2SASA

Structure of a sarcoplasmic calcium-binding protein from amphioxus refined at 2.4 angstroms resolution
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
185
structure length
185
Chain Sequence
GLNDFQKQKIKFTFDFFLDMNHDGSIQDNDFEDMMTRYKEVNKGSLSDADYKSMQASLEDEWRDLKGRADINKDDVVSWEEYLAMWEKTIATCKSVADLPAWCQNRIPFLFKGMDVSGDGIVDLEEFQNYCKNFQLQCADVPAVYNVITDGGKVTFDLNRYKELYYRLLTSPAADAGNTLMGQKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Calcium-binding protein
molecule keywords SARCOPLASMIC CALCIUM-BINDING PROTEIN
publication title Structure of a sarcoplasmic calcium-binding protein from amphioxus refined at 2.4 A resolution.
pubmed doi rcsb
source organism Branchiostoma lanceolatum
total genus 66
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 1993-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2sasA00
3EVVA 1NX2A 1A75A 4UPGA 2KYCA 3IQOA 5IBWA 3PN7C 1W7IB 4MBEA 2WORA 3C1VA 3KPXA 1XFZO 2LCPA 3OHMB 2KAVA 4MVFA 3A4UB 1CDPA 1KQMB 2MJWB 4WRIA 1JSAA 2K0JA 1BOCA 1CTRA 4FTGA 4PHKA 4HSZA 3VRNA 1B8LA 1NP8A 4PE4A 4GUKA 2WCEA 2BBMA 2ZN9A 4MZJA 5CPVA 1AHRA 4OVNF 2I7AA 1UHJA 1UHKA 2KDHA 5HLOA 3CWGA 1XA5A 1WY9A 2BE6A 1GQMA 1J1EA 1DF0A 4MZLA 2Y1MA 3BQ3A 4ORCB 1F8HA 3CR2A 1YR5A 4BY4A 4CPVA 2CXJA 2K8MB 4AQIA 1YX7A 2PRUA 4YGEB 1JFJA 1FPWA 2OS8B 2AUCA 1QX2A 2KYFA 3OB2B 1NCZA 5KU1A 1DJGA 1DGVA 2KNEA 1NCYA 1YX8A 1C7VA 4MRYA 2E6WA 2Y4QA 1FI6A 3EVUA 1OZSA 2K2AA 3SG4A 1ZUZA 1K9UA 1M31A 4JPZB 3IF7A 1KSMA 4I5LB 1SL7A 2LM5A 2SASA 2PASA 1BR4B 1LXFC 2G2BA 1PK0D 2LHLA 1XYDA 1YVHA 1QTXA 2HETA 2KI4B 4U8DA 1B7TY 3CTNA 1CFCA 3NSIA 2WCFA 4I5JA 3NSKA 1CMGA 1WDCC 2LMTA 2NCPA 2L2EA 3WHUB 1DGUA 1F55A 1A75B 1SL8A 2M0RA 1D1OA 2JPTA 3FS7A 5GQQC 2FCDA 2K7CA 1G8IA 1TNWA 4R1EA 1OSAA 5ER5A 5HKYA 1J7PA 4MRXA 4PDZA 1C07A 1S5GY 2MAZA 1WRLA 2F8PA 1DJXA 1TOPA 2Q4UA 1TN4A 4YI8A 1L2OC 4TNCA 4N1GA 1K8UA 3GK1A 2CT9A 1KK8B 1BLQA 3F45A 1NPQA 1U5IA 1YUUA 1OMRA 2R2IA 2BKHB 2MRDA 3PALA 4WQ3A 3GK4X 1R6PA 2MBXA 3WHTB 5K89A 3O6BA 1JC2A 5AERA 1IJ6A 1TCOB 2L98A 4PALA 1YRUB 2I18A 4ETOA 4QJ4B 1DF0B 3FWBA 1CDNA 1J7RA 3RM1A 1XFUO 2JWWA 2JNXA 3ZWHA 2I94A 4DCKA 2JT8A 2ZRTA 1KQVA 2GV5A 3CS1A 5I2LA 1QIVA 1AJ4A 1PSRA 1B4CA 3D0YA 1M63B 1CFDA 2HPSA 1DT7B 2JC2A 1DJZA 2KQYA 2LUXA 4NDBA 1B8CA 1PRWA 1QLSA 1RK9A 2H61C 2JRFA 5AFPA 3OP0A 5DKNA 1Y0VH 3O2PA 1CKKA 5CSIA 3DF0A 3DVEA 1SCMC 3AAKA 2NXQA 3VGOA 1YUTA 1YVLA 2M1UA 3GOFA 3KF9A 1CMFA 1JF2A 4F0ZB 1J7OA 2BL0B 2JXCA 1UUSA 2H2KA 1KWOC 1LKJA 4JWQA 1LA3A 1NYAA 3VROA 5JOLA 1BG1A 2AAOA 3VRQA 2M9GA 2M1KB 1AK8A 1S36A 3I5GB 5CSJA 1K90D 2K2FA 1NX3A 1K96A 3EVRA 3M0WA 1JWDA 2QACA 4NDCA 2HF5A 2KQ6A 1NWDA 2K7DA 1LINA 2EGDA 1NUBA 5G08A 3OX5A 1V1GA 1DMOA 1BT6A 2KBMA 5TNCA 2F2OA 1J1DA 2NLNA 1G4YR 4PHMA 1CB1A 1KQMC 2OTGB 1E8AA 2MLFC 1J7QA 4DIRA 1MWNA 2WCBA 3AAJA 2NZ0A 4I5NB 3ICBA 3PSRA 1AJ5A 1B1GA 1SCVA 2GGMA 1KK7Z 2Q91A 3CLNA 2M49B 5KSZA 2LE9B 3BXKA 2KFFA 2KGRA 1BU3A 1F4QA 4M2OA 1V1FA 1S6IA 2KOTA 3I5HB 3BUXB 4P2YB 4PHNA 3JVTC 1CNPA 2ZKMX 2PALA 3D0YB 1RWYA 4OR9B 1QV0A 2OS8C 1ZOTB 2JT0A 3RLZA 4N5XA 3LK0A 2IS9A 3FWCA 4MN0A 2L4IA 4HRGA 1K94A 1SPYA 2LLSA 5I8NA 1KFXS 2F3ZA 1VRKA 4YI9A 2LV7A 5DKRA 3DF0B 3SG7A 1OE9B 1TRFA 1XVJA 2CNPA 5AANA 3K21A 1UP5A 3TDUA 4NQGA 1AVSA 1ZFSA 3SJSA 1DTLA 2BE4A 3CR4X 1RECA 4OV2A 1GGZA 1SBJA 1HT9A 1S1EA 1TTXA 2BCBA 2KI4C 1KFUL 1JFKA 3NSLA 1IRJA 2BCXA 1QX5B 1EXRA 1QLKA 1WLMA 1Y1XA 1XFXO 5I2OA 4YBHB 1MUXA 1DJHA 1NSHA 2ZRSA 1IWQA 2K7BA 2L51A 3A8RA 5F6TA 1NX1A 2SCPA 3DVKA 4NDDA 1KK8C 1ZMZA 2LLTA 1N2DA 2O60A 2KHNA 1KCYA 3NXAA 1NX0A 1XK4C 2FJUB 1LA0A 3KEVA 1QVIZ 4I5KA 2M8UA 1F54A 1ALVA 3BUOB 1A03A 1TNPA 5D7FA 3EK7A 1IJ5A 4GGFA 2KGBC 3HCMA 2CTNA 4IL1A 3SG3A 1S26D 2E30A 2MHHA 3LK1A 3TS5B 4M2QA 1XO5A 3DD4A 4P5OE 1FI5A 3EK8A 3NSOA 2V53A 2PVBA 4MSPA 1S6JA 1IGVA 4XJKA 1OOJA 4A4CA 1S3PA 1JUOA 1NCXA 1K9PA 1X02A 4YRUA 1KK7Y 1XFYO 2F3YA 2TN4A 1K93D 2BKIB 3E3RA 2O5GA 3I5IC 2LAPA 4PCWA 1MXEA 4OKHA 1KSOA 2KSPA 4XYNA 1OQPA 2CBLA 2QPTA 4YGAA 1IH0A 2LC5A 4HREE 2HQ8A 2L0PA 2BL0C 2ZFDA 2F33A 5D69A 4E68A 1IKUA 3I5FC 1BF5A 1HQVA 1H8BA 1MR8A 2LANA 3AKBA 3OX6A 1BMOA 1K2HA 1TNQA 5AXIA 3TUYB 1MF8B 1MQ1A 1OZOA 4WQ2A 4BY5A 1BJFA 4YGBB 1YURA 5PALA 2EC6B 3BUMB 5DKQA 1WRKA 2JT3A 2LMUA 2M7NA 3JTDC 1XFVO 4C0KA 4GPLB 2F2PA 2JU0A 1QXPA 1M39A 1CDLA 1B8RA 1OMVA 1QJTA 2GGZA 1TIZA 2FCEA 1YTZC 2KFGA 5HLVA 1EL4A 1EH2A 4CLNA 2OTGC 3BUNB 4CFQA 3TZ1A 3BOWA 1EJ3A 2WC8A 1DJIA 1TCFA 3PM8A 2KI6D 1NIWA 1SCMB 2MA2A 2LVVA 2EHBA 4ZCUA 1U5IB 2LHIA 2LVKA 1AUIB 1QATA 2BECA 3LCPC 1M45A 2JTZA 1SW8A 3IQQA 4C0JA 1RJVA 3ZNIA 3DVMA 2BCAA 1QX7A 3GK2A 4GBAA 4HRHA 1R2UA 4AOMA 1CDMA 2A4JA 1OMDA 1J55A 1UHIA 1XFWO 3LL8B 2COLB 1G33A 4MZKA 4PHJA 1AP4A 1FBVA 4GAOA 5J3XA 5FYXA 1PVAA 4QJ5B 4Q04A 1BODA 1CLLA 1Y1UA 3SG5A 4L9MA 1SR6B 1QVIY 3SIBA 4GGNA 2JULA 1SRAA 4USLA 3DVJA 3PN7B 1CM1A 1MXLC 2M7LA 2OPOA 1CLMA 2KFHA 3SG2A 1LVCD 3O4YA 1WLZA 1UHHA 2CCMA 2LMVA 1ODBA 3EK4A 4CIDA 1SKTA 1XK4A 2L4HA 2WNDA 2M97A 5CSFA 1BR1B 2LVJA 2NCOA 3CGAA 3CR5X 2ZNDA 3EKHA 1SYMA 4GNKB 1GJYA 2L5XB 1UURA 3BYAA 1IQ3A 3SIAA 3PATA 1A2XA 1JF0A 2G9BA 2D8NA 3JVTB 4M2PA 4ORAB 1H4BA 2KBIA 4ZCVA 3KO0A 2FOTA 3TDIA 2KI6C 1SL9A 3MSEB 1F4OA 4DUQA 3PFVA 1UWOA 2MLEC 1MHOA 2M3WA 4MEWA 3BOWB 2LP3A 1WRZA 3LLEA 4OCIA 4YGCB 2K7OA 3TDZA 4C0LA 2JZIA 3WXAA 1CM4A 2K61A 3WNXB 3EKJA 3FIAA 2H61A 2LUCA 1YRTB 2LP2A 4JQ0D 4AQJA 2JNFA 2P6BB 3VRRA 1B9AA 2B1UA 4MLWA 1F71A 1A4PA 3SG6A 1JBAA 3TS5C 1SY9A 1SNLA 4PE0A 5I2QA 2PSRA 2AMIA 5CSNA 2JQ6A 2M29A 3BUWB 1RFJA 1WDCB 1UHNA 4PE7A 5JJGA 1PSBA 1F70A 4YGDB 2KAXA 1PALA 3H4SE 3CZTX 2ZNEA 1DVIA 2I2RE 1PVBA 1L2OB 1EG3A 1Y6WA 2Y1NA 4GFTA 4DS7A 1CFPA 1Q80A 5B8IB 1DJWA 2JTTA 3OB1B 3PLFB 2Y5IA 2PMYA 3TUYC 1KFUS 1M46A 2WOSA 2L50A 2EC6C 1CFFA 1RROA 4N1FA 1FF1A 1W7JB 4A4BA 5KTYA 3I5GC 1IG5A 4DRWA 1QASA 1TNXA 3HX4A 2LNKA 1EG4A 1K95A 1PULA 1SK6D 2KAYA 1QV1A 5HYDA 1K9KA 1C7WA 2JOJA 1KFXL 4PE1A 1S6CA 3I5IB 5ER4X 5HKWA 1B7TZ 1DJYA 1ZACA 2JXLA 4FQOA 1FW4A 1N0YA 2LVIA 1L7ZA 1B47A 4QJ3B 1QS7A 2ISDA 2RGIA 2LLUA 3QRXA 4GGFC 3VRPA 5BPJA 1ALWA 4CFRA 3I5FB 1YUSA 4D1EA 1RTP1 1S5GZ 3O78A 1A29A 2BBNA 4ORBB 1CLBA 5AEQA 1QIWA 3AKAA 1KWOB 1Y1AA 1SMGA 2VRGA 3I5HC 2DOQA 3KHEA 1IQ5A 1N65A 4ICBA 5HKZA 3JTDB 1SR6C 1GGWA 2HQWA 3D10A 4XJKB 2ZN8A
chains in the Genus database with same CATH superfamily
3EVVA 1NX2A 1A75A 4UPGA 2KYCA 3IQOA 5IBWA 3PN7C 1W7IB 4MBEA 1P28A 2WORA 3C1VA 3KPXA 1XFZO 2LCPA 3OHMB 2KAVA 4MVFA 3A4UB 1CDPA 1KQMB 2MJWB 4WRIA 1JSAA 3R72A 2K0JA 1Z4HA 1BOCA 1CTRA 1IIOA 4FTGA 4PHKA 4HSZA 3VRNA 1B8LA 1NP8A 4PE4A 4GUKA 2WCEA 2BBMA 2ZN9A 4MZJA 5CPVA 1AHRA 2P70A 2I7AA 1UHJA 1UHKA 1SSEB 2KDHA 3CWGA 4OVNF 5HLOA 1XA5A 2PQLA 1WY9A 1TWOA 2BE6A 1GQMA 1J1EA 1DF0A 4MZLA 2Y1MA 3BQ3A 4ORCB 1OOHA 1F8HA 3CR2A 1YR5A 4BY4A 4CPVA 2CXJA 2K8MB 4AQIA 1YX7A 2PRUA 3R1PA 4YGEB 1JFJA 2OS8B 1FPWA 2AUCA 1QX2A 2KYFA 3OB2B 1NCZA 5KU1A 1DJGA 3D73A 1DGVA 1C3YA 2KNEA 1NCYA 1YX8A 1C7VA 4MRYA 2E6WA 2Y4QA 1FI6A 3EVUA 3UNWA 1OZSA 2K2AA 3SG4A 1ZUZA 1K9UA 4INWA 1M31A 3FE9A 4JPZB 3IF7A 1KSMA 4I5LB 1SL7A 2LM5A 2SASA 2PASA 1BR4B 1LXFC 2G2BA 1PK0D 2LHLA 3CZ2A 1XYDA 1YVHA 1QTXA 2HETA 2KI4B 4U8DA 1B7TY 3CTNA 1CFCA 3NSIA 2WCFA 4I5JA 3NSKA 1CMGA 1WDCC 2LMTA 2NCPA 3CZ1A 2L2EA 1TUJA 3WHUB 1DGUA 1F55A 1A75B 1SL8A 2M0RA 1D1OA 4INXA 2JPTA 3FS7A 5GQQC 2FCDA 2K7CA 1G8IA 1TNWA 4R1EA 1OSAA 5ER5A 5HKYA 1J7PA 4MRXA 4PDZA 3BFBA 1C07A 3CZ0A 1S5GY 1W9ZA 2MAZA 1WRLA 2F8PA 1DJXA 1TOPA 2Q4UA 1TN4A 3BFHA 4YI8A 1L2OC 3FE8A 4TNCA 4N1GA 1K8UA 3GK1A 2CT9A 1KK8B 1BLQA 3F45A 1NPQA 1U5IA 1YUUA 1OMRA 2KLDA 2BKHB 2MRDA 2R2IA 3DYEA 4WQ3A 3S0AA 3GK4X 1R6PA 2FJYA 2MBXA 3WHTB 5K89A 3O6BA 1JC2A 5AERA 3D77A 1IJ6A 1TCOB 2L98A 3D75A 1YRUB 4PALA 2I18A 4ETOA 4QJ4B 1DF0B 3FWBA 1CDNA 1J7RA 3RM1A 1XFUO 2JWWA 2WCLA 2JNXA 3ZWHA 2KPHA 2I94A 4DCKA 2JT8A 2ZRTA 1KQVA 2GV5A 3CS1A 5I2LA 1QIVA 1AJ4A 1PSRA 1B4CA 3D0YA 5FI6A 1M63B 1CFDA 2HPSA 1DT7B 2JC2A 1DJZA 2KQYA 3OGNA 2LUXA 3S0DA 2L5YA 4NDBA 1B8CA 3OBVA 3VB1A 1PRWA 1QLSA 1RK9A 2H61C 2JRFA 5AFPA 3OP0A 5DKNA 1Y0VH 3O2PA 1CKKA 5CSIA 3DF0A 3DVEA 1SCMC 3PJIA 3AAKA 2NXQA 3VGOA 1YUTA 1YVLA 2M1UA 3GOFA 3KF9A 1CMFA 1JF2A 4F0ZB 1J7OA 2BL0B 2JXCA 3DZTA 4IJ7A 1UUSA 1DQEA 1DC1A 3NGVA 2H2KA 1KWOC 1LKJA 4JWQA 1LA3A 1NYAA 3VROA 5JOLA 1BG1A 2AAOA 1OW4A 3VRQA 2M9GA 2M1KB 1AK8A 1S36A 3I5GB 5CSJA 1K90D 2K2FA 1NX3A 1K96A 4PT1A 3EVRA 1GM0A 3M0WA 1JWDA 3B87A 2QACA 4NDCA 1Z2CB 2HF5A 2KQ6A 1NWDA 1C3ZA 1LINA 2EGDA 2K7DA 1NUBA 5G08A 3OX5A 3D76A 1V1GA 1DMOA 1BT6A 2KBMA 5TNCA 2F2OA 1J1DA 2NLNA 1G4YR 4PHMA 1CB1A 1KQMC 2OTGB 1E8AA 2MLFC 5DICA 1J7QA 4DIRA 1MWNA 2WCBA 2BAPA 2NZ0A 3AAJA 4I5NB 3B88A 3ICBA 3PSRA 1AJ5A 4KYNA 1SCVA 1B1GA 2GGMA 1KK7Z 2Q91A 3CLNA 2M49B 5KSZA 2LE9B 3BXKA 2KFFA 2KGRA 1BU3A 1F4QA 4M2OA 1V1FA 1S6IA 2KOTA 3I5HB 3BUXB 4P2YB 4PHNA 3JVTC 1CNPA 4F7FA 2ZKMX 2PALA 3D0YB 1RWYA 3L4AA 4OR9B 1QV0A 2OS8C 1ZOTB 2JT0A 3RLZA 4N5XA 3LK0A 2IS9A 3FWCA 4MN0A 2L4IA 4HRGA 1K94A 1SPYA 2LLSA 5I8NA 1KFXS 2F3ZA 1VRKA 4YI9A 3NHTA 2LV7A 5DKRA 3DF0B 3FE6A 3SG7A 1OE9B 1TRFA 1XVJA 2CNPA 5AANA 3K21A 1UP5A 3TDUA 4NQGA 2WC6A 5FI7A 1AVSA 1ZFSA 3SJSA 1DTLA 2BE4A 3CR4X 1RECA 4OV2A 1GGZA 3QMEA 1SBJA 1HT9A 1S1EA 1TTXA 2BCBA 2KI4C 1KFUL 1JFKA 3NSLA 3B86A 2QEOA 2KLEA 1IRJA 4OZDA 2BCXA 1QX5B 4JKTA 1EXRA 2WCHA 1QLKA 1WLMA 3PALA 1Y1XA 3SS3A 1XFXO 3N7HA 5I2OA 4YBHB 1MUXA 3R1OA 1DJHA 1NSHA 2ZRSA 1IWQA 2K7BA 2L51A 3A8RA 5F6TA 1NX1A 2SCPA 3DVKA 4NDDA 1KK8C 1ZMZA 2LLTA 1N2DA 2O60A 2KHNA 1KCYA 3NXAA 1TUZA 1NX0A 1XK4C 2FJUB 1LA0A 3KEVA 1QVIZ 4I5KA 2M8UA 1F54A 1ALVA 3BUOB 1A03A 1TNPA 5D7FA 3UO9A 3EK7A 1IJ5A 4GGFA 2KGBC 3HCMA 2CTNA 4IL1A 3SG3A 1S26D 2E30A 2MHHA 3LK1A 3TS5B 4M2QA 1XO5A 3DD4A 4P5OE 1FI5A 3EK8A 2K60A 3NSOA 2V53A 2PVBA 2WCKA 4MSPA 1S6JA 1IGVA 4XJKA 1OOJA 4A4CA 1S3PA 1JUOA 1NCXA 1K9PA 1X02A 1XFRA 4YRUA 1KK7Y 1XFYO 2F3YA 2TN4A 1K93D 2BKIB 2WCJA 3E3RA 2O5GA 3I5IC 2LAPA 4FQTA 4PCWA 1MXEA 4OKHA 1KSOA 2KSPA 4XYNA 2GTEA 1OQPA 2CBLA 2QPTA 3Q8IA 4YGAA 2LC5A 1IH0A 4HREE 3PM2A 2HQ8A 2L0PA 2BL0C 2ZFDA 2F33A 5D69A 4E68A 1IKUA 3I5FC 1BF5A 1HQVA 5D3OA 1DEKA 1H8BA 1MR8A 2LANA 3AKBA 3OX6A 1BMOA 1K2HA 1TNQA 5AXIA 3TUYB 1MF8B 1MQ1A 1OZOA 4WQ2A 4BY5A 1BJFA 4YGBB 1YURA 5PALA 2EC6B 3BUMB 5DKQA 1WRKA 2JT3A 2LMUA 2M7NA 2L2CA 2QEBA 3JTDC 3L4LA 1XFVO 4C0KA 4GPLB 2F2PA 2JU0A 3SS4A 1QXPA 1M39A 1CDLA 2QDIA 1B8RA 1OMVA 1QJTA 2GGZA 1TIZA 2WC5A 2FCEA 1YTZC 2KFGA 1QWVA 1EL4A 5HLVA 1EH2A 4CLNA 2OTGC 3BUNB 4CFQA 2P71A 3TZ1A 3BOWA 3DY9A 1EJ3A 2WC8A 1DJIA 1TCFA 3PM8A 2KI6D 1NIWA 1SCMB 2MA2A 2LVVA 2EHBA 4ZCUA 1U5IB 3V2LA 2LHIA 2LVKA 1AUIB 1QATA 2BECA 2QEVA 3LCPC 1M45A 2JTZA 1SW8A 3IQQA 3K1EA 4C0JA 1RJVA 3ZNIA 3DVMA 2BCAA 1QX7A 3GK2A 4GBAA 4HRHA 1R2UA 4AOMA 1CDMA 1OMDA 1J55A 1UHIA 2A4JA 1XFWO 3LL8B 1G33A 2COLB 4MZKA 4PHJA 1AP4A 1FBVA 4GAOA 5J3XA 5FYXA 1PVAA 4QJ5B 4Q04A 1BODA 1CLLA 1OOIX 1Y1UA 3SG5A 3BFAA 1SR6B 1QVIY 4L9MA 3SIBA 4GGNA 2JULA 1SRAA 4USLA 3NHIA 3DVJA 3PN7B 1CM1A 1MXLC 2M7LA 2OPOA 1CLMA 2JPOA 2KFHA 2H8VA 3SG2A 1LVCD 3O4YA 3SS5A 1WLZA 1UHHA 2CCMA 2LMVA 1ODBA 3EK4A 4CIDA 1SKTA 5FI2A 1XK4A 2L4HA 2WNDA 2M97A 5CSFA 1BR1B 2LVJA 2NCOA 3CGAA 3CR5X 2ZNDA 3D78A 3CABA 2QEHA 3EKHA 3IVTA 1SYMA 4GNKB 3S0FA 1GJYA 3EG5B 2L5XB 1UURA 3BYAA 1IQ3A 3D74A 3SIAA 3PATA 1A2XA 1JF0A 2G9BA 2D8NA 3CYZA 3JVTB 4M2PA 3BJHA 2KBIA 4ORAB 1H4BA 4ZCVA 3KO0A 2FOTA 3TDIA 2KI6C 1SL9A 3MSEB 1F4OA 4DUQA 3PFVA 1UWOA 3B6XA 2MLEC 1MHOA 2M3WA 4MEWA 3BOWB 2LP3A 1WRZA 3LLEA 4OCIA 4YGCB 2K7OA 3TDZA 4C0LA 2JZIA 3WXAA 1CM4A 2K61A 3RZSA 3WNXB 3EKJA 3FIAA 2H61A 2LUCA 1YRTB 2LP2A 2YGUA 4JQ0D 4AQJA 2WCMA 2JNFA 2P6BB 3VRRA 1B9AA 2B1UA 4MLWA 1F71A 1A4PA 3SG6A 1JBAA 3TS5C 1SY9A 1SNLA 4PE0A 5I2QA 1T14A 2PSRA 2AMIA 3S0EA 3CDNA 2JQ6A 5CSNA 2M29A 3BUWB 1RFJA 1OOFA 1WDCB 1UHNA 4PE7A 5JJGA 4JD9A 2PYQA 1PSBA 1F70A 4YGDB 3L47A 2KAXA 1PALA 3H4SE 3CZTX 2ZNEA 1DVIA 2I2RE 3O4XA 1PVBA 1L2OB 1EG3A 1Y6WA 2BNXA 2Y1NA 4GFTA 4DS7A 1CFPA 5EL2A 1Q80A 5I94A 5B8IB 2ERBA 1DJWA 2JTTA 3OB1B 3PLFB 2Y5IA 2PMYA 3TUYC 1KFUS 3R1VA 1M46A 2WOSA 2L50A 2EC6C 1CFFA 1RROA 4N1FA 1FF1A 1W7JB 4A4BA 5KTYA 3I5GC 1IG5A 3S0BA 4DRWA 1QASA 1TNXA 3HX4A 2LNKA 1EG4A 1K95A 1PULA 1SK6D 2KAYA 1QV1A 5HYDA 1K9KA 1C7WA 2JOJA 1KFXL 4PE1A 1LS8A 1S6CA 3I5IB 5ER4X 5HKWA 1B7TZ 1DJYA 1ZACA 2JXLA 4FQOA 5HL1A 1FW4A 1N0YA 1OOGA 1L7ZA 1B47A 2LVIA 1QS7A 3DXLA 2RGIA 4QJ3B 1DELA 2ISDA 2LLUA 3QRXA 4GGFC 3VRPA 5BPJA 1ALWA 4CFRA 3I5FB 1YUSA 4D1EA 3S0GA 3B7AA 1RTP1 1S5GZ 3O78A 1A29A 2BBNA 4ORBB 1CLBA 5AEQA 1QIWA 3AKAA 1KWOB 1Y1AA 1SMGA 2VRGA 3I5HC 2DOQA 3KHEA 1IQ5A 1N65A 4ICBA 5HKZA 1ORGA 3JTDB 1SR6C 1GGWA 2HQWA 3D10A 4XJKB 2ZN8A
chains in the Genus database with same CATH topology
3EVVA 1NX2A 1A75A 4UPGA 2KYCA 3IQOA 5IBWA 3PN7C 1W7IB 4MBEA 2WORA 3C1VA 3KPXA 1XFZO 2LCPA 3OHMB 2KAVA 4MVFA 3A4UB 1CDPA 1KQMB 2MJWB 4WRIA 1JSAA 2K0JA 1BOCA 1CTRA 4FTGA 4PHKA 4HSZA 3VRNA 1B8LA 1NP8A 4PE4A 4GUKA 2WCEA 2BBMA 2ZN9A 4MZJA 5CPVA 1AHRA 4OVNF 2I7AA 1UHJA 1UHKA 2KDHA 5HLOA 3CWGA 1XA5A 1WY9A 2BE6A 1GQMA 1J1EA 1DF0A 4MZLA 2Y1MA 3BQ3A 4ORCB 1F8HA 3CR2A 1YR5A 4BY4A 4CPVA 2CXJA 2K8MB 4AQIA 1YX7A 2PRUA 4YGEB 1JFJA 1FPWA 2OS8B 2AUCA 1QX2A 2KYFA 3OB2B 1NCZA 5KU1A 1DJGA 1DGVA 2KNEA 1NCYA 1YX8A 1C7VA 4MRYA 2E6WA 2Y4QA 1FI6A 3EVUA 1OZSA 2K2AA 3SG4A 1ZUZA 1K9UA 1M31A 4JPZB 3IF7A 1KSMA 4I5LB 1SL7A 2LM5A 2SASA 2PASA 1BR4B 1LXFC 2G2BA 1PK0D 2LHLA 1XYDA 1YVHA 1QTXA 2HETA 2KI4B 4U8DA 1B7TY 3CTNA 1CFCA 3NSIA 2WCFA 4I5JA 3NSKA 1CMGA 1WDCC 2LMTA 2NCPA 2L2EA 3WHUB 1DGUA 1F55A 1A75B 1SL8A 2M0RA 1D1OA 2JPTA 3FS7A 5GQQC 2FCDA 2K7CA 1G8IA 1TNWA 4R1EA 1OSAA 5ER5A 5HKYA 1J7PA 4MRXA 4PDZA 1C07A 1S5GY 2MAZA 1WRLA 2F8PA 1DJXA 1TOPA 2Q4UA 1TN4A 4YI8A 1L2OC 4TNCA 4N1GA 1K8UA 3GK1A 2CT9A 1KK8B 1BLQA 3F45A 1NPQA 1U5IA 1YUUA 1OMRA 2R2IA 2BKHB 2MRDA 3PALA 4WQ3A 3GK4X 1R6PA 2MBXA 3WHTB 5K89A 3O6BA 1JC2A 5AERA 1IJ6A 1TCOB 2L98A 4PALA 1YRUB 2I18A 4ETOA 4QJ4B 1DF0B 3FWBA 1CDNA 1J7RA 3RM1A 1XFUO 2JWWA 2JNXA 3ZWHA 2I94A 4DCKA 2JT8A 2ZRTA 1KQVA 2GV5A 3CS1A 5I2LA 1QIVA 1AJ4A 1PSRA 1B4CA 3D0YA 1M63B 1CFDA 2HPSA 1DT7B 2JC2A 1DJZA 2KQYA 2LUXA 4NDBA 1B8CA 1PRWA 1QLSA 1RK9A 2H61C 2JRFA 5AFPA 3OP0A 5DKNA 1Y0VH 3O2PA 1CKKA 5CSIA 3DF0A 3DVEA 1SCMC 3AAKA 2NXQA 3VGOA 1YUTA 1YVLA 2M1UA 3GOFA 3KF9A 1CMFA 1JF2A 4F0ZB 1J7OA 2BL0B 2JXCA 1UUSA 2H2KA 1KWOC 1LKJA 4JWQA 1LA3A 1NYAA 3VROA 5JOLA 1BG1A 2AAOA 3VRQA 2M9GA 2M1KB 1AK8A 1S36A 3I5GB 5CSJA 1K90D 2K2FA 1NX3A 1K96A 3EVRA 3M0WA 1JWDA 2QACA 4NDCA 2HF5A 2KQ6A 1NWDA 2K7DA 1LINA 2EGDA 1NUBA 5G08A 3OX5A 1V1GA 1DMOA 1BT6A 2KBMA 5TNCA 2F2OA 1J1DA 2NLNA 1G4YR 4PHMA 1CB1A 1KQMC 2OTGB 1E8AA 2MLFC 1J7QA 4DIRA 1MWNA 2WCBA 3AAJA 2NZ0A 4I5NB 3ICBA 3PSRA 1AJ5A 1B1GA 1SCVA 2GGMA 1KK7Z 2Q91A 3CLNA 2M49B 5KSZA 2LE9B 3BXKA 2KFFA 2KGRA 1BU3A 1F4QA 4M2OA 1V1FA 1S6IA 2KOTA 3I5HB 3BUXB 4P2YB 4PHNA 3JVTC 1CNPA 2ZKMX 2PALA 3D0YB 1RWYA 4OR9B 1QV0A 2OS8C 1ZOTB 2JT0A 3RLZA 4N5XA 3LK0A 2IS9A 3FWCA 4MN0A 2L4IA 4HRGA 1K94A 1SPYA 2LLSA 5I8NA 1KFXS 2F3ZA 1VRKA 4YI9A 2LV7A 5DKRA 3DF0B 3SG7A 1OE9B 1TRFA 1XVJA 2CNPA 5AANA 3K21A 1UP5A 3TDUA 4NQGA 1AVSA 1ZFSA 3SJSA 1DTLA 2BE4A 3CR4X 1RECA 4OV2A 1GGZA 1SBJA 1HT9A 1S1EA 1TTXA 2BCBA 2KI4C 1KFUL 1JFKA 3NSLA 1IRJA 2BCXA 1QX5B 1EXRA 1QLKA 1WLMA 1Y1XA 1XFXO 5I2OA 4YBHB 1MUXA 1DJHA 1NSHA 2ZRSA 1IWQA 2K7BA 2L51A 3A8RA 5F6TA 1NX1A 2SCPA 3DVKA 4NDDA 1KK8C 1ZMZA 2LLTA 1N2DA 2O60A 2KHNA 1KCYA 3NXAA 1NX0A 1XK4C 2FJUB 1LA0A 3KEVA 1QVIZ 4I5KA 2M8UA 1F54A 1ALVA 3BUOB 1A03A 1TNPA 5D7FA 3EK7A 1IJ5A 4GGFA 2KGBC 3HCMA 2CTNA 4IL1A 3SG3A 1S26D 2E30A 2MHHA 3LK1A 3TS5B 4M2QA 1XO5A 3DD4A 4P5OE 1FI5A 3EK8A 3NSOA 2V53A 2PVBA 4MSPA 1S6JA 1IGVA 4XJKA 1OOJA 4A4CA 1S3PA 1JUOA 1NCXA 1K9PA 1X02A 4YRUA 1KK7Y 1XFYO 2F3YA 2TN4A 1K93D 2BKIB 3E3RA 2O5GA 3I5IC 2LAPA 4PCWA 1MXEA 4OKHA 1KSOA 2KSPA 4XYNA 1OQPA 2CBLA 2QPTA 4YGAA 1IH0A 2LC5A 4HREE 2HQ8A 2L0PA 2BL0C 2ZFDA 2F33A 5D69A 4E68A 1IKUA 3I5FC 1BF5A 1HQVA 1H8BA 1MR8A 2LANA 3AKBA 3OX6A 1BMOA 1K2HA 1TNQA 5AXIA 3TUYB 1MF8B 1MQ1A 1OZOA 4WQ2A 4BY5A 1BJFA 4YGBB 1YURA 5PALA 2EC6B 3BUMB 5DKQA 1WRKA 2JT3A 2LMUA 2M7NA 3JTDC 1XFVO 4C0KA 4GPLB 2F2PA 2JU0A 1QXPA 1M39A 1CDLA 1B8RA 1OMVA 1QJTA 2GGZA 1TIZA 2FCEA 1YTZC 2KFGA 5HLVA 1EL4A 1EH2A 4CLNA 2OTGC 3BUNB 4CFQA 3TZ1A 3BOWA 1EJ3A 2WC8A 1DJIA 1TCFA 3PM8A 2KI6D 1NIWA 1SCMB 2MA2A 2LVVA 2EHBA 4ZCUA 1U5IB 2LHIA 2LVKA 1AUIB 1QATA 2BECA 3LCPC 1M45A 2JTZA 1SW8A 3IQQA 4C0JA 1RJVA 3ZNIA 3DVMA 2BCAA 1QX7A 3GK2A 4GBAA 4HRHA 1R2UA 4AOMA 1CDMA 2A4JA 1OMDA 1J55A 1UHIA 1XFWO 3LL8B 2COLB 1G33A 4MZKA 4PHJA 1AP4A 1FBVA 4GAOA 5J3XA 5FYXA 1PVAA 4QJ5B 4Q04A 1BODA 1CLLA 1Y1UA 3SG5A 4L9MA 1SR6B 1QVIY 3SIBA 4GGNA 2JULA 1SRAA 4USLA 3DVJA 3PN7B 1CM1A 1MXLC 2M7LA 2OPOA 1CLMA 2KFHA 3SG2A 1LVCD 3O4YA 1WLZA 1UHHA 2CCMA 2LMVA 1ODBA 3EK4A 4CIDA 1SKTA 1XK4A 2L4HA 2WNDA 2M97A 5CSFA 1BR1B 2LVJA 2NCOA 3CGAA 3CR5X 2ZNDA 3EKHA 1SYMA 4GNKB 1GJYA 2L5XB 1UURA 3BYAA 1IQ3A 3SIAA 3PATA 1A2XA 1JF0A 2G9BA 2D8NA 3JVTB 4M2PA 4ORAB 1H4BA 2KBIA 4ZCVA 3KO0A 2FOTA 3TDIA 2KI6C 1SL9A 3MSEB 1F4OA 4DUQA 3PFVA 1UWOA 2MLEC 1MHOA 2M3WA 4MEWA 3BOWB 2LP3A 1WRZA 3LLEA 4OCIA 4YGCB 2K7OA 3TDZA 4C0LA 2JZIA 3WXAA 1CM4A 2K61A 3WNXB 3EKJA 3FIAA 2H61A 2LUCA 1YRTB 2LP2A 4JQ0D 4AQJA 2JNFA 2P6BB 3VRRA 1B9AA 2B1UA 4MLWA 1F71A 1A4PA 3SG6A 1JBAA 3TS5C 1SY9A 1SNLA 4PE0A 5I2QA 2PSRA 2AMIA 5CSNA 2JQ6A 2M29A 3BUWB 1RFJA 1WDCB 1UHNA 4PE7A 5JJGA 1PSBA 1F70A 4YGDB 2KAXA 1PALA 3H4SE 3CZTX 2ZNEA 1DVIA 2I2RE 1PVBA 1L2OB 1EG3A 1Y6WA 2Y1NA 4GFTA 4DS7A 1CFPA 1Q80A 5B8IB 1DJWA 2JTTA 3OB1B 3PLFB 2Y5IA 2PMYA 3TUYC 1KFUS 1M46A 2WOSA 2L50A 2EC6C 1CFFA 1RROA 4N1FA 1FF1A 1W7JB 4A4BA 5KTYA 3I5GC 1IG5A 4DRWA 1QASA 1TNXA 3HX4A 2LNKA 1EG4A 1K95A 1PULA 1SK6D 2KAYA 1QV1A 5HYDA 1K9KA 1C7WA 2JOJA 1KFXL 4PE1A 1S6CA 3I5IB 5ER4X 5HKWA 1B7TZ 1DJYA 1ZACA 2JXLA 4FQOA 1FW4A 1N0YA 2LVIA 1L7ZA 1B47A 4QJ3B 1QS7A 2ISDA 2RGIA 2LLUA 3QRXA 4GGFC 3VRPA 5BPJA 1ALWA 4CFRA 3I5FB 1YUSA 4D1EA 1RTP1 1S5GZ 3O78A 1A29A 2BBNA 4ORBB 1CLBA 5AEQA 1QIWA 3AKAA 1KWOB 1Y1AA 1SMGA 2VRGA 3I5HC 2DOQA 3KHEA 1IQ5A 1N65A 4ICBA 5HKZA 3JTDB 1SR6C 1GGWA 2HQWA 3D10A 4XJKB 2ZN8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EVV A;  1NX2 A;  1A75 A;  4UPG A;  2KYC A;  3IQO A;  5IBW A;  3PN7 C;  1W7I B;  4MBE A;  2WOR A;  3C1V A;  3KPX A;  1XFZ O;  2LCP A;  3OHM B;  2KAV A;  4MVF A;  3A4U B;  1CDP A;  1KQM B;  2MJW B;  4WRI A;  1JSA A;  2K0J A;  1BOC A;  1CTR A;  4FTG A;  4PHK A;  4HSZ A;  3VRN A;  1B8L A;  1NP8 A;  4PE4 A;  4GUK A;  2WCE A;  2BBM A;  2ZN9 A;  4MZJ A;  5CPV A;  1AHR A;  4OVN F;  2I7A A;  1UHJ A;  1UHK A;  2KDH A;  5HLO A;  3CWG A;  1XA5 A;  1WY9 A;  2BE6 A;  1GQM A;  1J1E A;  1DF0 A;  4MZL A;  2Y1M A;  3BQ3 A;  4ORC B;  1F8H A;  3CR2 A;  1YR5 A;  4BY4 A;  4CPV A;  2CXJ A;  2K8M B;  4AQI A;  1YX7 A;  2PRU A;  4YGE B;  1JFJ A;  1FPW A;  2OS8 B;  2AUC A;  1QX2 A;  2KYF A;  3OB2 B;  1NCZ A;  5KU1 A;  1DJG A;  1DGV A;  2KNE A;  1NCY A;  1YX8 A;  1C7V A;  4MRY A;  2E6W A;  2Y4Q A;  1FI6 A;  3EVU A;  1OZS A;  2K2A A;  3SG4 A;  1ZUZ A;  1K9U A;  1M31 A;  4JPZ B;  3IF7 A;  1KSM A;  4I5L B;  1SL7 A;  2LM5 A;  2SAS A;  2PAS A;  1BR4 B;  1LXF C;  2G2B A;  1PK0 D;  2LHL A;  1XYD A;  1YVH A;  1QTX A;  2HET A;  2KI4 B;  4U8D A;  1B7T Y;  3CTN A;  1CFC A;  3NSI A;  2WCF A;  4I5J A;  3NSK A;  1CMG A;  1WDC C;  2LMT A;  2NCP A;  2L2E A;  3WHU B;  1DGU A;  1F55 A;  1A75 B;  1SL8 A;  2M0R A;  1D1O A;  2JPT A;  3FS7 A;  5GQQ C;  2FCD A;  2K7C A;  1G8I A;  1TNW A;  4R1E A;  1OSA A;  5ER5 A;  5HKY A;  1J7P A;  4MRX A;  4PDZ A;  1C07 A;  1S5G Y;  2MAZ A;  1WRL A;  2F8P A;  1DJX A;  1TOP A;  2Q4U A;  1TN4 A;  4YI8 A;  1L2O C;  4TNC A;  4N1G A;  1K8U A;  3GK1 A;  2CT9 A;  1KK8 B;  1BLQ A;  3F45 A;  1NPQ A;  1U5I A;  1YUU A;  1OMR A;  2R2I A;  2BKH B;  2MRD A;  3PAL A;  4WQ3 A;  3GK4 X;  1R6P A;  2MBX A;  3WHT B;  5K89 A;  3O6B A;  1JC2 A;  5AER A;  1IJ6 A;  1TCO B;  2L98 A;  4PAL A;  1YRU B;  2I18 A;  4ETO A;  4QJ4 B;  1DF0 B;  3FWB A;  1CDN A;  1J7R A;  3RM1 A;  1XFU O;  2JWW A;  2JNX A;  3ZWH A;  2I94 A;  4DCK A;  2JT8 A;  2ZRT A;  1KQV A;  2GV5 A;  3CS1 A;  5I2L A;  1QIV A;  1AJ4 A;  1PSR A;  1B4C A;  3D0Y A;  1M63 B;  1CFD A;  2HPS A;  1DT7 B;  2JC2 A;  1DJZ A;  2KQY A;  2LUX A;  4NDB A;  1B8C A;  1PRW A;  1QLS A;  1RK9 A;  2H61 C;  2JRF A;  5AFP A;  3OP0 A;  5DKN A;  1Y0V H;  3O2P A;  1CKK A;  5CSI A;  3DF0 A;  3DVE A;  1SCM C;  3AAK A;  2NXQ A;  3VGO A;  1YUT A;  1YVL A;  2M1U A;  3GOF A;  3KF9 A;  1CMF A;  1JF2 A;  4F0Z B;  1J7O A;  2BL0 B;  2JXC A;  1UUS A;  2H2K A;  1KWO C;  1LKJ A;  4JWQ A;  1LA3 A;  1NYA A;  3VRO A;  5JOL A;  1BG1 A;  2AAO A;  3VRQ A;  2M9G A;  2M1K B;  1AK8 A;  1S36 A;  3I5G B;  5CSJ A;  1K90 D;  2K2F A;  1NX3 A;  1K96 A;  3EVR A;  3M0W A;  1JWD A;  2QAC A;  4NDC A;  2HF5 A;  2KQ6 A;  1NWD A;  2K7D A;  1LIN A;  2EGD A;  1NUB A;  5G08 A;  3OX5 A;  1V1G A;  1DMO A;  1BT6 A;  2KBM A;  5TNC A;  2F2O A;  1J1D A;  2NLN A;  1G4Y R;  4PHM A;  1CB1 A;  1KQM C;  2OTG B;  1E8A A;  2MLF C;  1J7Q A;  4DIR A;  1MWN A;  2WCB A;  3AAJ A;  2NZ0 A;  4I5N B;  3ICB A;  3PSR A;  1AJ5 A;  1B1G A;  1SCV A;  2GGM A;  1KK7 Z;  2Q91 A;  3CLN A;  2M49 B;  5KSZ A;  2LE9 B;  3BXK A;  2KFF A;  2KGR A;  1BU3 A;  1F4Q A;  4M2O A;  1V1F A;  1S6I A;  2KOT A;  3I5H B;  3BUX B;  4P2Y B;  4PHN A;  3JVT C;  1CNP A;  2ZKM X;  2PAL A;  3D0Y B;  1RWY A;  4OR9 B;  1QV0 A;  2OS8 C;  1ZOT B;  2JT0 A;  3RLZ A;  4N5X A;  3LK0 A;  2IS9 A;  3FWC A;  4MN0 A;  2L4I A;  4HRG A;  1K94 A;  1SPY A;  2LLS A;  5I8N A;  1KFX S;  2F3Z A;  1VRK A;  4YI9 A;  2LV7 A;  5DKR A;  3DF0 B;  3SG7 A;  1OE9 B;  1TRF A;  1XVJ A;  2CNP A;  5AAN A;  3K21 A;  1UP5 A;  3TDU A;  4NQG A;  1AVS A;  1ZFS A;  3SJS A;  1DTL A;  2BE4 A;  3CR4 X;  1REC A;  4OV2 A;  1GGZ A;  1SBJ A;  1HT9 A;  1S1E A;  1TTX A;  2BCB A;  2KI4 C;  1KFU L;  1JFK A;  3NSL A;  1IRJ A;  2BCX A;  1QX5 B;  1EXR A;  1QLK A;  1WLM A;  1Y1X A;  1XFX O;  5I2O A;  4YBH B;  1MUX A;  1DJH A;  1NSH A;  2ZRS A;  1IWQ A;  2K7B A;  2L51 A;  3A8R A;  5F6T A;  1NX1 A;  2SCP A;  3DVK A;  4NDD A;  1KK8 C;  1ZMZ A;  2LLT A;  1N2D A;  2O60 A;  2KHN A;  1KCY A;  3NXA A;  1NX0 A;  1XK4 C;  2FJU B;  1LA0 A;  3KEV A;  1QVI Z;  4I5K A;  2M8U A;  1F54 A;  1ALV A;  3BUO B;  1A03 A;  1TNP A;  5D7F A;  3EK7 A;  1IJ5 A;  4GGF A;  2KGB C;  3HCM A;  2CTN A;  4IL1 A;  3SG3 A;  1S26 D;  2E30 A;  2MHH A;  3LK1 A;  3TS5 B;  4M2Q A;  1XO5 A;  3DD4 A;  4P5O E;  1FI5 A;  3EK8 A;  3NSO A;  2V53 A;  2PVB A;  4MSP A;  1S6J A;  1IGV A;  4XJK A;  1OOJ A;  4A4C A;  1S3P A;  1JUO A;  1NCX A;  1K9P A;  1X02 A;  4YRU A;  1KK7 Y;  1XFY O;  2F3Y A;  2TN4 A;  1K93 D;  2BKI B;  3E3R A;  2O5G A;  3I5I C;  2LAP A;  4PCW A;  1MXE A;  4OKH A;  1KSO A;  2KSP A;  4XYN A;  1OQP A;  2CBL A;  2QPT A;  4YGA A;  1IH0 A;  2LC5 A;  4HRE E;  2HQ8 A;  2L0P A;  2BL0 C;  2ZFD A;  2F33 A;  5D69 A;  4E68 A;  1IKU A;  3I5F C;  1BF5 A;  1HQV A;  1H8B A;  1MR8 A;  2LAN A;  3AKB A;  3OX6 A;  1BMO A;  1K2H A;  1TNQ A;  5AXI A;  3TUY B;  1MF8 B;  1MQ1 A;  1OZO A;  4WQ2 A;  4BY5 A;  1BJF A;  4YGB B;  1YUR A;  5PAL A;  2EC6 B;  3BUM B;  5DKQ A;  1WRK A;  2JT3 A;  2LMU A;  2M7N A;  3JTD C;  1XFV O;  4C0K A;  4GPL B;  2F2P A;  2JU0 A;  1QXP A;  1M39 A;  1CDL A;  1B8R A;  1OMV A;  1QJT A;  2GGZ A;  1TIZ A;  2FCE A;  1YTZ C;  2KFG A;  5HLV A;  1EL4 A;  1EH2 A;  4CLN A;  2OTG C;  3BUN B;  4CFQ A;  3TZ1 A;  3BOW A;  1EJ3 A;  2WC8 A;  1DJI A;  1TCF A;  3PM8 A;  2KI6 D;  1NIW A;  1SCM B;  2MA2 A;  2LVV A;  2EHB A;  4ZCU A;  1U5I B;  2LHI A;  2LVK A;  1AUI B;  1QAT A;  2BEC A;  3LCP C;  1M45 A;  2JTZ A;  1SW8 A;  3IQQ A;  4C0J A;  1RJV A;  3ZNI A;  3DVM A;  2BCA A;  1QX7 A;  3GK2 A;  4GBA A;  4HRH A;  1R2U A;  4AOM A;  1CDM A;  2A4J A;  1OMD A;  1J55 A;  1UHI A;  1XFW O;  3LL8 B;  2COL B;  1G33 A;  4MZK A;  4PHJ A;  1AP4 A;  1FBV A;  4GAO A;  5J3X A;  5FYX A;  1PVA A;  4QJ5 B;  4Q04 A;  1BOD A;  1CLL A;  1Y1U A;  3SG5 A;  4L9M A;  1SR6 B;  1QVI Y;  3SIB A;  4GGN A;  2JUL A;  1SRA A;  4USL A;  3DVJ A;  3PN7 B;  1CM1 A;  1MXL C;  2M7L A;  2OPO A;  1CLM A;  2KFH A;  3SG2 A;  1LVC D;  3O4Y A;  1WLZ A;  1UHH A;  2CCM A;  2LMV A;  1ODB A;  3EK4 A;  4CID A;  1SKT A;  1XK4 A;  2L4H A;  2WND A;  2M97 A;  5CSF A;  1BR1 B;  2LVJ A;  2NCO A;  3CGA A;  3CR5 X;  2ZND A;  3EKH A;  1SYM A;  4GNK B;  1GJY A;  2L5X B;  1UUR A;  3BYA A;  1IQ3 A;  3SIA A;  3PAT A;  1A2X A;  1JF0 A;  2G9B A;  2D8N A;  3JVT B;  4M2P A;  4ORA B;  1H4B A;  2KBI A;  4ZCV A;  3KO0 A;  2FOT A;  3TDI A;  2KI6 C;  1SL9 A;  3MSE B;  1F4O A;  4DUQ A;  3PFV A;  1UWO A;  2MLE C;  1MHO A;  2M3W A;  4MEW A;  3BOW B;  2LP3 A;  1WRZ A;  3LLE A;  4OCI A;  4YGC B;  2K7O A;  3TDZ A;  4C0L A;  2JZI A;  3WXA A;  1CM4 A;  2K61 A;  3WNX B;  3EKJ A;  3FIA A;  2H61 A;  2LUC A;  1YRT B;  2LP2 A;  4JQ0 D;  4AQJ A;  2JNF A;  2P6B B;  3VRR A;  1B9A A;  2B1U A;  4MLW A;  1F71 A;  1A4P A;  3SG6 A;  1JBA A;  3TS5 C;  1SY9 A;  1SNL A;  4PE0 A;  5I2Q A;  2PSR A;  2AMI A;  5CSN A;  2JQ6 A;  2M29 A;  3BUW B;  1RFJ A;  1WDC B;  1UHN A;  4PE7 A;  5JJG A;  1PSB A;  1F70 A;  4YGD B;  2KAX A;  1PAL A;  3H4S E;  3CZT X;  2ZNE A;  1DVI A;  2I2R E;  1PVB A;  1L2O B;  1EG3 A;  1Y6W A;  2Y1N A;  4GFT A;  4DS7 A;  1CFP A;  1Q80 A;  5B8I B;  1DJW A;  2JTT A;  3OB1 B;  3PLF B;  2Y5I A;  2PMY A;  3TUY C;  1KFU S;  1M46 A;  2WOS A;  2L50 A;  2EC6 C;  1CFF A;  1RRO A;  4N1F A;  1FF1 A;  1W7J B;  4A4B A;  5KTY A;  3I5G C;  1IG5 A;  4DRW A;  1QAS A;  1TNX A;  3HX4 A;  2LNK A;  1EG4 A;  1K95 A;  1PUL A;  1SK6 D;  2KAY A;  1QV1 A;  5HYD A;  1K9K A;  1C7W A;  2JOJ A;  1KFX L;  4PE1 A;  1S6C A;  3I5I B;  5ER4 X;  5HKW A;  1B7T Z;  1DJY A;  1ZAC A;  2JXL A;  4FQO A;  1FW4 A;  1N0Y A;  2LVI A;  1L7Z A;  1B47 A;  4QJ3 B;  1QS7 A;  2ISD A;  2RGI A;  2LLU A;  3QRX A;  4GGF C;  3VRP A;  5BPJ A;  1ALW A;  4CFR A;  3I5F B;  1YUS A;  4D1E A;  1RTP 1;  1S5G Z;  3O78 A;  1A29 A;  2BBN A;  4ORB B;  1CLB A;  5AEQ A;  1QIW A;  3AKA A;  1KWO B;  1Y1A A;  1SMG A;  2VRG A;  3I5H C;  2DOQ A;  3KHE A;  1IQ5 A;  1N65 A;  4ICB A;  5HKZ A;  3JTD B;  1SR6 C;  1GGW A;  2HQW A;  3D10 A;  4XJK B;  2ZN8 A; 
#chains in the Genus database with same CATH topology
 3EVV A;  1NX2 A;  1A75 A;  4UPG A;  2KYC A;  3IQO A;  5IBW A;  3PN7 C;  1W7I B;  4MBE A;  1P28 A;  2WOR A;  3C1V A;  3KPX A;  1XFZ O;  2LCP A;  3OHM B;  2KAV A;  4MVF A;  3A4U B;  1CDP A;  1KQM B;  2MJW B;  4WRI A;  1JSA A;  3R72 A;  2K0J A;  1Z4H A;  1BOC A;  1CTR A;  1IIO A;  4FTG A;  4PHK A;  4HSZ A;  3VRN A;  1B8L A;  1NP8 A;  4PE4 A;  4GUK A;  2WCE A;  2BBM A;  2ZN9 A;  4MZJ A;  5CPV A;  1AHR A;  2P70 A;  2I7A A;  1UHJ A;  1UHK A;  1SSE B;  2KDH A;  3CWG A;  4OVN F;  5HLO A;  1XA5 A;  2PQL A;  1WY9 A;  1TWO A;  2BE6 A;  1GQM A;  1J1E A;  1DF0 A;  4MZL A;  2Y1M A;  3BQ3 A;  4ORC B;  1OOH A;  1F8H A;  3CR2 A;  1YR5 A;  4BY4 A;  4CPV A;  2CXJ A;  2K8M B;  4AQI A;  1YX7 A;  2PRU A;  3R1P A;  4YGE B;  1JFJ A;  2OS8 B;  1FPW A;  2AUC A;  1QX2 A;  2KYF A;  3OB2 B;  1NCZ A;  5KU1 A;  1DJG A;  3D73 A;  1DGV A;  1C3Y A;  2KNE A;  1NCY A;  1YX8 A;  1C7V A;  4MRY A;  2E6W A;  2Y4Q A;  1FI6 A;  3EVU A;  3UNW A;  1OZS A;  2K2A A;  3SG4 A;  1ZUZ A;  1K9U A;  4INW A;  1M31 A;  3FE9 A;  4JPZ B;  3IF7 A;  1KSM A;  4I5L B;  1SL7 A;  2LM5 A;  2SAS A;  2PAS A;  1BR4 B;  1LXF C;  2G2B A;  1PK0 D;  2LHL A;  3CZ2 A;  1XYD A;  1YVH A;  1QTX A;  2HET A;  2KI4 B;  4U8D A;  1B7T Y;  3CTN A;  1CFC A;  3NSI A;  2WCF A;  4I5J A;  3NSK A;  1CMG A;  1WDC C;  2LMT A;  2NCP A;  3CZ1 A;  2L2E A;  1TUJ A;  3WHU B;  1DGU A;  1F55 A;  1A75 B;  1SL8 A;  2M0R A;  1D1O A;  4INX A;  2JPT A;  3FS7 A;  5GQQ C;  2FCD A;  2K7C A;  1G8I A;  1TNW A;  4R1E A;  1OSA A;  5ER5 A;  5HKY A;  1J7P A;  4MRX A;  4PDZ A;  3BFB A;  1C07 A;  3CZ0 A;  1S5G Y;  1W9Z A;  2MAZ A;  1WRL A;  2F8P A;  1DJX A;  1TOP A;  2Q4U A;  1TN4 A;  3BFH A;  4YI8 A;  1L2O C;  3FE8 A;  4TNC A;  4N1G A;  1K8U A;  3GK1 A;  2CT9 A;  1KK8 B;  1BLQ A;  3F45 A;  1NPQ A;  1U5I A;  1YUU A;  1OMR A;  2KLD A;  2BKH B;  2MRD A;  2R2I A;  3DYE A;  4WQ3 A;  3S0A A;  3GK4 X;  1R6P A;  2FJY A;  2MBX A;  3WHT B;  5K89 A;  3O6B A;  1JC2 A;  5AER A;  3D77 A;  1IJ6 A;  1TCO B;  2L98 A;  3D75 A;  1YRU B;  4PAL A;  2I18 A;  4ETO A;  4QJ4 B;  1DF0 B;  3FWB A;  1CDN A;  1J7R A;  3RM1 A;  1XFU O;  2JWW A;  2WCL A;  2JNX A;  3ZWH A;  2KPH A;  2I94 A;  4DCK A;  2JT8 A;  2ZRT A;  1KQV A;  2GV5 A;  3CS1 A;  5I2L A;  1QIV A;  1AJ4 A;  1PSR A;  1B4C A;  3D0Y A;  5FI6 A;  1M63 B;  1CFD A;  2HPS A;  1DT7 B;  2JC2 A;  1DJZ A;  2KQY A;  3OGN A;  2LUX A;  3S0D A;  2L5Y A;  4NDB A;  1B8C A;  3OBV A;  3VB1 A;  1PRW A;  1QLS A;  1RK9 A;  2H61 C;  2JRF A;  5AFP A;  3OP0 A;  5DKN A;  1Y0V H;  3O2P A;  1CKK A;  5CSI A;  3DF0 A;  3DVE A;  1SCM C;  3PJI A;  3AAK A;  2NXQ A;  3VGO A;  1YUT A;  1YVL A;  2M1U A;  3GOF A;  3KF9 A;  1CMF A;  1JF2 A;  4F0Z B;  1J7O A;  2BL0 B;  2JXC A;  3DZT A;  4IJ7 A;  1UUS A;  1DQE A;  1DC1 A;  3NGV A;  2H2K A;  1KWO C;  1LKJ A;  4JWQ A;  1LA3 A;  1NYA A;  3VRO A;  5JOL A;  1BG1 A;  2AAO A;  1OW4 A;  3VRQ A;  2M9G A;  2M1K B;  1AK8 A;  1S36 A;  3I5G B;  5CSJ A;  1K90 D;  2K2F A;  1NX3 A;  1K96 A;  4PT1 A;  3EVR A;  1GM0 A;  3M0W A;  1JWD A;  3B87 A;  2QAC A;  4NDC A;  1Z2C B;  2HF5 A;  2KQ6 A;  1NWD A;  1C3Z A;  1LIN A;  2EGD A;  2K7D A;  1NUB A;  5G08 A;  3OX5 A;  3D76 A;  1V1G A;  1DMO A;  1BT6 A;  2KBM A;  5TNC A;  2F2O A;  1J1D A;  2NLN A;  1G4Y R;  4PHM A;  1CB1 A;  1KQM C;  2OTG B;  1E8A A;  2MLF C;  5DIC A;  1J7Q A;  4DIR A;  1MWN A;  2WCB A;  2BAP A;  2NZ0 A;  3AAJ A;  4I5N B;  3B88 A;  3ICB A;  3PSR A;  1AJ5 A;  4KYN A;  1SCV A;  1B1G A;  2GGM A;  1KK7 Z;  2Q91 A;  3CLN A;  2M49 B;  5KSZ A;  2LE9 B;  3BXK A;  2KFF A;  2KGR A;  1BU3 A;  1F4Q A;  4M2O A;  1V1F A;  1S6I A;  2KOT A;  3I5H B;  3BUX B;  4P2Y B;  4PHN A;  3JVT C;  1CNP A;  4F7F A;  2ZKM X;  2PAL A;  3D0Y B;  1RWY A;  3L4A A;  4OR9 B;  1QV0 A;  2OS8 C;  1ZOT B;  2JT0 A;  3RLZ A;  4N5X A;  3LK0 A;  2IS9 A;  3FWC A;  4MN0 A;  2L4I A;  4HRG A;  1K94 A;  1SPY A;  2LLS A;  5I8N A;  1KFX S;  2F3Z A;  1VRK A;  4YI9 A;  3NHT A;  2LV7 A;  5DKR A;  3DF0 B;  3FE6 A;  3SG7 A;  1OE9 B;  1TRF A;  1XVJ A;  2CNP A;  5AAN A;  3K21 A;  1UP5 A;  3TDU A;  4NQG A;  2WC6 A;  5FI7 A;  1AVS A;  1ZFS A;  3SJS A;  1DTL A;  2BE4 A;  3CR4 X;  1REC A;  4OV2 A;  1GGZ A;  3QME A;  1SBJ A;  1HT9 A;  1S1E A;  1TTX A;  2BCB A;  2KI4 C;  1KFU L;  1JFK A;  3NSL A;  3B86 A;  2QEO A;  2KLE A;  1IRJ A;  4OZD A;  2BCX A;  1QX5 B;  4JKT A;  1EXR A;  2WCH A;  1QLK A;  1WLM A;  3PAL A;  1Y1X A;  3SS3 A;  1XFX O;  3N7H A;  5I2O A;  4YBH B;  1MUX A;  3R1O A;  1DJH A;  1NSH A;  2ZRS A;  1IWQ A;  2K7B A;  2L51 A;  3A8R A;  5F6T A;  1NX1 A;  2SCP A;  3DVK A;  4NDD A;  1KK8 C;  1ZMZ A;  2LLT A;  1N2D A;  2O60 A;  2KHN A;  1KCY A;  3NXA A;  1TUZ A;  1NX0 A;  1XK4 C;  2FJU B;  1LA0 A;  3KEV A;  1QVI Z;  4I5K A;  2M8U A;  1F54 A;  1ALV A;  3BUO B;  1A03 A;  1TNP A;  5D7F A;  3UO9 A;  3EK7 A;  1IJ5 A;  4GGF A;  2KGB C;  3HCM A;  2CTN A;  4IL1 A;  3SG3 A;  1S26 D;  2E30 A;  2MHH A;  3LK1 A;  3TS5 B;  4M2Q A;  1XO5 A;  3DD4 A;  4P5O E;  1FI5 A;  3EK8 A;  2K60 A;  3NSO A;  2V53 A;  2PVB A;  2WCK A;  4MSP A;  1S6J A;  1IGV A;  4XJK A;  1OOJ A;  4A4C A;  1S3P A;  1JUO A;  1NCX A;  1K9P A;  1X02 A;  1XFR A;  4YRU A;  1KK7 Y;  1XFY O;  2F3Y A;  2TN4 A;  1K93 D;  2BKI B;  2WCJ A;  3E3R A;  2O5G A;  3I5I C;  2LAP A;  4FQT A;  4PCW A;  1MXE A;  4OKH A;  1KSO A;  2KSP A;  4XYN A;  2GTE A;  1OQP A;  2CBL A;  2QPT A;  3Q8I A;  4YGA A;  2LC5 A;  1IH0 A;  4HRE E;  3PM2 A;  2HQ8 A;  2L0P A;  2BL0 C;  2ZFD A;  2F33 A;  5D69 A;  4E68 A;  1IKU A;  3I5F C;  1BF5 A;  1HQV A;  5D3O A;  1DEK A;  1H8B A;  1MR8 A;  2LAN A;  3AKB A;  3OX6 A;  1BMO A;  1K2H A;  1TNQ A;  5AXI A;  3TUY B;  1MF8 B;  1MQ1 A;  1OZO A;  4WQ2 A;  4BY5 A;  1BJF A;  4YGB B;  1YUR A;  5PAL A;  2EC6 B;  3BUM B;  5DKQ A;  1WRK A;  2JT3 A;  2LMU A;  2M7N A;  2L2C A;  2QEB A;  3JTD C;  3L4L A;  1XFV O;  4C0K A;  4GPL B;  2F2P A;  2JU0 A;  3SS4 A;  1QXP A;  1M39 A;  1CDL A;  2QDI A;  1B8R A;  1OMV A;  1QJT A;  2GGZ A;  1TIZ A;  2WC5 A;  2FCE A;  1YTZ C;  2KFG A;  1QWV A;  1EL4 A;  5HLV A;  1EH2 A;  4CLN A;  2OTG C;  3BUN B;  4CFQ A;  2P71 A;  3TZ1 A;  3BOW A;  3DY9 A;  1EJ3 A;  2WC8 A;  1DJI A;  1TCF A;  3PM8 A;  2KI6 D;  1NIW A;  1SCM B;  2MA2 A;  2LVV A;  2EHB A;  4ZCU A;  1U5I B;  3V2L A;  2LHI A;  2LVK A;  1AUI B;  1QAT A;  2BEC A;  2QEV A;  3LCP C;  1M45 A;  2JTZ A;  1SW8 A;  3IQQ A;  3K1E A;  4C0J A;  1RJV A;  3ZNI A;  3DVM A;  2BCA A;  1QX7 A;  3GK2 A;  4GBA A;  4HRH A;  1R2U A;  4AOM A;  1CDM A;  1OMD A;  1J55 A;  1UHI A;  2A4J A;  1XFW O;  3LL8 B;  1G33 A;  2COL B;  4MZK A;  4PHJ A;  1AP4 A;  1FBV A;  4GAO A;  5J3X A;  5FYX A;  1PVA A;  4QJ5 B;  4Q04 A;  1BOD A;  1CLL A;  1OOI X;  1Y1U A;  3SG5 A;  3BFA A;  1SR6 B;  1QVI Y;  4L9M A;  3SIB A;  4GGN A;  2JUL A;  1SRA A;  4USL A;  3NHI A;  3DVJ A;  3PN7 B;  1CM1 A;  1MXL C;  2M7L A;  2OPO A;  1CLM A;  2JPO A;  2KFH A;  2H8V A;  3SG2 A;  1LVC D;  3O4Y A;  3SS5 A;  1WLZ A;  1UHH A;  2CCM A;  2LMV A;  1ODB A;  3EK4 A;  4CID A;  1SKT A;  5FI2 A;  1XK4 A;  2L4H A;  2WND A;  2M97 A;  5CSF A;  1BR1 B;  2LVJ A;  2NCO A;  3CGA A;  3CR5 X;  2ZND A;  3D78 A;  3CAB A;  2QEH A;  3EKH A;  3IVT A;  1SYM A;  4GNK B;  3S0F A;  1GJY A;  3EG5 B;  2L5X B;  1UUR A;  3BYA A;  1IQ3 A;  3D74 A;  3SIA A;  3PAT A;  1A2X A;  1JF0 A;  2G9B A;  2D8N A;  3CYZ A;  3JVT B;  4M2P A;  3BJH A;  2KBI A;  4ORA B;  1H4B A;  4ZCV A;  3KO0 A;  2FOT A;  3TDI A;  2KI6 C;  1SL9 A;  3MSE B;  1F4O A;  4DUQ A;  3PFV A;  1UWO A;  3B6X A;  2MLE C;  1MHO A;  2M3W A;  4MEW A;  3BOW B;  2LP3 A;  1WRZ A;  3LLE A;  4OCI A;  4YGC B;  2K7O A;  3TDZ A;  4C0L A;  2JZI A;  3WXA A;  1CM4 A;  2K61 A;  3RZS A;  3WNX B;  3EKJ A;  3FIA A;  2H61 A;  2LUC A;  1YRT B;  2LP2 A;  2YGU A;  4JQ0 D;  4AQJ A;  2WCM A;  2JNF A;  2P6B B;  3VRR A;  1B9A A;  2B1U A;  4MLW A;  1F71 A;  1A4P A;  3SG6 A;  1JBA A;  3TS5 C;  1SY9 A;  1SNL A;  4PE0 A;  5I2Q A;  1T14 A;  2PSR A;  2AMI A;  3S0E A;  3CDN A;  2JQ6 A;  5CSN A;  2M29 A;  3BUW B;  1RFJ A;  1OOF A;  1WDC B;  1UHN A;  4PE7 A;  5JJG A;  4JD9 A;  2PYQ A;  1PSB A;  1F70 A;  4YGD B;  3L47 A;  2KAX A;  1PAL A;  3H4S E;  3CZT X;  2ZNE A;  1DVI A;  2I2R E;  3O4X A;  1PVB A;  1L2O B;  1EG3 A;  1Y6W A;  2BNX A;  2Y1N A;  4GFT A;  4DS7 A;  1CFP A;  5EL2 A;  1Q80 A;  5I94 A;  5B8I B;  2ERB A;  1DJW A;  2JTT A;  3OB1 B;  3PLF B;  2Y5I A;  2PMY A;  3TUY C;  1KFU S;  3R1V A;  1M46 A;  2WOS A;  2L50 A;  2EC6 C;  1CFF A;  1RRO A;  4N1F A;  1FF1 A;  1W7J B;  4A4B A;  5KTY A;  3I5G C;  1IG5 A;  3S0B A;  4DRW A;  1QAS A;  1TNX A;  3HX4 A;  2LNK A;  1EG4 A;  1K95 A;  1PUL A;  1SK6 D;  2KAY A;  1QV1 A;  5HYD A;  1K9K A;  1C7W A;  2JOJ A;  1KFX L;  4PE1 A;  1LS8 A;  1S6C A;  3I5I B;  5ER4 X;  5HKW A;  1B7T Z;  1DJY A;  1ZAC A;  2JXL A;  4FQO A;  5HL1 A;  1FW4 A;  1N0Y A;  1OOG A;  1L7Z A;  1B47 A;  2LVI A;  1QS7 A;  3DXL A;  2RGI A;  4QJ3 B;  1DEL A;  2ISD A;  2LLU A;  3QRX A;  4GGF C;  3VRP A;  5BPJ A;  1ALW A;  4CFR A;  3I5F B;  1YUS A;  4D1E A;  3S0G A;  3B7A A;  1RTP 1;  1S5G Z;  3O78 A;  1A29 A;  2BBN A;  4ORB B;  1CLB A;  5AEQ A;  1QIW A;  3AKA A;  1KWO B;  1Y1A A;  1SMG A;  2VRG A;  3I5H C;  2DOQ A;  3KHE A;  1IQ5 A;  1N65 A;  4ICB A;  5HKZ A;  1ORG A;  3JTD B;  1SR6 C;  1GGW A;  2HQW A;  3D10 A;  4XJK B;  2ZN8 A; 
#chains in the Genus database with same CATH homology
 3EVV A;  1NX2 A;  1A75 A;  4UPG A;  2KYC A;  3IQO A;  5IBW A;  3PN7 C;  1W7I B;  4MBE A;  2WOR A;  3C1V A;  3KPX A;  1XFZ O;  2LCP A;  3OHM B;  2KAV A;  4MVF A;  3A4U B;  1CDP A;  1KQM B;  2MJW B;  4WRI A;  1JSA A;  2K0J A;  1BOC A;  1CTR A;  4FTG A;  4PHK A;  4HSZ A;  3VRN A;  1B8L A;  1NP8 A;  4PE4 A;  4GUK A;  2WCE A;  2BBM A;  2ZN9 A;  4MZJ A;  5CPV A;  1AHR A;  4OVN F;  2I7A A;  1UHJ A;  1UHK A;  2KDH A;  5HLO A;  3CWG A;  1XA5 A;  1WY9 A;  2BE6 A;  1GQM A;  1J1E A;  1DF0 A;  4MZL A;  2Y1M A;  3BQ3 A;  4ORC B;  1F8H A;  3CR2 A;  1YR5 A;  4BY4 A;  4CPV A;  2CXJ A;  2K8M B;  4AQI A;  1YX7 A;  2PRU A;  4YGE B;  1JFJ A;  1FPW A;  2OS8 B;  2AUC A;  1QX2 A;  2KYF A;  3OB2 B;  1NCZ A;  5KU1 A;  1DJG A;  1DGV A;  2KNE A;  1NCY A;  1YX8 A;  1C7V A;  4MRY A;  2E6W A;  2Y4Q A;  1FI6 A;  3EVU A;  1OZS A;  2K2A A;  3SG4 A;  1ZUZ A;  1K9U A;  1M31 A;  4JPZ B;  3IF7 A;  1KSM A;  4I5L B;  1SL7 A;  2LM5 A;  2SAS A;  2PAS A;  1BR4 B;  1LXF C;  2G2B A;  1PK0 D;  2LHL A;  1XYD A;  1YVH A;  1QTX A;  2HET A;  2KI4 B;  4U8D A;  1B7T Y;  3CTN A;  1CFC A;  3NSI A;  2WCF A;  4I5J A;  3NSK A;  1CMG A;  1WDC C;  2LMT A;  2NCP A;  2L2E A;  3WHU B;  1DGU A;  1F55 A;  1A75 B;  1SL8 A;  2M0R A;  1D1O A;  2JPT A;  3FS7 A;  5GQQ C;  2FCD A;  2K7C A;  1G8I A;  1TNW A;  4R1E A;  1OSA A;  5ER5 A;  5HKY A;  1J7P A;  4MRX A;  4PDZ A;  1C07 A;  1S5G Y;  2MAZ A;  1WRL A;  2F8P A;  1DJX A;  1TOP A;  2Q4U A;  1TN4 A;  4YI8 A;  1L2O C;  4TNC A;  4N1G A;  1K8U A;  3GK1 A;  2CT9 A;  1KK8 B;  1BLQ A;  3F45 A;  1NPQ A;  1U5I A;  1YUU A;  1OMR A;  2R2I A;  2BKH B;  2MRD A;  3PAL A;  4WQ3 A;  3GK4 X;  1R6P A;  2MBX A;  3WHT B;  5K89 A;  3O6B A;  1JC2 A;  5AER A;  1IJ6 A;  1TCO B;  2L98 A;  4PAL A;  1YRU B;  2I18 A;  4ETO A;  4QJ4 B;  1DF0 B;  3FWB A;  1CDN A;  1J7R A;  3RM1 A;  1XFU O;  2JWW A;  2JNX A;  3ZWH A;  2I94 A;  4DCK A;  2JT8 A;  2ZRT A;  1KQV A;  2GV5 A;  3CS1 A;  5I2L A;  1QIV A;  1AJ4 A;  1PSR A;  1B4C A;  3D0Y A;  1M63 B;  1CFD A;  2HPS A;  1DT7 B;  2JC2 A;  1DJZ A;  2KQY A;  2LUX A;  4NDB A;  1B8C A;  1PRW A;  1QLS A;  1RK9 A;  2H61 C;  2JRF A;  5AFP A;  3OP0 A;  5DKN A;  1Y0V H;  3O2P A;  1CKK A;  5CSI A;  3DF0 A;  3DVE A;  1SCM C;  3AAK A;  2NXQ A;  3VGO A;  1YUT A;  1YVL A;  2M1U A;  3GOF A;  3KF9 A;  1CMF A;  1JF2 A;  4F0Z B;  1J7O A;  2BL0 B;  2JXC A;  1UUS A;  2H2K A;  1KWO C;  1LKJ A;  4JWQ A;  1LA3 A;  1NYA A;  3VRO A;  5JOL A;  1BG1 A;  2AAO A;  3VRQ A;  2M9G A;  2M1K B;  1AK8 A;  1S36 A;  3I5G B;  5CSJ A;  1K90 D;  2K2F A;  1NX3 A;  1K96 A;  3EVR A;  3M0W A;  1JWD A;  2QAC A;  4NDC A;  2HF5 A;  2KQ6 A;  1NWD A;  2K7D A;  1LIN A;  2EGD A;  1NUB A;  5G08 A;  3OX5 A;  1V1G A;  1DMO A;  1BT6 A;  2KBM A;  5TNC A;  2F2O A;  1J1D A;  2NLN A;  1G4Y R;  4PHM A;  1CB1 A;  1KQM C;  2OTG B;  1E8A A;  2MLF C;  1J7Q A;  4DIR A;  1MWN A;  2WCB A;  3AAJ A;  2NZ0 A;  4I5N B;  3ICB A;  3PSR A;  1AJ5 A;  1B1G A;  1SCV A;  2GGM A;  1KK7 Z;  2Q91 A;  3CLN A;  2M49 B;  5KSZ A;  2LE9 B;  3BXK A;  2KFF A;  2KGR A;  1BU3 A;  1F4Q A;  4M2O A;  1V1F A;  1S6I A;  2KOT A;  3I5H B;  3BUX B;  4P2Y B;  4PHN A;  3JVT C;  1CNP A;  2ZKM X;  2PAL A;  3D0Y B;  1RWY A;  4OR9 B;  1QV0 A;  2OS8 C;  1ZOT B;  2JT0 A;  3RLZ A;  4N5X A;  3LK0 A;  2IS9 A;  3FWC A;  4MN0 A;  2L4I A;  4HRG A;  1K94 A;  1SPY A;  2LLS A;  5I8N A;  1KFX S;  2F3Z A;  1VRK A;  4YI9 A;  2LV7 A;  5DKR A;  3DF0 B;  3SG7 A;  1OE9 B;  1TRF A;  1XVJ A;  2CNP A;  5AAN A;  3K21 A;  1UP5 A;  3TDU A;  4NQG A;  1AVS A;  1ZFS A;  3SJS A;  1DTL A;  2BE4 A;  3CR4 X;  1REC A;  4OV2 A;  1GGZ A;  1SBJ A;  1HT9 A;  1S1E A;  1TTX A;  2BCB A;  2KI4 C;  1KFU L;  1JFK A;  3NSL A;  1IRJ A;  2BCX A;  1QX5 B;  1EXR A;  1QLK A;  1WLM A;  1Y1X A;  1XFX O;  5I2O A;  4YBH B;  1MUX A;  1DJH A;  1NSH A;  2ZRS A;  1IWQ A;  2K7B A;  2L51 A;  3A8R A;  5F6T A;  1NX1 A;  2SCP A;  3DVK A;  4NDD A;  1KK8 C;  1ZMZ A;  2LLT A;  1N2D A;  2O60 A;  2KHN A;  1KCY A;  3NXA A;  1NX0 A;  1XK4 C;  2FJU B;  1LA0 A;  3KEV A;  1QVI Z;  4I5K A;  2M8U A;  1F54 A;  1ALV A;  3BUO B;  1A03 A;  1TNP A;  5D7F A;  3EK7 A;  1IJ5 A;  4GGF A;  2KGB C;  3HCM A;  2CTN A;  4IL1 A;  3SG3 A;  1S26 D;  2E30 A;  2MHH A;  3LK1 A;  3TS5 B;  4M2Q A;  1XO5 A;  3DD4 A;  4P5O E;  1FI5 A;  3EK8 A;  3NSO A;  2V53 A;  2PVB A;  4MSP A;  1S6J A;  1IGV A;  4XJK A;  1OOJ A;  4A4C A;  1S3P A;  1JUO A;  1NCX A;  1K9P A;  1X02 A;  4YRU A;  1KK7 Y;  1XFY O;  2F3Y A;  2TN4 A;  1K93 D;  2BKI B;  3E3R A;  2O5G A;  3I5I C;  2LAP A;  4PCW A;  1MXE A;  4OKH A;  1KSO A;  2KSP A;  4XYN A;  1OQP A;  2CBL A;  2QPT A;  4YGA A;  1IH0 A;  2LC5 A;  4HRE E;  2HQ8 A;  2L0P A;  2BL0 C;  2ZFD A;  2F33 A;  5D69 A;  4E68 A;  1IKU A;  3I5F C;  1BF5 A;  1HQV A;  1H8B A;  1MR8 A;  2LAN A;  3AKB A;  3OX6 A;  1BMO A;  1K2H A;  1TNQ A;  5AXI A;  3TUY B;  1MF8 B;  1MQ1 A;  1OZO A;  4WQ2 A;  4BY5 A;  1BJF A;  4YGB B;  1YUR A;  5PAL A;  2EC6 B;  3BUM B;  5DKQ A;  1WRK A;  2JT3 A;  2LMU A;  2M7N A;  3JTD C;  1XFV O;  4C0K A;  4GPL B;  2F2P A;  2JU0 A;  1QXP A;  1M39 A;  1CDL A;  1B8R A;  1OMV A;  1QJT A;  2GGZ A;  1TIZ A;  2FCE A;  1YTZ C;  2KFG A;  5HLV A;  1EL4 A;  1EH2 A;  4CLN A;  2OTG C;  3BUN B;  4CFQ A;  3TZ1 A;  3BOW A;  1EJ3 A;  2WC8 A;  1DJI A;  1TCF A;  3PM8 A;  2KI6 D;  1NIW A;  1SCM B;  2MA2 A;  2LVV A;  2EHB A;  4ZCU A;  1U5I B;  2LHI A;  2LVK A;  1AUI B;  1QAT A;  2BEC A;  3LCP C;  1M45 A;  2JTZ A;  1SW8 A;  3IQQ A;  4C0J A;  1RJV A;  3ZNI A;  3DVM A;  2BCA A;  1QX7 A;  3GK2 A;  4GBA A;  4HRH A;  1R2U A;  4AOM A;  1CDM A;  2A4J A;  1OMD A;  1J55 A;  1UHI A;  1XFW O;  3LL8 B;  2COL B;  1G33 A;  4MZK A;  4PHJ A;  1AP4 A;  1FBV A;  4GAO A;  5J3X A;  5FYX A;  1PVA A;  4QJ5 B;  4Q04 A;  1BOD A;  1CLL A;  1Y1U A;  3SG5 A;  4L9M A;  1SR6 B;  1QVI Y;  3SIB A;  4GGN A;  2JUL A;  1SRA A;  4USL A;  3DVJ A;  3PN7 B;  1CM1 A;  1MXL C;  2M7L A;  2OPO A;  1CLM A;  2KFH A;  3SG2 A;  1LVC D;  3O4Y A;  1WLZ A;  1UHH A;  2CCM A;  2LMV A;  1ODB A;  3EK4 A;  4CID A;  1SKT A;  1XK4 A;  2L4H A;  2WND A;  2M97 A;  5CSF A;  1BR1 B;  2LVJ A;  2NCO A;  3CGA A;  3CR5 X;  2ZND A;  3EKH A;  1SYM A;  4GNK B;  1GJY A;  2L5X B;  1UUR A;  3BYA A;  1IQ3 A;  3SIA A;  3PAT A;  1A2X A;  1JF0 A;  2G9B A;  2D8N A;  3JVT B;  4M2P A;  4ORA B;  1H4B A;  2KBI A;  4ZCV A;  3KO0 A;  2FOT A;  3TDI A;  2KI6 C;  1SL9 A;  3MSE B;  1F4O A;  4DUQ A;  3PFV A;  1UWO A;  2MLE C;  1MHO A;  2M3W A;  4MEW A;  3BOW B;  2LP3 A;  1WRZ A;  3LLE A;  4OCI A;  4YGC B;  2K7O A;  3TDZ A;  4C0L A;  2JZI A;  3WXA A;  1CM4 A;  2K61 A;  3WNX B;  3EKJ A;  3FIA A;  2H61 A;  2LUC A;  1YRT B;  2LP2 A;  4JQ0 D;  4AQJ A;  2JNF A;  2P6B B;  3VRR A;  1B9A A;  2B1U A;  4MLW A;  1F71 A;  1A4P A;  3SG6 A;  1JBA A;  3TS5 C;  1SY9 A;  1SNL A;  4PE0 A;  5I2Q A;  2PSR A;  2AMI A;  5CSN A;  2JQ6 A;  2M29 A;  3BUW B;  1RFJ A;  1WDC B;  1UHN A;  4PE7 A;  5JJG A;  1PSB A;  1F70 A;  4YGD B;  2KAX A;  1PAL A;  3H4S E;  3CZT X;  2ZNE A;  1DVI A;  2I2R E;  1PVB A;  1L2O B;  1EG3 A;  1Y6W A;  2Y1N A;  4GFT A;  4DS7 A;  1CFP A;  1Q80 A;  5B8I B;  1DJW A;  2JTT A;  3OB1 B;  3PLF B;  2Y5I A;  2PMY A;  3TUY C;  1KFU S;  1M46 A;  2WOS A;  2L50 A;  2EC6 C;  1CFF A;  1RRO A;  4N1F A;  1FF1 A;  1W7J B;  4A4B A;  5KTY A;  3I5G C;  1IG5 A;  4DRW A;  1QAS A;  1TNX A;  3HX4 A;  2LNK A;  1EG4 A;  1K95 A;  1PUL A;  1SK6 D;  2KAY A;  1QV1 A;  5HYD A;  1K9K A;  1C7W A;  2JOJ A;  1KFX L;  4PE1 A;  1S6C A;  3I5I B;  5ER4 X;  5HKW A;  1B7T Z;  1DJY A;  1ZAC A;  2JXL A;  4FQO A;  1FW4 A;  1N0Y A;  2LVI A;  1L7Z A;  1B47 A;  4QJ3 B;  1QS7 A;  2ISD A;  2RGI A;  2LLU A;  3QRX A;  4GGF C;  3VRP A;  5BPJ A;  1ALW A;  4CFR A;  3I5F B;  1YUS A;  4D1E A;  1RTP 1;  1S5G Z;  3O78 A;  1A29 A;  2BBN A;  4ORB B;  1CLB A;  5AEQ A;  1QIW A;  3AKA A;  1KWO B;  1Y1A A;  1SMG A;  2VRG A;  3I5H C;  2DOQ A;  3KHE A;  1IQ5 A;  1N65 A;  4ICB A;  5HKZ A;  3JTD B;  1SR6 C;  1GGW A;  2HQW A;  3D10 A;  4XJK B;  2ZN8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...