2M3WA 2Y4QA 1G33A 1XFXO 1JUOA 2LUCA 5JJGA 2PSRA 1A4PA 2JQ6A 2Y5IA 1JF2A 1ODBA 2TN4A 1YVHA 4MSPA 2BKHB 2JC2A 3VROA 1ZACA 4JQ0D 2KBMA 3D0YA 1RROA 2HETA 1IG5A 1RTP1 2KBIA 1JWDA 1SRAA 3SG4A 1K2HA 1CDMA 2I7AA 4YGBB 2KI4B 5KU1A 2JULA 3BQ3A 5IBWA 1OOJA 1QVIZ 2ZRTA 5CSNA 2MRDA 4MN0A 1GJYA 2WCFA 1KCYA 2KFHA 2EC6C 3CZTX 3TDZA 1QX2A 2EGDA 2K7OA 3TDIA 3TDUA 4GGNA 1NWDA 1BU3A 5FYXA 4MZJA 2LANA 3BUMB 1H4BA 3VRPA 4MLWA 1TN4A 1K9KA 4CFQA 3LK0A 1AVSA 3CLNA 1PVBA 3OHMB 4PDZA 4YBHB 1A75A 5HLOA 5AANA 1L2OC 2O60A 2L4IA 2LAPA 1C07A 1WDCB 1C7VA 4XJKB 2P6BB 2LC5A 1J7RA 1Y1AA 3I5HC 1XVJA 1ALWA 2JXLA 2LP2A 3D10A 1XK4A 5D7FA 2ZN9A 2H2KA 2E6WA 4HRHA 4HREE 2JWWA 1WLZA 2MHHA 1BF5A 1QV1A 3CTNA 4GFTA 1F8HA 1C7WA 1DF0A 1QLSA 1XFZO 1JBAA 1QXPA 1F71A 2R2IA 1N2DA 4BY4A 1AK8A 4UPGA 1G4YR 1CKKA 1K93D 1YX7A 4D1EA 1CMGA 1DGUA 1RK9A 4CPVA 2FJUB 4AQJA 3JTDC 1PSBA 4JPZB 4JWQA 3ZWHA 2QACA 1DGVA 3EK7A 1F4QA 1TCOB 2BL0B 4MEWA 1CB1A 3M0WA 2HPSA 5CSJA 2A4JA 3AKAA 2KDHA 1XA5A 2Y1MA 4OCIA 2MA2A 3BUNB 3GK4X 3VRRA 2LMUA 2Q4UA 4XYNA 1ZUZA 4N1GA 2LLTA 5CPVA 3DVEA 1CFDA 1FF1A 2JTZA 1KK7Y 1K8UA 1WY9A 2AAOA 2MLEC 2PASA 4FQOA 4NDCA 3SJSA 4OV2A 1R2UA 2CT9A 2KI6C 3CWGA 1SCMC 1KSOA 5AXIA 2KI6D 2DOQA 1Y1UA 2KAXA 2KHNA 4Q04A 2KYFA 5I2OA 4WRIA 1WRKA 1CDLA 4P5OE 1TNQA 1NSHA 1UURA 2M9GA 3BYAA 2M49B 4ORAB 2JOJA 2WCBA 4N1FA 4YGAA 1XFVO 2LLSA 2CTNA 4DS7A 4GNKB 4GUKA 2O5GA 1EG4A 1SY9A 1DVIA 4YI9A 3AAKA 4NQGA 1L2OB 1YUSA 2EHBA 1UUSA 2L50A 2L51A 2LVKA 2WOSA 1DJGA 2WORA 5DKRA 1LA3A 3BOWB 3EVRA 4R1EA 1EXRA 3MSEB 1JF0A 3LK1A 3OB2B 5AEQA 4YGDB 1TOPA 2K7CA 4QJ5B 2MLFC 2BBMA 1RECA 2BL0C 1YVLA 3EKJA 3EVUA 2CXJA 2I94A 2LVIA 2HF5A 1FW4A 1AP4A 3EK4A 3SG5A 3PN7C 2I2RE 2JRFA 2KQ6A 4TNCA 3JTDB 4WQ2A 1K95A 1YUTA 2K7DA 1N0YA 2FOTA 3I5GC 3LL8B 1KFXL 3PSRA 1GGZA 1YRUB 3DF0B 1S1EA 2NXQA 1ZMZA 4PE4A 3VRQA 4ZCUA 1HQVA 3SG2A 1SW8A 1K9UA 1LKJA 1L7ZA 2ZFDA 3NXAA 2LE9B 1N65A 2K2AA 5BPJA 1HT9A 4YI8A 1SMGA 3D0YB 1S6CA 1OZOA 2AMIA 2L4HA 2M0RA 2LMTA 2BKIB 3A8RA 4GAOA 3CR4X 2JNXA 4A4CA 3JVTB 2SASA 1B8CA 4AOMA 1VRKA 3OB1B 1MQ1A 1QS7A 1MXLC 4FTGA 1OQPA 1LXFC 1SCMB 2GGZA 2NZ0A 3OX5A 2GV5A 2LMVA 2LNKA 1NCYA 1UHHA 5PALA 1YRTB 3RLZA 2COLB 2M1UA 4ICBA 3SIAA 5CSFA 4MRXA 2LVJA 4GGFC 3BXKA 2LLUA 4QJ3B 1M31A 1PK0D 2FCEA 4USLA 1EG3A 1QASA 1J7OA 2H61C 2I18A 1U5IB 1M39A 3BUWB 1DJYA 5KTYA 1DMOA 2NLNA 2M97A 4A4BA 1K90D 2ZNEA 1QX7A 1RJVA 1XFUO 1FI6A 2LV7A 2KFFA 3SIBA 1BLQA 2FCDA 1AUIB 3TUYC 1FBVA 4NDDA 1SCVA 3SG7A 5KSZA 3LCPC 4I5LB 5CSIA 1AHRA 5JOLA 1IQ3A 1KK8C 4HSZA 1NCXA 3DVJA 4XJKA 1K94A 4E68A 3WHUB 3ZNIA 3GOFA 4QJ4B 3KO0A 1V1GA 2V53A 4IL1A 2JT8A 1CNPA 1A29A 1BG1A 3DD4A 2QPTA 3KHEA 4U8DA 2Q91A 1CM4A 1KQMC 1SL8A 2KGRA 3PN7B 3I5FB 2SCPA 1DJWA 2MAZA 1NPQA 1QJTA 1XFYO 2JTTA 3I5GB 2K2FA 2BE4A 1UHNA 1MXEA 1QIWA 1W7IB 1Y0VH 3NSKA 4N5XA 2WNDA 3O78A 2OTGB 1S6JA 4PE0A 3NSIA 1TIZA 3EVVA 1OZSA 1KK7Z 1IWQA 1S5GY 3JVTC 1M63B 2JPTA 3O2PA 1UHJA 2LM5A 3IQOA 4PHMA 5F6TA 3QRXA 2G2BA 3GK2A 3AAJA 2JT0A 2WC8A 4PE1A 4DRWA 1LINA 2JZIA 4OKHA 4F0ZB 1CTRA 1GGWA 1EJ3A 4PHNA 1OMDA 1G8IA 1A2XA 1ZFSA 4MRYA 2ISDA 1F55A 2CNPA 3E3RA 3VGOA 1S36A 1PSRA 1BR1B 4DIRA 5AERA 1XFWO 3FS7A 1KFUL 2RGIA 3WNXB 1DT7B 1UP5A 2GGMA 1Y1XA 3PFVA 3KF9A 1S6IA 1B4CA 1XK4C 1B7TY
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LLE A;  3AKB A;  1IH0 A;  2LHI A;  1BOC A;  2CBL A;  3F45 A;  1MHO A;  1QX5 B;  2KNE A;  2BEC A;  1OMR A;  4PHJ A;  1YR5 A;  1TCF A;  1YUR A;  2B1U A;  1CDN A;  3TUY B;  3FWC A;  1JC2 A;  4OVN F;  4I5J A;  1CLM A;  2BCX A;  2JNF A;  2PVB A;  4MVF A;  2L0P A;  1K9P A;  1KK8 B;  2ZN8 A;  3I5F C;  3BOW A;  3NSO A;  4AQI A;  3CR5 X;  2PMY A;  3PAT A;  5GQQ C;  2F3Z A;  4MBE A;  4HRG A;  2OTG C;  1CFC A;  2OS8 C;  2MBX A;  1WRZ A;  4DCK A;  1DTL A;  1KQM B;  1CMF A;  5HKZ A;  2ZND A;  1J7P A;  1H8B A;  4C0J A;  3FIA A;  2PRU A;  4ETO A;  4WQ3 A;  3EKH A;  4I5K A;  4L9M A;  1SK6 D;  3IF7 A;  1WRL A;  1NX1 A;  3SG6 A;  3DF0 A;  1EL4 A;  3WHT B;  4C0K A;  1AJ5 A;  1XYD A;  2K8M B;  3KPX A;  4GBA A;  3H4S E;  1YUU A;  2KAY A;  1CFF A;  4NDB A;  3A4U B;  5DKN A;  3WXA A;  2F2P A;  3I5I C;  1LA0 A;  2L5X B;  4CID A;  3PLF B;  2AUC A;  3CGA A;  1GQM A;  1OE9 B;  1TNP A;  2LP3 A;  2KGB C;  2VRG A;  3C1V A;  2F8P A;  5B8I B;  5K89 A;  1K96 A;  4ORB B;  1TNX A;  2F33 A;  1KFX S;  1E8A A;  1CLB A;  3HX4 A;  1TNW A;  2LUX A;  1F4O A;  1B47 A;  1CDP A;  1A75 B;  1NCZ A;  1QVI Y;  1B8L A;  1YTZ C;  2KQY A;  3IQQ A;  4PHK A;  1DJZ A;  1ALV A;  1KWO C;  4DUQ A;  2M7N A;  3GK1 A;  1Q80 A;  3NSL A;  1B9A A;  3DVK A;  3PM8 A;  1MR8 A;  1SR6 C;  1U5I A;  2F2O A;  2D8N A;  1DF0 B;  5G08 A;  5ER5 A;  2KYC A;  2JU0 A;  3EK8 A;  1DJH A;  3HCM A;  2K61 A;  2LVV A;  2Y1N A;  2E30 A;  2ZKM X;  1SKT A;  4I5N B;  1DJI A;  1MF8 B;  2HQW A;  1QAT A;  1KSM A;  2JT3 A;  2KAV A;  4MZL A;  5I8N A;  1SYM A;  2F3Y A;  1FI5 A;  4PCW A;  1BJF A;  4YGE B;  4C0L A;  4CLN A;  1JSA A;  3CR2 A;  2KOT A;  3K21 A;  1D1O A;  1LVC D;  1J1E A;  4GPL B;  3TS5 C;  4BY5 A;  1NUB A;  1S3P A;  1CFP A;  1J55 A;  1R6P A;  2OS8 B;  1J1D A;  2LCP A;  1IJ5 A;  1QV0 A;  2M7L A;  2NCP A;  1EH2 A;  1NX0 A;  1S5G Z;  1BR4 B;  1NX3 A;  2PAL A;  1F54 A;  2KFG A;  5ER4 X;  3SG3 A;  1BMO A;  1B8R A;  2LHL A;  1NYA A;  1PUL A;  1PAL A;  1A03 A;  2K7B A;  2MJW B;  3VRN A;  1B1G A;  1Y6W A;  1IRJ A;  2K0J A;  1S26 D;  1SNL A;  1W7J B;  1M46 A;  1RFJ A;  3ICB A;  4OR9 B;  5DKQ A;  5HYD A;  3I5I B;  2BBN A;  3FWB A;  2KI4 C;  2JXC A;  5AFP A;  1YX8 A;  3KEV A;  1SBJ A;  1UHI A;  1CLL A;  4P2Y B;  2G9B A;  3TZ1 A;  1KQV A;  1X02 A;  4M2O A;  1OMV A;  1QTX A;  1SL9 A;  5I2L A;  3RM1 A;  4YGC B;  1RWY A;  2BCB A;  1ZOT B;  2M29 A;  1BOD A;  1B7T Z;  1V1F A;  5I2Q A;  1JFK A;  1QIV A;  1IGV A;  2NCO A;  1TRF A;  2L2E A;  1PVA A;  1DJX A;  1OSA A;  3CS1 A;  3BUO B;  5HKW A;  2CCM A;  1UHK A;  1PRW A;  2EC6 B;  2M8U A;  4PE7 A;  1WDC C;  1KWO B;  1WLM A;  4GGF A;  1NIW A;  5J3X A;  1SL7 A;  5HKY A;  2BCA A;  3PAL A;  1J7Q A;  1MWN A;  1AJ4 A;  2H61 A;  1CM1 A;  4PAL A;  3BUX B;  1SR6 B;  2OPO A;  1QLK A;  4ORC B;  2HQ8 A;  1IKU A;  1M45 A;  1NX2 A;  2L98 A;  1FPW A;  1IQ5 A;  5HLV A;  3I5H B;  2ZRS A;  1MUX A;  4MZK A;  3O6B A;  2M1K B;  1TTX A;  1UWO A;  2BE6 A;  1KFU S;  5D69 A;  1F70 A;  4ZCV A;  3TS5 B;  1BT6 A;  4M2Q A;  2IS9 A;  3O4Y A;  1SPY A;  2KSP A;  4YRU A;  1XO5 A;  4M2P A;  4CFR A;  3DVM A;  5TNC A;  3OP0 A;  1IJ6 A;  1NP8 A;  1JFJ A;  2WCE A;  3OX6 A;  2M3W A;  2Y4Q A;  1G33 A;  1XFX O;  1JUO A;  2LUC A;  5JJG A;  2PSR A;  1A4P A;  2JQ6 A;  2Y5I A;  1JF2 A;  1ODB A;  2TN4 A;  1YVH A;  4MSP A;  2BKH B;  2JC2 A;  3VRO A;  1ZAC A;  4JQ0 D;  2KBM A;  3D0Y A;  1RRO A;  2HET A;  1IG5 A;  1RTP 1;  2KBI A;  1JWD A;  1SRA A;  3SG4 A;  1K2H A;  1CDM A;  2I7A A;  4YGB B;  2KI4 B;  5KU1 A;  2JUL A;  3BQ3 A;  5IBW A;  1OOJ A;  1QVI Z;  2ZRT A;  5CSN A;  2MRD A;  4MN0 A;  1GJY A;  2WCF A;  1KCY A;  2KFH A;  2EC6 C;  3CZT X;  3TDZ A;  1QX2 A;  2EGD A;  2K7O A;  3TDI A;  3TDU A;  4GGN A;  1NWD A;  1BU3 A;  5FYX A;  4MZJ A;  2LAN A;  3BUM B;  1H4B A;  3VRP A;  4MLW A;  1TN4 A;  1K9K A;  4CFQ A;  3LK0 A;  1AVS A;  3CLN A;  1PVB A;  3OHM B;  4PDZ A;  4YBH B;  1A75 A;  5HLO A;  5AAN A;  1L2O C;  2O60 A;  2L4I A;  2LAP A;  1C07 A;  1WDC B;  1C7V A;  4XJK B;  2P6B B;  2LC5 A;  1J7R A;  1Y1A A;  3I5H C;  1XVJ A;  1ALW A;  2JXL A;  2LP2 A;  3D10 A;  1XK4 A;  5D7F A;  2ZN9 A;  2H2K A;  2E6W A;  4HRH A;  4HRE E;  2JWW A;  1WLZ A;  2MHH A;  1BF5 A;  1QV1 A;  3CTN A;  4GFT A;  1F8H A;  1C7W A;  1DF0 A;  1QLS A;  1XFZ O;  1JBA A;  1QXP A;  1F71 A;  2R2I A;  1N2D A;  4BY4 A;  1AK8 A;  4UPG A;  1G4Y R;  1CKK A;  1K93 D;  1YX7 A;  4D1E A;  1CMG A;  1DGU A;  1RK9 A;  4CPV A;  2FJU B;  4AQJ A;  3JTD C;  1PSB A;  4JPZ B;  4JWQ A;  3ZWH A;  2QAC A;  1DGV A;  3EK7 A;  1F4Q A;  1TCO B;  2BL0 B;  4MEW A;  1CB1 A;  3M0W A;  2HPS A;  5CSJ A;  2A4J A;  3AKA A;  2KDH A;  1XA5 A;  2Y1M A;  4OCI A;  2MA2 A;  3BUN B;  3GK4 X;  3VRR A;  2LMU A;  2Q4U A;  4XYN A;  1ZUZ A;  4N1G A;  2LLT A;  5CPV A;  3DVE A;  1CFD A;  1FF1 A;  2JTZ A;  1KK7 Y;  1K8U A;  1WY9 A;  2AAO A;  2MLE C;  2PAS A;  4FQO A;  4NDC A;  3SJS A;  4OV2 A;  1R2U A;  2CT9 A;  2KI6 C;  3CWG A;  1SCM C;  1KSO A;  5AXI A;  2KI6 D;  2DOQ A;  1Y1U A;  2KAX A;  2KHN A;  4Q04 A;  2KYF A;  5I2O A;  4WRI A;  1WRK A;  1CDL A;  4P5O E;  1TNQ A;  1NSH A;  1UUR A;  2M9G A;  3BYA A;  2M49 B;  4ORA B;  2JOJ A;  2WCB A;  4N1F A;  4YGA A;  1XFV O;  2LLS A;  2CTN A;  4DS7 A;  4GNK B;  4GUK A;  2O5G A;  1EG4 A;  1SY9 A;  1DVI A;  4YI9 A;  3AAK A;  4NQG A;  1L2O B;  1YUS A;  2EHB A;  1UUS A;  2L50 A;  2L51 A;  2LVK A;  2WOS A;  1DJG A;  2WOR A;  5DKR A;  1LA3 A;  3BOW B;  3EVR A;  4R1E A;  1EXR A;  3MSE B;  1JF0 A;  3LK1 A;  3OB2 B;  5AEQ A;  4YGD B;  1TOP A;  2K7C A;  4QJ5 B;  2MLF C;  2BBM A;  1REC A;  2BL0 C;  1YVL A;  3EKJ A;  3EVU A;  2CXJ A;  2I94 A;  2LVI A;  2HF5 A;  1FW4 A;  1AP4 A;  3EK4 A;  3SG5 A;  3PN7 C;  2I2R E;  2JRF A;  2KQ6 A;  4TNC A;  3JTD B;  4WQ2 A;  1K95 A;  1YUT A;  2K7D A;  1N0Y A;  2FOT A;  3I5G C;  3LL8 B;  1KFX L;  3PSR A;  1GGZ A;  1YRU B;  3DF0 B;  1S1E A;  2NXQ A;  1ZMZ A;  4PE4 A;  3VRQ A;  4ZCU A;  1HQV A;  3SG2 A;  1SW8 A;  1K9U A;  1LKJ A;  1L7Z A;  2ZFD A;  3NXA A;  2LE9 B;  1N65 A;  2K2A A;  5BPJ A;  1HT9 A;  4YI8 A;  1SMG A;  3D0Y B;  1S6C A;  1OZO A;  2AMI A;  2L4H A;  2M0R A;  2LMT A;  2BKI B;  3A8R A;  4GAO A;  3CR4 X;  2JNX A;  4A4C A;  3JVT B;  2SAS A;  1B8C A;  4AOM A;  1VRK A;  3OB1 B;  1MQ1 A;  1QS7 A;  1MXL C;  4FTG A;  1OQP A;  1LXF C;  1SCM B;  2GGZ A;  2NZ0 A;  3OX5 A;  2GV5 A;  2LMV A;  2LNK A;  1NCY A;  1UHH A;  5PAL A;  1YRT B;  3RLZ A;  2COL B;  2M1U A;  4ICB A;  3SIA A;  5CSF A;  4MRX A;  2LVJ A;  4GGF C;  3BXK A;  2LLU A;  4QJ3 B;  1M31 A;  1PK0 D;  2FCE A;  4USL A;  1EG3 A;  1QAS A;  1J7O A;  2H61 C;  2I18 A;  1U5I B;  1M39 A;  3BUW B;  1DJY A;  5KTY A;  1DMO A;  2NLN A;  2M97 A;  4A4B A;  1K90 D;  2ZNE A;  1QX7 A;  1RJV A;  1XFU O;  1FI6 A;  2LV7 A;  2KFF A;  3SIB A;  1BLQ A;  2FCD A;  1AUI B;  3TUY C;  1FBV A;  4NDD A;  1SCV A;  3SG7 A;  5KSZ A;  3LCP C;  4I5L B;  5CSI A;  1AHR A;  5JOL A;  1IQ3 A;  1KK8 C;  4HSZ A;  1NCX A;  3DVJ A;  4XJK A;  1K94 A;  4E68 A;  3WHU B;  3ZNI A;  3GOF A;  4QJ4 B;  3KO0 A;  1V1G A;  2V53 A;  4IL1 A;  2JT8 A;  1CNP A;  1A29 A;  1BG1 A;  3DD4 A;  2QPT A;  3KHE A;  4U8D A;  2Q91 A;  1CM4 A;  1KQM C;  1SL8 A;  2KGR A;  3PN7 B;  3I5F B;  2SCP A;  1DJW A;  2MAZ A;  1NPQ A;  1QJT A;  1XFY O;  2JTT A;  3I5G B;  2K2F A;  2BE4 A;  1UHN A;  1MXE A;  1QIW A;  1W7I B;  1Y0V H;  3NSK A;  4N5X A;  2WND A;  3O78 A;  2OTG B;  1S6J A;  4PE0 A;  3NSI A;  1TIZ A;  3EVV A;  1OZS A;  1KK7 Z;  1IWQ A;  1S5G Y;  3JVT C;  1M63 B;  2JPT A;  3O2P A;  1UHJ A;  2LM5 A;  3IQO A;  4PHM A;  5F6T A;  3QRX A;  2G2B A;  3GK2 A;  3AAJ A;  2JT0 A;  2WC8 A;  4PE1 A;  4DRW A;  1LIN A;  2JZI A;  4OKH A;  4F0Z B;  1CTR A;  1GGW A;  1EJ3 A;  4PHN A;  1OMD A;  1G8I A;  1A2X A;  1ZFS A;  4MRY A;  2ISD A;  1F55 A;  2CNP A;  3E3R A;  3VGO A;  1S36 A;  1PSR A;  1BR1 B;  4DIR A;  5AER A;  1XFW O;  3FS7 A;  1KFU L;  2RGI A;  3WNX B;  1DT7 B;  1UP5 A;  2GGM A;  1Y1X A;  3PFV A;  3KF9 A;  1S6I A;  1B4C A;  1XK4 C;  1B7T Y; 
#chains in the Genus database with same CATH topology
 3LLE A;  3AKB A;  1IH0 A;  2LHI A;  1BOC A;  2CBL A;  3F45 A;  4F7F A;  1SSE B;  1MHO A;  1QX5 B;  3OGN A;  1QWV A;  2KNE A;  2BEC A;  1OMR A;  4PHJ A;  1YR5 A;  1W9Z A;  1TCF A;  1YUR A;  2B1U A;  1CDN A;  3TUY B;  3FWC A;  1JC2 A;  4OVN F;  4I5J A;  1CLM A;  2BCX A;  2JNF A;  2PVB A;  4MVF A;  2L0P A;  1K9P A;  1KK8 B;  2ZN8 A;  1DEK A;  3I5F C;  3BOW A;  3NSO A;  2K60 A;  4AQI A;  2QEO A;  3CR5 X;  2PMY A;  3PAT A;  5GQQ C;  2F3Z A;  2KLD A;  4MBE A;  4HRG A;  2OTG C;  1CFC A;  2OS8 C;  2MBX A;  1WRZ A;  4DCK A;  1DTL A;  1KQM B;  1CMF A;  5HKZ A;  2ZND A;  1J7P A;  1H8B A;  1C3Y A;  4C0J A;  3FIA A;  2PRU A;  4ETO A;  4WQ3 A;  2WCK A;  3EKH A;  4I5K A;  4L9M A;  1SK6 D;  3IF7 A;  1WRL A;  1NX1 A;  3SG6 A;  3DF0 A;  1EL4 A;  3WHT B;  4C0K A;  1AJ5 A;  1XYD A;  2K8M B;  3KPX A;  4GBA A;  3H4S E;  1YUU A;  2KAY A;  1CFF A;  4NDB A;  3A4U B;  5DKN A;  3WXA A;  2F2P A;  3I5I C;  1LA0 A;  2L5X B;  4CID A;  3CYZ A;  3R1V A;  3PLF B;  2AUC A;  3CGA A;  1GQM A;  1OE9 B;  1TNP A;  2LP3 A;  2KGB C;  2VRG A;  3C1V A;  2F8P A;  5B8I B;  5K89 A;  2H8V A;  1K96 A;  4ORB B;  1TNX A;  2F33 A;  1KFX S;  1E8A A;  1CLB A;  3HX4 A;  1OOG A;  1TNW A;  2LUX A;  1F4O A;  1B47 A;  1CDP A;  1A75 B;  1NCZ A;  1QVI Y;  2WC6 A;  1B8L A;  1YTZ C;  2KQY A;  2QEB A;  3IQQ A;  1DJZ A;  4PHK A;  1ALV A;  1KWO C;  1TUZ A;  4DUQ A;  2M7N A;  3GK1 A;  2ERB A;  1Q80 A;  3NSL A;  1B9A A;  3DVK A;  3PM8 A;  1MR8 A;  1SR6 C;  1U5I A;  2F2O A;  2D8N A;  1DF0 B;  1Z2C B;  5G08 A;  5ER5 A;  2KYC A;  2JU0 A;  3EK8 A;  1DJH A;  3HCM A;  5D3O A;  2K61 A;  2LVV A;  2Y1N A;  2E30 A;  2ZKM X;  1SKT A;  4I5N B;  1DJI A;  1MF8 B;  2HQW A;  1QAT A;  1KSM A;  2JT3 A;  2KAV A;  3N7H A;  4MZL A;  1SYM A;  2F3Y A;  3D74 A;  5I8N A;  3BFA A;  1BJF A;  4PCW A;  4YGE B;  1FI5 A;  4C0L A;  4CLN A;  1JSA A;  3CR2 A;  2KOT A;  3K21 A;  3NHI A;  1D1O A;  1LVC D;  1J1E A;  4GPL B;  3TS5 C;  3R1O A;  4BY5 A;  1NUB A;  1S3P A;  1CFP A;  1J55 A;  1R6P A;  2OS8 B;  5FI7 A;  2QEH A;  1J1D A;  2LCP A;  1IJ5 A;  1QV0 A;  2M7L A;  2NCP A;  1EH2 A;  3PM2 A;  1NX0 A;  1S5G Z;  1BR4 B;  3L4L A;  1NX3 A;  2PAL A;  4JKT A;  1F54 A;  2KFG A;  5ER4 X;  3SG3 A;  1DC1 A;  1BMO A;  1B8R A;  2LHL A;  1NYA A;  1PUL A;  1PAL A;  1A03 A;  2K7B A;  2MJW B;  3VRN A;  1B1G A;  1Y6W A;  1IRJ A;  2K0J A;  1S26 D;  1SNL A;  1W7J B;  1M46 A;  2WCJ A;  1FF1 A;  1RFJ A;  3ICB A;  4OR9 B;  5DKQ A;  5HYD A;  3I5I B;  2BBN A;  3FWB A;  2KI4 C;  2JXC A;  2L2C A;  5AFP A;  1YX8 A;  3KEV A;  2BAP A;  1SBJ A;  1UHI A;  1CLL A;  4P2Y B;  2G9B A;  3TZ1 A;  1KQV A;  1X02 A;  4M2O A;  1OMV A;  1QTX A;  1SL9 A;  5I2L A;  3RM1 A;  4YGC B;  1RWY A;  2BCB A;  1ZOT B;  2M29 A;  1BOD A;  1B7T Z;  1V1F A;  5I2Q A;  1JFK A;  1QIV A;  3BFH A;  1IGV A;  2NCO A;  1TRF A;  2L2E A;  1PVA A;  1DJX A;  1OSA A;  3CS1 A;  3BUO B;  5HKW A;  2CCM A;  1UHK A;  1PRW A;  2EC6 B;  2M8U A;  3D77 A;  1WDC C;  3FE9 A;  1KWO B;  1WLM A;  4GGF A;  4PE7 A;  1NIW A;  5J3X A;  1SL7 A;  5HKY A;  2BCA A;  3PAL A;  1J7Q A;  1MWN A;  1AJ4 A;  2H61 A;  3RZS A;  1CM1 A;  4PAL A;  3BUX B;  1SR6 B;  3DXL A;  3UO9 A;  2OPO A;  1QLK A;  2PYQ A;  2HQ8 A;  4ORC B;  1IKU A;  1M45 A;  1NX2 A;  2L5Y A;  2L98 A;  3NHT A;  1FPW A;  1IQ5 A;  5HLV A;  3I5H B;  2ZRS A;  1MUX A;  4MZK A;  3V2L A;  3O6B A;  2M1K B;  1TTX A;  1UWO A;  2BE6 A;  1KFU S;  5D69 A;  1F70 A;  4ZCV A;  3OBV A;  3TS5 B;  1BT6 A;  4M2Q A;  2IS9 A;  2JPO A;  3O4Y A;  1SPY A;  2KSP A;  4YRU A;  2WCL A;  1XO5 A;  4M2P A;  4CFR A;  3DVM A;  5TNC A;  3OP0 A;  1IJ6 A;  1NP8 A;  1JFJ A;  2WCM A;  2WCE A;  3OX6 A;  2M3W A;  2Y4Q A;  1G33 A;  1XFX O;  2YGU A;  1JUO A;  2LUC A;  3QME A;  2PSR A;  1A4P A;  2JQ6 A;  3D76 A;  2Y5I A;  5JJG A;  1JF2 A;  1ODB A;  2TN4 A;  1YVH A;  4MSP A;  5I94 A;  2BKH B;  1Z4H A;  2JC2 A;  3VRO A;  1ZAC A;  2P70 A;  4JQ0 D;  2KBM A;  3D0Y A;  1RRO A;  2HET A;  1IG5 A;  1RTP 1;  2KBI A;  1JWD A;  1SRA A;  3SG4 A;  1K2H A;  1CDM A;  2I7A A;  4YGB B;  2KI4 B;  1OOF A;  5KU1 A;  3CDN A;  2JUL A;  3BQ3 A;  5IBW A;  1OOJ A;  1QVI Z;  2ZRT A;  5CSN A;  2MRD A;  4MN0 A;  1GJY A;  2WCF A;  1KCY A;  2KFH A;  2EC6 C;  3CZT X;  3TDZ A;  1QX2 A;  2EGD A;  2K7O A;  3TDI A;  1C3Z A;  3TDU A;  3IVT A;  4GGN A;  1NWD A;  1BU3 A;  1OW4 A;  4MZJ A;  5FYX A;  2LAN A;  3BUM B;  1H4B A;  3VRP A;  4MLW A;  1TN4 A;  1K9K A;  3FE6 A;  4CFQ A;  2BNX A;  3LK0 A;  1AVS A;  3CLN A;  1PVB A;  3OHM B;  4PDZ A;  4YBH B;  1A75 A;  5HLO A;  5AAN A;  1L2O C;  2O60 A;  2L4I A;  2LAP A;  1C07 A;  1WDC B;  1C7V A;  4XJK B;  2P6B B;  2LC5 A;  1J7R A;  1Y1A A;  3I5H C;  1XVJ A;  1ALW A;  2JXL A;  2LP2 A;  3D10 A;  1XK4 A;  3B7A A;  5D7F A;  2ZN9 A;  2H2K A;  2E6W A;  4HRH A;  4HRE E;  4OZD A;  2QEV A;  2JWW A;  1WLZ A;  2MHH A;  1BF5 A;  1QV1 A;  3CTN A;  4GFT A;  1F8H A;  1C7W A;  1DF0 A;  1QLS A;  1XFZ O;  2QDI A;  1QXP A;  1JBA A;  1F71 A;  2R2I A;  1N2D A;  4BY4 A;  4INW A;  4UPG A;  1AK8 A;  1G4Y R;  1CKK A;  1K93 D;  1YX7 A;  4D1E A;  1CMG A;  1DGU A;  1RK9 A;  4CPV A;  2FJU B;  4FQT A;  3JTD C;  1PSB A;  4JPZ B;  4JWQ A;  3ZWH A;  4AQJ A;  2QAC A;  1DGV A;  3EK7 A;  1DQE A;  1F4Q A;  1TCO B;  2BL0 B;  4MEW A;  1CB1 A;  3M0W A;  2HPS A;  5CSJ A;  3B87 A;  2A4J A;  3AKA A;  2KDH A;  1XA5 A;  2Y1M A;  4OCI A;  2MA2 A;  3BUN B;  5FI6 A;  3S0G A;  3GK4 X;  3VRR A;  3EG5 B;  3D75 A;  2LMU A;  2Q4U A;  4XYN A;  1ZUZ A;  3PJI A;  4N1G A;  2PQL A;  2LLT A;  1GM0 A;  5CPV A;  4JD9 A;  3DVE A;  1CFD A;  2WC5 A;  2JTZ A;  1KK7 Y;  1K8U A;  1WY9 A;  2AAO A;  2MLE C;  2PAS A;  4FQO A;  4NDC A;  3SJS A;  4OV2 A;  1R2U A;  2CT9 A;  2KI6 C;  3DYE A;  3CWG A;  3DY9 A;  1SCM C;  1KSO A;  5AXI A;  2KI6 D;  2DOQ A;  3BFB A;  1ORG A;  1Y1U A;  2P71 A;  2KAX A;  2KHN A;  1LS8 A;  4Q04 A;  2KYF A;  5I2O A;  4WRI A;  1WRK A;  1CDL A;  4P5O E;  1TNQ A;  1NSH A;  1UUR A;  2M9G A;  3BYA A;  4PT1 A;  2M49 B;  4ORA B;  2JOJ A;  2WCB A;  4N1F A;  4YGA A;  1XFV O;  2LLS A;  2CTN A;  4DS7 A;  3O4X A;  4GNK B;  4GUK A;  2O5G A;  1EG4 A;  1SY9 A;  1DVI A;  4YI9 A;  3AAK A;  4NQG A;  3L47 A;  1L2O B;  1YUS A;  2EHB A;  1UUS A;  2L50 A;  2L51 A;  2LVK A;  2WOS A;  1DJG A;  2WOR A;  5DKR A;  1LA3 A;  3SS3 A;  3BOW B;  3EVR A;  4R1E A;  1EXR A;  3MSE B;  1JF0 A;  3LK1 A;  3CAB A;  3B86 A;  3OB2 B;  5AEQ A;  4YGD B;  1TOP A;  2K7C A;  4QJ5 B;  3S0F A;  2MLF C;  2BBM A;  1REC A;  2BL0 C;  1YVL A;  3EKJ A;  3EVU A;  2CXJ A;  2I94 A;  2LVI A;  2HF5 A;  3S0B A;  1FW4 A;  1AP4 A;  3EK4 A;  3SG5 A;  3PN7 C;  2I2R E;  2JRF A;  2KQ6 A;  4TNC A;  3JTD B;  4WQ2 A;  1K95 A;  1YUT A;  2K7D A;  1N0Y A;  2FOT A;  3I5G C;  3LL8 B;  5HL1 A;  1KFX L;  3PSR A;  1GGZ A;  1YRU B;  3B88 A;  1XFR A;  3DF0 B;  1S1E A;  2NXQ A;  1ZMZ A;  4PE4 A;  3VRQ A;  3BJH A;  4ZCU A;  3K1E A;  1HQV A;  3SG2 A;  1SW8 A;  1K9U A;  1LKJ A;  5DIC A;  1L7Z A;  1OOH A;  4INX A;  2ZFD A;  3NXA A;  2LE9 B;  1N65 A;  2K2A A;  5BPJ A;  1HT9 A;  4YI8 A;  3FE8 A;  1SMG A;  3CZ2 A;  1S6C A;  3D0Y B;  1OZO A;  2AMI A;  2L4H A;  2M0R A;  4IJ7 A;  2LMT A;  2BKI B;  3R72 A;  3A8R A;  4GAO A;  1TUJ A;  2JNX A;  3CR4 X;  3JVT B;  2SAS A;  1B8C A;  4A4C A;  4AOM A;  1VRK A;  3OB1 B;  1T14 A;  1MQ1 A;  1QS7 A;  1MXL C;  4FTG A;  1OQP A;  1LXF C;  1SCM B;  2GGZ A;  2NZ0 A;  3OX5 A;  2GV5 A;  2LMV A;  2LNK A;  1NCY A;  1UHH A;  2WCH A;  5PAL A;  1YRT B;  3RLZ A;  2COL B;  2M1U A;  4ICB A;  3SIA A;  5CSF A;  4MRX A;  2LVJ A;  4GGF C;  3BXK A;  2LLU A;  4QJ3 B;  3B6X A;  1M31 A;  1PK0 D;  2FCE A;  4USL A;  1EG3 A;  1QAS A;  1J7O A;  4KYN A;  2H61 C;  2I18 A;  1U5I B;  1M39 A;  3D73 A;  3BUW B;  1DJY A;  5KTY A;  1DMO A;  2NLN A;  2M97 A;  2GTE A;  4A4B A;  1K90 D;  2ZNE A;  1QX7 A;  1RJV A;  1XFU O;  1FI6 A;  3Q8I A;  2LV7 A;  2KFF A;  3SIB A;  1BLQ A;  3NGV A;  2FCD A;  1AUI B;  3TUY C;  1FBV A;  4NDD A;  1SCV A;  3SG7 A;  5KSZ A;  3LCP C;  4I5L B;  5CSI A;  1AHR A;  5JOL A;  1IQ3 A;  1KK8 C;  1P28 A;  1NCX A;  3DVJ A;  4HSZ A;  1K94 A;  4XJK A;  3WHU B;  4E68 A;  3ZNI A;  3GOF A;  4QJ4 B;  3KO0 A;  1V1G A;  2V53 A;  4IL1 A;  2JT8 A;  1CNP A;  1A29 A;  1BG1 A;  3DD4 A;  2QPT A;  3KHE A;  3S0A A;  4U8D A;  3SS4 A;  2Q91 A;  3S0E A;  1CM4 A;  3CZ1 A;  3VB1 A;  1KQM C;  1SL8 A;  2KGR A;  3PN7 B;  3I5F B;  2SCP A;  1DJW A;  2FJY A;  2MAZ A;  1NPQ A;  1QJT A;  1XFY O;  2JTT A;  3I5G B;  2K2F A;  2BE4 A;  1UHN A;  1MXE A;  1QIW A;  1W7I B;  1Y0V H;  3NSK A;  4N5X A;  5FI2 A;  2WND A;  3O78 A;  2OTG B;  1S6J A;  2KLE A;  3R1P A;  4PE0 A;  1IIO A;  3NSI A;  1TIZ A;  3EVV A;  1OZS A;  1KK7 Z;  5EL2 A;  1IWQ A;  1OOI X;  1S5G Y;  3JVT C;  1M63 B;  2JPT A;  3O2P A;  3S0D A;  1UHJ A;  2LM5 A;  2KPH A;  3IQO A;  4PHM A;  5F6T A;  3QRX A;  2G2B A;  3GK2 A;  3AAJ A;  2JT0 A;  3D78 A;  2WC8 A;  4PE1 A;  4DRW A;  1LIN A;  2JZI A;  4OKH A;  4F0Z B;  1CTR A;  1GGW A;  1EJ3 A;  3CZ0 A;  4PHN A;  1OMD A;  1TWO A;  1G8I A;  1A2X A;  1ZFS A;  3DZT A;  4MRY A;  2ISD A;  1F55 A;  2CNP A;  3E3R A;  3VGO A;  3L4A A;  1S36 A;  1PSR A;  1BR1 B;  4DIR A;  5AER A;  1XFW O;  3UNW A;  3FS7 A;  1KFU L;  2RGI A;  3WNX B;  1DT7 B;  1UP5 A;  2GGM A;  1DEL A;  1Y1X A;  3PFV A;  3KF9 A;  3SS5 A;  1S6I A;  1B4C A;  1XK4 C;  1B7T Y; 
#chains in the Genus database with same CATH homology
 3LLE A;  3AKB A;  1IH0 A;  2LHI A;  1BOC A;  2CBL A;  3F45 A;  1MHO A;  1QX5 B;  2KNE A;  2BEC A;  1OMR A;  4PHJ A;  1YR5 A;  1TCF A;  1YUR A;  2B1U A;  1CDN A;  3TUY B;  3FWC A;  1JC2 A;  4OVN F;  4I5J A;  1CLM A;  2BCX A;  2JNF A;  2PVB A;  4MVF A;  2L0P A;  1K9P A;  1KK8 B;  2ZN8 A;  3I5F C;  3BOW A;  3NSO A;  4AQI A;  3CR5 X;  2PMY A;  3PAT A;  5GQQ C;  2F3Z A;  4MBE A;  4HRG A;  2OTG C;  1CFC A;  2OS8 C;  2MBX A;  1WRZ A;  4DCK A;  1DTL A;  1KQM B;  1CMF A;  5HKZ A;  2ZND A;  1J7P A;  1H8B A;  4C0J A;  3FIA A;  2PRU A;  4ETO A;  4WQ3 A;  3EKH A;  4I5K A;  4L9M A;  1SK6 D;  3IF7 A;  1WRL A;  1NX1 A;  3SG6 A;  3DF0 A;  1EL4 A;  3WHT B;  4C0K A;  1AJ5 A;  1XYD A;  2K8M B;  3KPX A;  4GBA A;  3H4S E;  1YUU A;  2KAY A;  1CFF A;  4NDB A;  3A4U B;  5DKN A;  3WXA A;  2F2P A;  3I5I C;  1LA0 A;  2L5X B;  4CID A;  3PLF B;  2AUC A;  3CGA A;  1GQM A;  1OE9 B;  1TNP A;  2LP3 A;  2KGB C;  2VRG A;  3C1V A;  2F8P A;  5B8I B;  5K89 A;  1K96 A;  4ORB B;  1TNX A;  2F33 A;  1KFX S;  1E8A A;  1CLB A;  3HX4 A;  1TNW A;  2LUX A;  1F4O A;  1B47 A;  1CDP A;  1A75 B;  1NCZ A;  1QVI Y;  1B8L A;  1YTZ C;  2KQY A;  3IQQ A;  4PHK A;  1DJZ A;  1ALV A;  1KWO C;  4DUQ A;  2M7N A;  3GK1 A;  1Q80 A;  3NSL A;  1B9A A;  3DVK A;  3PM8 A;  1MR8 A;  1SR6 C;  1U5I A;  2F2O A;  2D8N A;  1DF0 B;  5G08 A;  5ER5 A;  2KYC A;  2JU0 A;  3EK8 A;  1DJH A;  3HCM A;  2K61 A;  2LVV A;  2Y1N A;  2E30 A;  2ZKM X;  1SKT A;  4I5N B;  1DJI A;  1MF8 B;  2HQW A;  1QAT A;  1KSM A;  2JT3 A;  2KAV A;  4MZL A;  5I8N A;  1SYM A;  2F3Y A;  1FI5 A;  4PCW A;  1BJF A;  4YGE B;  4C0L A;  4CLN A;  1JSA A;  3CR2 A;  2KOT A;  3K21 A;  1D1O A;  1LVC D;  1J1E A;  4GPL B;  3TS5 C;  4BY5 A;  1NUB A;  1S3P A;  1CFP A;  1J55 A;  1R6P A;  2OS8 B;  1J1D A;  2LCP A;  1IJ5 A;  1QV0 A;  2M7L A;  2NCP A;  1EH2 A;  1NX0 A;  1S5G Z;  1BR4 B;  1NX3 A;  2PAL A;  1F54 A;  2KFG A;  5ER4 X;  3SG3 A;  1BMO A;  1B8R A;  2LHL A;  1NYA A;  1PUL A;  1PAL A;  1A03 A;  2K7B A;  2MJW B;  3VRN A;  1B1G A;  1Y6W A;  1IRJ A;  2K0J A;  1S26 D;  1SNL A;  1W7J B;  1M46 A;  1RFJ A;  3ICB A;  4OR9 B;  5DKQ A;  5HYD A;  3I5I B;  2BBN A;  3FWB A;  2KI4 C;  2JXC A;  5AFP A;  1YX8 A;  3KEV A;  1SBJ A;  1UHI A;  1CLL A;  4P2Y B;  2G9B A;  3TZ1 A;  1KQV A;  1X02 A;  4M2O A;  1OMV A;  1QTX A;  1SL9 A;  5I2L A;  3RM1 A;  4YGC B;  1RWY A;  2BCB A;  1ZOT B;  2M29 A;  1BOD A;  1B7T Z;  1V1F A;  5I2Q A;  1JFK A;  1QIV A;  1IGV A;  2NCO A;  1TRF A;  2L2E A;  1PVA A;  1DJX A;  1OSA A;  3CS1 A;  3BUO B;  5HKW A;  2CCM A;  1UHK A;  1PRW A;  2EC6 B;  2M8U A;  4PE7 A;  1WDC C;  1KWO B;  1WLM A;  4GGF A;  1NIW A;  5J3X A;  1SL7 A;  5HKY A;  2BCA A;  3PAL A;  1J7Q A;  1MWN A;  1AJ4 A;  2H61 A;  1CM1 A;  4PAL A;  3BUX B;  1SR6 B;  2OPO A;  1QLK A;  4ORC B;  2HQ8 A;  1IKU A;  1M45 A;  1NX2 A;  2L98 A;  1FPW A;  1IQ5 A;  5HLV A;  3I5H B;  2ZRS A;  1MUX A;  4MZK A;  3O6B A;  2M1K B;  1TTX A;  1UWO A;  2BE6 A;  1KFU S;  5D69 A;  1F70 A;  4ZCV A;  3TS5 B;  1BT6 A;  4M2Q A;  2IS9 A;  3O4Y A;  1SPY A;  2KSP A;  4YRU A;  1XO5 A;  4M2P A;  4CFR A;  3DVM A;  5TNC A;  3OP0 A;  1IJ6 A;  1NP8 A;  1JFJ A;  2WCE A;  3OX6 A;  2M3W A;  2Y4Q A;  1G33 A;  1XFX O;  1JUO A;  2LUC A;  5JJG A;  2PSR A;  1A4P A;  2JQ6 A;  2Y5I A;  1JF2 A;  1ODB A;  2TN4 A;  1YVH A;  4MSP A;  2BKH B;  2JC2 A;  3VRO A;  1ZAC A;  4JQ0 D;  2KBM A;  3D0Y A;  1RRO A;  2HET A;  1IG5 A;  1RTP 1;  2KBI A;  1JWD A;  1SRA A;  3SG4 A;  1K2H A;  1CDM A;  2I7A A;  4YGB B;  2KI4 B;  5KU1 A;  2JUL A;  3BQ3 A;  5IBW A;  1OOJ A;  1QVI Z;  2ZRT A;  5CSN A;  2MRD A;  4MN0 A;  1GJY A;  2WCF A;  1KCY A;  2KFH A;  2EC6 C;  3CZT X;  3TDZ A;  1QX2 A;  2EGD A;  2K7O A;  3TDI A;  3TDU A;  4GGN A;  1NWD A;  1BU3 A;  5FYX A;  4MZJ A;  2LAN A;  3BUM B;  1H4B A;  3VRP A;  4MLW A;  1TN4 A;  1K9K A;  4CFQ A;  3LK0 A;  1AVS A;  3CLN A;  1PVB A;  3OHM B;  4PDZ A;  4YBH B;  1A75 A;  5HLO A;  5AAN A;  1L2O C;  2O60 A;  2L4I A;  2LAP A;  1C07 A;  1WDC B;  1C7V A;  4XJK B;  2P6B B;  2LC5 A;  1J7R A;  1Y1A A;  3I5H C;  1XVJ A;  1ALW A;  2JXL A;  2LP2 A;  3D10 A;  1XK4 A;  5D7F A;  2ZN9 A;  2H2K A;  2E6W A;  4HRH A;  4HRE E;  2JWW A;  1WLZ A;  2MHH A;  1BF5 A;  1QV1 A;  3CTN A;  4GFT A;  1F8H A;  1C7W A;  1DF0 A;  1QLS A;  1XFZ O;  1JBA A;  1QXP A;  1F71 A;  2R2I A;  1N2D A;  4BY4 A;  1AK8 A;  4UPG A;  1G4Y R;  1CKK A;  1K93 D;  1YX7 A;  4D1E A;  1CMG A;  1DGU A;  1RK9 A;  4CPV A;  2FJU B;  4AQJ A;  3JTD C;  1PSB A;  4JPZ B;  4JWQ A;  3ZWH A;  2QAC A;  1DGV A;  3EK7 A;  1F4Q A;  1TCO B;  2BL0 B;  4MEW A;  1CB1 A;  3M0W A;  2HPS A;  5CSJ A;  2A4J A;  3AKA A;  2KDH A;  1XA5 A;  2Y1M A;  4OCI A;  2MA2 A;  3BUN B;  3GK4 X;  3VRR A;  2LMU A;  2Q4U A;  4XYN A;  1ZUZ A;  4N1G A;  2LLT A;  5CPV A;  3DVE A;  1CFD A;  1FF1 A;  2JTZ A;  1KK7 Y;  1K8U A;  1WY9 A;  2AAO A;  2MLE C;  2PAS A;  4FQO A;  4NDC A;  3SJS A;  4OV2 A;  1R2U A;  2CT9 A;  2KI6 C;  3CWG A;  1SCM C;  1KSO A;  5AXI A;  2KI6 D;  2DOQ A;  1Y1U A;  2KAX A;  2KHN A;  4Q04 A;  2KYF A;  5I2O A;  4WRI A;  1WRK A;  1CDL A;  4P5O E;  1TNQ A;  1NSH A;  1UUR A;  2M9G A;  3BYA A;  2M49 B;  4ORA B;  2JOJ A;  2WCB A;  4N1F A;  4YGA A;  1XFV O;  2LLS A;  2CTN A;  4DS7 A;  4GNK B;  4GUK A;  2O5G A;  1EG4 A;  1SY9 A;  1DVI A;  4YI9 A;  3AAK A;  4NQG A;  1L2O B;  1YUS A;  2EHB A;  1UUS A;  2L50 A;  2L51 A;  2LVK A;  2WOS A;  1DJG A;  2WOR A;  5DKR A;  1LA3 A;  3BOW B;  3EVR A;  4R1E A;  1EXR A;  3MSE B;  1JF0 A;  3LK1 A;  3OB2 B;  5AEQ A;  4YGD B;  1TOP A;  2K7C A;  4QJ5 B;  2MLF C;  2BBM A;  1REC A;  2BL0 C;  1YVL A;  3EKJ A;  3EVU A;  2CXJ A;  2I94 A;  2LVI A;  2HF5 A;  1FW4 A;  1AP4 A;  3EK4 A;  3SG5 A;  3PN7 C;  2I2R E;  2JRF A;  2KQ6 A;  4TNC A;  3JTD B;  4WQ2 A;  1K95 A;  1YUT A;  2K7D A;  1N0Y A;  2FOT A;  3I5G C;  3LL8 B;  1KFX L;  3PSR A;  1GGZ A;  1YRU B;  3DF0 B;  1S1E A;  2NXQ A;  1ZMZ A;  4PE4 A;  3VRQ A;  4ZCU A;  1HQV A;  3SG2 A;  1SW8 A;  1K9U A;  1LKJ A;  1L7Z A;  2ZFD A;  3NXA A;  2LE9 B;  1N65 A;  2K2A A;  5BPJ A;  1HT9 A;  4YI8 A;  1SMG A;  3D0Y B;  1S6C A;  1OZO A;  2AMI A;  2L4H A;  2M0R A;  2LMT A;  2BKI B;  3A8R A;  4GAO A;  3CR4 X;  2JNX A;  4A4C A;  3JVT B;  2SAS A;  1B8C A;  4AOM A;  1VRK A;  3OB1 B;  1MQ1 A;  1QS7 A;  1MXL C;  4FTG A;  1OQP A;  1LXF C;  1SCM B;  2GGZ A;  2NZ0 A;  3OX5 A;  2GV5 A;  2LMV A;  2LNK A;  1NCY A;  1UHH A;  5PAL A;  1YRT B;  3RLZ A;  2COL B;  2M1U A;  4ICB A;  3SIA A;  5CSF A;  4MRX A;  2LVJ A;  4GGF C;  3BXK A;  2LLU A;  4QJ3 B;  1M31 A;  1PK0 D;  2FCE A;  4USL A;  1EG3 A;  1QAS A;  1J7O A;  2H61 C;  2I18 A;  1U5I B;  1M39 A;  3BUW B;  1DJY A;  5KTY A;  1DMO A;  2NLN A;  2M97 A;  4A4B A;  1K90 D;  2ZNE A;  1QX7 A;  1RJV A;  1XFU O;  1FI6 A;  2LV7 A;  2KFF A;  3SIB A;  1BLQ A;  2FCD A;  1AUI B;  3TUY C;  1FBV A;  4NDD A;  1SCV A;  3SG7 A;  5KSZ A;  3LCP C;  4I5L B;  5CSI A;  1AHR A;  5JOL A;  1IQ3 A;  1KK8 C;  4HSZ A;  1NCX A;  3DVJ A;  4XJK A;  1K94 A;  4E68 A;  3WHU B;  3ZNI A;  3GOF A;  4QJ4 B;  3KO0 A;  1V1G A;  2V53 A;  4IL1 A;  2JT8 A;  1CNP A;  1A29 A;  1BG1 A;  3DD4 A;  2QPT A;  3KHE A;  4U8D A;  2Q91 A;  1CM4 A;  1KQM C;  1SL8 A;  2KGR A;  3PN7 B;  3I5F B;  2SCP A;  1DJW A;  2MAZ A;  1NPQ A;  1QJT A;  1XFY O;  2JTT A;  3I5G B;  2K2F A;  2BE4 A;  1UHN A;  1MXE A;  1QIW A;  1W7I B;  1Y0V H;  3NSK A;  4N5X A;  2WND A;  3O78 A;  2OTG B;  1S6J A;  4PE0 A;  3NSI A;  1TIZ A;  3EVV A;  1OZS A;  1KK7 Z;  1IWQ A;  1S5G Y;  3JVT C;  1M63 B;  2JPT A;  3O2P A;  1UHJ A;  2LM5 A;  3IQO A;  4PHM A;  5F6T A;  3QRX A;  2G2B A;  3GK2 A;  3AAJ A;  2JT0 A;  2WC8 A;  4PE1 A;  4DRW A;  1LIN A;  2JZI A;  4OKH A;  4F0Z B;  1CTR A;  1GGW A;  1EJ3 A;  4PHN A;  1OMD A;  1G8I A;  1A2X A;  1ZFS A;  4MRY A;  2ISD A;  1F55 A;  2CNP A;  3E3R A;  3VGO A;  1S36 A;  1PSR A;  1BR1 B;  4DIR A;  5AER A;  1XFW O;  3FS7 A;  1KFU L;  2RGI A;  3WNX B;  1DT7 B;  1UP5 A;  2GGM A;  1Y1X A;  3PFV A;  3KF9 A;  1S6I A;  1B4C A;  1XK4 C;  1B7T Y; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...