1CMGA

Nmr solution structure of calcium-loaded calmodulin carboxy-terminal domain
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
73
structure length
73
Chain Sequence
MKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CALMODULIN (VERTEBRATE)
publication title Calcium-induced structural changes and domain autonomy in calmodulin.
pubmed doi rcsb
source organism Bos taurus
molecule tags Calcium-binding protein
total genus 12
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 1995-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1cmgA00
2K2AA 3IQOA 5D7FA 2LANA 4GPLB 3DF0B 3NSLA 4ZCVA 1YUUA 1B8CA 2F2PA 2EC6C 2AMIA 2AAOA 1NPQA 1JF0A 3BXKA 1TCOB 1AUIB 1G8IA 2KYCA 2PRUA 1N2DA 3BUNB 3KO0A 1E8AA 3SG4A 1CDNA 3MSEB 1YRTB 4GGFA 1R6PA 1KWOB 2SASA 1SCMB 2LNKA 3PSRA 2G2BA 2JZIA 4OKHA 4PE4A 3D0YB 2FCDA 1QV1A 1Y1UA 1DMOA 1FPWA 1SW8A 1WLMA 2PVBA 2K2FA 3SIBA 1S6JA 1CMFA 1BOCA 1KFXL 5ER5A 1C07A 1KFUL 3OX6A 4IL1A 1KQVA 1ODBA 2CBLA 2HPSA 3PM8A 3LL8B 2M49B 1TN4A 2FOTA 4MRYA 2M3WA 1AJ5A 1SNLA 3LK1A 3A8RA 1MXEA 2D8NA 5JJGA 3IQQA 2LE9B 4N5XA 1JF2A 2M29A 1OE9B 1QX2A 1X02A 1K90D 2BKHB 5I8NA 4PHNA 4I5LB 1SCMC 2H61C 1CMGA 3I5FB 2O5GA 2HQWA 4HRGA 1WRLA 1N0YA 4USLA 1K9KA 3O2PA 4AOMA 1H8BA 1OSAA 2L0PA 1JWDA 3WXAA 1IQ5A 1L2OB 1NX3A 3EVUA 4ORBB 4DRWA 1UHNA 2OS8B 1NWDA 1QATA 1SCVA 3NSOA 1V1FA 2CCMA 4CIDA 1NSHA 2F3ZA 1UHIA 3CR4X 1NX1A 3OHMB 4QJ5B 2KAVA 2LVVA 1K94A 3JTDC 1FI6A 4ORAB 4C0LA 4GAOA 1YVLA 4GGNA 1QLKA 1WDCB 2ZRTA 1DJYA 1M45A 1F55A 1RJVA 2F2OA 1AVSA 1KK7Y 1S6IA 5BPJA 5IBWA 3AKAA 4HREE 2JNFA 1CFFA 3I5FC 3PFVA 1SKTA 1TNPA 5TNCA 3E3RA 1QVIY 1G33A 2KBIA 1A29A 1L2OC 2FJUB 1EG4A 2OS8C 3KHEA 2M0RA 4YBHB 1MXLC 2JQ6A 1BR1B 1RROA 2H61A 3F45A 1R2UA 1M31A 1M39A 1GGWA 5CSJA 2CTNA 1CM1A 2OTGB 4A4BA 3D0YA 4PCWA 1PK0D 4PE1A 3I5GB 4YGEB 3K21A 2KSPA 2M97A 2PSRA 4GFTA 1IG5A 1BODA 1SY9A 3LK0A 2JT8A 2JT3A 5DKRA 4GNKB 5DKQA 5AERA 2WCEA 2LV7A 4R1EA 2WOSA 4U8DA 3RM1A 2KFFA 2ISDA 2LAPA 4NQGA 3JVTB 2MA2A 3SG5A 3ZWHA 1A75B 4XJKA 3VGOA 1BJFA 1IJ6A 1OZOA 3EK7A 1K95A 1YR5A 5I2QA 5J3XA 1DJZA 3FWBA 1S6CA 4F0ZB 1U5IB 4NDDA 2JC2A 2GV5A 3I5HB 3TUYB 4C0JA 1RWYA 1XVJA 2V53A 1AJ4A 1Y0VH 4PE0A 5HLVA 3DVJA 4PHJA 2L4HA 3WHTB 3BOWB 2AUCA 1CLLA 2ZNEA 4MZLA 1K9PA 1BR4B 2LHIA 4DUQA 1H4BA 1ZUZA 2JOJA 4YRUA 3BUXB 4YI9A 3TDIA 1LKJA 3CR5X 1CFCA 2LVIA 3CGAA 3JVTC 3GOFA 5AEQA 2I2RE 4MZKA 4YGAA 1BF5A 4MSPA 1RTP1 3VRPA 1J55A 1JFJA 1B47A 1DTLA 1PVAA 1TIZA 4FTGA 1NCZA 1HQVA 2BL0C 1IWQA 4CLNA 1F70A 3A4UB 4HRHA 3I5HC 1S5GZ 4OV2A 4UPGA 2HF5A 2MRDA 4NDBA 1PALA 3BUMB 3GK2A 1VRKA 4YI8A 1AP4A 3GK4X 1CFDA 3PALA 1MF8B 1SL7A 2JTTA 2KGBC 2WCFA 5CPVA 1K9UA 1MQ1A 2KI4C 2M7LA 4N1FA 1W7IB 2EGDA 4MBEA 1A03A 3CWGA 5CSFA 2JWWA 1PVBA 1LVCD 2KAXA 2LM5A 4QJ4B 2ZRSA 1TTXA 4NDCA 3EVVA 3OP0A 1AK8A 4M2OA 3SIAA 2F8PA 1BG1A 3BYAA 1J7QA 3FIAA 1YTZC 2LVJA 5AANA 1J7OA 1DVIA 1QTXA 3QRXA 1NYAA 1IQ3A 1A4PA 2K7OA 2NZ0A 1Y1XA 2FCEA 2ZKMX 1KWOC 1B8RA 1SR6B 1YRUB 2KNEA 2KDHA 2G9BA 1QX7A 2LUXA 1U5IA 2L50A 2NLNA 4PDZA 3CTNA 3TS5B 2KYFA 4BY5A 2LCPA 2A4JA 5KSZA 3PN7B 5ER4X 2Q91A 1QS7A 1CLMA 3NSKA 4L9MA 2L2EA 4GUKA 3TDZA 2I18A 4AQJA 1OMVA 4GBAA 3CS1A 1QV0A 2JRFA 1CFPA 3WHUB 1JFKA 2M9GA 2RGIA 1LINA 2JULA 2E6WA 1J7RA 1J1DA 2CXJA 1KQMB 3BUWB 1K8UA 4PHKA 2P6BB 4WRIA 1IRJA 1SBJA 2LP2A 1CDLA 3DF0A 3CZTX 2JT0A 1SR6C 1NP8A 3DD4A 1YX8A 1S36A 1F4QA 3OX5A 5D69A 2F3YA 1K93D 1RECA 1B7TY 2WORA 4ZCUA 4I5NB 1SRAA 3AKBA 3EKJA 2KGRA 5KTYA 3PN7C 1WLZA 3SG2A 2BBNA 4I5JA 2GGZA 1CNPA 1JC2A 2BBMA 3OB2B 1ZOTB 5DKNA 4P2YB 3KF9A 2LMTA 1CM4A 3SG6A 1EJ3A 1DF0B 1WDCC 1BT6A 1SL8A 3FWCA 1M46A 1PSBA 1RFJA 4OVNF 2PALA 4JWQA 4OCIA 1ALVA 1QIVA 1D1OA 2GGMA 1G4YR 1KFXS 2MBXA 4DCKA 1IKUA 2IS9A 1KFUS 1OMRA 2JXLA 3BUOB 4PALA 5PALA 2BE6A 2WCBA 2QPTA 3DVKA 4MVFA 1DJWA 2BCXA 1MWNA 2JNXA 2M1KB 4YGCB 4M2PA 2OTGC 2KOTA 5KU1A 2JU0A 3D10A 3LCPC 3I5GC 4JQ0D 2K8MB 1DJIA 1FF1A 4MRXA 1TCFA 1PULA 1B4CA 2B1UA 2KAYA 4JPZB 1CKKA 1F54A 1FW4A 4A4CA 2K7DA 1DJGA 2SCPA 1PSRA 5JOLA 2M7NA 1SL9A 1QXPA 1SMGA 1FI5A 2Y4QA 1OMDA 3DVMA 3SG7A 1XA5A 1TNQA 2WC8A 2NCOA 1NX2A 2EC6B 2K61A 1JSAA 1QJTA 2NCPA 2E30A 4WQ2A 1B1GA 2OPOA 1XYDA 1UHHA 1ZMZA 2TN4A 1S5GY 1Q80A 1ZACA 2LP3A 1FBVA 3ICBA 3TUYC 1YUTA 1XK4C 2L5XB 2LVKA 1LA0A 4QJ3B 2MLEC 3EK8A 5HKYA 3AAJA 1UURA 2KI6C 1EL4A 4XYNA 1NCXA 5FYXA 2MJWB 1CLBA 4FQOA 3KEVA 3O4YA 1GGZA 1WRKA 1XFUO 1DT7B 1A2XA 1Y6WA 1OQPA 1UUSA 3CR2A 4WQ3A 1IGVA 2BE4A 1PRWA 5HLOA 1YVHA 1DF0A 1DGVA 5HYDA 2Q4UA 1DJXA 1DJHA 3I5IB 1J7PA 1YUSA 2O60A 1OOJA 1QLSA 2Y5IA 3VROA 3VRRA 4C0KA 4DIRA 1JBAA 1NIWA 5CSIA 1M63B 2MAZA 4AQIA 5B8IB 3AAKA 1F71A 2CNPA 4E68A 1A75A 1UHJA 3VRNA 3VRQA 3TDUA 3NXAA 1NUBA 2KBMA 2KQYA 3RLZA 2NXQA 1S1EA 1NX0A 5I2LA 4PHMA 5GQQC 1LA3A 1GJYA 1XK4A 1WY9A 3HCMA 1UHKA 3JTDB 5AXIA 2LLTA 5AFPA 3BOWA 2R2IA 4XJKB 2COLB 4N1GA 2ZFDA 3C1VA 2LHLA 4ORCB 3PATA 5G08A 3I5IC 2PMYA 1XO5A 1RK9A 1AHRA 1GQMA 2LUCA 4ICBA 1XFVO 1EXRA 1SPYA 1IJ5A 3BQ3A 1TRFA 3PLFB 2MHHA 1JUOA 1HT9A 1KSMA 1W7JB 3SJSA 2KFGA 2QACA 2ZN8A 1EH2A 1KK8B 4ETOA 3H4SE 1TNXA 1F8HA 1XFXO 1WRZA 3FS7A 3TS5C 1SYMA 1Y1AA 2BECA 4CFRA 5HKWA 4CFQA 1KSOA 4MZJA 1N65A 1XFYO 4M2QA 3M0WA 5I2OA 4P5OE 1BLQA 2H2KA 4BY4A 1MR8A 4YGBB 1K96A 2JXCA 2DOQA 1B8LA 1CTRA 4YGDB 1CDPA 1MUXA 4MN0A 1KQMC 1KK7Z 3EK4A 2LMVA 1F4OA 1DGUA 3DVEA 3O78A 4HSZA 1C7VA 1CB1A 1IH0A 2KFHA 2HETA 2F33A 4TNCA 2JPTA 1QASA 1QVIZ 1J1EA 4OR9B 2LC5A 1B7TZ 1KK8C 2BCBA 2PASA 2Y1NA 2BKIB 3TZ1A 4Q04A 2VRGA 3KPXA 5F6TA 1L7ZA 1TNWA 2BCAA 3EVRA 1QX5B 3O6BA 3CLNA 5HKZA 2HQ8A 2KHNA 2I7AA 3EKHA 3HX4A 1OZSA 4CPVA 2EHBA 1YX7A 3OB1B 1CDMA 2CT9A 1YURA 2LLSA 4MEWA 2WNDA 2K7BA 4MLWA 1XFZO 3LLEA 2MLFC 2ZN9A 2K7CA 4GGFC 1C7WA 1K2HA 2LLUA 1UP5A 1ALWA 1QIWA 2Y1MA 2ZNDA 4DS7A 1EG3A 4D1EA 1SK6D 2BL0B 1S3PA 3ZNIA 2K0JA 1BMOA 1XFWO 2L4IA 3NSIA 2M8UA 4I5KA 2M1UA 3WNXB 1NCYA 2I94A 1LXFC 2KQ6A 2L51A 3IF7A 4PE7A 5CSNA 1V1GA 2LMUA 5K89A 2JTZA 2L98A 1B9AA 3SG3A 1MHOA 1S26D 1ZFSA 3GK1A 1UWOA 1TOPA 2KI4B 2KI6D 1KCYA 1BU3A
chains in the Genus database with same CATH superfamily
2K2AA 2K60A 3IQOA 5D7FA 2LANA 4GPLB 1IKUA 3DF0B 3NSLA 2JPOA 4ZCVA 1YUUA 1B8CA 2F2PA 2EC6C 3S0GA 2AMIA 2AAOA 1NPQA 1JF0A 3BXKA 1TCOB 1AUIB 1G8IA 1Z4HA 2KYCA 1N2DA 2PRUA 3BUNB 1E8AA 1TWOA 3KO0A 3MSEB 5D3OA 1YRTB 4GGFA 1R6PA 1KWOB 3EG5B 2SASA 1SCMB 2LNKA 3PSRA 2G2BA 2JZIA 4OKHA 4PE4A 3D0YB 2FCDA 1QV1A 1Y1UA 1DMOA 3SS5A 1FPWA 1SW8A 1WLMA 2PVBA 2K2FA 3SIBA 1S6JA 1CMFA 1BOCA 1KFXL 5ER5A 1C07A 3S0EA 1KFUL 3OX6A 3SG4A 4IL1A 1KQVA 1ODBA 3NHIA 2CBLA 2HPSA 3PM8A 3LL8B 2M49B 1TN4A 2FOTA 4MRYA 2M3WA 1AJ5A 3D73A 1SNLA 3LK1A 3A8RA 1MXEA 2D8NA 5JJGA 3IQQA 2LE9B 4N5XA 1JF2A 2M29A 1OE9B 1QX2A 1X02A 1K90D 2BKHB 5I8NA 3R72A 4PHNA 4I5LB 1SCMC 2H61C 1CMGA 3I5FB 3PJIA 2O5GA 2HQWA 4HRGA 1WRLA 1N0YA 4USLA 1K9KA 3O2PA 4AOMA 1H8BA 1OSAA 2L0PA 1JWDA 3WXAA 1IQ5A 1L2OB 1NX3A 3EVUA 4ORBB 4DRWA 1UHNA 2OS8B 1NWDA 1QATA 1SCVA 3NSOA 1V1FA 2CCMA 4CIDA 1NSHA 2F3ZA 1UHIA 3CR4X 1NX1A 3OHMB 3CZ1A 4QJ5B 2KAVA 2LVVA 1K94A 3JTDC 1FI6A 4ORAB 3D75A 4C0LA 4GAOA 5FI7A 4F7FA 1YVLA 4GGNA 1QLKA 1WDCB 2ZRTA 1DJYA 1M45A 1F55A 4OZDA 1RJVA 2F2OA 5I94A 1AVSA 1KK7Y 1S6IA 5BPJA 5IBWA 3AKAA 4HREE 2JNFA 1CFFA 3DYEA 3I5FC 3PFVA 1OOGA 1SKTA 1TNPA 5TNCA 3E3RA 1QVIY 1G33A 2KBIA 1A29A 1L2OC 2FJUB 1EG4A 2OS8C 3KHEA 2M0RA 4YBHB 1MXLC 1QWVA 1TUZA 2JQ6A 1BR1B 1RROA 2H61A 3OBVA 3F45A 1R2UA 1M31A 1M39A 3DY9A 5CSJA 2CTNA 1CM1A 1GGWA 2OTGB 4A4BA 3D0YA 4PCWA 1PK0D 4PE1A 3I5GB 4YGEB 3K21A 2KSPA 2M97A 2PSRA 4GFTA 1IG5A 1BODA 1SY9A 1OOHA 3LK0A 3RZSA 2JT8A 2JT3A 5DKRA 4GNKB 5DKQA 5AERA 2WCMA 2WCEA 2LV7A 2QEVA 3L4AA 4R1EA 2WOSA 4U8DA 3RM1A 2KFFA 2ISDA 2LAPA 4NQGA 3JVTB 2MA2A 1GM0A 3SG5A 3D76A 3ZWHA 1A75B 2KLEA 4XJKA 5FI6A 3VGOA 1BJFA 1IJ6A 1OZOA 3EK7A 3NGVA 1K95A 1YR5A 5I2QA 5J3XA 1DJZA 1P28A 1S6CA 3FWBA 4F0ZB 1U5IB 4NDDA 2JC2A 2GV5A 3I5HB 3TUYB 4C0JA 1RWYA 1XVJA 2V53A 1AJ4A 1Y0VH 4PE0A 5HLVA 3DVJA 4PHJA 2L4HA 3WHTB 3BOWB 1W9ZA 1CLLA 2AUCA 2ZNEA 1K9PA 1BR4B 2LHIA 4MZLA 4DUQA 4FQTA 3BFBA 1H4BA 1ZUZA 2JOJA 3NHTA 4YRUA 3BUXB 4YI9A 3IVTA 3TDIA 1LKJA 3CR5X 1CFCA 2LVIA 3CGAA 3JVTC 3V2LA 3GOFA 5AEQA 2I2RE 3PM2A 3D77A 4MZKA 2BAPA 4YGAA 1DEKA 1BF5A 4MSPA 3D78A 1RTP1 3VRPA 1J55A 1JFJA 1B47A 1DTLA 1PVAA 1TIZA 4FTGA 1NCZA 1HQVA 2BL0C 2PYQA 1IWQA 4CLNA 1F70A 2WC5A 3A4UB 4HRHA 3I5HC 1S5GZ 4OV2A 2YGUA 4UPGA 2HF5A 2MRDA 4NDBA 1PALA 3BUMB 3GK2A 1VRKA 4INWA 4YI8A 1AP4A 3GK4X 1CFDA 3PALA 1MF8B 1SL7A 2JTTA 2KGBC 2WCFA 2L2CA 5CPVA 1K9UA 1MQ1A 2KI4C 3B87A 2M7LA 4N1FA 1W7IB 2EGDA 4MBEA 1A03A 3CWGA 5CSFA 1CDNA 2JWWA 3QMEA 1PVBA 1LVCD 1SSEB 2KAXA 2LM5A 4QJ4B 2ZRSA 1TTXA 2L5YA 3EVVA 3OP0A 4NDCA 1AK8A 4M2OA 3SIAA 2F8PA 1BG1A 3BYAA 3K1EA 1J7QA 3FIAA 1YTZC 2LVJA 5AANA 1OW4A 1DVIA 1Z2CB 1QTXA 1J7OA 3QRXA 1NYAA 1IQ3A 1A4PA 2K7OA 2NZ0A 1Y1XA 2FCEA 2ZKMX 1KWOC 1B8RA 1SR6B 1YRUB 2WCKA 2KNEA 2KDHA 4INXA 2G9BA 2WCHA 3B7AA 1QX7A 2LUXA 1U5IA 2WCLA 2L50A 2NLNA 3CDNA 4PDZA 3CTNA 3TS5B 2KYFA 4BY5A 2LCPA 2A4JA 5KSZA 3PN7B 5ER4X 2Q91A 1QS7A 1CLMA 3NSKA 4L9MA 2L2EA 4GUKA 3TDZA 2I18A 4AQJA 1OMVA 4GBAA 3CS1A 2QEHA 1QV0A 2JRFA 1CFPA 3WHUB 1JFKA 2M9GA 2RGIA 1LINA 2JULA 2E6WA 1J7RA 1J1DA 2CXJA 1KQMB 3BUWB 2QEOA 1K8UA 4PHKA 2P6BB 4WRIA 1IRJA 1SBJA 3CYZA 2KLDA 2LP2A 1CDLA 3DF0A 3CZTX 2JT0A 1SR6C 2KPHA 1NP8A 3DD4A 1YX8A 1S36A 1DELA 3UNWA 1F4QA 3OX5A 5D69A 2F3YA 1K93D 1RECA 1B7TY 2WORA 4ZCUA 4I5NB 1ORGA 1SRAA 3AKBA 5FI2A 3EKJA 2KGRA 5KTYA 3PN7C 1WLZA 3SG2A 2WCJA 2BBNA 3O4XA 4I5JA 2GGZA 1CNPA 1JC2A 1TUJA 2BBMA 3OB2B 1ZOTB 5DKNA 3R1VA 4P2YB 3KF9A 2LMTA 2P71A 1CM4A 3B88A 1EJ3A 1DF0B 1WDCC 3SG6A 1BT6A 2GTEA 3BFHA 1SL8A 3FWCA 1M46A 1PSBA 1RFJA 3CABA 4OVNF 2PALA 4JWQA 4OCIA 1ALVA 1QIVA 1D1OA 2GGMA 1G4YR 1C3ZA 1KFXS 1DQEA 2MBXA 4DCKA 2IS9A 1KFUS 1OMRA 2JXLA 3BUOB 4PALA 5PALA 2BE6A 3SS3A 2WCBA 2QPTA 3DVKA 4MVFA 1DJWA 2BCXA 1MWNA 2JNXA 2M1KB 4YGCB 3R1OA 4M2PA 2OTGC 2KOTA 5HL1A 5KU1A 2JU0A 3D10A 3LCPC 3I5GC 4JQ0D 2K8MB 1DJIA 1FF1A 4MRXA 1TCFA 1PULA 1B4CA 2B1UA 2KAYA 4JPZB 1CKKA 1F54A 1FW4A 4A4CA 2K7DA 1DJGA 2SCPA 1PSRA 5JOLA 2M7NA 1SL9A 1QXPA 3SS4A 1SMGA 1FI5A 2Y4QA 1OMDA 3DVMA 3SG7A 3CZ0A 1XA5A 1TNQA 1OOIX 3OGNA 2WC8A 2NCOA 1NX2A 2EC6B 2K61A 1JSAA 1QJTA 2NCPA 2E30A 4WQ2A 3S0BA 2H8VA 1B1GA 2WC6A 2OPOA 1XYDA 1UHHA 3L4LA 1ZMZA 3BJHA 2TN4A 1S5GY 1Q80A 3R1PA 1ZACA 2LP3A 3L47A 1FBVA 2FJYA 3ICBA 3TUYC 1YUTA 1XK4C 2L5XB 2LVKA 1LA0A 4QJ3B 2MLEC 3EK8A 5HKYA 3AAJA 1UURA 2KI6C 1EL4A 2ERBA 1NCXA 2QEBA 3DZTA 4XYNA 2MJWB 5FYXA 3FE9A 1CLBA 4FQOA 3KEVA 3O4YA 1GGZA 1WRKA 1XFUO 1DT7B 1A2XA 1Y6WA 1OQPA 1UUSA 3CR2A 4WQ3A 1IGVA 2BE4A 1PRWA 5HLOA 1YVHA 1C3YA 1DF0A 1DGVA 5HYDA 2Q4UA 1DJXA 3UO9A 1DJHA 3I5IB 1J7PA 1YUSA 2O60A 1OOJA 1QLSA 2Y5IA 3VROA 3VRRA 4C0KA 4DIRA 1JBAA 1NIWA 5CSIA 1M63B 2MAZA 4AQIA 5B8IB 3AAKA 1F71A 2CNPA 4E68A 1A75A 1UHJA 3VRNA 3VRQA 3TDUA 3NXAA 2QDIA 1NUBA 2KBMA 2KQYA 3RLZA 2NXQA 1S1EA 1NX0A 5I2LA 4PHMA 5GQQC 1LA3A 3Q8IA 4JKTA 1GJYA 3B86A 1XK4A 1WY9A 3HCMA 1UHKA 3JTDB 5AXIA 2LLTA 5AFPA 3BOWA 2R2IA 3VB1A 4XJKB 2COLB 4N1GA 3BFAA 2ZFDA 3C1VA 2LHLA 4ORCB 3PATA 5G08A 3I5IC 2PMYA 1XO5A 1RK9A 1AHRA 1GQMA 2LUCA 4IJ7A 4ICBA 1XFVO 1EXRA 1SPYA 1DC1A 1IJ5A 3BQ3A 1TRFA 3PLFB 3S0AA 2MHHA 1JUOA 1HT9A 1KSMA 1W7JB 3SJSA 2KFGA 2QACA 2ZN8A 1EH2A 1KK8B 4ETOA 3H4SE 1TNXA 1F8HA 1XFXO 1WRZA 3FS7A 3TS5C 1SYMA 1Y1AA 2BECA 4CFRA 5HKWA 4KYNA 1KSOA 4MZJA 4CFQA 1N65A 1XFYO 4M2QA 3FE6A 3B6XA 3M0WA 5I2OA 3S0FA 4P5OE 3N7HA 1BLQA 2H2KA 4BY4A 1MR8A 4YGBB 1K96A 2JXCA 2DOQA 1B8LA 1CTRA 4YGDB 1CDPA 1MUXA 4MN0A 1KQMC 1KK7Z 3EK4A 2LMVA 1F4OA 1DGUA 3DVEA 3O78A 4HSZA 1C7VA 1CB1A 1IH0A 1OOFA 2KFHA 2HETA 4JD9A 2F33A 4TNCA 1LS8A 2JPTA 1QASA 1QVIZ 1J1EA 4OR9B 2LC5A 1B7TZ 1KK8C 2BCBA 2PASA 2Y1NA 2BKIB 3TZ1A 4Q04A 2VRGA 3KPXA 5F6TA 2PQLA 1L7ZA 1TNWA 2BCAA 3EVRA 1QX5B 3O6BA 3CLNA 5EL2A 5HKZA 2HQ8A 2KHNA 3S0DA 2I7AA 1XFRA 3EKHA 1OZSA 1T14A 3DXLA 2EHBA 3HX4A 4CPVA 1YX7A 3OB1B 1CDMA 2CT9A 1YURA 2LLSA 4MEWA 2WNDA 3D74A 2K7BA 4MLWA 1XFZO 3CZ2A 2MLFC 3LLEA 2ZN9A 1IIOA 2K7CA 4GGFC 1C7WA 1K2HA 2LLUA 1UP5A 1ALWA 1QIWA 2Y1MA 2ZNDA 4DS7A 1EG3A 4D1EA 1SK6D 2BL0B 1S3PA 3ZNIA 2K0JA 1BMOA 1XFWO 3FE8A 2L4IA 3NSIA 2P70A 2M8UA 2BNXA 2M1UA 4I5KA 4PT1A 3WNXB 1NCYA 2I94A 1LXFC 2KQ6A 2L51A 3IF7A 4PE7A 5CSNA 1V1GA 2LMUA 5K89A 2JTZA 2L98A 1B9AA 3SG3A 1MHOA 1S26D 1ZFSA 3GK1A 1UWOA 1TOPA 2KI4B 2KI6D 1KCYA 5DICA 1BU3A
chains in the Genus database with same CATH topology
2K2AA 3IQOA 5D7FA 2LANA 4GPLB 3DF0B 3NSLA 4ZCVA 1YUUA 1B8CA 2F2PA 2EC6C 2AMIA 2AAOA 1NPQA 1JF0A 3BXKA 1TCOB 1AUIB 1G8IA 2KYCA 2PRUA 1N2DA 3BUNB 3KO0A 1E8AA 3SG4A 1CDNA 3MSEB 1YRTB 4GGFA 1R6PA 1KWOB 2SASA 1SCMB 2LNKA 3PSRA 2G2BA 2JZIA 4OKHA 4PE4A 3D0YB 2FCDA 1QV1A 1Y1UA 1DMOA 1FPWA 1SW8A 1WLMA 2PVBA 2K2FA 3SIBA 1S6JA 1CMFA 1BOCA 1KFXL 5ER5A 1C07A 1KFUL 3OX6A 4IL1A 1KQVA 1ODBA 2CBLA 2HPSA 3PM8A 3LL8B 2M49B 1TN4A 2FOTA 4MRYA 2M3WA 1AJ5A 1SNLA 3LK1A 3A8RA 1MXEA 2D8NA 5JJGA 3IQQA 2LE9B 4N5XA 1JF2A 2M29A 1OE9B 1QX2A 1X02A 1K90D 2BKHB 5I8NA 4PHNA 4I5LB 1SCMC 2H61C 1CMGA 3I5FB 2O5GA 2HQWA 4HRGA 1WRLA 1N0YA 4USLA 1K9KA 3O2PA 4AOMA 1H8BA 1OSAA 2L0PA 1JWDA 3WXAA 1IQ5A 1L2OB 1NX3A 3EVUA 4ORBB 4DRWA 1UHNA 2OS8B 1NWDA 1QATA 1SCVA 3NSOA 1V1FA 2CCMA 4CIDA 1NSHA 2F3ZA 1UHIA 3CR4X 1NX1A 3OHMB 4QJ5B 2KAVA 2LVVA 1K94A 3JTDC 1FI6A 4ORAB 4C0LA 4GAOA 1YVLA 4GGNA 1QLKA 1WDCB 2ZRTA 1DJYA 1M45A 1F55A 1RJVA 2F2OA 1AVSA 1KK7Y 1S6IA 5BPJA 5IBWA 3AKAA 4HREE 2JNFA 1CFFA 3I5FC 3PFVA 1SKTA 1TNPA 5TNCA 3E3RA 1QVIY 1G33A 2KBIA 1A29A 1L2OC 2FJUB 1EG4A 2OS8C 3KHEA 2M0RA 4YBHB 1MXLC 2JQ6A 1BR1B 1RROA 2H61A 3F45A 1R2UA 1M31A 1M39A 1GGWA 5CSJA 2CTNA 1CM1A 2OTGB 4A4BA 3D0YA 4PCWA 1PK0D 4PE1A 3I5GB 4YGEB 3K21A 2KSPA 2M97A 2PSRA 4GFTA 1IG5A 1BODA 1SY9A 3LK0A 2JT8A 2JT3A 5DKRA 4GNKB 5DKQA 5AERA 2WCEA 2LV7A 4R1EA 2WOSA 4U8DA 3RM1A 2KFFA 2ISDA 2LAPA 4NQGA 3JVTB 2MA2A 3SG5A 3ZWHA 1A75B 4XJKA 3VGOA 1BJFA 1IJ6A 1OZOA 3EK7A 1K95A 1YR5A 5I2QA 5J3XA 1DJZA 3FWBA 1S6CA 4F0ZB 1U5IB 4NDDA 2JC2A 2GV5A 3I5HB 3TUYB 4C0JA 1RWYA 1XVJA 2V53A 1AJ4A 1Y0VH 4PE0A 5HLVA 3DVJA 4PHJA 2L4HA 3WHTB 3BOWB 2AUCA 1CLLA 2ZNEA 4MZLA 1K9PA 1BR4B 2LHIA 4DUQA 1H4BA 1ZUZA 2JOJA 4YRUA 3BUXB 4YI9A 3TDIA 1LKJA 3CR5X 1CFCA 2LVIA 3CGAA 3JVTC 3GOFA 5AEQA 2I2RE 4MZKA 4YGAA 1BF5A 4MSPA 1RTP1 3VRPA 1J55A 1JFJA 1B47A 1DTLA 1PVAA 1TIZA 4FTGA 1NCZA 1HQVA 2BL0C 1IWQA 4CLNA 1F70A 3A4UB 4HRHA 3I5HC 1S5GZ 4OV2A 4UPGA 2HF5A 2MRDA 4NDBA 1PALA 3BUMB 3GK2A 1VRKA 4YI8A 1AP4A 3GK4X 1CFDA 3PALA 1MF8B 1SL7A 2JTTA 2KGBC 2WCFA 5CPVA 1K9UA 1MQ1A 2KI4C 2M7LA 4N1FA 1W7IB 2EGDA 4MBEA 1A03A 3CWGA 5CSFA 2JWWA 1PVBA 1LVCD 2KAXA 2LM5A 4QJ4B 2ZRSA 1TTXA 4NDCA 3EVVA 3OP0A 1AK8A 4M2OA 3SIAA 2F8PA 1BG1A 3BYAA 1J7QA 3FIAA 1YTZC 2LVJA 5AANA 1J7OA 1DVIA 1QTXA 3QRXA 1NYAA 1IQ3A 1A4PA 2K7OA 2NZ0A 1Y1XA 2FCEA 2ZKMX 1KWOC 1B8RA 1SR6B 1YRUB 2KNEA 2KDHA 2G9BA 1QX7A 2LUXA 1U5IA 2L50A 2NLNA 4PDZA 3CTNA 3TS5B 2KYFA 4BY5A 2LCPA 2A4JA 5KSZA 3PN7B 5ER4X 2Q91A 1QS7A 1CLMA 3NSKA 4L9MA 2L2EA 4GUKA 3TDZA 2I18A 4AQJA 1OMVA 4GBAA 3CS1A 1QV0A 2JRFA 1CFPA 3WHUB 1JFKA 2M9GA 2RGIA 1LINA 2JULA 2E6WA 1J7RA 1J1DA 2CXJA 1KQMB 3BUWB 1K8UA 4PHKA 2P6BB 4WRIA 1IRJA 1SBJA 2LP2A 1CDLA 3DF0A 3CZTX 2JT0A 1SR6C 1NP8A 3DD4A 1YX8A 1S36A 1F4QA 3OX5A 5D69A 2F3YA 1K93D 1RECA 1B7TY 2WORA 4ZCUA 4I5NB 1SRAA 3AKBA 3EKJA 2KGRA 5KTYA 3PN7C 1WLZA 3SG2A 2BBNA 4I5JA 2GGZA 1CNPA 1JC2A 2BBMA 3OB2B 1ZOTB 5DKNA 4P2YB 3KF9A 2LMTA 1CM4A 3SG6A 1EJ3A 1DF0B 1WDCC 1BT6A 1SL8A 3FWCA 1M46A 1PSBA 1RFJA 4OVNF 2PALA 4JWQA 4OCIA 1ALVA 1QIVA 1D1OA 2GGMA 1G4YR 1KFXS 2MBXA 4DCKA 1IKUA 2IS9A 1KFUS 1OMRA 2JXLA 3BUOB 4PALA 5PALA 2BE6A 2WCBA 2QPTA 3DVKA 4MVFA 1DJWA 2BCXA 1MWNA 2JNXA 2M1KB 4YGCB 4M2PA 2OTGC 2KOTA 5KU1A 2JU0A 3D10A 3LCPC 3I5GC 4JQ0D 2K8MB 1DJIA 1FF1A 4MRXA 1TCFA 1PULA 1B4CA 2B1UA 2KAYA 4JPZB 1CKKA 1F54A 1FW4A 4A4CA 2K7DA 1DJGA 2SCPA 1PSRA 5JOLA 2M7NA 1SL9A 1QXPA 1SMGA 1FI5A 2Y4QA 1OMDA 3DVMA 3SG7A 1XA5A 1TNQA 2WC8A 2NCOA 1NX2A 2EC6B 2K61A 1JSAA 1QJTA 2NCPA 2E30A 4WQ2A 1B1GA 2OPOA 1XYDA 1UHHA 1ZMZA 2TN4A 1S5GY 1Q80A 1ZACA 2LP3A 1FBVA 3ICBA 3TUYC 1YUTA 1XK4C 2L5XB 2LVKA 1LA0A 4QJ3B 2MLEC 3EK8A 5HKYA 3AAJA 1UURA 2KI6C 1EL4A 4XYNA 1NCXA 5FYXA 2MJWB 1CLBA 4FQOA 3KEVA 3O4YA 1GGZA 1WRKA 1XFUO 1DT7B 1A2XA 1Y6WA 1OQPA 1UUSA 3CR2A 4WQ3A 1IGVA 2BE4A 1PRWA 5HLOA 1YVHA 1DF0A 1DGVA 5HYDA 2Q4UA 1DJXA 1DJHA 3I5IB 1J7PA 1YUSA 2O60A 1OOJA 1QLSA 2Y5IA 3VROA 3VRRA 4C0KA 4DIRA 1JBAA 1NIWA 5CSIA 1M63B 2MAZA 4AQIA 5B8IB 3AAKA 1F71A 2CNPA 4E68A 1A75A 1UHJA 3VRNA 3VRQA 3TDUA 3NXAA 1NUBA 2KBMA 2KQYA 3RLZA 2NXQA 1S1EA 1NX0A 5I2LA 4PHMA 5GQQC 1LA3A 1GJYA 1XK4A 1WY9A 3HCMA 1UHKA 3JTDB 5AXIA 2LLTA 5AFPA 3BOWA 2R2IA 4XJKB 2COLB 4N1GA 2ZFDA 3C1VA 2LHLA 4ORCB 3PATA 5G08A 3I5IC 2PMYA 1XO5A 1RK9A 1AHRA 1GQMA 2LUCA 4ICBA 1XFVO 1EXRA 1SPYA 1IJ5A 3BQ3A 1TRFA 3PLFB 2MHHA 1JUOA 1HT9A 1KSMA 1W7JB 3SJSA 2KFGA 2QACA 2ZN8A 1EH2A 1KK8B 4ETOA 3H4SE 1TNXA 1F8HA 1XFXO 1WRZA 3FS7A 3TS5C 1SYMA 1Y1AA 2BECA 4CFRA 5HKWA 4CFQA 1KSOA 4MZJA 1N65A 1XFYO 4M2QA 3M0WA 5I2OA 4P5OE 1BLQA 2H2KA 4BY4A 1MR8A 4YGBB 1K96A 2JXCA 2DOQA 1B8LA 1CTRA 4YGDB 1CDPA 1MUXA 4MN0A 1KQMC 1KK7Z 3EK4A 2LMVA 1F4OA 1DGUA 3DVEA 3O78A 4HSZA 1C7VA 1CB1A 1IH0A 2KFHA 2HETA 2F33A 4TNCA 2JPTA 1QASA 1QVIZ 1J1EA 4OR9B 2LC5A 1B7TZ 1KK8C 2BCBA 2PASA 2Y1NA 2BKIB 3TZ1A 4Q04A 2VRGA 3KPXA 5F6TA 1L7ZA 1TNWA 2BCAA 3EVRA 1QX5B 3O6BA 3CLNA 5HKZA 2HQ8A 2KHNA 2I7AA 3EKHA 3HX4A 1OZSA 4CPVA 2EHBA 1YX7A 3OB1B 1CDMA 2CT9A 1YURA 2LLSA 4MEWA 2WNDA 2K7BA 4MLWA 1XFZO 3LLEA 2MLFC 2ZN9A 2K7CA 4GGFC 1C7WA 1K2HA 2LLUA 1UP5A 1ALWA 1QIWA 2Y1MA 2ZNDA 4DS7A 1EG3A 4D1EA 1SK6D 2BL0B 1S3PA 3ZNIA 2K0JA 1BMOA 1XFWO 2L4IA 3NSIA 2M8UA 4I5KA 2M1UA 3WNXB 1NCYA 2I94A 1LXFC 2KQ6A 2L51A 3IF7A 4PE7A 5CSNA 1V1GA 2LMUA 5K89A 2JTZA 2L98A 1B9AA 3SG3A 1MHOA 1S26D 1ZFSA 3GK1A 1UWOA 1TOPA 2KI4B 2KI6D 1KCYA 1BU3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K2A A;  3IQO A;  5D7F A;  2LAN A;  4GPL B;  3DF0 B;  3NSL A;  4ZCV A;  1YUU A;  1B8C A;  2F2P A;  2EC6 C;  2AMI A;  2AAO A;  1NPQ A;  1JF0 A;  3BXK A;  1TCO B;  1AUI B;  1G8I A;  2KYC A;  2PRU A;  1N2D A;  3BUN B;  3KO0 A;  1E8A A;  3SG4 A;  1CDN A;  3MSE B;  1YRT B;  4GGF A;  1R6P A;  1KWO B;  2SAS A;  1SCM B;  2LNK A;  3PSR A;  2G2B A;  2JZI A;  4OKH A;  4PE4 A;  3D0Y B;  2FCD A;  1QV1 A;  1Y1U A;  1DMO A;  1FPW A;  1SW8 A;  1WLM A;  2PVB A;  2K2F A;  3SIB A;  1S6J A;  1CMF A;  1BOC A;  1KFX L;  5ER5 A;  1C07 A;  1KFU L;  3OX6 A;  4IL1 A;  1KQV A;  1ODB A;  2CBL A;  2HPS A;  3PM8 A;  3LL8 B;  2M49 B;  1TN4 A;  2FOT A;  4MRY A;  2M3W A;  1AJ5 A;  1SNL A;  3LK1 A;  3A8R A;  1MXE A;  2D8N A;  5JJG A;  3IQQ A;  2LE9 B;  4N5X A;  1JF2 A;  2M29 A;  1OE9 B;  1QX2 A;  1X02 A;  1K90 D;  2BKH B;  5I8N A;  4PHN A;  4I5L B;  1SCM C;  2H61 C;  1CMG A;  3I5F B;  2O5G A;  2HQW A;  4HRG A;  1WRL A;  1N0Y A;  4USL A;  1K9K A;  3O2P A;  4AOM A;  1H8B A;  1OSA A;  2L0P A;  1JWD A;  3WXA A;  1IQ5 A;  1L2O B;  1NX3 A;  3EVU A;  4ORB B;  4DRW A;  1UHN A;  2OS8 B;  1NWD A;  1QAT A;  1SCV A;  3NSO A;  1V1F A;  2CCM A;  4CID A;  1NSH A;  2F3Z A;  1UHI A;  3CR4 X;  1NX1 A;  3OHM B;  4QJ5 B;  2KAV A;  2LVV A;  1K94 A;  3JTD C;  1FI6 A;  4ORA B;  4C0L A;  4GAO A;  1YVL A;  4GGN A;  1QLK A;  1WDC B;  2ZRT A;  1DJY A;  1M45 A;  1F55 A;  1RJV A;  2F2O A;  1AVS A;  1KK7 Y;  1S6I A;  5BPJ A;  5IBW A;  3AKA A;  4HRE E;  2JNF A;  1CFF A;  3I5F C;  3PFV A;  1SKT A;  1TNP A;  5TNC A;  3E3R A;  1QVI Y;  1G33 A;  2KBI A;  1A29 A;  1L2O C;  2FJU B;  1EG4 A;  2OS8 C;  3KHE A;  2M0R A;  4YBH B;  1MXL C;  2JQ6 A;  1BR1 B;  1RRO A;  2H61 A;  3F45 A;  1R2U A;  1M31 A;  1M39 A;  1GGW A;  5CSJ A;  2CTN A;  1CM1 A;  2OTG B;  4A4B A;  3D0Y A;  4PCW A;  1PK0 D;  4PE1 A;  3I5G B;  4YGE B;  3K21 A;  2KSP A;  2M97 A;  2PSR A;  4GFT A;  1IG5 A;  1BOD A;  1SY9 A;  3LK0 A;  2JT8 A;  2JT3 A;  5DKR A;  4GNK B;  5DKQ A;  5AER A;  2WCE A;  2LV7 A;  4R1E A;  2WOS A;  4U8D A;  3RM1 A;  2KFF A;  2ISD A;  2LAP A;  4NQG A;  3JVT B;  2MA2 A;  3SG5 A;  3ZWH A;  1A75 B;  4XJK A;  3VGO A;  1BJF A;  1IJ6 A;  1OZO A;  3EK7 A;  1K95 A;  1YR5 A;  5I2Q A;  5J3X A;  1DJZ A;  3FWB A;  1S6C A;  4F0Z B;  1U5I B;  4NDD A;  2JC2 A;  2GV5 A;  3I5H B;  3TUY B;  4C0J A;  1RWY A;  1XVJ A;  2V53 A;  1AJ4 A;  1Y0V H;  4PE0 A;  5HLV A;  3DVJ A;  4PHJ A;  2L4H A;  3WHT B;  3BOW B;  2AUC A;  1CLL A;  2ZNE A;  4MZL A;  1K9P A;  1BR4 B;  2LHI A;  4DUQ A;  1H4B A;  1ZUZ A;  2JOJ A;  4YRU A;  3BUX B;  4YI9 A;  3TDI A;  1LKJ A;  3CR5 X;  1CFC A;  2LVI A;  3CGA A;  3JVT C;  3GOF A;  5AEQ A;  2I2R E;  4MZK A;  4YGA A;  1BF5 A;  4MSP A;  1RTP 1;  3VRP A;  1J55 A;  1JFJ A;  1B47 A;  1DTL A;  1PVA A;  1TIZ A;  4FTG A;  1NCZ A;  1HQV A;  2BL0 C;  1IWQ A;  4CLN A;  1F70 A;  3A4U B;  4HRH A;  3I5H C;  1S5G Z;  4OV2 A;  4UPG A;  2HF5 A;  2MRD A;  4NDB A;  1PAL A;  3BUM B;  3GK2 A;  1VRK A;  4YI8 A;  1AP4 A;  3GK4 X;  1CFD A;  3PAL A;  1MF8 B;  1SL7 A;  2JTT A;  2KGB C;  2WCF A;  5CPV A;  1K9U A;  1MQ1 A;  2KI4 C;  2M7L A;  4N1F A;  1W7I B;  2EGD A;  4MBE A;  1A03 A;  3CWG A;  5CSF A;  2JWW A;  1PVB A;  1LVC D;  2KAX A;  2LM5 A;  4QJ4 B;  2ZRS A;  1TTX A;  4NDC A;  3EVV A;  3OP0 A;  1AK8 A;  4M2O A;  3SIA A;  2F8P A;  1BG1 A;  3BYA A;  1J7Q A;  3FIA A;  1YTZ C;  2LVJ A;  5AAN A;  1J7O A;  1DVI A;  1QTX A;  3QRX A;  1NYA A;  1IQ3 A;  1A4P A;  2K7O A;  2NZ0 A;  1Y1X A;  2FCE A;  2ZKM X;  1KWO C;  1B8R A;  1SR6 B;  1YRU B;  2KNE A;  2KDH A;  2G9B A;  1QX7 A;  2LUX A;  1U5I A;  2L50 A;  2NLN A;  4PDZ A;  3CTN A;  3TS5 B;  2KYF A;  4BY5 A;  2LCP A;  2A4J A;  5KSZ A;  3PN7 B;  5ER4 X;  2Q91 A;  1QS7 A;  1CLM A;  3NSK A;  4L9M A;  2L2E A;  4GUK A;  3TDZ A;  2I18 A;  4AQJ A;  1OMV A;  4GBA A;  3CS1 A;  1QV0 A;  2JRF A;  1CFP A;  3WHU B;  1JFK A;  2M9G A;  2RGI A;  1LIN A;  2JUL A;  2E6W A;  1J7R A;  1J1D A;  2CXJ A;  1KQM B;  3BUW B;  1K8U A;  4PHK A;  2P6B B;  4WRI A;  1IRJ A;  1SBJ A;  2LP2 A;  1CDL A;  3DF0 A;  3CZT X;  2JT0 A;  1SR6 C;  1NP8 A;  3DD4 A;  1YX8 A;  1S36 A;  1F4Q A;  3OX5 A;  5D69 A;  2F3Y A;  1K93 D;  1REC A;  1B7T Y;  2WOR A;  4ZCU A;  4I5N B;  1SRA A;  3AKB A;  3EKJ A;  2KGR A;  5KTY A;  3PN7 C;  1WLZ A;  3SG2 A;  2BBN A;  4I5J A;  2GGZ A;  1CNP A;  1JC2 A;  2BBM A;  3OB2 B;  1ZOT B;  5DKN A;  4P2Y B;  3KF9 A;  2LMT A;  1CM4 A;  3SG6 A;  1EJ3 A;  1DF0 B;  1WDC C;  1BT6 A;  1SL8 A;  3FWC A;  1M46 A;  1PSB A;  1RFJ A;  4OVN F;  2PAL A;  4JWQ A;  4OCI A;  1ALV A;  1QIV A;  1D1O A;  2GGM A;  1G4Y R;  1KFX S;  2MBX A;  4DCK A;  1IKU A;  2IS9 A;  1KFU S;  1OMR A;  2JXL A;  3BUO B;  4PAL A;  5PAL A;  2BE6 A;  2WCB A;  2QPT A;  3DVK A;  4MVF A;  1DJW A;  2BCX A;  1MWN A;  2JNX A;  2M1K B;  4YGC B;  4M2P A;  2OTG C;  2KOT A;  5KU1 A;  2JU0 A;  3D10 A;  3LCP C;  3I5G C;  4JQ0 D;  2K8M B;  1DJI A;  1FF1 A;  4MRX A;  1TCF A;  1PUL A;  1B4C A;  2B1U A;  2KAY A;  4JPZ B;  1CKK A;  1F54 A;  1FW4 A;  4A4C A;  2K7D A;  1DJG A;  2SCP A;  1PSR A;  5JOL A;  2M7N A;  1SL9 A;  1QXP A;  1SMG A;  1FI5 A;  2Y4Q A;  1OMD A;  3DVM A;  3SG7 A;  1XA5 A;  1TNQ A;  2WC8 A;  2NCO A;  1NX2 A;  2EC6 B;  2K61 A;  1JSA A;  1QJT A;  2NCP A;  2E30 A;  4WQ2 A;  1B1G A;  2OPO A;  1XYD A;  1UHH A;  1ZMZ A;  2TN4 A;  1S5G Y;  1Q80 A;  1ZAC A;  2LP3 A;  1FBV A;  3ICB A;  3TUY C;  1YUT A;  1XK4 C;  2L5X B;  2LVK A;  1LA0 A;  4QJ3 B;  2MLE C;  3EK8 A;  5HKY A;  3AAJ A;  1UUR A;  2KI6 C;  1EL4 A;  4XYN A;  1NCX A;  5FYX A;  2MJW B;  1CLB A;  4FQO A;  3KEV A;  3O4Y A;  1GGZ A;  1WRK A;  1XFU O;  1DT7 B;  1A2X A;  1Y6W A;  1OQP A;  1UUS A;  3CR2 A;  4WQ3 A;  1IGV A;  2BE4 A;  1PRW A;  5HLO A;  1YVH A;  1DF0 A;  1DGV A;  5HYD A;  2Q4U A;  1DJX A;  1DJH A;  3I5I B;  1J7P A;  1YUS A;  2O60 A;  1OOJ A;  1QLS A;  2Y5I A;  3VRO A;  3VRR A;  4C0K A;  4DIR A;  1JBA A;  1NIW A;  5CSI A;  1M63 B;  2MAZ A;  4AQI A;  5B8I B;  3AAK A;  1F71 A;  2CNP A;  4E68 A;  1A75 A;  1UHJ A;  3VRN A;  3VRQ A;  3TDU A;  3NXA A;  1NUB A;  2KBM A;  2KQY A;  3RLZ A;  2NXQ A;  1S1E A;  1NX0 A;  5I2L A;  4PHM A;  5GQQ C;  1LA3 A;  1GJY A;  1XK4 A;  1WY9 A;  3HCM A;  1UHK A;  3JTD B;  5AXI A;  2LLT A;  5AFP A;  3BOW A;  2R2I A;  4XJK B;  2COL B;  4N1G A;  2ZFD A;  3C1V A;  2LHL A;  4ORC B;  3PAT A;  5G08 A;  3I5I C;  2PMY A;  1XO5 A;  1RK9 A;  1AHR A;  1GQM A;  2LUC A;  4ICB A;  1XFV O;  1EXR A;  1SPY A;  1IJ5 A;  3BQ3 A;  1TRF A;  3PLF B;  2MHH A;  1JUO A;  1HT9 A;  1KSM A;  1W7J B;  3SJS A;  2KFG A;  2QAC A;  2ZN8 A;  1EH2 A;  1KK8 B;  4ETO A;  3H4S E;  1TNX A;  1F8H A;  1XFX O;  1WRZ A;  3FS7 A;  3TS5 C;  1SYM A;  1Y1A A;  2BEC A;  4CFR A;  5HKW A;  4CFQ A;  1KSO A;  4MZJ A;  1N65 A;  1XFY O;  4M2Q A;  3M0W A;  5I2O A;  4P5O E;  1BLQ A;  2H2K A;  4BY4 A;  1MR8 A;  4YGB B;  1K96 A;  2JXC A;  2DOQ A;  1B8L A;  1CTR A;  4YGD B;  1CDP A;  1MUX A;  4MN0 A;  1KQM C;  1KK7 Z;  3EK4 A;  2LMV A;  1F4O A;  1DGU A;  3DVE A;  3O78 A;  4HSZ A;  1C7V A;  1CB1 A;  1IH0 A;  2KFH A;  2HET A;  2F33 A;  4TNC A;  2JPT A;  1QAS A;  1QVI Z;  1J1E A;  4OR9 B;  2LC5 A;  1B7T Z;  1KK8 C;  2BCB A;  2PAS A;  2Y1N A;  2BKI B;  3TZ1 A;  4Q04 A;  2VRG A;  3KPX A;  5F6T A;  1L7Z A;  1TNW A;  2BCA A;  3EVR A;  1QX5 B;  3O6B A;  3CLN A;  5HKZ A;  2HQ8 A;  2KHN A;  2I7A A;  3EKH A;  3HX4 A;  1OZS A;  4CPV A;  2EHB A;  1YX7 A;  3OB1 B;  1CDM A;  2CT9 A;  1YUR A;  2LLS A;  4MEW A;  2WND A;  2K7B A;  4MLW A;  1XFZ O;  3LLE A;  2MLF C;  2ZN9 A;  2K7C A;  4GGF C;  1C7W A;  1K2H A;  2LLU A;  1UP5 A;  1ALW A;  1QIW A;  2Y1M A;  2ZND A;  4DS7 A;  1EG3 A;  4D1E A;  1SK6 D;  2BL0 B;  1S3P A;  3ZNI A;  2K0J A;  1BMO A;  1XFW O;  2L4I A;  3NSI A;  2M8U A;  4I5K A;  2M1U A;  3WNX B;  1NCY A;  2I94 A;  1LXF C;  2KQ6 A;  2L51 A;  3IF7 A;  4PE7 A;  5CSN A;  1V1G A;  2LMU A;  5K89 A;  2JTZ A;  2L98 A;  1B9A A;  3SG3 A;  1MHO A;  1S26 D;  1ZFS A;  3GK1 A;  1UWO A;  1TOP A;  2KI4 B;  2KI6 D;  1KCY A;  1BU3 A; 
#chains in the Genus database with same CATH topology
 2K2A A;  2K60 A;  3IQO A;  5D7F A;  2LAN A;  4GPL B;  1IKU A;  3DF0 B;  3NSL A;  2JPO A;  4ZCV A;  1YUU A;  1B8C A;  2F2P A;  2EC6 C;  3S0G A;  2AMI A;  2AAO A;  1NPQ A;  1JF0 A;  3BXK A;  1TCO B;  1AUI B;  1G8I A;  1Z4H A;  2KYC A;  1N2D A;  2PRU A;  3BUN B;  1E8A A;  1TWO A;  3KO0 A;  3MSE B;  5D3O A;  1YRT B;  4GGF A;  1R6P A;  1KWO B;  3EG5 B;  2SAS A;  1SCM B;  2LNK A;  3PSR A;  2G2B A;  2JZI A;  4OKH A;  4PE4 A;  3D0Y B;  2FCD A;  1QV1 A;  1Y1U A;  1DMO A;  3SS5 A;  1FPW A;  1SW8 A;  1WLM A;  2PVB A;  2K2F A;  3SIB A;  1S6J A;  1CMF A;  1BOC A;  1KFX L;  5ER5 A;  1C07 A;  3S0E A;  1KFU L;  3OX6 A;  3SG4 A;  4IL1 A;  1KQV A;  1ODB A;  3NHI A;  2CBL A;  2HPS A;  3PM8 A;  3LL8 B;  2M49 B;  1TN4 A;  2FOT A;  4MRY A;  2M3W A;  1AJ5 A;  3D73 A;  1SNL A;  3LK1 A;  3A8R A;  1MXE A;  2D8N A;  5JJG A;  3IQQ A;  2LE9 B;  4N5X A;  1JF2 A;  2M29 A;  1OE9 B;  1QX2 A;  1X02 A;  1K90 D;  2BKH B;  5I8N A;  3R72 A;  4PHN A;  4I5L B;  1SCM C;  2H61 C;  1CMG A;  3I5F B;  3PJI A;  2O5G A;  2HQW A;  4HRG A;  1WRL A;  1N0Y A;  4USL A;  1K9K A;  3O2P A;  4AOM A;  1H8B A;  1OSA A;  2L0P A;  1JWD A;  3WXA A;  1IQ5 A;  1L2O B;  1NX3 A;  3EVU A;  4ORB B;  4DRW A;  1UHN A;  2OS8 B;  1NWD A;  1QAT A;  1SCV A;  3NSO A;  1V1F A;  2CCM A;  4CID A;  1NSH A;  2F3Z A;  1UHI A;  3CR4 X;  1NX1 A;  3OHM B;  3CZ1 A;  4QJ5 B;  2KAV A;  2LVV A;  1K94 A;  3JTD C;  1FI6 A;  4ORA B;  3D75 A;  4C0L A;  4GAO A;  5FI7 A;  4F7F A;  1YVL A;  4GGN A;  1QLK A;  1WDC B;  2ZRT A;  1DJY A;  1M45 A;  1F55 A;  4OZD A;  1RJV A;  2F2O A;  5I94 A;  1AVS A;  1KK7 Y;  1S6I A;  5BPJ A;  5IBW A;  3AKA A;  4HRE E;  2JNF A;  1CFF A;  3DYE A;  3I5F C;  3PFV A;  1OOG A;  1SKT A;  1TNP A;  5TNC A;  3E3R A;  1QVI Y;  1G33 A;  2KBI A;  1A29 A;  1L2O C;  2FJU B;  1EG4 A;  2OS8 C;  3KHE A;  2M0R A;  4YBH B;  1MXL C;  1QWV A;  1TUZ A;  2JQ6 A;  1BR1 B;  1RRO A;  2H61 A;  3OBV A;  3F45 A;  1R2U A;  1M31 A;  1M39 A;  3DY9 A;  5CSJ A;  2CTN A;  1CM1 A;  1GGW A;  2OTG B;  4A4B A;  3D0Y A;  4PCW A;  1PK0 D;  4PE1 A;  3I5G B;  4YGE B;  3K21 A;  2KSP A;  2M97 A;  2PSR A;  4GFT A;  1IG5 A;  1BOD A;  1SY9 A;  1OOH A;  3LK0 A;  3RZS A;  2JT8 A;  2JT3 A;  5DKR A;  4GNK B;  5DKQ A;  5AER A;  2WCM A;  2WCE A;  2LV7 A;  2QEV A;  3L4A A;  4R1E A;  2WOS A;  4U8D A;  3RM1 A;  2KFF A;  2ISD A;  2LAP A;  4NQG A;  3JVT B;  2MA2 A;  1GM0 A;  3SG5 A;  3D76 A;  3ZWH A;  1A75 B;  2KLE A;  4XJK A;  5FI6 A;  3VGO A;  1BJF A;  1IJ6 A;  1OZO A;  3EK7 A;  3NGV A;  1K95 A;  1YR5 A;  5I2Q A;  5J3X A;  1DJZ A;  1P28 A;  1S6C A;  3FWB A;  4F0Z B;  1U5I B;  4NDD A;  2JC2 A;  2GV5 A;  3I5H B;  3TUY B;  4C0J A;  1RWY A;  1XVJ A;  2V53 A;  1AJ4 A;  1Y0V H;  4PE0 A;  5HLV A;  3DVJ A;  4PHJ A;  2L4H A;  3WHT B;  3BOW B;  1W9Z A;  1CLL A;  2AUC A;  2ZNE A;  1K9P A;  1BR4 B;  2LHI A;  4MZL A;  4DUQ A;  4FQT A;  3BFB A;  1H4B A;  1ZUZ A;  2JOJ A;  3NHT A;  4YRU A;  3BUX B;  4YI9 A;  3IVT A;  3TDI A;  1LKJ A;  3CR5 X;  1CFC A;  2LVI A;  3CGA A;  3JVT C;  3V2L A;  3GOF A;  5AEQ A;  2I2R E;  3PM2 A;  3D77 A;  4MZK A;  2BAP A;  4YGA A;  1DEK A;  1BF5 A;  4MSP A;  3D78 A;  1RTP 1;  3VRP A;  1J55 A;  1JFJ A;  1B47 A;  1DTL A;  1PVA A;  1TIZ A;  4FTG A;  1NCZ A;  1HQV A;  2BL0 C;  2PYQ A;  1IWQ A;  4CLN A;  1F70 A;  2WC5 A;  3A4U B;  4HRH A;  3I5H C;  1S5G Z;  4OV2 A;  2YGU A;  4UPG A;  2HF5 A;  2MRD A;  4NDB A;  1PAL A;  3BUM B;  3GK2 A;  1VRK A;  4INW A;  4YI8 A;  1AP4 A;  3GK4 X;  1CFD A;  3PAL A;  1MF8 B;  1SL7 A;  2JTT A;  2KGB C;  2WCF A;  2L2C A;  5CPV A;  1K9U A;  1MQ1 A;  2KI4 C;  3B87 A;  2M7L A;  4N1F A;  1W7I B;  2EGD A;  4MBE A;  1A03 A;  3CWG A;  5CSF A;  1CDN A;  2JWW A;  3QME A;  1PVB A;  1LVC D;  1SSE B;  2KAX A;  2LM5 A;  4QJ4 B;  2ZRS A;  1TTX A;  2L5Y A;  3EVV A;  3OP0 A;  4NDC A;  1AK8 A;  4M2O A;  3SIA A;  2F8P A;  1BG1 A;  3BYA A;  3K1E A;  1J7Q A;  3FIA A;  1YTZ C;  2LVJ A;  5AAN A;  1OW4 A;  1DVI A;  1Z2C B;  1QTX A;  1J7O A;  3QRX A;  1NYA A;  1IQ3 A;  1A4P A;  2K7O A;  2NZ0 A;  1Y1X A;  2FCE A;  2ZKM X;  1KWO C;  1B8R A;  1SR6 B;  1YRU B;  2WCK A;  2KNE A;  2KDH A;  4INX A;  2G9B A;  2WCH A;  3B7A A;  1QX7 A;  2LUX A;  1U5I A;  2WCL A;  2L50 A;  2NLN A;  3CDN A;  4PDZ A;  3CTN A;  3TS5 B;  2KYF A;  4BY5 A;  2LCP A;  2A4J A;  5KSZ A;  3PN7 B;  5ER4 X;  2Q91 A;  1QS7 A;  1CLM A;  3NSK A;  4L9M A;  2L2E A;  4GUK A;  3TDZ A;  2I18 A;  4AQJ A;  1OMV A;  4GBA A;  3CS1 A;  2QEH A;  1QV0 A;  2JRF A;  1CFP A;  3WHU B;  1JFK A;  2M9G A;  2RGI A;  1LIN A;  2JUL A;  2E6W A;  1J7R A;  1J1D A;  2CXJ A;  1KQM B;  3BUW B;  2QEO A;  1K8U A;  4PHK A;  2P6B B;  4WRI A;  1IRJ A;  1SBJ A;  3CYZ A;  2KLD A;  2LP2 A;  1CDL A;  3DF0 A;  3CZT X;  2JT0 A;  1SR6 C;  2KPH A;  1NP8 A;  3DD4 A;  1YX8 A;  1S36 A;  1DEL A;  3UNW A;  1F4Q A;  3OX5 A;  5D69 A;  2F3Y A;  1K93 D;  1REC A;  1B7T Y;  2WOR A;  4ZCU A;  4I5N B;  1ORG A;  1SRA A;  3AKB A;  5FI2 A;  3EKJ A;  2KGR A;  5KTY A;  3PN7 C;  1WLZ A;  3SG2 A;  2WCJ A;  2BBN A;  3O4X A;  4I5J A;  2GGZ A;  1CNP A;  1JC2 A;  1TUJ A;  2BBM A;  3OB2 B;  1ZOT B;  5DKN A;  3R1V A;  4P2Y B;  3KF9 A;  2LMT A;  2P71 A;  1CM4 A;  3B88 A;  1EJ3 A;  1DF0 B;  1WDC C;  3SG6 A;  1BT6 A;  2GTE A;  3BFH A;  1SL8 A;  3FWC A;  1M46 A;  1PSB A;  1RFJ A;  3CAB A;  4OVN F;  2PAL A;  4JWQ A;  4OCI A;  1ALV A;  1QIV A;  1D1O A;  2GGM A;  1G4Y R;  1C3Z A;  1KFX S;  1DQE A;  2MBX A;  4DCK A;  2IS9 A;  1KFU S;  1OMR A;  2JXL A;  3BUO B;  4PAL A;  5PAL A;  2BE6 A;  3SS3 A;  2WCB A;  2QPT A;  3DVK A;  4MVF A;  1DJW A;  2BCX A;  1MWN A;  2JNX A;  2M1K B;  4YGC B;  3R1O A;  4M2P A;  2OTG C;  2KOT A;  5HL1 A;  5KU1 A;  2JU0 A;  3D10 A;  3LCP C;  3I5G C;  4JQ0 D;  2K8M B;  1DJI A;  1FF1 A;  4MRX A;  1TCF A;  1PUL A;  1B4C A;  2B1U A;  2KAY A;  4JPZ B;  1CKK A;  1F54 A;  1FW4 A;  4A4C A;  2K7D A;  1DJG A;  2SCP A;  1PSR A;  5JOL A;  2M7N A;  1SL9 A;  1QXP A;  3SS4 A;  1SMG A;  1FI5 A;  2Y4Q A;  1OMD A;  3DVM A;  3SG7 A;  3CZ0 A;  1XA5 A;  1TNQ A;  1OOI X;  3OGN A;  2WC8 A;  2NCO A;  1NX2 A;  2EC6 B;  2K61 A;  1JSA A;  1QJT A;  2NCP A;  2E30 A;  4WQ2 A;  3S0B A;  2H8V A;  1B1G A;  2WC6 A;  2OPO A;  1XYD A;  1UHH A;  3L4L A;  1ZMZ A;  3BJH A;  2TN4 A;  1S5G Y;  1Q80 A;  3R1P A;  1ZAC A;  2LP3 A;  3L47 A;  1FBV A;  2FJY A;  3ICB A;  3TUY C;  1YUT A;  1XK4 C;  2L5X B;  2LVK A;  1LA0 A;  4QJ3 B;  2MLE C;  3EK8 A;  5HKY A;  3AAJ A;  1UUR A;  2KI6 C;  1EL4 A;  2ERB A;  1NCX A;  2QEB A;  3DZT A;  4XYN A;  2MJW B;  5FYX A;  3FE9 A;  1CLB A;  4FQO A;  3KEV A;  3O4Y A;  1GGZ A;  1WRK A;  1XFU O;  1DT7 B;  1A2X A;  1Y6W A;  1OQP A;  1UUS A;  3CR2 A;  4WQ3 A;  1IGV A;  2BE4 A;  1PRW A;  5HLO A;  1YVH A;  1C3Y A;  1DF0 A;  1DGV A;  5HYD A;  2Q4U A;  1DJX A;  3UO9 A;  1DJH A;  3I5I B;  1J7P A;  1YUS A;  2O60 A;  1OOJ A;  1QLS A;  2Y5I A;  3VRO A;  3VRR A;  4C0K A;  4DIR A;  1JBA A;  1NIW A;  5CSI A;  1M63 B;  2MAZ A;  4AQI A;  5B8I B;  3AAK A;  1F71 A;  2CNP A;  4E68 A;  1A75 A;  1UHJ A;  3VRN A;  3VRQ A;  3TDU A;  3NXA A;  2QDI A;  1NUB A;  2KBM A;  2KQY A;  3RLZ A;  2NXQ A;  1S1E A;  1NX0 A;  5I2L A;  4PHM A;  5GQQ C;  1LA3 A;  3Q8I A;  4JKT A;  1GJY A;  3B86 A;  1XK4 A;  1WY9 A;  3HCM A;  1UHK A;  3JTD B;  5AXI A;  2LLT A;  5AFP A;  3BOW A;  2R2I A;  3VB1 A;  4XJK B;  2COL B;  4N1G A;  3BFA A;  2ZFD A;  3C1V A;  2LHL A;  4ORC B;  3PAT A;  5G08 A;  3I5I C;  2PMY A;  1XO5 A;  1RK9 A;  1AHR A;  1GQM A;  2LUC A;  4IJ7 A;  4ICB A;  1XFV O;  1EXR A;  1SPY A;  1DC1 A;  1IJ5 A;  3BQ3 A;  1TRF A;  3PLF B;  3S0A A;  2MHH A;  1JUO A;  1HT9 A;  1KSM A;  1W7J B;  3SJS A;  2KFG A;  2QAC A;  2ZN8 A;  1EH2 A;  1KK8 B;  4ETO A;  3H4S E;  1TNX A;  1F8H A;  1XFX O;  1WRZ A;  3FS7 A;  3TS5 C;  1SYM A;  1Y1A A;  2BEC A;  4CFR A;  5HKW A;  4KYN A;  1KSO A;  4MZJ A;  4CFQ A;  1N65 A;  1XFY O;  4M2Q A;  3FE6 A;  3B6X A;  3M0W A;  5I2O A;  3S0F A;  4P5O E;  3N7H A;  1BLQ A;  2H2K A;  4BY4 A;  1MR8 A;  4YGB B;  1K96 A;  2JXC A;  2DOQ A;  1B8L A;  1CTR A;  4YGD B;  1CDP A;  1MUX A;  4MN0 A;  1KQM C;  1KK7 Z;  3EK4 A;  2LMV A;  1F4O A;  1DGU A;  3DVE A;  3O78 A;  4HSZ A;  1C7V A;  1CB1 A;  1IH0 A;  1OOF A;  2KFH A;  2HET A;  4JD9 A;  2F33 A;  4TNC A;  1LS8 A;  2JPT A;  1QAS A;  1QVI Z;  1J1E A;  4OR9 B;  2LC5 A;  1B7T Z;  1KK8 C;  2BCB A;  2PAS A;  2Y1N A;  2BKI B;  3TZ1 A;  4Q04 A;  2VRG A;  3KPX A;  5F6T A;  2PQL A;  1L7Z A;  1TNW A;  2BCA A;  3EVR A;  1QX5 B;  3O6B A;  3CLN A;  5EL2 A;  5HKZ A;  2HQ8 A;  2KHN A;  3S0D A;  2I7A A;  1XFR A;  3EKH A;  1OZS A;  1T14 A;  3DXL A;  2EHB A;  3HX4 A;  4CPV A;  1YX7 A;  3OB1 B;  1CDM A;  2CT9 A;  1YUR A;  2LLS A;  4MEW A;  2WND A;  3D74 A;  2K7B A;  4MLW A;  1XFZ O;  3CZ2 A;  2MLF C;  3LLE A;  2ZN9 A;  1IIO A;  2K7C A;  4GGF C;  1C7W A;  1K2H A;  2LLU A;  1UP5 A;  1ALW A;  1QIW A;  2Y1M A;  2ZND A;  4DS7 A;  1EG3 A;  4D1E A;  1SK6 D;  2BL0 B;  1S3P A;  3ZNI A;  2K0J A;  1BMO A;  1XFW O;  3FE8 A;  2L4I A;  3NSI A;  2P70 A;  2M8U A;  2BNX A;  2M1U A;  4I5K A;  4PT1 A;  3WNX B;  1NCY A;  2I94 A;  1LXF C;  2KQ6 A;  2L51 A;  3IF7 A;  4PE7 A;  5CSN A;  1V1G A;  2LMU A;  5K89 A;  2JTZ A;  2L98 A;  1B9A A;  3SG3 A;  1MHO A;  1S26 D;  1ZFS A;  3GK1 A;  1UWO A;  1TOP A;  2KI4 B;  2KI6 D;  1KCY A;  5DIC A;  1BU3 A; 
#chains in the Genus database with same CATH homology
 2K2A A;  3IQO A;  5D7F A;  2LAN A;  4GPL B;  3DF0 B;  3NSL A;  4ZCV A;  1YUU A;  1B8C A;  2F2P A;  2EC6 C;  2AMI A;  2AAO A;  1NPQ A;  1JF0 A;  3BXK A;  1TCO B;  1AUI B;  1G8I A;  2KYC A;  2PRU A;  1N2D A;  3BUN B;  3KO0 A;  1E8A A;  3SG4 A;  1CDN A;  3MSE B;  1YRT B;  4GGF A;  1R6P A;  1KWO B;  2SAS A;  1SCM B;  2LNK A;  3PSR A;  2G2B A;  2JZI A;  4OKH A;  4PE4 A;  3D0Y B;  2FCD A;  1QV1 A;  1Y1U A;  1DMO A;  1FPW A;  1SW8 A;  1WLM A;  2PVB A;  2K2F A;  3SIB A;  1S6J A;  1CMF A;  1BOC A;  1KFX L;  5ER5 A;  1C07 A;  1KFU L;  3OX6 A;  4IL1 A;  1KQV A;  1ODB A;  2CBL A;  2HPS A;  3PM8 A;  3LL8 B;  2M49 B;  1TN4 A;  2FOT A;  4MRY A;  2M3W A;  1AJ5 A;  1SNL A;  3LK1 A;  3A8R A;  1MXE A;  2D8N A;  5JJG A;  3IQQ A;  2LE9 B;  4N5X A;  1JF2 A;  2M29 A;  1OE9 B;  1QX2 A;  1X02 A;  1K90 D;  2BKH B;  5I8N A;  4PHN A;  4I5L B;  1SCM C;  2H61 C;  1CMG A;  3I5F B;  2O5G A;  2HQW A;  4HRG A;  1WRL A;  1N0Y A;  4USL A;  1K9K A;  3O2P A;  4AOM A;  1H8B A;  1OSA A;  2L0P A;  1JWD A;  3WXA A;  1IQ5 A;  1L2O B;  1NX3 A;  3EVU A;  4ORB B;  4DRW A;  1UHN A;  2OS8 B;  1NWD A;  1QAT A;  1SCV A;  3NSO A;  1V1F A;  2CCM A;  4CID A;  1NSH A;  2F3Z A;  1UHI A;  3CR4 X;  1NX1 A;  3OHM B;  4QJ5 B;  2KAV A;  2LVV A;  1K94 A;  3JTD C;  1FI6 A;  4ORA B;  4C0L A;  4GAO A;  1YVL A;  4GGN A;  1QLK A;  1WDC B;  2ZRT A;  1DJY A;  1M45 A;  1F55 A;  1RJV A;  2F2O A;  1AVS A;  1KK7 Y;  1S6I A;  5BPJ A;  5IBW A;  3AKA A;  4HRE E;  2JNF A;  1CFF A;  3I5F C;  3PFV A;  1SKT A;  1TNP A;  5TNC A;  3E3R A;  1QVI Y;  1G33 A;  2KBI A;  1A29 A;  1L2O C;  2FJU B;  1EG4 A;  2OS8 C;  3KHE A;  2M0R A;  4YBH B;  1MXL C;  2JQ6 A;  1BR1 B;  1RRO A;  2H61 A;  3F45 A;  1R2U A;  1M31 A;  1M39 A;  1GGW A;  5CSJ A;  2CTN A;  1CM1 A;  2OTG B;  4A4B A;  3D0Y A;  4PCW A;  1PK0 D;  4PE1 A;  3I5G B;  4YGE B;  3K21 A;  2KSP A;  2M97 A;  2PSR A;  4GFT A;  1IG5 A;  1BOD A;  1SY9 A;  3LK0 A;  2JT8 A;  2JT3 A;  5DKR A;  4GNK B;  5DKQ A;  5AER A;  2WCE A;  2LV7 A;  4R1E A;  2WOS A;  4U8D A;  3RM1 A;  2KFF A;  2ISD A;  2LAP A;  4NQG A;  3JVT B;  2MA2 A;  3SG5 A;  3ZWH A;  1A75 B;  4XJK A;  3VGO A;  1BJF A;  1IJ6 A;  1OZO A;  3EK7 A;  1K95 A;  1YR5 A;  5I2Q A;  5J3X A;  1DJZ A;  3FWB A;  1S6C A;  4F0Z B;  1U5I B;  4NDD A;  2JC2 A;  2GV5 A;  3I5H B;  3TUY B;  4C0J A;  1RWY A;  1XVJ A;  2V53 A;  1AJ4 A;  1Y0V H;  4PE0 A;  5HLV A;  3DVJ A;  4PHJ A;  2L4H A;  3WHT B;  3BOW B;  2AUC A;  1CLL A;  2ZNE A;  4MZL A;  1K9P A;  1BR4 B;  2LHI A;  4DUQ A;  1H4B A;  1ZUZ A;  2JOJ A;  4YRU A;  3BUX B;  4YI9 A;  3TDI A;  1LKJ A;  3CR5 X;  1CFC A;  2LVI A;  3CGA A;  3JVT C;  3GOF A;  5AEQ A;  2I2R E;  4MZK A;  4YGA A;  1BF5 A;  4MSP A;  1RTP 1;  3VRP A;  1J55 A;  1JFJ A;  1B47 A;  1DTL A;  1PVA A;  1TIZ A;  4FTG A;  1NCZ A;  1HQV A;  2BL0 C;  1IWQ A;  4CLN A;  1F70 A;  3A4U B;  4HRH A;  3I5H C;  1S5G Z;  4OV2 A;  4UPG A;  2HF5 A;  2MRD A;  4NDB A;  1PAL A;  3BUM B;  3GK2 A;  1VRK A;  4YI8 A;  1AP4 A;  3GK4 X;  1CFD A;  3PAL A;  1MF8 B;  1SL7 A;  2JTT A;  2KGB C;  2WCF A;  5CPV A;  1K9U A;  1MQ1 A;  2KI4 C;  2M7L A;  4N1F A;  1W7I B;  2EGD A;  4MBE A;  1A03 A;  3CWG A;  5CSF A;  2JWW A;  1PVB A;  1LVC D;  2KAX A;  2LM5 A;  4QJ4 B;  2ZRS A;  1TTX A;  4NDC A;  3EVV A;  3OP0 A;  1AK8 A;  4M2O A;  3SIA A;  2F8P A;  1BG1 A;  3BYA A;  1J7Q A;  3FIA A;  1YTZ C;  2LVJ A;  5AAN A;  1J7O A;  1DVI A;  1QTX A;  3QRX A;  1NYA A;  1IQ3 A;  1A4P A;  2K7O A;  2NZ0 A;  1Y1X A;  2FCE A;  2ZKM X;  1KWO C;  1B8R A;  1SR6 B;  1YRU B;  2KNE A;  2KDH A;  2G9B A;  1QX7 A;  2LUX A;  1U5I A;  2L50 A;  2NLN A;  4PDZ A;  3CTN A;  3TS5 B;  2KYF A;  4BY5 A;  2LCP A;  2A4J A;  5KSZ A;  3PN7 B;  5ER4 X;  2Q91 A;  1QS7 A;  1CLM A;  3NSK A;  4L9M A;  2L2E A;  4GUK A;  3TDZ A;  2I18 A;  4AQJ A;  1OMV A;  4GBA A;  3CS1 A;  1QV0 A;  2JRF A;  1CFP A;  3WHU B;  1JFK A;  2M9G A;  2RGI A;  1LIN A;  2JUL A;  2E6W A;  1J7R A;  1J1D A;  2CXJ A;  1KQM B;  3BUW B;  1K8U A;  4PHK A;  2P6B B;  4WRI A;  1IRJ A;  1SBJ A;  2LP2 A;  1CDL A;  3DF0 A;  3CZT X;  2JT0 A;  1SR6 C;  1NP8 A;  3DD4 A;  1YX8 A;  1S36 A;  1F4Q A;  3OX5 A;  5D69 A;  2F3Y A;  1K93 D;  1REC A;  1B7T Y;  2WOR A;  4ZCU A;  4I5N B;  1SRA A;  3AKB A;  3EKJ A;  2KGR A;  5KTY A;  3PN7 C;  1WLZ A;  3SG2 A;  2BBN A;  4I5J A;  2GGZ A;  1CNP A;  1JC2 A;  2BBM A;  3OB2 B;  1ZOT B;  5DKN A;  4P2Y B;  3KF9 A;  2LMT A;  1CM4 A;  3SG6 A;  1EJ3 A;  1DF0 B;  1WDC C;  1BT6 A;  1SL8 A;  3FWC A;  1M46 A;  1PSB A;  1RFJ A;  4OVN F;  2PAL A;  4JWQ A;  4OCI A;  1ALV A;  1QIV A;  1D1O A;  2GGM A;  1G4Y R;  1KFX S;  2MBX A;  4DCK A;  1IKU A;  2IS9 A;  1KFU S;  1OMR A;  2JXL A;  3BUO B;  4PAL A;  5PAL A;  2BE6 A;  2WCB A;  2QPT A;  3DVK A;  4MVF A;  1DJW A;  2BCX A;  1MWN A;  2JNX A;  2M1K B;  4YGC B;  4M2P A;  2OTG C;  2KOT A;  5KU1 A;  2JU0 A;  3D10 A;  3LCP C;  3I5G C;  4JQ0 D;  2K8M B;  1DJI A;  1FF1 A;  4MRX A;  1TCF A;  1PUL A;  1B4C A;  2B1U A;  2KAY A;  4JPZ B;  1CKK A;  1F54 A;  1FW4 A;  4A4C A;  2K7D A;  1DJG A;  2SCP A;  1PSR A;  5JOL A;  2M7N A;  1SL9 A;  1QXP A;  1SMG A;  1FI5 A;  2Y4Q A;  1OMD A;  3DVM A;  3SG7 A;  1XA5 A;  1TNQ A;  2WC8 A;  2NCO A;  1NX2 A;  2EC6 B;  2K61 A;  1JSA A;  1QJT A;  2NCP A;  2E30 A;  4WQ2 A;  1B1G A;  2OPO A;  1XYD A;  1UHH A;  1ZMZ A;  2TN4 A;  1S5G Y;  1Q80 A;  1ZAC A;  2LP3 A;  1FBV A;  3ICB A;  3TUY C;  1YUT A;  1XK4 C;  2L5X B;  2LVK A;  1LA0 A;  4QJ3 B;  2MLE C;  3EK8 A;  5HKY A;  3AAJ A;  1UUR A;  2KI6 C;  1EL4 A;  4XYN A;  1NCX A;  5FYX A;  2MJW B;  1CLB A;  4FQO A;  3KEV A;  3O4Y A;  1GGZ A;  1WRK A;  1XFU O;  1DT7 B;  1A2X A;  1Y6W A;  1OQP A;  1UUS A;  3CR2 A;  4WQ3 A;  1IGV A;  2BE4 A;  1PRW A;  5HLO A;  1YVH A;  1DF0 A;  1DGV A;  5HYD A;  2Q4U A;  1DJX A;  1DJH A;  3I5I B;  1J7P A;  1YUS A;  2O60 A;  1OOJ A;  1QLS A;  2Y5I A;  3VRO A;  3VRR A;  4C0K A;  4DIR A;  1JBA A;  1NIW A;  5CSI A;  1M63 B;  2MAZ A;  4AQI A;  5B8I B;  3AAK A;  1F71 A;  2CNP A;  4E68 A;  1A75 A;  1UHJ A;  3VRN A;  3VRQ A;  3TDU A;  3NXA A;  1NUB A;  2KBM A;  2KQY A;  3RLZ A;  2NXQ A;  1S1E A;  1NX0 A;  5I2L A;  4PHM A;  5GQQ C;  1LA3 A;  1GJY A;  1XK4 A;  1WY9 A;  3HCM A;  1UHK A;  3JTD B;  5AXI A;  2LLT A;  5AFP A;  3BOW A;  2R2I A;  4XJK B;  2COL B;  4N1G A;  2ZFD A;  3C1V A;  2LHL A;  4ORC B;  3PAT A;  5G08 A;  3I5I C;  2PMY A;  1XO5 A;  1RK9 A;  1AHR A;  1GQM A;  2LUC A;  4ICB A;  1XFV O;  1EXR A;  1SPY A;  1IJ5 A;  3BQ3 A;  1TRF A;  3PLF B;  2MHH A;  1JUO A;  1HT9 A;  1KSM A;  1W7J B;  3SJS A;  2KFG A;  2QAC A;  2ZN8 A;  1EH2 A;  1KK8 B;  4ETO A;  3H4S E;  1TNX A;  1F8H A;  1XFX O;  1WRZ A;  3FS7 A;  3TS5 C;  1SYM A;  1Y1A A;  2BEC A;  4CFR A;  5HKW A;  4CFQ A;  1KSO A;  4MZJ A;  1N65 A;  1XFY O;  4M2Q A;  3M0W A;  5I2O A;  4P5O E;  1BLQ A;  2H2K A;  4BY4 A;  1MR8 A;  4YGB B;  1K96 A;  2JXC A;  2DOQ A;  1B8L A;  1CTR A;  4YGD B;  1CDP A;  1MUX A;  4MN0 A;  1KQM C;  1KK7 Z;  3EK4 A;  2LMV A;  1F4O A;  1DGU A;  3DVE A;  3O78 A;  4HSZ A;  1C7V A;  1CB1 A;  1IH0 A;  2KFH A;  2HET A;  2F33 A;  4TNC A;  2JPT A;  1QAS A;  1QVI Z;  1J1E A;  4OR9 B;  2LC5 A;  1B7T Z;  1KK8 C;  2BCB A;  2PAS A;  2Y1N A;  2BKI B;  3TZ1 A;  4Q04 A;  2VRG A;  3KPX A;  5F6T A;  1L7Z A;  1TNW A;  2BCA A;  3EVR A;  1QX5 B;  3O6B A;  3CLN A;  5HKZ A;  2HQ8 A;  2KHN A;  2I7A A;  3EKH A;  3HX4 A;  1OZS A;  4CPV A;  2EHB A;  1YX7 A;  3OB1 B;  1CDM A;  2CT9 A;  1YUR A;  2LLS A;  4MEW A;  2WND A;  2K7B A;  4MLW A;  1XFZ O;  3LLE A;  2MLF C;  2ZN9 A;  2K7C A;  4GGF C;  1C7W A;  1K2H A;  2LLU A;  1UP5 A;  1ALW A;  1QIW A;  2Y1M A;  2ZND A;  4DS7 A;  1EG3 A;  4D1E A;  1SK6 D;  2BL0 B;  1S3P A;  3ZNI A;  2K0J A;  1BMO A;  1XFW O;  2L4I A;  3NSI A;  2M8U A;  4I5K A;  2M1U A;  3WNX B;  1NCY A;  2I94 A;  1LXF C;  2KQ6 A;  2L51 A;  3IF7 A;  4PE7 A;  5CSN A;  1V1G A;  2LMU A;  5K89 A;  2JTZ A;  2L98 A;  1B9A A;  3SG3 A;  1MHO A;  1S26 D;  1ZFS A;  3GK1 A;  1UWO A;  1TOP A;  2KI4 B;  2KI6 D;  1KCY A;  1BU3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...