1CMGA

Nmr solution structure of calcium-loaded calmodulin carboxy-terminal domain
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
73
structure length
73
Chain Sequence
MKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Calcium-binding protein
molecule keywords CALMODULIN (VERTEBRATE)
publication title Calcium-induced structural changes and domain autonomy in calmodulin.
pubmed doi rcsb
source organism Bos taurus
total genus 12
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 1995-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1cmgA00
1AUIB 4CFQA 1YRTB 1BG1A 1B8RA 3EK4A 2ZRTA 1U5IB 2KGRA 1WRKA 1F4OA 1TN4A 1K8UA 2JXLA 2L0PA 4D1EA 2OPOA 2ZNDA 1B7TZ 2F3ZA 3GOFA 3O4YA 3WXAA 4USLA 1OMRA 1OMDA 2HQWA 4PDZA 1V1FA 3CTNA 1Y1UA 3JVTB 4FTGA 4JQ0D 1MXLC 1EXRA 1SL9A 1NX2A 2M49B 2WCEA 4DRWA 1IJ6A 5PALA 3HCMA 1RFJA 4PE4A 3WHUB 1CLBA 5K89A 4MBEA 3PM8A 1YVLA 1KWOB 1J7OA 2KQYA 1WRZA 2PSRA 1PSBA 3FWBA 3AAKA 2A4JA 1JF0A 4BY4A 1CFPA 1XFWO 3CS1A 1W7JB 2L51A 3CR5X 4YRUA 1KWOC 1M63B 1DJIA 1WY9A 1LINA 1RTP1 2JPTA 2I94A 2LNKA 2AAOA 1GJYA 1YUSA 1DF0A 1EH2A 1VRKA 1DJWA 2H61A 1S6CA 4I5JA 4ORAB 2LHIA 2ISDA 1PULA 2I2RE 5D69A 1QVIZ 2FOTA 4MN0A 3JTDB 1S5GY 4I5KA 2KYCA 3BUNB 5FYXA 5HLVA 1AJ5A 2NCOA 1IGVA 1XFXO 2JTZA 2TN4A 1C7VA 1F8HA 2M0RA 2JRFA 4MVFA 1IJ5A 1ZOTB 2JU0A 5CSFA 1ALVA 1EJ3A 2M1KB 2BL0C 1CLLA 3KPXA 3TS5C 1K9UA 4ORCB 3SG2A 4OKHA 3A4UB 3SIBA 2LANA 1F70A 2JOJA 4PHKA 1QASA 3D0YB 2I7AA 1B8LA 1TNXA 2NLNA 1SL7A 5AEQA 1JUOA 4AQIA 5KTYA 1CFCA 1CFDA 1BODA 4L9MA 1EG3A 5HKWA 3DVJA 3SG3A 4QJ5B 2KAYA 1JSAA 4HREE 1RROA 2KBIA 1XK4A 1IRJA 2KBMA 4YI8A 2Y1MA 3F45A 2M9GA 2MLEC 4OVNF 5J3XA 4OR9B 1KSOA 3LLEA 1QV1A 3IF7A 1WDCC 1CM1A 1SW8A 3D10A 5BPJA 1Y0VH 4DS7A 2EC6C 2H2KA 3AAJA 1JBAA 2KI6C 1NX3A 1AJ4A 1E8AA 1YR5A 5CSJA 4A4BA 2PASA 2WOSA 2L50A 4GNKB 2KOTA 3C1VA 3CLNA 3TDZA 5I2QA 1LKJA 1A75B 1LA0A 1N0YA 1UHIA 1MWNA 2EGDA 2JNXA 2ZN9A 4ORBB 3ZNIA 2BKHB 1S3PA 1YVHA 1BR1B 1CKKA 2KQ6A 1LA3A 1PALA 4PE0A 3VROA 2M3WA 1H8BA 2O5GA 4GUKA 1NPQA 5I2LA 4HSZA 2D8NA 2K8MB 1S36A 1TOPA 2HF5A 2JWWA 3BYAA 1Q80A 5F6TA 2KSPA 3MSEB 1SMGA 4FQOA 2L4HA 1LVCD 2L2EA 3GK2A 1GQMA 1SKTA 1R6PA 3PALA 5AERA 1CDLA 1TNQA 1KFUS 1CTRA 5I2OA 3PSRA 1A2XA 2WORA 2Y4QA 1L7ZA 4NQGA 4R1EA 2H61C 2K7CA 1QX5B 1NX0A 1SRAA 1NUBA 1N65A 3BUOB 1KK8B 3WHTB 1B47A 2DOQA 1L2OB 1CDMA 1DGVA 2G9BA 2KDHA 5CSIA 2BBNA 2LVJA 1KK8C 1UHKA 2OS8B 3PLFB 4BY5A 2BCBA 1L2OC 2PMYA 2NCPA 1G4YR 2NXQA 2COLB 4GPLB 3DF0A 2OS8C 4HRHA 1UWOA 3VRPA 1TCFA 1ODBA 3KHEA 2LP2A 1HT9A 4GFTA 2CTNA 4OV2A 2K7DA 2JXCA 1UHJA 2LVVA 1ZACA 2M7LA 2Y1NA 3IQQA 3NSIA 3VRQA 5HKYA 2FJUB 1JF2A 2V53A 1DJXA 5ER4X 1NCXA 2BE4A 1K9KA 1B7TY 2MAZA 1OQPA 1BU3A 1OSAA 5AXIA 1EL4A 1WLMA 1XYDA 1YUUA 5JOLA 4ETOA 1CDPA 1YUTA 4XJKB 3M0WA 1SPYA 4N5XA 1HQVA 4YGBB 3CR4X 2LMUA 4WQ2A 1YURA 3O78A 3DVEA 1TIZA 2BL0B 4DUQA 3TS5B 1IQ5A 3I5IC 1MR8A 1J7QA 1KFUL 1CM4A 5CPVA 3SG7A 4M2QA 2LE9B 1BMOA 1UHNA 4PE1A 3NXAA 4GAOA 1TRFA 1XFYO 1IWQA 4YGCB 4DCKA 5I8NA 4CIDA 2LP3A 5DKNA 1KCYA 2WCBA 3OX5A 1MQ1A 1C07A 3TDIA 1CFFA 2QPTA 1J1DA 1UUSA 1QX7A 1NIWA 1QATA 2F3YA 2LLTA 2LVKA 2Y5IA 2K61A 3A8RA 3LK1A 4MRYA 2IS9A 1K94A 1QVIY 2ZKMX 4YGEB 1OZSA 3EK8A 1ZMZA 2MHHA 1NP8A 4ZCUA 1KSMA 1QX2A 1K9PA 3QRXA 1IH0A 1KQMB 1CMGA 2B1UA 1J7PA 4Q04A 2P6BB 1J1EA 1XFZO 2I18A 2MLFC 1UURA 1DTLA 1EG4A 2K7OA 1QV0A 1SNLA 1LXFC 2LLUA 2R2IA 3I5HC 2F8PA 1KQMC 3PFVA 1SCMC 1WDCB 1G33A 4U8DA 1Y1XA 2GGZA 1B9AA 4A4CA 1U5IA 3I5GC 1J55A 2EC6B 1XA5A 2MJWB 1BR4B 3OX6A 1OZOA 3RM1A 3ICBA 1K96A 4AOMA 1NCYA 4GGNA 1S6IA 4MSPA 2JQ6A 1KQVA 2KGBC 4UPGA 1SBJA 2LHLA 1ZUZA 2LM5A 5KSZA 1F54A 2KHNA 1WLZA 3OP0A 1FPWA 4QJ4B 1KK7Z 5TNCA 2BCXA 4CPVA 1RECA 3VRRA 2RGIA 5D7FA 2LMTA 2NZ0A 1GGZA 4ICBA 1OE9B 2HETA 3NSOA 3FS7A 3DVMA 3FWCA 4PALA 3SG4A 1DJYA 1WRLA 1YX7A 5DKRA 1CNPA 2HPSA 2GGMA 1K90D 3GK4X 2KFGA 5AFPA 3KEVA 1MXEA 3BOWB 1XO5A 3AKBA 3I5FB 1K93D 1AHRA 1N2DA 1S6JA 5ER5A 3VRNA 1FF1A 4NDDA 4XJKA 1H4BA 2KI6D 2F33A 2M97A 1TTXA 2KAXA 1PVAA 3I5FC 3DD4A 3KF9A 1DVIA 1IG5A 1PRWA 1CMFA 4PE7A 3LL8B 2KYFA 2M8UA 1QS7A 2M29A 4ZCVA 3TUYC 4I5NB 3CGAA 5HLOA 2L98A 3EVVA 1V1GA 2JC2A 2QACA 1PK0D 2KFHA 4GGFA 4PHJA 1BOCA 3OHMB 2K7BA 5KU1A 4CFRA 2ZFDA 4YBHB 2LUCA 3D0YA 1QIWA 2JT0A 1SCVA 1UP5A 4MRXA 2CXJA 2JTTA 3WNXB 1B1GA 2MRDA 1QLSA 4I5LB 2BKIB 1SR6C 2LMVA 3HX4A 1TNWA 1QXPA 2EHBA 1IQ3A 1DJGA 1M31A 4GBAA 2OTGC 3SJSA 4PHMA 1BT6A 1XK4C 4C0LA 3OB1B 4MZKA 2K2AA 4OCIA 2FCEA 2L5XB 2MBXA 1DJHA 4MZLA 2LVIA 4YGDB 5HKZA 5DKQA 2WNDA 3I5IB 1YRUB 1B4CA 1M46A 1RJVA 1YTZC 2AMIA 2KI4B 1D1OA 1S5GZ 1JWDA 1A75A 3JVTC 4QJ3B 1PSRA 2E6WA 4E68A 1W7IB 3TDUA 1F71A 3BUMB 2KI4C 2Q91A 1NX1A 3OB2B 3O2PA 2HQ8A 2JULA 1DMOA 2PRUA 1JFJA 2PALA 1QTXA 1XFUO 2K0JA 4F0ZB 4WRIA 3CZTX 3BOWA 3PN7B 2WCFA 4YI9A 4C0KA 1S1EA 2O60A 1MF8B 1BF5A 3CWGA 1FI5A 1FW4A 1K95A 2LAPA 1DT7B 1NYAA 3PN7C 5JJGA 3BUXB 1KFXS 5IBWA 1QIVA 3I5HB 1K2HA 2BCAA 1SCMB 2WC8A 2ZNEA 3LK0A 3BXKA 3JTDC 3E3RA 3SG6A 3SIAA 1S26D 1DGUA 2CBLA 3I5GB 1A03A 3FIAA 2ZRSA 2LV7A 4C0JA 1ZFSA 2SCPA 1A4PA 2JT8A 2K2FA 1R2UA 2G2BA 5CSNA 3O6BA 2M1UA 2L4IA 2JNFA 2LLSA 3DF0B 2BBMA 4GGFC 2VRGA 3LCPC 1IKUA 1OOJA 3SG5A 3EVUA 4M2PA 4PHNA 3NSKA 4YGAA 3EKJA 2CT9A 1A29A 3EVRA 2M7NA 5AANA 3KO0A 2F2OA 2LUXA 2JZIA 4JPZB 3K21A 1NWDA 1CB1A 4N1FA 4AQJA 1RWYA 4P2YB 1NCZA 3ZWHA 2LC5A 2E30A 4IL1A 2KFFA 4NDBA 1QLKA 2CCMA 1DJZA 2Q4UA 4XYNA 3NSLA 1QJTA 3EKHA 1CDNA 3TZ1A 3VGOA 1DF0B 1M45A 1TCOB 2F2PA 4NDCA 2CNPA 2MA2A 1UHHA 5GQQC 2KNEA 4MZJA 1MHOA 1FI6A 4M2OA 1KK7Y 4CLNA 1M39A 4TNCA 3RLZA 2ZN8A 4JWQA 5HYDA 2AUCA 3BUWB 2KAVA 2BECA 1JFKA 2BE6A 5G08A 3TUYB 1YX8A 1B8CA 2LCPA 5B8IB 4HRGA 1F55A 1SY9A 1BJFA 1RK9A 1GGWA 3IQOA 2PVBA 1PVBA 1SYMA 3EK7A 1Y6WA 4N1GA 1FBVA 1NSHA 2FCDA 1KFXL 4P5OE 1C7WA 4WQ3A 1BLQA 4MLWA 4DIRA 1SL8A 1OMVA 3CR2A 3PATA 2GV5A 2JT3A 3H4SE 1J7RA 1XFVO 3DVKA 1X02A 1TNPA 1SR6B 1XVJA 1F4QA 1AVSA 1AP4A 3BQ3A 1JC2A 1CLMA 3AKAA 1MUXA 3GK1A 1AK8A 4PCWA 1ALWA 2OTGB 4MEWA 1G8IA 1Y1AA 2SASA 1SK6D
chains in the Genus database with same CATH superfamily
1AUIB 4CFQA 1YRTB 4YGEB 1BG1A 4F7FA 2QEOA 1B8RA 3EK4A 2ZRTA 1U5IB 2QDIA 2KGRA 1WRKA 1F4OA 1TN4A 1K8UA 2JXLA 2L0PA 4D1EA 2OPOA 2ZNDA 1B7TZ 2F3ZA 3GOFA 3O4YA 3WXAA 4USLA 1OMRA 3SS3A 1OMDA 2HQWA 4PDZA 1V1FA 3CTNA 1Y1UA 3JVTB 3CYZA 3L4AA 4FTGA 4JQ0D 1MXLC 1EXRA 1SL9A 1NX2A 2M49B 2WCEA 4DRWA 1IJ6A 5PALA 3HCMA 1RFJA 4PE4A 3WHUB 1CLBA 3CDNA 5K89A 4MBEA 3PM8A 1YVLA 1KWOB 1J7OA 2KQYA 1WRZA 2PSRA 1PSBA 3FWBA 3AAKA 2A4JA 1JF0A 4BY4A 1CFPA 1XFWO 3CS1A 1W7JB 2L51A 3CR5X 4YRUA 1KWOC 1GM0A 1M63B 1DJIA 1WY9A 1LINA 1RTP1 2JPTA 2I94A 2LNKA 2AAOA 1GJYA 1YUSA 3OBVA 1DF0A 1EH2A 3PM2A 1VRKA 1DJWA 1C3ZA 1S6CA 2H61A 4I5JA 2LHIA 4ORAB 2ISDA 1PULA 2I2RE 3CZ1A 5D69A 5FI6A 1QVIZ 2FOTA 4MN0A 3JTDB 1S5GY 4I5KA 2KYCA 3BUNB 5FYXA 5HLVA 1AJ5A 1DEKA 2NCOA 1IGVA 1XFXO 2JTZA 2TN4A 1C7VA 1F8HA 2KPHA 2M0RA 2JRFA 4MVFA 1IJ5A 1LS8A 1ZOTB 2JU0A 5CSFA 1ALVA 1EJ3A 2M1KB 2BL0C 3L47A 1SSEB 3QMEA 1CLLA 2P71A 3KPXA 5FI7A 1K9UA 4ORCB 3TS5C 3CABA 3SG2A 4OKHA 3A4UB 3SIBA 2LANA 1F70A 2JOJA 4PHKA 1QASA 3D0YB 3ZWHA 3DXLA 2I7AA 1B8LA 1TNXA 2NLNA 1SL7A 5AEQA 1JUOA 4AQIA 5KTYA 1CFCA 1CFDA 3O4XA 1BODA 5DICA 4L9MA 1EG3A 5HKWA 3DVJA 2WC5A 3SG3A 4QJ5B 2KAYA 1JSAA 4HREE 3OGNA 1RROA 2KBIA 1XK4A 1IRJA 4FQTA 2KBMA 4YI8A 2Y1MA 3F45A 2M9GA 2MLEC 1TUZA 4OVNF 5EL2A 5J3XA 4OR9B 1KSOA 3LLEA 1QV1A 3IF7A 1WDCC 1CM1A 1SW8A 3D10A 5BPJA 1Y0VH 1P28A 2EC6C 2H2KA 3AAJA 4DS7A 1JBAA 2KI6C 1NX3A 1AJ4A 1E8AA 1YR5A 5CSJA 4A4BA 2PASA 2WOSA 3S0BA 2L50A 4GNKB 2KOTA 2WC6A 3C1VA 3CLNA 3TDZA 5I2QA 1LKJA 1A75B 1LA0A 1N0YA 1UHIA 1MWNA 2EGDA 2JNXA 2ZN9A 4ORBB 3ZNIA 1C3YA 3BFAA 2BKHB 1S3PA 1YVHA 1BR1B 1CKKA 2KQ6A 1LA3A 1PALA 1W9ZA 4PE0A 3VROA 3S0AA 2M3WA 1H8BA 2O5GA 4GUKA 1NPQA 5I2LA 4HSZA 2D8NA 2K8MB 1S36A 1TOPA 2HF5A 2JWWA 3BYAA 1Q80A 5F6TA 2KSPA 3MSEB 4IJ7A 1SMGA 4FQOA 2L4HA 1LVCD 2L2EA 1XFRA 1GQMA 1SKTA 3B88A 1R6PA 3GK2A 3PALA 5FI2A 1CDLA 5AERA 1TNQA 1KFUS 1CTRA 5I2OA 3PSRA 1A2XA 2WORA 2Y4QA 1L7ZA 4NQGA 4R1EA 2H61C 2K7CA 1QX5B 1NX0A 3D73A 1SRAA 1NUBA 1N65A 3BUOB 1KK8B 3WHTB 1B47A 2DOQA 1L2OB 1CDMA 1DGVA 2G9BA 2KDHA 5CSIA 2FJYA 3EG5B 1OOHA 3NHIA 2BBNA 2LVJA 1KK8C 1UHKA 2OS8B 3NGVA 3PLFB 4BY5A 2BCBA 1L2OC 2PMYA 2NCPA 1G4YR 2NXQA 2COLB 3Q8IA 4GPLB 3DF0A 2OS8C 4HRHA 1UWOA 3VRPA 1TCFA 1ODBA 3KHEA 2LP2A 1HT9A 3K1EA 4GFTA 1OOGA 2CTNA 4OV2A 2K7DA 2JXCA 1UHJA 1TUJA 2LVVA 1ZACA 2M7LA 2Y1NA 1TWOA 3IQQA 3NSIA 3VRQA 4PT1A 5HKYA 2FJUB 1JF2A 3BFBA 2V53A 3CZ2A 1DJXA 5ER4X 1NCXA 3NHTA 2BE4A 1K9KA 1T14A 1B7TY 2MAZA 1OQPA 1BU3A 1OSAA 5AXIA 1EL4A 1WLMA 1XYDA 1YUUA 5JOLA 4ETOA 1CDPA 1YUTA 4XJKB 3M0WA 1SPYA 4N5XA 1HQVA 4YGBB 3FE8A 1OOIX 3CR4X 2LMUA 4WQ2A 1YURA 3O78A 3DVEA 1TIZA 2BL0B 4DUQA 3TS5B 1IQ5A 3I5IC 1MR8A 1J7QA 1KFUL 1CM4A 5CPVA 3L4LA 3RZSA 3SG7A 4M2QA 2LE9B 1BMOA 1UHNA 4PE1A 3NXAA 4GAOA 1TRFA 1XFYO 1IWQA 4YGCB 4DCKA 5I8NA 4CIDA 2LP3A 5DKNA 3BFHA 2WCLA 1KCYA 2WCBA 3OX5A 1MQ1A 1C07A 3TDIA 1CFFA 2QPTA 1J1DA 1UUSA 1QX7A 1NIWA 1QATA 2F3YA 2LLTA 2LVKA 2Y5IA 2K61A 2YGUA 3A8RA 3LK1A 2IS9A 1K94A 1QVIY 2ZKMX 4MRYA 1OZSA 3EK8A 1ZMZA 2MHHA 1NP8A 4ZCUA 1DQEA 1KSMA 1QX2A 1K9PA 2KLEA 3QRXA 1IH0A 1KQMB 4JKTA 1ORGA 1CMGA 1OW4A 2B1UA 4Q04A 2P6BB 1J7PA 1J1EA 1XFZO 2I18A 2MLFC 1UURA 1DTLA 1EG4A 2K7OA 2WCMA 1QV0A 1SNLA 4INXA 1LXFC 2LLUA 2R2IA 3I5HC 2F8PA 1KQMC 3PFVA 1SCMC 1WDCB 2BNXA 2QEHA 1G33A 4U8DA 1Y1XA 2GGZA 1B9AA 4A4CA 1U5IA 3I5GC 1J55A 2EC6B 1XA5A 2MJWB 1BR4B 3OX6A 1OZOA 3RM1A 3ICBA 1K96A 4AOMA 1NCYA 4GGNA 1S6IA 4MSPA 2JQ6A 1KQVA 2KGBC 4UPGA 1SBJA 2LHLA 1ZUZA 2LM5A 5KSZA 1F54A 2KHNA 1WLZA 3OP0A 1FPWA 4QJ4B 1KK7Z 2WCKA 2BCXA 5TNCA 1RECA 4CPVA 3VRRA 2RGIA 3S0FA 5D7FA 2LMTA 1DELA 2NZ0A 1GGZA 4ICBA 1OE9B 2HETA 3NSOA 1Z2CB 3DVMA 3FS7A 3FWCA 4PALA 3SG4A 1DJYA 1WRLA 1YX7A 5DKRA 1CNPA 2HPSA 2GGMA 1K90D 3GK4X 2KFGA 5AFPA 3KEVA 1MXEA 3B87A 3BOWB 1XO5A 3AKBA 3I5FB 1K93D 1AHRA 1N2DA 1S6JA 5ER5A 3VRNA 1FF1A 4NDDA 4XJKA 3DZTA 3S0DA 3DYEA 1H4BA 2KI6D 2F33A 2M97A 1TTXA 2KAXA 1PVAA 3I5FC 3DD4A 3KF9A 1DVIA 1IG5A 1PRWA 1CMFA 4JD9A 4PE7A 3LL8B 2KYFA 2M8UA 1QS7A 2M29A 4ZCVA 3TUYC 4I5NB 3CGAA 5HLOA 3S0EA 2L98A 3EVVA 1QWVA 1V1GA 2JC2A 2QACA 1PK0D 2KFHA 4GGFA 4PHJA 3VB1A 1BOCA 3OHMB 2K7BA 5KU1A 4CFRA 2QEVA 4INWA 2ZFDA 4YBHB 2LUCA 3D0YA 1QIWA 2ERBA 2JT0A 1SCVA 1UP5A 4MRXA 2CXJA 2JTTA 2K60A 3WNXB 1B1GA 2MRDA 1QLSA 4I5LB 2BKIB 1SR6C 2LMVA 3HX4A 1TNWA 1QXPA 3V2LA 2EHBA 1IQ3A 1DJGA 1M31A 4GBAA 3BJHA 2OTGC 3SJSA 3D76A 4PHMA 1BT6A 1XK4C 4C0LA 3OB1B 4MZKA 3D77A 2K2AA 3D74A 4OCIA 2FCEA 2PQLA 2L5XB 3N7HA 2MBXA 1DJHA 3S0GA 2P70A 3FE9A 2LVIA 3D75A 4MZLA 4YGDB 5DKQA 5HKZA 2WNDA 3D78A 1YRUB 3I5IB 1M46A 1B4CA 1RJVA 1YTZC 2AMIA 2KI4B 1D1OA 1S5GZ 1JWDA 1A75A 3JVTC 4QJ3B 1PSRA 2E6WA 4E68A 1W7IB 3TDUA 1F71A 3BUMB 2KI4C 2Q91A 1NX1A 3OB2B 4KYNA 3O2PA 2HQ8A 2JULA 1DMOA 2PRUA 1JFJA 2PALA 2L2CA 1QTXA 1XFUO 2K0JA 4F0ZB 4WRIA 3CZTX 3R72A 3BOWA 2WCJA 3PN7B 1DC1A 2WCFA 4YI9A 4C0KA 1S1EA 2O60A 1MF8B 1BF5A 3CWGA 1FI5A 1FW4A 2BAPA 1K95A 3R1PA 2LAPA 1DT7B 1NYAA 3PN7C 5JJGA 3BUXB 1KFXS 5IBWA 1QIVA 3I5HB 1K2HA 2BCAA 1SCMB 2WC8A 2ZNEA 3LK0A 3BXKA 3JTDC 3UNWA 3E3RA 3SG6A 3SIAA 1S26D 1DGUA 2CBLA 3I5GB 1A03A 3FIAA 2ZRSA 2LV7A 4C0JA 1ZFSA 2GTEA 2SCPA 1A4PA 2JT8A 2K2FA 1R2UA 2G2BA 5CSNA 3O6BA 2M1UA 2L4IA 2JNFA 2LLSA 3DF0B 2BBMA 4GGFC 5D3OA 3R1OA 2WCHA 2VRGA 3LCPC 5HL1A 1OOJA 3SG5A 1IKUA 3EVUA 4M2PA 4PHNA 3NSKA 4YGAA 3B86A 3EKJA 2CT9A 1OOFA 3IVTA 1A29A 3EVRA 2M7NA 5AANA 3SS4A 3KO0A 2F2OA 2LUXA 3FE6A 2JZIA 4JPZB 3K21A 1NWDA 1CB1A 2PYQA 4N1FA 4AQJA 1RWYA 4P2YB 1NCZA 4OZDA 2LC5A 2E30A 4IL1A 2KFFA 3SS5A 4NDBA 1QLKA 2CCMA 2KLDA 1DJZA 2Q4UA 4XYNA 3NSLA 3R1VA 1QJTA 3EKHA 1CDNA 3TZ1A 3VGOA 5I94A 1DF0B 1M45A 1TCOB 2F2PA 4NDCA 2CNPA 2MA2A 1UHHA 2H8VA 2QEBA 2KNEA 5GQQC 3PJIA 4MZJA 1MHOA 1FI6A 4M2OA 1KK7Y 4CLNA 1M39A 4TNCA 3RLZA 2ZN8A 4JWQA 5HYDA 2AUCA 3BUWB 2KAVA 2BECA 1JFKA 2BE6A 5G08A 3CZ0A 1YX8A 1B8CA 2LCPA 3TUYB 4HRGA 5B8IB 1F55A 1SY9A 1BJFA 1RK9A 3B6XA 1GGWA 3IQOA 2PVBA 1PVBA 3UO9A 1SYMA 3EK7A 1Y6WA 4N1GA 1FBVA 1NSHA 2FCDA 1KFXL 2JPOA 4P5OE 2L5YA 1C7WA 4WQ3A 1BLQA 1Z4HA 4MLWA 4DIRA 1SL8A 1OMVA 3CR2A 3PATA 2GV5A 2JT3A 3H4SE 1J7RA 1XFVO 3DVKA 1X02A 1TNPA 1SR6B 1XVJA 1IIOA 3B7AA 1F4QA 1AVSA 1AP4A 3BQ3A 1JC2A 1CLMA 3AKAA 1MUXA 3GK1A 1AK8A 4PCWA 3DY9A 1ALWA 2OTGB 4MEWA 1G8IA 1Y1AA 2SASA 1SK6D
chains in the Genus database with same CATH topology
1AUIB 4CFQA 1YRTB 1BG1A 1B8RA 3EK4A 2ZRTA 1U5IB 2KGRA 1WRKA 1F4OA 1TN4A 1K8UA 2JXLA 2L0PA 4D1EA 2OPOA 2ZNDA 1B7TZ 2F3ZA 3GOFA 3O4YA 3WXAA 4USLA 1OMRA 1OMDA 2HQWA 4PDZA 1V1FA 3CTNA 1Y1UA 3JVTB 4FTGA 4JQ0D 1MXLC 1EXRA 1SL9A 1NX2A 2M49B 2WCEA 4DRWA 1IJ6A 5PALA 3HCMA 1RFJA 4PE4A 3WHUB 1CLBA 5K89A 4MBEA 3PM8A 1YVLA 1KWOB 1J7OA 2KQYA 1WRZA 2PSRA 1PSBA 3FWBA 3AAKA 2A4JA 1JF0A 4BY4A 1CFPA 1XFWO 3CS1A 1W7JB 2L51A 3CR5X 4YRUA 1KWOC 1M63B 1DJIA 1WY9A 1LINA 1RTP1 2JPTA 2I94A 2LNKA 2AAOA 1GJYA 1YUSA 1DF0A 1EH2A 1VRKA 1DJWA 2H61A 1S6CA 4I5JA 4ORAB 2LHIA 2ISDA 1PULA 2I2RE 5D69A 1QVIZ 2FOTA 4MN0A 3JTDB 1S5GY 4I5KA 2KYCA 3BUNB 5FYXA 5HLVA 1AJ5A 2NCOA 1IGVA 1XFXO 2JTZA 2TN4A 1C7VA 1F8HA 2M0RA 2JRFA 4MVFA 1IJ5A 1ZOTB 2JU0A 5CSFA 1ALVA 1EJ3A 2M1KB 2BL0C 1CLLA 3KPXA 3TS5C 1K9UA 4ORCB 3SG2A 4OKHA 3A4UB 3SIBA 2LANA 1F70A 2JOJA 4PHKA 1QASA 3D0YB 2I7AA 1B8LA 1TNXA 2NLNA 1SL7A 5AEQA 1JUOA 4AQIA 5KTYA 1CFCA 1CFDA 1BODA 4L9MA 1EG3A 5HKWA 3DVJA 3SG3A 4QJ5B 2KAYA 1JSAA 4HREE 1RROA 2KBIA 1XK4A 1IRJA 2KBMA 4YI8A 2Y1MA 3F45A 2M9GA 2MLEC 4OVNF 5J3XA 4OR9B 1KSOA 3LLEA 1QV1A 3IF7A 1WDCC 1CM1A 1SW8A 3D10A 5BPJA 1Y0VH 4DS7A 2EC6C 2H2KA 3AAJA 1JBAA 2KI6C 1NX3A 1AJ4A 1E8AA 1YR5A 5CSJA 4A4BA 2PASA 2WOSA 2L50A 4GNKB 2KOTA 3C1VA 3CLNA 3TDZA 5I2QA 1LKJA 1A75B 1LA0A 1N0YA 1UHIA 1MWNA 2EGDA 2JNXA 2ZN9A 4ORBB 3ZNIA 2BKHB 1S3PA 1YVHA 1BR1B 1CKKA 2KQ6A 1LA3A 1PALA 4PE0A 3VROA 2M3WA 1H8BA 2O5GA 4GUKA 1NPQA 5I2LA 4HSZA 2D8NA 2K8MB 1S36A 1TOPA 2HF5A 2JWWA 3BYAA 1Q80A 5F6TA 2KSPA 3MSEB 1SMGA 4FQOA 2L4HA 1LVCD 2L2EA 3GK2A 1GQMA 1SKTA 1R6PA 3PALA 5AERA 1CDLA 1TNQA 1KFUS 1CTRA 5I2OA 3PSRA 1A2XA 2WORA 2Y4QA 1L7ZA 4NQGA 4R1EA 2H61C 2K7CA 1QX5B 1NX0A 1SRAA 1NUBA 1N65A 3BUOB 1KK8B 3WHTB 1B47A 2DOQA 1L2OB 1CDMA 1DGVA 2G9BA 2KDHA 5CSIA 2BBNA 2LVJA 1KK8C 1UHKA 2OS8B 3PLFB 4BY5A 2BCBA 1L2OC 2PMYA 2NCPA 1G4YR 2NXQA 2COLB 4GPLB 3DF0A 2OS8C 4HRHA 1UWOA 3VRPA 1TCFA 1ODBA 3KHEA 2LP2A 1HT9A 4GFTA 2CTNA 4OV2A 2K7DA 2JXCA 1UHJA 2LVVA 1ZACA 2M7LA 2Y1NA 3IQQA 3NSIA 3VRQA 5HKYA 2FJUB 1JF2A 2V53A 1DJXA 5ER4X 1NCXA 2BE4A 1K9KA 1B7TY 2MAZA 1OQPA 1BU3A 1OSAA 5AXIA 1EL4A 1WLMA 1XYDA 1YUUA 5JOLA 4ETOA 1CDPA 1YUTA 4XJKB 3M0WA 1SPYA 4N5XA 1HQVA 4YGBB 3CR4X 2LMUA 4WQ2A 1YURA 3O78A 3DVEA 1TIZA 2BL0B 4DUQA 3TS5B 1IQ5A 3I5IC 1MR8A 1J7QA 1KFUL 1CM4A 5CPVA 3SG7A 4M2QA 2LE9B 1BMOA 1UHNA 4PE1A 3NXAA 4GAOA 1TRFA 1XFYO 1IWQA 4YGCB 4DCKA 5I8NA 4CIDA 2LP3A 5DKNA 1KCYA 2WCBA 3OX5A 1MQ1A 1C07A 3TDIA 1CFFA 2QPTA 1J1DA 1UUSA 1QX7A 1NIWA 1QATA 2F3YA 2LLTA 2LVKA 2Y5IA 2K61A 3A8RA 3LK1A 4MRYA 2IS9A 1K94A 1QVIY 2ZKMX 4YGEB 1OZSA 3EK8A 1ZMZA 2MHHA 1NP8A 4ZCUA 1KSMA 1QX2A 1K9PA 3QRXA 1IH0A 1KQMB 1CMGA 2B1UA 1J7PA 4Q04A 2P6BB 1J1EA 1XFZO 2I18A 2MLFC 1UURA 1DTLA 1EG4A 2K7OA 1QV0A 1SNLA 1LXFC 2LLUA 2R2IA 3I5HC 2F8PA 1KQMC 3PFVA 1SCMC 1WDCB 1G33A 4U8DA 1Y1XA 2GGZA 1B9AA 4A4CA 1U5IA 3I5GC 1J55A 2EC6B 1XA5A 2MJWB 1BR4B 3OX6A 1OZOA 3RM1A 3ICBA 1K96A 4AOMA 1NCYA 4GGNA 1S6IA 4MSPA 2JQ6A 1KQVA 2KGBC 4UPGA 1SBJA 2LHLA 1ZUZA 2LM5A 5KSZA 1F54A 2KHNA 1WLZA 3OP0A 1FPWA 4QJ4B 1KK7Z 5TNCA 2BCXA 4CPVA 1RECA 3VRRA 2RGIA 5D7FA 2LMTA 2NZ0A 1GGZA 4ICBA 1OE9B 2HETA 3NSOA 3FS7A 3DVMA 3FWCA 4PALA 3SG4A 1DJYA 1WRLA 1YX7A 5DKRA 1CNPA 2HPSA 2GGMA 1K90D 3GK4X 2KFGA 5AFPA 3KEVA 1MXEA 3BOWB 1XO5A 3AKBA 3I5FB 1K93D 1AHRA 1N2DA 1S6JA 5ER5A 3VRNA 1FF1A 4NDDA 4XJKA 1H4BA 2KI6D 2F33A 2M97A 1TTXA 2KAXA 1PVAA 3I5FC 3DD4A 3KF9A 1DVIA 1IG5A 1PRWA 1CMFA 4PE7A 3LL8B 2KYFA 2M8UA 1QS7A 2M29A 4ZCVA 3TUYC 4I5NB 3CGAA 5HLOA 2L98A 3EVVA 1V1GA 2JC2A 2QACA 1PK0D 2KFHA 4GGFA 4PHJA 1BOCA 3OHMB 2K7BA 5KU1A 4CFRA 2ZFDA 4YBHB 2LUCA 3D0YA 1QIWA 2JT0A 1SCVA 1UP5A 4MRXA 2CXJA 2JTTA 3WNXB 1B1GA 2MRDA 1QLSA 4I5LB 2BKIB 1SR6C 2LMVA 3HX4A 1TNWA 1QXPA 2EHBA 1IQ3A 1DJGA 1M31A 4GBAA 2OTGC 3SJSA 4PHMA 1BT6A 1XK4C 4C0LA 3OB1B 4MZKA 2K2AA 4OCIA 2FCEA 2L5XB 2MBXA 1DJHA 4MZLA 2LVIA 4YGDB 5HKZA 5DKQA 2WNDA 3I5IB 1YRUB 1B4CA 1M46A 1RJVA 1YTZC 2AMIA 2KI4B 1D1OA 1S5GZ 1JWDA 1A75A 3JVTC 4QJ3B 1PSRA 2E6WA 4E68A 1W7IB 3TDUA 1F71A 3BUMB 2KI4C 2Q91A 1NX1A 3OB2B 3O2PA 2HQ8A 2JULA 1DMOA 2PRUA 1JFJA 2PALA 1QTXA 1XFUO 2K0JA 4F0ZB 4WRIA 3CZTX 3BOWA 3PN7B 2WCFA 4YI9A 4C0KA 1S1EA 2O60A 1MF8B 1BF5A 3CWGA 1FI5A 1FW4A 1K95A 2LAPA 1DT7B 1NYAA 3PN7C 5JJGA 3BUXB 1KFXS 5IBWA 1QIVA 3I5HB 1K2HA 2BCAA 1SCMB 2WC8A 2ZNEA 3LK0A 3BXKA 3JTDC 3E3RA 3SG6A 3SIAA 1S26D 1DGUA 2CBLA 3I5GB 1A03A 3FIAA 2ZRSA 2LV7A 4C0JA 1ZFSA 2SCPA 1A4PA 2JT8A 2K2FA 1R2UA 2G2BA 5CSNA 3O6BA 2M1UA 2L4IA 2JNFA 2LLSA 3DF0B 2BBMA 4GGFC 2VRGA 3LCPC 1IKUA 1OOJA 3SG5A 3EVUA 4M2PA 4PHNA 3NSKA 4YGAA 3EKJA 2CT9A 1A29A 3EVRA 2M7NA 5AANA 3KO0A 2F2OA 2LUXA 2JZIA 4JPZB 3K21A 1NWDA 1CB1A 4N1FA 4AQJA 1RWYA 4P2YB 1NCZA 3ZWHA 2LC5A 2E30A 4IL1A 2KFFA 4NDBA 1QLKA 2CCMA 1DJZA 2Q4UA 4XYNA 3NSLA 1QJTA 3EKHA 1CDNA 3TZ1A 3VGOA 1DF0B 1M45A 1TCOB 2F2PA 4NDCA 2CNPA 2MA2A 1UHHA 5GQQC 2KNEA 4MZJA 1MHOA 1FI6A 4M2OA 1KK7Y 4CLNA 1M39A 4TNCA 3RLZA 2ZN8A 4JWQA 5HYDA 2AUCA 3BUWB 2KAVA 2BECA 1JFKA 2BE6A 5G08A 3TUYB 1YX8A 1B8CA 2LCPA 5B8IB 4HRGA 1F55A 1SY9A 1BJFA 1RK9A 1GGWA 3IQOA 2PVBA 1PVBA 1SYMA 3EK7A 1Y6WA 4N1GA 1FBVA 1NSHA 2FCDA 1KFXL 4P5OE 1C7WA 4WQ3A 1BLQA 4MLWA 4DIRA 1SL8A 1OMVA 3CR2A 3PATA 2GV5A 2JT3A 3H4SE 1J7RA 1XFVO 3DVKA 1X02A 1TNPA 1SR6B 1XVJA 1F4QA 1AVSA 1AP4A 3BQ3A 1JC2A 1CLMA 3AKAA 1MUXA 3GK1A 1AK8A 4PCWA 1ALWA 2OTGB 4MEWA 1G8IA 1Y1AA 2SASA 1SK6D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AUI B;  4CFQ A;  1YRT B;  1BG1 A;  1B8R A;  3EK4 A;  2ZRT A;  1U5I B;  2KGR A;  1WRK A;  1F4O A;  1TN4 A;  1K8U A;  2JXL A;  2L0P A;  4D1E A;  2OPO A;  2ZND A;  1B7T Z;  2F3Z A;  3GOF A;  3O4Y A;  3WXA A;  4USL A;  1OMR A;  1OMD A;  2HQW A;  4PDZ A;  1V1F A;  3CTN A;  1Y1U A;  3JVT B;  4FTG A;  4JQ0 D;  1MXL C;  1EXR A;  1SL9 A;  1NX2 A;  2M49 B;  2WCE A;  4DRW A;  1IJ6 A;  5PAL A;  3HCM A;  1RFJ A;  4PE4 A;  3WHU B;  1CLB A;  5K89 A;  4MBE A;  3PM8 A;  1YVL A;  1KWO B;  1J7O A;  2KQY A;  1WRZ A;  2PSR A;  1PSB A;  3FWB A;  3AAK A;  2A4J A;  1JF0 A;  4BY4 A;  1CFP A;  1XFW O;  3CS1 A;  1W7J B;  2L51 A;  3CR5 X;  4YRU A;  1KWO C;  1M63 B;  1DJI A;  1WY9 A;  1LIN A;  1RTP 1;  2JPT A;  2I94 A;  2LNK A;  2AAO A;  1GJY A;  1YUS A;  1DF0 A;  1EH2 A;  1VRK A;  1DJW A;  2H61 A;  1S6C A;  4I5J A;  4ORA B;  2LHI A;  2ISD A;  1PUL A;  2I2R E;  5D69 A;  1QVI Z;  2FOT A;  4MN0 A;  3JTD B;  1S5G Y;  4I5K A;  2KYC A;  3BUN B;  5FYX A;  5HLV A;  1AJ5 A;  2NCO A;  1IGV A;  1XFX O;  2JTZ A;  2TN4 A;  1C7V A;  1F8H A;  2M0R A;  2JRF A;  4MVF A;  1IJ5 A;  1ZOT B;  2JU0 A;  5CSF A;  1ALV A;  1EJ3 A;  2M1K B;  2BL0 C;  1CLL A;  3KPX A;  3TS5 C;  1K9U A;  4ORC B;  3SG2 A;  4OKH A;  3A4U B;  3SIB A;  2LAN A;  1F70 A;  2JOJ A;  4PHK A;  1QAS A;  3D0Y B;  2I7A A;  1B8L A;  1TNX A;  2NLN A;  1SL7 A;  5AEQ A;  1JUO A;  4AQI A;  5KTY A;  1CFC A;  1CFD A;  1BOD A;  4L9M A;  1EG3 A;  5HKW A;  3DVJ A;  3SG3 A;  4QJ5 B;  2KAY A;  1JSA A;  4HRE E;  1RRO A;  2KBI A;  1XK4 A;  1IRJ A;  2KBM A;  4YI8 A;  2Y1M A;  3F45 A;  2M9G A;  2MLE C;  4OVN F;  5J3X A;  4OR9 B;  1KSO A;  3LLE A;  1QV1 A;  3IF7 A;  1WDC C;  1CM1 A;  1SW8 A;  3D10 A;  5BPJ A;  1Y0V H;  4DS7 A;  2EC6 C;  2H2K A;  3AAJ A;  1JBA A;  2KI6 C;  1NX3 A;  1AJ4 A;  1E8A A;  1YR5 A;  5CSJ A;  4A4B A;  2PAS A;  2WOS A;  2L50 A;  4GNK B;  2KOT A;  3C1V A;  3CLN A;  3TDZ A;  5I2Q A;  1LKJ A;  1A75 B;  1LA0 A;  1N0Y A;  1UHI A;  1MWN A;  2EGD A;  2JNX A;  2ZN9 A;  4ORB B;  3ZNI A;  2BKH B;  1S3P A;  1YVH A;  1BR1 B;  1CKK A;  2KQ6 A;  1LA3 A;  1PAL A;  4PE0 A;  3VRO A;  2M3W A;  1H8B A;  2O5G A;  4GUK A;  1NPQ A;  5I2L A;  4HSZ A;  2D8N A;  2K8M B;  1S36 A;  1TOP A;  2HF5 A;  2JWW A;  3BYA A;  1Q80 A;  5F6T A;  2KSP A;  3MSE B;  1SMG A;  4FQO A;  2L4H A;  1LVC D;  2L2E A;  3GK2 A;  1GQM A;  1SKT A;  1R6P A;  3PAL A;  5AER A;  1CDL A;  1TNQ A;  1KFU S;  1CTR A;  5I2O A;  3PSR A;  1A2X A;  2WOR A;  2Y4Q A;  1L7Z A;  4NQG A;  4R1E A;  2H61 C;  2K7C A;  1QX5 B;  1NX0 A;  1SRA A;  1NUB A;  1N65 A;  3BUO B;  1KK8 B;  3WHT B;  1B47 A;  2DOQ A;  1L2O B;  1CDM A;  1DGV A;  2G9B A;  2KDH A;  5CSI A;  2BBN A;  2LVJ A;  1KK8 C;  1UHK A;  2OS8 B;  3PLF B;  4BY5 A;  2BCB A;  1L2O C;  2PMY A;  2NCP A;  1G4Y R;  2NXQ A;  2COL B;  4GPL B;  3DF0 A;  2OS8 C;  4HRH A;  1UWO A;  3VRP A;  1TCF A;  1ODB A;  3KHE A;  2LP2 A;  1HT9 A;  4GFT A;  2CTN A;  4OV2 A;  2K7D A;  2JXC A;  1UHJ A;  2LVV A;  1ZAC A;  2M7L A;  2Y1N A;  3IQQ A;  3NSI A;  3VRQ A;  5HKY A;  2FJU B;  1JF2 A;  2V53 A;  1DJX A;  5ER4 X;  1NCX A;  2BE4 A;  1K9K A;  1B7T Y;  2MAZ A;  1OQP A;  1BU3 A;  1OSA A;  5AXI A;  1EL4 A;  1WLM A;  1XYD A;  1YUU A;  5JOL A;  4ETO A;  1CDP A;  1YUT A;  4XJK B;  3M0W A;  1SPY A;  4N5X A;  1HQV A;  4YGB B;  3CR4 X;  2LMU A;  4WQ2 A;  1YUR A;  3O78 A;  3DVE A;  1TIZ A;  2BL0 B;  4DUQ A;  3TS5 B;  1IQ5 A;  3I5I C;  1MR8 A;  1J7Q A;  1KFU L;  1CM4 A;  5CPV A;  3SG7 A;  4M2Q A;  2LE9 B;  1BMO A;  1UHN A;  4PE1 A;  3NXA A;  4GAO A;  1TRF A;  1XFY O;  1IWQ A;  4YGC B;  4DCK A;  5I8N A;  4CID A;  2LP3 A;  5DKN A;  1KCY A;  2WCB A;  3OX5 A;  1MQ1 A;  1C07 A;  3TDI A;  1CFF A;  2QPT A;  1J1D A;  1UUS A;  1QX7 A;  1NIW A;  1QAT A;  2F3Y A;  2LLT A;  2LVK A;  2Y5I A;  2K61 A;  3A8R A;  3LK1 A;  4MRY A;  2IS9 A;  1K94 A;  1QVI Y;  2ZKM X;  4YGE B;  1OZS A;  3EK8 A;  1ZMZ A;  2MHH A;  1NP8 A;  4ZCU A;  1KSM A;  1QX2 A;  1K9P A;  3QRX A;  1IH0 A;  1KQM B;  1CMG A;  2B1U A;  1J7P A;  4Q04 A;  2P6B B;  1J1E A;  1XFZ O;  2I18 A;  2MLF C;  1UUR A;  1DTL A;  1EG4 A;  2K7O A;  1QV0 A;  1SNL A;  1LXF C;  2LLU A;  2R2I A;  3I5H C;  2F8P A;  1KQM C;  3PFV A;  1SCM C;  1WDC B;  1G33 A;  4U8D A;  1Y1X A;  2GGZ A;  1B9A A;  4A4C A;  1U5I A;  3I5G C;  1J55 A;  2EC6 B;  1XA5 A;  2MJW B;  1BR4 B;  3OX6 A;  1OZO A;  3RM1 A;  3ICB A;  1K96 A;  4AOM A;  1NCY A;  4GGN A;  1S6I A;  4MSP A;  2JQ6 A;  1KQV A;  2KGB C;  4UPG A;  1SBJ A;  2LHL A;  1ZUZ A;  2LM5 A;  5KSZ A;  1F54 A;  2KHN A;  1WLZ A;  3OP0 A;  1FPW A;  4QJ4 B;  1KK7 Z;  5TNC A;  2BCX A;  4CPV A;  1REC A;  3VRR A;  2RGI A;  5D7F A;  2LMT A;  2NZ0 A;  1GGZ A;  4ICB A;  1OE9 B;  2HET A;  3NSO A;  3FS7 A;  3DVM A;  3FWC A;  4PAL A;  3SG4 A;  1DJY A;  1WRL A;  1YX7 A;  5DKR A;  1CNP A;  2HPS A;  2GGM A;  1K90 D;  3GK4 X;  2KFG A;  5AFP A;  3KEV A;  1MXE A;  3BOW B;  1XO5 A;  3AKB A;  3I5F B;  1K93 D;  1AHR A;  1N2D A;  1S6J A;  5ER5 A;  3VRN A;  1FF1 A;  4NDD A;  4XJK A;  1H4B A;  2KI6 D;  2F33 A;  2M97 A;  1TTX A;  2KAX A;  1PVA A;  3I5F C;  3DD4 A;  3KF9 A;  1DVI A;  1IG5 A;  1PRW A;  1CMF A;  4PE7 A;  3LL8 B;  2KYF A;  2M8U A;  1QS7 A;  2M29 A;  4ZCV A;  3TUY C;  4I5N B;  3CGA A;  5HLO A;  2L98 A;  3EVV A;  1V1G A;  2JC2 A;  2QAC A;  1PK0 D;  2KFH A;  4GGF A;  4PHJ A;  1BOC A;  3OHM B;  2K7B A;  5KU1 A;  4CFR A;  2ZFD A;  4YBH B;  2LUC A;  3D0Y A;  1QIW A;  2JT0 A;  1SCV A;  1UP5 A;  4MRX A;  2CXJ A;  2JTT A;  3WNX B;  1B1G A;  2MRD A;  1QLS A;  4I5L B;  2BKI B;  1SR6 C;  2LMV A;  3HX4 A;  1TNW A;  1QXP A;  2EHB A;  1IQ3 A;  1DJG A;  1M31 A;  4GBA A;  2OTG C;  3SJS A;  4PHM A;  1BT6 A;  1XK4 C;  4C0L A;  3OB1 B;  4MZK A;  2K2A A;  4OCI A;  2FCE A;  2L5X B;  2MBX A;  1DJH A;  4MZL A;  2LVI A;  4YGD B;  5HKZ A;  5DKQ A;  2WND A;  3I5I B;  1YRU B;  1B4C A;  1M46 A;  1RJV A;  1YTZ C;  2AMI A;  2KI4 B;  1D1O A;  1S5G Z;  1JWD A;  1A75 A;  3JVT C;  4QJ3 B;  1PSR A;  2E6W A;  4E68 A;  1W7I B;  3TDU A;  1F71 A;  3BUM B;  2KI4 C;  2Q91 A;  1NX1 A;  3OB2 B;  3O2P A;  2HQ8 A;  2JUL A;  1DMO A;  2PRU A;  1JFJ A;  2PAL A;  1QTX A;  1XFU O;  2K0J A;  4F0Z B;  4WRI A;  3CZT X;  3BOW A;  3PN7 B;  2WCF A;  4YI9 A;  4C0K A;  1S1E A;  2O60 A;  1MF8 B;  1BF5 A;  3CWG A;  1FI5 A;  1FW4 A;  1K95 A;  2LAP A;  1DT7 B;  1NYA A;  3PN7 C;  5JJG A;  3BUX B;  1KFX S;  5IBW A;  1QIV A;  3I5H B;  1K2H A;  2BCA A;  1SCM B;  2WC8 A;  2ZNE A;  3LK0 A;  3BXK A;  3JTD C;  3E3R A;  3SG6 A;  3SIA A;  1S26 D;  1DGU A;  2CBL A;  3I5G B;  1A03 A;  3FIA A;  2ZRS A;  2LV7 A;  4C0J A;  1ZFS A;  2SCP A;  1A4P A;  2JT8 A;  2K2F A;  1R2U A;  2G2B A;  5CSN A;  3O6B A;  2M1U A;  2L4I A;  2JNF A;  2LLS A;  3DF0 B;  2BBM A;  4GGF C;  2VRG A;  3LCP C;  1IKU A;  1OOJ A;  3SG5 A;  3EVU A;  4M2P A;  4PHN A;  3NSK A;  4YGA A;  3EKJ A;  2CT9 A;  1A29 A;  3EVR A;  2M7N A;  5AAN A;  3KO0 A;  2F2O A;  2LUX A;  2JZI A;  4JPZ B;  3K21 A;  1NWD A;  1CB1 A;  4N1F A;  4AQJ A;  1RWY A;  4P2Y B;  1NCZ A;  3ZWH A;  2LC5 A;  2E30 A;  4IL1 A;  2KFF A;  4NDB A;  1QLK A;  2CCM A;  1DJZ A;  2Q4U A;  4XYN A;  3NSL A;  1QJT A;  3EKH A;  1CDN A;  3TZ1 A;  3VGO A;  1DF0 B;  1M45 A;  1TCO B;  2F2P A;  4NDC A;  2CNP A;  2MA2 A;  1UHH A;  5GQQ C;  2KNE A;  4MZJ A;  1MHO A;  1FI6 A;  4M2O A;  1KK7 Y;  4CLN A;  1M39 A;  4TNC A;  3RLZ A;  2ZN8 A;  4JWQ A;  5HYD A;  2AUC A;  3BUW B;  2KAV A;  2BEC A;  1JFK A;  2BE6 A;  5G08 A;  3TUY B;  1YX8 A;  1B8C A;  2LCP A;  5B8I B;  4HRG A;  1F55 A;  1SY9 A;  1BJF A;  1RK9 A;  1GGW A;  3IQO A;  2PVB A;  1PVB A;  1SYM A;  3EK7 A;  1Y6W A;  4N1G A;  1FBV A;  1NSH A;  2FCD A;  1KFX L;  4P5O E;  1C7W A;  4WQ3 A;  1BLQ A;  4MLW A;  4DIR A;  1SL8 A;  1OMV A;  3CR2 A;  3PAT A;  2GV5 A;  2JT3 A;  3H4S E;  1J7R A;  1XFV O;  3DVK A;  1X02 A;  1TNP A;  1SR6 B;  1XVJ A;  1F4Q A;  1AVS A;  1AP4 A;  3BQ3 A;  1JC2 A;  1CLM A;  3AKA A;  1MUX A;  3GK1 A;  1AK8 A;  4PCW A;  1ALW A;  2OTG B;  4MEW A;  1G8I A;  1Y1A A;  2SAS A;  1SK6 D; 
#chains in the Genus database with same CATH topology
 1AUI B;  4CFQ A;  1YRT B;  4YGE B;  1BG1 A;  4F7F A;  2QEO A;  1B8R A;  3EK4 A;  2ZRT A;  1U5I B;  2QDI A;  2KGR A;  1WRK A;  1F4O A;  1TN4 A;  1K8U A;  2JXL A;  2L0P A;  4D1E A;  2OPO A;  2ZND A;  1B7T Z;  2F3Z A;  3GOF A;  3O4Y A;  3WXA A;  4USL A;  1OMR A;  3SS3 A;  1OMD A;  2HQW A;  4PDZ A;  1V1F A;  3CTN A;  1Y1U A;  3JVT B;  3CYZ A;  3L4A A;  4FTG A;  4JQ0 D;  1MXL C;  1EXR A;  1SL9 A;  1NX2 A;  2M49 B;  2WCE A;  4DRW A;  1IJ6 A;  5PAL A;  3HCM A;  1RFJ A;  4PE4 A;  3WHU B;  1CLB A;  3CDN A;  5K89 A;  4MBE A;  3PM8 A;  1YVL A;  1KWO B;  1J7O A;  2KQY A;  1WRZ A;  2PSR A;  1PSB A;  3FWB A;  3AAK A;  2A4J A;  1JF0 A;  4BY4 A;  1CFP A;  1XFW O;  3CS1 A;  1W7J B;  2L51 A;  3CR5 X;  4YRU A;  1KWO C;  1GM0 A;  1M63 B;  1DJI A;  1WY9 A;  1LIN A;  1RTP 1;  2JPT A;  2I94 A;  2LNK A;  2AAO A;  1GJY A;  1YUS A;  3OBV A;  1DF0 A;  1EH2 A;  3PM2 A;  1VRK A;  1DJW A;  1C3Z A;  1S6C A;  2H61 A;  4I5J A;  2LHI A;  4ORA B;  2ISD A;  1PUL A;  2I2R E;  3CZ1 A;  5D69 A;  5FI6 A;  1QVI Z;  2FOT A;  4MN0 A;  3JTD B;  1S5G Y;  4I5K A;  2KYC A;  3BUN B;  5FYX A;  5HLV A;  1AJ5 A;  1DEK A;  2NCO A;  1IGV A;  1XFX O;  2JTZ A;  2TN4 A;  1C7V A;  1F8H A;  2KPH A;  2M0R A;  2JRF A;  4MVF A;  1IJ5 A;  1LS8 A;  1ZOT B;  2JU0 A;  5CSF A;  1ALV A;  1EJ3 A;  2M1K B;  2BL0 C;  3L47 A;  1SSE B;  3QME A;  1CLL A;  2P71 A;  3KPX A;  5FI7 A;  1K9U A;  4ORC B;  3TS5 C;  3CAB A;  3SG2 A;  4OKH A;  3A4U B;  3SIB A;  2LAN A;  1F70 A;  2JOJ A;  4PHK A;  1QAS A;  3D0Y B;  3ZWH A;  3DXL A;  2I7A A;  1B8L A;  1TNX A;  2NLN A;  1SL7 A;  5AEQ A;  1JUO A;  4AQI A;  5KTY A;  1CFC A;  1CFD A;  3O4X A;  1BOD A;  5DIC A;  4L9M A;  1EG3 A;  5HKW A;  3DVJ A;  2WC5 A;  3SG3 A;  4QJ5 B;  2KAY A;  1JSA A;  4HRE E;  3OGN A;  1RRO A;  2KBI A;  1XK4 A;  1IRJ A;  4FQT A;  2KBM A;  4YI8 A;  2Y1M A;  3F45 A;  2M9G A;  2MLE C;  1TUZ A;  4OVN F;  5EL2 A;  5J3X A;  4OR9 B;  1KSO A;  3LLE A;  1QV1 A;  3IF7 A;  1WDC C;  1CM1 A;  1SW8 A;  3D10 A;  5BPJ A;  1Y0V H;  1P28 A;  2EC6 C;  2H2K A;  3AAJ A;  4DS7 A;  1JBA A;  2KI6 C;  1NX3 A;  1AJ4 A;  1E8A A;  1YR5 A;  5CSJ A;  4A4B A;  2PAS A;  2WOS A;  3S0B A;  2L50 A;  4GNK B;  2KOT A;  2WC6 A;  3C1V A;  3CLN A;  3TDZ A;  5I2Q A;  1LKJ A;  1A75 B;  1LA0 A;  1N0Y A;  1UHI A;  1MWN A;  2EGD A;  2JNX A;  2ZN9 A;  4ORB B;  3ZNI A;  1C3Y A;  3BFA A;  2BKH B;  1S3P A;  1YVH A;  1BR1 B;  1CKK A;  2KQ6 A;  1LA3 A;  1PAL A;  1W9Z A;  4PE0 A;  3VRO A;  3S0A A;  2M3W A;  1H8B A;  2O5G A;  4GUK A;  1NPQ A;  5I2L A;  4HSZ A;  2D8N A;  2K8M B;  1S36 A;  1TOP A;  2HF5 A;  2JWW A;  3BYA A;  1Q80 A;  5F6T A;  2KSP A;  3MSE B;  4IJ7 A;  1SMG A;  4FQO A;  2L4H A;  1LVC D;  2L2E A;  1XFR A;  1GQM A;  1SKT A;  3B88 A;  1R6P A;  3GK2 A;  3PAL A;  5FI2 A;  1CDL A;  5AER A;  1TNQ A;  1KFU S;  1CTR A;  5I2O A;  3PSR A;  1A2X A;  2WOR A;  2Y4Q A;  1L7Z A;  4NQG A;  4R1E A;  2H61 C;  2K7C A;  1QX5 B;  1NX0 A;  3D73 A;  1SRA A;  1NUB A;  1N65 A;  3BUO B;  1KK8 B;  3WHT B;  1B47 A;  2DOQ A;  1L2O B;  1CDM A;  1DGV A;  2G9B A;  2KDH A;  5CSI A;  2FJY A;  3EG5 B;  1OOH A;  3NHI A;  2BBN A;  2LVJ A;  1KK8 C;  1UHK A;  2OS8 B;  3NGV A;  3PLF B;  4BY5 A;  2BCB A;  1L2O C;  2PMY A;  2NCP A;  1G4Y R;  2NXQ A;  2COL B;  3Q8I A;  4GPL B;  3DF0 A;  2OS8 C;  4HRH A;  1UWO A;  3VRP A;  1TCF A;  1ODB A;  3KHE A;  2LP2 A;  1HT9 A;  3K1E A;  4GFT A;  1OOG A;  2CTN A;  4OV2 A;  2K7D A;  2JXC A;  1UHJ A;  1TUJ A;  2LVV A;  1ZAC A;  2M7L A;  2Y1N A;  1TWO A;  3IQQ A;  3NSI A;  3VRQ A;  4PT1 A;  5HKY A;  2FJU B;  1JF2 A;  3BFB A;  2V53 A;  3CZ2 A;  1DJX A;  5ER4 X;  1NCX A;  3NHT A;  2BE4 A;  1K9K A;  1T14 A;  1B7T Y;  2MAZ A;  1OQP A;  1BU3 A;  1OSA A;  5AXI A;  1EL4 A;  1WLM A;  1XYD A;  1YUU A;  5JOL A;  4ETO A;  1CDP A;  1YUT A;  4XJK B;  3M0W A;  1SPY A;  4N5X A;  1HQV A;  4YGB B;  3FE8 A;  1OOI X;  3CR4 X;  2LMU A;  4WQ2 A;  1YUR A;  3O78 A;  3DVE A;  1TIZ A;  2BL0 B;  4DUQ A;  3TS5 B;  1IQ5 A;  3I5I C;  1MR8 A;  1J7Q A;  1KFU L;  1CM4 A;  5CPV A;  3L4L A;  3RZS A;  3SG7 A;  4M2Q A;  2LE9 B;  1BMO A;  1UHN A;  4PE1 A;  3NXA A;  4GAO A;  1TRF A;  1XFY O;  1IWQ A;  4YGC B;  4DCK A;  5I8N A;  4CID A;  2LP3 A;  5DKN A;  3BFH A;  2WCL A;  1KCY A;  2WCB A;  3OX5 A;  1MQ1 A;  1C07 A;  3TDI A;  1CFF A;  2QPT A;  1J1D A;  1UUS A;  1QX7 A;  1NIW A;  1QAT A;  2F3Y A;  2LLT A;  2LVK A;  2Y5I A;  2K61 A;  2YGU A;  3A8R A;  3LK1 A;  2IS9 A;  1K94 A;  1QVI Y;  2ZKM X;  4MRY A;  1OZS A;  3EK8 A;  1ZMZ A;  2MHH A;  1NP8 A;  4ZCU A;  1DQE A;  1KSM A;  1QX2 A;  1K9P A;  2KLE A;  3QRX A;  1IH0 A;  1KQM B;  4JKT A;  1ORG A;  1CMG A;  1OW4 A;  2B1U A;  4Q04 A;  2P6B B;  1J7P A;  1J1E A;  1XFZ O;  2I18 A;  2MLF C;  1UUR A;  1DTL A;  1EG4 A;  2K7O A;  2WCM A;  1QV0 A;  1SNL A;  4INX A;  1LXF C;  2LLU A;  2R2I A;  3I5H C;  2F8P A;  1KQM C;  3PFV A;  1SCM C;  1WDC B;  2BNX A;  2QEH A;  1G33 A;  4U8D A;  1Y1X A;  2GGZ A;  1B9A A;  4A4C A;  1U5I A;  3I5G C;  1J55 A;  2EC6 B;  1XA5 A;  2MJW B;  1BR4 B;  3OX6 A;  1OZO A;  3RM1 A;  3ICB A;  1K96 A;  4AOM A;  1NCY A;  4GGN A;  1S6I A;  4MSP A;  2JQ6 A;  1KQV A;  2KGB C;  4UPG A;  1SBJ A;  2LHL A;  1ZUZ A;  2LM5 A;  5KSZ A;  1F54 A;  2KHN A;  1WLZ A;  3OP0 A;  1FPW A;  4QJ4 B;  1KK7 Z;  2WCK A;  2BCX A;  5TNC A;  1REC A;  4CPV A;  3VRR A;  2RGI A;  3S0F A;  5D7F A;  2LMT A;  1DEL A;  2NZ0 A;  1GGZ A;  4ICB A;  1OE9 B;  2HET A;  3NSO A;  1Z2C B;  3DVM A;  3FS7 A;  3FWC A;  4PAL A;  3SG4 A;  1DJY A;  1WRL A;  1YX7 A;  5DKR A;  1CNP A;  2HPS A;  2GGM A;  1K90 D;  3GK4 X;  2KFG A;  5AFP A;  3KEV A;  1MXE A;  3B87 A;  3BOW B;  1XO5 A;  3AKB A;  3I5F B;  1K93 D;  1AHR A;  1N2D A;  1S6J A;  5ER5 A;  3VRN A;  1FF1 A;  4NDD A;  4XJK A;  3DZT A;  3S0D A;  3DYE A;  1H4B A;  2KI6 D;  2F33 A;  2M97 A;  1TTX A;  2KAX A;  1PVA A;  3I5F C;  3DD4 A;  3KF9 A;  1DVI A;  1IG5 A;  1PRW A;  1CMF A;  4JD9 A;  4PE7 A;  3LL8 B;  2KYF A;  2M8U A;  1QS7 A;  2M29 A;  4ZCV A;  3TUY C;  4I5N B;  3CGA A;  5HLO A;  3S0E A;  2L98 A;  3EVV A;  1QWV A;  1V1G A;  2JC2 A;  2QAC A;  1PK0 D;  2KFH A;  4GGF A;  4PHJ A;  3VB1 A;  1BOC A;  3OHM B;  2K7B A;  5KU1 A;  4CFR A;  2QEV A;  4INW A;  2ZFD A;  4YBH B;  2LUC A;  3D0Y A;  1QIW A;  2ERB A;  2JT0 A;  1SCV A;  1UP5 A;  4MRX A;  2CXJ A;  2JTT A;  2K60 A;  3WNX B;  1B1G A;  2MRD A;  1QLS A;  4I5L B;  2BKI B;  1SR6 C;  2LMV A;  3HX4 A;  1TNW A;  1QXP A;  3V2L A;  2EHB A;  1IQ3 A;  1DJG A;  1M31 A;  4GBA A;  3BJH A;  2OTG C;  3SJS A;  3D76 A;  4PHM A;  1BT6 A;  1XK4 C;  4C0L A;  3OB1 B;  4MZK A;  3D77 A;  2K2A A;  3D74 A;  4OCI A;  2FCE A;  2PQL A;  2L5X B;  3N7H A;  2MBX A;  1DJH A;  3S0G A;  2P70 A;  3FE9 A;  2LVI A;  3D75 A;  4MZL A;  4YGD B;  5DKQ A;  5HKZ A;  2WND A;  3D78 A;  1YRU B;  3I5I B;  1M46 A;  1B4C A;  1RJV A;  1YTZ C;  2AMI A;  2KI4 B;  1D1O A;  1S5G Z;  1JWD A;  1A75 A;  3JVT C;  4QJ3 B;  1PSR A;  2E6W A;  4E68 A;  1W7I B;  3TDU A;  1F71 A;  3BUM B;  2KI4 C;  2Q91 A;  1NX1 A;  3OB2 B;  4KYN A;  3O2P A;  2HQ8 A;  2JUL A;  1DMO A;  2PRU A;  1JFJ A;  2PAL A;  2L2C A;  1QTX A;  1XFU O;  2K0J A;  4F0Z B;  4WRI A;  3CZT X;  3R72 A;  3BOW A;  2WCJ A;  3PN7 B;  1DC1 A;  2WCF A;  4YI9 A;  4C0K A;  1S1E A;  2O60 A;  1MF8 B;  1BF5 A;  3CWG A;  1FI5 A;  1FW4 A;  2BAP A;  1K95 A;  3R1P A;  2LAP A;  1DT7 B;  1NYA A;  3PN7 C;  5JJG A;  3BUX B;  1KFX S;  5IBW A;  1QIV A;  3I5H B;  1K2H A;  2BCA A;  1SCM B;  2WC8 A;  2ZNE A;  3LK0 A;  3BXK A;  3JTD C;  3UNW A;  3E3R A;  3SG6 A;  3SIA A;  1S26 D;  1DGU A;  2CBL A;  3I5G B;  1A03 A;  3FIA A;  2ZRS A;  2LV7 A;  4C0J A;  1ZFS A;  2GTE A;  2SCP A;  1A4P A;  2JT8 A;  2K2F A;  1R2U A;  2G2B A;  5CSN A;  3O6B A;  2M1U A;  2L4I A;  2JNF A;  2LLS A;  3DF0 B;  2BBM A;  4GGF C;  5D3O A;  3R1O A;  2WCH A;  2VRG A;  3LCP C;  5HL1 A;  1OOJ A;  3SG5 A;  1IKU A;  3EVU A;  4M2P A;  4PHN A;  3NSK A;  4YGA A;  3B86 A;  3EKJ A;  2CT9 A;  1OOF A;  3IVT A;  1A29 A;  3EVR A;  2M7N A;  5AAN A;  3SS4 A;  3KO0 A;  2F2O A;  2LUX A;  3FE6 A;  2JZI A;  4JPZ B;  3K21 A;  1NWD A;  1CB1 A;  2PYQ A;  4N1F A;  4AQJ A;  1RWY A;  4P2Y B;  1NCZ A;  4OZD A;  2LC5 A;  2E30 A;  4IL1 A;  2KFF A;  3SS5 A;  4NDB A;  1QLK A;  2CCM A;  2KLD A;  1DJZ A;  2Q4U A;  4XYN A;  3NSL A;  3R1V A;  1QJT A;  3EKH A;  1CDN A;  3TZ1 A;  3VGO A;  5I94 A;  1DF0 B;  1M45 A;  1TCO B;  2F2P A;  4NDC A;  2CNP A;  2MA2 A;  1UHH A;  2H8V A;  2QEB A;  2KNE A;  5GQQ C;  3PJI A;  4MZJ A;  1MHO A;  1FI6 A;  4M2O A;  1KK7 Y;  4CLN A;  1M39 A;  4TNC A;  3RLZ A;  2ZN8 A;  4JWQ A;  5HYD A;  2AUC A;  3BUW B;  2KAV A;  2BEC A;  1JFK A;  2BE6 A;  5G08 A;  3CZ0 A;  1YX8 A;  1B8C A;  2LCP A;  3TUY B;  4HRG A;  5B8I B;  1F55 A;  1SY9 A;  1BJF A;  1RK9 A;  3B6X A;  1GGW A;  3IQO A;  2PVB A;  1PVB A;  3UO9 A;  1SYM A;  3EK7 A;  1Y6W A;  4N1G A;  1FBV A;  1NSH A;  2FCD A;  1KFX L;  2JPO A;  4P5O E;  2L5Y A;  1C7W A;  4WQ3 A;  1BLQ A;  1Z4H A;  4MLW A;  4DIR A;  1SL8 A;  1OMV A;  3CR2 A;  3PAT A;  2GV5 A;  2JT3 A;  3H4S E;  1J7R A;  1XFV O;  3DVK A;  1X02 A;  1TNP A;  1SR6 B;  1XVJ A;  1IIO A;  3B7A A;  1F4Q A;  1AVS A;  1AP4 A;  3BQ3 A;  1JC2 A;  1CLM A;  3AKA A;  1MUX A;  3GK1 A;  1AK8 A;  4PCW A;  3DY9 A;  1ALW A;  2OTG B;  4MEW A;  1G8I A;  1Y1A A;  2SAS A;  1SK6 D; 
#chains in the Genus database with same CATH homology
 1AUI B;  4CFQ A;  1YRT B;  1BG1 A;  1B8R A;  3EK4 A;  2ZRT A;  1U5I B;  2KGR A;  1WRK A;  1F4O A;  1TN4 A;  1K8U A;  2JXL A;  2L0P A;  4D1E A;  2OPO A;  2ZND A;  1B7T Z;  2F3Z A;  3GOF A;  3O4Y A;  3WXA A;  4USL A;  1OMR A;  1OMD A;  2HQW A;  4PDZ A;  1V1F A;  3CTN A;  1Y1U A;  3JVT B;  4FTG A;  4JQ0 D;  1MXL C;  1EXR A;  1SL9 A;  1NX2 A;  2M49 B;  2WCE A;  4DRW A;  1IJ6 A;  5PAL A;  3HCM A;  1RFJ A;  4PE4 A;  3WHU B;  1CLB A;  5K89 A;  4MBE A;  3PM8 A;  1YVL A;  1KWO B;  1J7O A;  2KQY A;  1WRZ A;  2PSR A;  1PSB A;  3FWB A;  3AAK A;  2A4J A;  1JF0 A;  4BY4 A;  1CFP A;  1XFW O;  3CS1 A;  1W7J B;  2L51 A;  3CR5 X;  4YRU A;  1KWO C;  1M63 B;  1DJI A;  1WY9 A;  1LIN A;  1RTP 1;  2JPT A;  2I94 A;  2LNK A;  2AAO A;  1GJY A;  1YUS A;  1DF0 A;  1EH2 A;  1VRK A;  1DJW A;  2H61 A;  1S6C A;  4I5J A;  4ORA B;  2LHI A;  2ISD A;  1PUL A;  2I2R E;  5D69 A;  1QVI Z;  2FOT A;  4MN0 A;  3JTD B;  1S5G Y;  4I5K A;  2KYC A;  3BUN B;  5FYX A;  5HLV A;  1AJ5 A;  2NCO A;  1IGV A;  1XFX O;  2JTZ A;  2TN4 A;  1C7V A;  1F8H A;  2M0R A;  2JRF A;  4MVF A;  1IJ5 A;  1ZOT B;  2JU0 A;  5CSF A;  1ALV A;  1EJ3 A;  2M1K B;  2BL0 C;  1CLL A;  3KPX A;  3TS5 C;  1K9U A;  4ORC B;  3SG2 A;  4OKH A;  3A4U B;  3SIB A;  2LAN A;  1F70 A;  2JOJ A;  4PHK A;  1QAS A;  3D0Y B;  2I7A A;  1B8L A;  1TNX A;  2NLN A;  1SL7 A;  5AEQ A;  1JUO A;  4AQI A;  5KTY A;  1CFC A;  1CFD A;  1BOD A;  4L9M A;  1EG3 A;  5HKW A;  3DVJ A;  3SG3 A;  4QJ5 B;  2KAY A;  1JSA A;  4HRE E;  1RRO A;  2KBI A;  1XK4 A;  1IRJ A;  2KBM A;  4YI8 A;  2Y1M A;  3F45 A;  2M9G A;  2MLE C;  4OVN F;  5J3X A;  4OR9 B;  1KSO A;  3LLE A;  1QV1 A;  3IF7 A;  1WDC C;  1CM1 A;  1SW8 A;  3D10 A;  5BPJ A;  1Y0V H;  4DS7 A;  2EC6 C;  2H2K A;  3AAJ A;  1JBA A;  2KI6 C;  1NX3 A;  1AJ4 A;  1E8A A;  1YR5 A;  5CSJ A;  4A4B A;  2PAS A;  2WOS A;  2L50 A;  4GNK B;  2KOT A;  3C1V A;  3CLN A;  3TDZ A;  5I2Q A;  1LKJ A;  1A75 B;  1LA0 A;  1N0Y A;  1UHI A;  1MWN A;  2EGD A;  2JNX A;  2ZN9 A;  4ORB B;  3ZNI A;  2BKH B;  1S3P A;  1YVH A;  1BR1 B;  1CKK A;  2KQ6 A;  1LA3 A;  1PAL A;  4PE0 A;  3VRO A;  2M3W A;  1H8B A;  2O5G A;  4GUK A;  1NPQ A;  5I2L A;  4HSZ A;  2D8N A;  2K8M B;  1S36 A;  1TOP A;  2HF5 A;  2JWW A;  3BYA A;  1Q80 A;  5F6T A;  2KSP A;  3MSE B;  1SMG A;  4FQO A;  2L4H A;  1LVC D;  2L2E A;  3GK2 A;  1GQM A;  1SKT A;  1R6P A;  3PAL A;  5AER A;  1CDL A;  1TNQ A;  1KFU S;  1CTR A;  5I2O A;  3PSR A;  1A2X A;  2WOR A;  2Y4Q A;  1L7Z A;  4NQG A;  4R1E A;  2H61 C;  2K7C A;  1QX5 B;  1NX0 A;  1SRA A;  1NUB A;  1N65 A;  3BUO B;  1KK8 B;  3WHT B;  1B47 A;  2DOQ A;  1L2O B;  1CDM A;  1DGV A;  2G9B A;  2KDH A;  5CSI A;  2BBN A;  2LVJ A;  1KK8 C;  1UHK A;  2OS8 B;  3PLF B;  4BY5 A;  2BCB A;  1L2O C;  2PMY A;  2NCP A;  1G4Y R;  2NXQ A;  2COL B;  4GPL B;  3DF0 A;  2OS8 C;  4HRH A;  1UWO A;  3VRP A;  1TCF A;  1ODB A;  3KHE A;  2LP2 A;  1HT9 A;  4GFT A;  2CTN A;  4OV2 A;  2K7D A;  2JXC A;  1UHJ A;  2LVV A;  1ZAC A;  2M7L A;  2Y1N A;  3IQQ A;  3NSI A;  3VRQ A;  5HKY A;  2FJU B;  1JF2 A;  2V53 A;  1DJX A;  5ER4 X;  1NCX A;  2BE4 A;  1K9K A;  1B7T Y;  2MAZ A;  1OQP A;  1BU3 A;  1OSA A;  5AXI A;  1EL4 A;  1WLM A;  1XYD A;  1YUU A;  5JOL A;  4ETO A;  1CDP A;  1YUT A;  4XJK B;  3M0W A;  1SPY A;  4N5X A;  1HQV A;  4YGB B;  3CR4 X;  2LMU A;  4WQ2 A;  1YUR A;  3O78 A;  3DVE A;  1TIZ A;  2BL0 B;  4DUQ A;  3TS5 B;  1IQ5 A;  3I5I C;  1MR8 A;  1J7Q A;  1KFU L;  1CM4 A;  5CPV A;  3SG7 A;  4M2Q A;  2LE9 B;  1BMO A;  1UHN A;  4PE1 A;  3NXA A;  4GAO A;  1TRF A;  1XFY O;  1IWQ A;  4YGC B;  4DCK A;  5I8N A;  4CID A;  2LP3 A;  5DKN A;  1KCY A;  2WCB A;  3OX5 A;  1MQ1 A;  1C07 A;  3TDI A;  1CFF A;  2QPT A;  1J1D A;  1UUS A;  1QX7 A;  1NIW A;  1QAT A;  2F3Y A;  2LLT A;  2LVK A;  2Y5I A;  2K61 A;  3A8R A;  3LK1 A;  4MRY A;  2IS9 A;  1K94 A;  1QVI Y;  2ZKM X;  4YGE B;  1OZS A;  3EK8 A;  1ZMZ A;  2MHH A;  1NP8 A;  4ZCU A;  1KSM A;  1QX2 A;  1K9P A;  3QRX A;  1IH0 A;  1KQM B;  1CMG A;  2B1U A;  1J7P A;  4Q04 A;  2P6B B;  1J1E A;  1XFZ O;  2I18 A;  2MLF C;  1UUR A;  1DTL A;  1EG4 A;  2K7O A;  1QV0 A;  1SNL A;  1LXF C;  2LLU A;  2R2I A;  3I5H C;  2F8P A;  1KQM C;  3PFV A;  1SCM C;  1WDC B;  1G33 A;  4U8D A;  1Y1X A;  2GGZ A;  1B9A A;  4A4C A;  1U5I A;  3I5G C;  1J55 A;  2EC6 B;  1XA5 A;  2MJW B;  1BR4 B;  3OX6 A;  1OZO A;  3RM1 A;  3ICB A;  1K96 A;  4AOM A;  1NCY A;  4GGN A;  1S6I A;  4MSP A;  2JQ6 A;  1KQV A;  2KGB C;  4UPG A;  1SBJ A;  2LHL A;  1ZUZ A;  2LM5 A;  5KSZ A;  1F54 A;  2KHN A;  1WLZ A;  3OP0 A;  1FPW A;  4QJ4 B;  1KK7 Z;  5TNC A;  2BCX A;  4CPV A;  1REC A;  3VRR A;  2RGI A;  5D7F A;  2LMT A;  2NZ0 A;  1GGZ A;  4ICB A;  1OE9 B;  2HET A;  3NSO A;  3FS7 A;  3DVM A;  3FWC A;  4PAL A;  3SG4 A;  1DJY A;  1WRL A;  1YX7 A;  5DKR A;  1CNP A;  2HPS A;  2GGM A;  1K90 D;  3GK4 X;  2KFG A;  5AFP A;  3KEV A;  1MXE A;  3BOW B;  1XO5 A;  3AKB A;  3I5F B;  1K93 D;  1AHR A;  1N2D A;  1S6J A;  5ER5 A;  3VRN A;  1FF1 A;  4NDD A;  4XJK A;  1H4B A;  2KI6 D;  2F33 A;  2M97 A;  1TTX A;  2KAX A;  1PVA A;  3I5F C;  3DD4 A;  3KF9 A;  1DVI A;  1IG5 A;  1PRW A;  1CMF A;  4PE7 A;  3LL8 B;  2KYF A;  2M8U A;  1QS7 A;  2M29 A;  4ZCV A;  3TUY C;  4I5N B;  3CGA A;  5HLO A;  2L98 A;  3EVV A;  1V1G A;  2JC2 A;  2QAC A;  1PK0 D;  2KFH A;  4GGF A;  4PHJ A;  1BOC A;  3OHM B;  2K7B A;  5KU1 A;  4CFR A;  2ZFD A;  4YBH B;  2LUC A;  3D0Y A;  1QIW A;  2JT0 A;  1SCV A;  1UP5 A;  4MRX A;  2CXJ A;  2JTT A;  3WNX B;  1B1G A;  2MRD A;  1QLS A;  4I5L B;  2BKI B;  1SR6 C;  2LMV A;  3HX4 A;  1TNW A;  1QXP A;  2EHB A;  1IQ3 A;  1DJG A;  1M31 A;  4GBA A;  2OTG C;  3SJS A;  4PHM A;  1BT6 A;  1XK4 C;  4C0L A;  3OB1 B;  4MZK A;  2K2A A;  4OCI A;  2FCE A;  2L5X B;  2MBX A;  1DJH A;  4MZL A;  2LVI A;  4YGD B;  5HKZ A;  5DKQ A;  2WND A;  3I5I B;  1YRU B;  1B4C A;  1M46 A;  1RJV A;  1YTZ C;  2AMI A;  2KI4 B;  1D1O A;  1S5G Z;  1JWD A;  1A75 A;  3JVT C;  4QJ3 B;  1PSR A;  2E6W A;  4E68 A;  1W7I B;  3TDU A;  1F71 A;  3BUM B;  2KI4 C;  2Q91 A;  1NX1 A;  3OB2 B;  3O2P A;  2HQ8 A;  2JUL A;  1DMO A;  2PRU A;  1JFJ A;  2PAL A;  1QTX A;  1XFU O;  2K0J A;  4F0Z B;  4WRI A;  3CZT X;  3BOW A;  3PN7 B;  2WCF A;  4YI9 A;  4C0K A;  1S1E A;  2O60 A;  1MF8 B;  1BF5 A;  3CWG A;  1FI5 A;  1FW4 A;  1K95 A;  2LAP A;  1DT7 B;  1NYA A;  3PN7 C;  5JJG A;  3BUX B;  1KFX S;  5IBW A;  1QIV A;  3I5H B;  1K2H A;  2BCA A;  1SCM B;  2WC8 A;  2ZNE A;  3LK0 A;  3BXK A;  3JTD C;  3E3R A;  3SG6 A;  3SIA A;  1S26 D;  1DGU A;  2CBL A;  3I5G B;  1A03 A;  3FIA A;  2ZRS A;  2LV7 A;  4C0J A;  1ZFS A;  2SCP A;  1A4P A;  2JT8 A;  2K2F A;  1R2U A;  2G2B A;  5CSN A;  3O6B A;  2M1U A;  2L4I A;  2JNF A;  2LLS A;  3DF0 B;  2BBM A;  4GGF C;  2VRG A;  3LCP C;  1IKU A;  1OOJ A;  3SG5 A;  3EVU A;  4M2P A;  4PHN A;  3NSK A;  4YGA A;  3EKJ A;  2CT9 A;  1A29 A;  3EVR A;  2M7N A;  5AAN A;  3KO0 A;  2F2O A;  2LUX A;  2JZI A;  4JPZ B;  3K21 A;  1NWD A;  1CB1 A;  4N1F A;  4AQJ A;  1RWY A;  4P2Y B;  1NCZ A;  3ZWH A;  2LC5 A;  2E30 A;  4IL1 A;  2KFF A;  4NDB A;  1QLK A;  2CCM A;  1DJZ A;  2Q4U A;  4XYN A;  3NSL A;  1QJT A;  3EKH A;  1CDN A;  3TZ1 A;  3VGO A;  1DF0 B;  1M45 A;  1TCO B;  2F2P A;  4NDC A;  2CNP A;  2MA2 A;  1UHH A;  5GQQ C;  2KNE A;  4MZJ A;  1MHO A;  1FI6 A;  4M2O A;  1KK7 Y;  4CLN A;  1M39 A;  4TNC A;  3RLZ A;  2ZN8 A;  4JWQ A;  5HYD A;  2AUC A;  3BUW B;  2KAV A;  2BEC A;  1JFK A;  2BE6 A;  5G08 A;  3TUY B;  1YX8 A;  1B8C A;  2LCP A;  5B8I B;  4HRG A;  1F55 A;  1SY9 A;  1BJF A;  1RK9 A;  1GGW A;  3IQO A;  2PVB A;  1PVB A;  1SYM A;  3EK7 A;  1Y6W A;  4N1G A;  1FBV A;  1NSH A;  2FCD A;  1KFX L;  4P5O E;  1C7W A;  4WQ3 A;  1BLQ A;  4MLW A;  4DIR A;  1SL8 A;  1OMV A;  3CR2 A;  3PAT A;  2GV5 A;  2JT3 A;  3H4S E;  1J7R A;  1XFV O;  3DVK A;  1X02 A;  1TNP A;  1SR6 B;  1XVJ A;  1F4Q A;  1AVS A;  1AP4 A;  3BQ3 A;  1JC2 A;  1CLM A;  3AKA A;  1MUX A;  3GK1 A;  1AK8 A;  4PCW A;  1ALW A;  2OTG B;  4MEW A;  1G8I A;  1Y1A A;  2SAS A;  1SK6 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...