2SASA

Structure of a sarcoplasmic calcium-binding protein from amphioxus refined at 2.4 angstroms resolution
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
185
structure length
185
Chain Sequence
GLNDFQKQKIKFTFDFFLDMNHDGSIQDNDFEDMMTRYKEVNKGSLSDADYKSMQASLEDEWRDLKGRADINKDDVVSWEEYLAMWEKTIATCKSVADLPAWCQNRIPFLFKGMDVSGDGIVDLEEFQNYCKNFQLQCADVPAVYNVITDGGKVTFDLNRYKELYYRLLTSPAADAGNTLMGQKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SARCOPLASMIC CALCIUM-BINDING PROTEIN
publication title Structure of a sarcoplasmic calcium-binding protein from amphioxus refined at 2.4 A resolution.
pubmed doi rcsb
source organism Branchiostoma lanceolatum
molecule tags Calcium-binding protein
total genus 66
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 1993-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2sasA00
2L50A 4DIRA 2MLEC 2IS9A 4QJ4B 1CKKA 3SG6A 1ODBA 2KI4C 1QV1A 2B1UA 3VRPA 1S26D 2OTGC 1PRWA 2LHIA 2ZNDA 3A4UB 4GGFC 3CR2A 3OB2B 2JNXA 1CMFA 1GGWA 2LUXA 5TNCA 2PSRA 5ER4X 1BOCA 1KWOB 2KNEA 1UHHA 4MSPA 1QVIZ 1PK0D 1IGVA 2KOTA 3O78A 3RM1A 4JPZB 4BY5A 1DF0A 1LA0A 1OMRA 1QASA 1SL9A 2GGZA 3JVTC 2V53A 1IJ5A 1AUIB 5HKWA 2K7DA 1TOPA 2M29A 1CFCA 2WC8A 3NXAA 1S3PA 3PFVA 1H4BA 1RTP1 2BL0B 3E3RA 2OS8C 4I5LB 4NDBA 1BJFA 3IF7A 4PHMA 5PALA 3FWBA 3FIAA 5CSIA 2KYFA 1W7IB 2BECA 4BY4A 1CMGA 3I5GB 3CR4X 1R2UA 5KSZA 2LANA 2K2FA 2K7OA 1DJIA 5G08A 1KCYA 1TNPA 1FBVA 4ORAB 1C7WA 3BUWB 3BUOB 4FTGA 1UHIA 1SW8A 3OX6A 5IBWA 2FOTA 2PASA 1XA5A 3ZNIA 3IQOA 1PVAA 1KQMC 1IH0A 2F3ZA 3FS7A 4IL1A 4OR9B 3GK1A 3KPXA 3OHMB 3OP0A 3I5IB 1M46A 4TNCA 4ORCB 2KFGA 5ER5A 3VRNA 1JBAA 2WCBA 3DVJA 1RROA 3EVRA 1CFPA 3NSIA 4CLNA 1L2OB 2KAVA 2D8NA 4MN0A 2KI6C 4DS7A 2LVIA 3GK2A 1LKJA 4PHNA 1W7JB 3DVMA 2Y1MA 1BODA 2K0JA 3DVKA 2M7NA 2JNFA 4ICBA 1F8HA 3TUYC 4I5NB 3HCMA 1YTZC 1PVBA 1U5IB 1NWDA 1B47A 2RGIA 3OX5A 3FWCA 3M0WA 3TDZA 3SG3A 1FF1A 1SR6B 1K94A 2MBXA 2M49B 5CSJA 2H61C 1KK8B 4P5OE 2M1UA 1DJXA 2NCOA 4PDZA 1UP5A 2MRDA 4Q04A 5I2LA 3O6BA 1MF8B 1J7PA 3I5FC 1KFXL 5HYDA 1B7TY 2QACA 1PULA 2EGDA 1FW4A 1B8CA 4D1EA 1S6CA 1YUUA 4USLA 5GQQC 1KQVA 3WNXB 4NDDA 1V1FA 2O60A 2PMYA 1V1GA 3I5HB 1N0YA 1B9AA 2BKHB 3EK4A 1YURA 4WRIA 1LVCD 4OKHA 1XK4C 4MVFA 2KI4B 1NSHA 2OTGB 1TTXA 1NX0A 1WRZA 2FJUB 4JWQA 3DF0A 3SG4A 4UPGA 2BCXA 1Y6WA 2LP2A 4I5JA 3KO0A 1S5GY 1PSRA 2ZNEA 4YBHB 1QTXA 1GQMA 1N65A 4MZLA 4WQ3A 2WCEA 1KK7Y 1Y0VH 1OMVA 1NP8A 2JT3A 3CLNA 3JVTB 2A4JA 5D7FA 2AAOA 1OQPA 2L98A 1DGUA 1IWQA 1BR1B 1YUSA 2WCFA 4OCIA 2KAXA 2OS8B 2ZRSA 1JSAA 1DGVA 4YGCB 2K2AA 2KGRA 1YUTA 3CZTX 3A8RA 1QX5B 3NSKA 1F70A 1A4PA 2DOQA 3DVEA 1EJ3A 2ZN8A 4C0JA 1DTLA 2HQ8A 2JXCA 3AKBA 4FQOA 2L4IA 2K61A 3H4SE 4YGEB 1Q80A 1YX7A 2ZFDA 4MZJA 2MAZA 1SL8A 2M7LA 1IQ3A 1B4CA 4MEWA 2L2EA 1VRKA 1FI5A 1IJ6A 2LUCA 3BOWB 1KQMB 2Q4UA 3PATA 1S1EA 5DKRA 4L9MA 2KBMA 1XFXO 2LLTA 1SK6D 1NCYA 2JRFA 3PLFB 1JUOA 4YGBB 4OVNF 4CFRA 3SIBA 1N2DA 4GNKB 2SCPA 1OE9B 1C7VA 2LHLA 4GBAA 4QJ5B 2CXJA 1UHNA 1HQVA 2LMUA 2P6BB 1UUSA 2I94A 1TNXA 1UHJA 2BKIB 2CT9A 2SASA 1G33A 4GGNA 3TUYB 3WHTB 1YRTB 1MWNA 4YI9A 1CFFA 2JTZA 2LLUA 5K89A 1KFXS 1S6IA 1QJTA 1QS7A 2I7AA 5CSFA 1EXRA 3LL8B 4PE7A 3BUXB 2I18A 1M45A 2R2IA 1EH2A 1ZACA 1KFUL 3I5FB 2MHHA 1SBJA 4HRHA 1CTRA 1YVHA 1QX7A 2CTNA 2PALA 2COLB 1UHKA 2M1KB 3CTNA 1MXLC 2TN4A 5CSNA 3EKJA 1LXFC 2HPSA 3SG2A 1CDMA 4YI8A 4YRUA 1ALWA 1M39A 1XFVO 2WORA 3JTDC 2NCPA 3D0YA 2JOJA 1RK9A 2EC6C 2M9GA 2G2BA 2ZN9A 1CM4A 5AXIA 5JOLA 3KF9A 5HLOA 3NSOA 1K93D 5I8NA 3EK8A 2EHBA 1K90D 1YVLA 1GGZA 2L5XB 1H8BA 3EK7A 2M0RA 1F71A 1SNLA 2BCBA 1MR8A 3F45A 4PCWA 4PE1A 2CCMA 1RECA 2Y5IA 3O4YA 4PE0A 2M3WA 1DVIA 2KGBC 4DUQA 1TRFA 3TDIA 4M2OA 1BT6A 2JWWA 1TIZA 1Y1XA 2FCDA 2M97A 1IG5A 4PHJA 5DKQA 1TN4A 1BR4B 4CFQA 2JC2A 1ALVA 3EKHA 3NSLA 1NCXA 4P2YB 1ZUZA 3EVVA 2JXLA 1DF0B 5HKZA 3SG7A 1XFWO 3AAKA 1BG1A 3D10A 3VROA 2QPTA 3RLZA 4OV2A 2L4HA 2LMTA 4HREE 1HT9A 1PALA 1DT7B 1IQ5A 3PM8A 1B8LA 1TCOB 4C0KA 1B7TZ 3K21A 4HRGA 5B8IB 1SCMC 5I2OA 1D1OA 2F33A 1ZOTB 4NDCA 1LA3A 3HX4A 2JU0A 1PSBA 5J3XA 4ZCUA 5AFPA 1QATA 4YGAA 2JTTA 2KYCA 4GUKA 1WLMA 3CS1A 1SMGA 3QRXA 1E8AA 1OZSA 4I5KA 3ICBA 1CDLA 2BCAA 2LM5A 4A4BA 1JFKA 3WHUB 4F0ZB 3SIAA 4GAOA 4JQ0D 3LCPC 1NPQA 2JPTA 5D69A 1QVIY 4N5XA 3PALA 1U5IA 4PHKA 3TDUA 3VRQA 4ZCVA 4AOMA 3PN7C 1QIVA 1S5GZ 2KAYA 2KQYA 1MHOA 1NX3A 5KU1A 4MZKA 2MA2A 2JT0A 4DCKA 1KK7Z 2F2OA 1OMDA 2JT8A 2MLFC 2WNDA 5CPVA 1Y1UA 1A75A 3BYAA 1QLKA 1CDPA 2JULA 1BLQA 1JC2A 1SRAA 2KHNA 2LVKA 4MLWA 1JFJA 1SKTA 4XJKA 1K9UA 2KDHA 3AAJA 3GK4X 1OZOA 1AK8A 1M63B 1G4YR 1RWYA 2E6WA 3IQQA 2E30A 3OB1B 2MJWB 3D0YB 1A03A 2L51A 2VRGA 2WOSA 4M2PA 1YRUB 2NXQA 1RJVA 1K9PA 2OPOA 5DKNA 2NZ0A 2BE6A 1XFZO 2O5GA 3LLEA 3JTDB 4DRWA 1J55A 3TZ1A 1CFDA 2LV7A 3CWGA 1CB1A 1S36A 3DD4A 4GGFA 4NQGA 2EC6B 1J1DA 2HF5A 1S6JA 1WDCC 3TS5C 1DJYA 1EG3A 1F4OA 1L7ZA 5HLVA 1OOJA 1SY9A 2K7BA 1MUXA 2KQ6A 2PVBA 3BXKA 1NIWA 1QV0A 2LE9B 1AP4A 1QLSA 2K7CA 1WY9A 1A2XA 2M8UA 2ZKMX 3SG5A 2JZIA 4MRXA 1DJZA 4AQJA 3LK0A 3EVUA 2GV5A 1CLMA 4ETOA 5I2QA 2GGMA 4ORBB 1TCFA 1CNPA 1JF2A 2CNPA 1B1GA 1X02A 3DF0B 1IRJA 1KSOA 2BE4A 3BUMB 2LMVA 1KWOC 2F2PA 3VGOA 1MQ1A 3O2PA 3BUNB 4CIDA 3SJSA 2AMIA 5AERA 4M2QA 1XFUO 5JJGA 1J7QA 3C1VA 1QXPA 2BBNA 1SL7A 1WRKA 2KSPA 2G9BA 2BL0C 1DJWA 1YX8A 2AUCA 1MXEA 2LVVA 3BOWA 3WXAA 2LP3A 2LLSA 2ZRTA 5FYXA 1FI6A 1B8RA 1NUBA 1SCMB 3ZWHA 1G8IA 1AJ4A 2LCPA 2ISDA 1XO5A 2LC5A 3I5GC 4YGDB 2K8MB 4MBEA 1K8UA 1ZFSA 2HQWA 1RFJA 4PE4A 1JWDA 1OSAA 1CLLA 1NYAA 1AJ5A 2KBIA 1J7RA 1SPYA 3CR5X 1KSMA 1TNQA 2LAPA 1DMOA 3AKAA 4GPLB 1EG4A 2Q91A 1TNWA 3GOFA 1A75B 2FCEA 1DJGA 4XYNA 1NX1A 3I5IC 3PN7B 2Y4QA 5F6TA 1UURA 2Y1NA 1C07A 4XJKB 4A4CA 1BU3A 1AHRA 1QX2A 1XFYO 1XYDA 2H61A 2L0PA 2LNKA 4R1EA 5HKYA 1BF5A 1CDNA 1K9KA 1K95A 1L2OC 2NLNA 5AEQA 1CLBA 4U8DA 1NX2A 2LVJA 3MSEB 4MRYA 2H2KA 5BPJA 3CGAA 3KHEA 1F55A 1M31A 1F54A 1BMOA 4N1FA 2CBLA 3PSRA 4N1GA 1DJHA 2F3YA 1WRLA 1FPWA 1IKUA 1J1EA 1QIWA 1SR6C 1J7OA 5AANA 2KI6D 1XK4A 1K96A 2PRUA 1KK8C 1Y1AA 2I2RE 2F8PA 2HETA 3VRRA 1XVJA 4E68A 1ZMZA 1GJYA 2BBMA 1A29A 1NCZA 1SYMA 2KFFA 1LINA 1EL4A 1WDCB 3TS5B 1JF0A 4GFTA 3BQ3A 1KFUS 3KEVA 1K2HA 3LK1A 1F4QA 4QJ3B 1YR5A 1CM1A 4WQ2A 4PALA 1R6PA 4AQIA 2JQ6A 1UWOA 2KFHA 4HSZA 1SCVA 1WLZA 4C0LA 4CPVA 5KTYA 3I5HC 1AVSA
chains in the Genus database with same CATH superfamily
2L50A 4DIRA 2MLEC 2IS9A 4QJ4B 1CKKA 3SG6A 1ODBA 2KI4C 1QV1A 2B1UA 3VRPA 1S26D 2OTGC 1PRWA 3S0AA 2LHIA 2ZNDA 4INXA 3A4UB 4GGFC 3CR2A 3OB2B 2JNXA 1CMFA 1GGWA 2LUXA 5TNCA 1C3YA 2PSRA 5ER4X 1BOCA 1KWOB 2KNEA 1UHHA 4MSPA 1QVIZ 1PK0D 1IGVA 2KOTA 3EG5B 3O78A 3RM1A 4JPZB 4BY5A 1DF0A 1LA0A 1OMRA 1QASA 1SL9A 2GGZA 2KLEA 3JVTC 2V53A 1IJ5A 4FQTA 1AUIB 4JKTA 5HKWA 2K7DA 1TOPA 2M29A 1CFCA 2WC8A 3NXAA 1S3PA 3PFVA 1H4BA 1RTP1 2BL0B 1XFRA 3E3RA 2OS8C 4I5LB 4NDBA 1BJFA 3IF7A 2GTEA 4PHMA 5PALA 1J7PA 2BAPA 3FWBA 2PQLA 3FIAA 5CSIA 2KYFA 1W7IB 2BECA 4BY4A 1CMGA 3I5GB 3CR4X 1R2UA 5KSZA 2LANA 2K2FA 2K7OA 1DJIA 5G08A 1KCYA 1TNPA 1FBVA 4ORAB 1C7WA 3CZ2A 3BUWB 3BUOB 4FTGA 1UHIA 1SW8A 5FI6A 3OX6A 3BFHA 2FOTA 5IBWA 2PASA 1XA5A 3ZNIA 4IJ7A 3IQOA 1PVAA 1KQMC 1IH0A 2F3ZA 3FS7A 4IL1A 4OR9B 3GK1A 3KPXA 3OHMB 3OP0A 3I5IB 1M46A 4TNCA 4ORCB 2KFGA 5ER5A 3VRNA 1JBAA 2WCBA 3DVJA 1RROA 3EVRA 3DY9A 1CFPA 5FI7A 3NSIA 4CLNA 1L2OB 2KAVA 2D8NA 4MN0A 2KI6C 4DS7A 2LVIA 3GK2A 1LKJA 4PHNA 1W7JB 3DVMA 2Y1MA 1BODA 3SS3A 2K0JA 3DVKA 2M7NA 2JNFA 1DEKA 3L4AA 4ICBA 3TUYC 1F8HA 4I5NB 2QEHA 3HCMA 1YTZC 1PVBA 1U5IB 3RZSA 1NWDA 1B47A 2RGIA 3OX5A 3FWCA 3M0WA 3TDZA 3SG3A 1FF1A 1SR6B 1SSEB 1K94A 2MBXA 2M49B 5CSJA 2H61C 1KK8B 4JD9A 4P5OE 2M1UA 1DJXA 2NCOA 4PDZA 1P28A 1UP5A 2MRDA 2P71A 2WCMA 1MF8B 3O6BA 3I5FC 1KFXL 4Q04A 1B7TY 5HYDA 4INWA 2QACA 1IIOA 1PULA 2EGDA 1FW4A 1B8CA 1T14A 4D1EA 1S6CA 1YUUA 3DZTA 4USLA 5GQQC 1KQVA 3WNXB 4NDDA 1V1FA 2O60A 2PMYA 1V1GA 3CZ0A 3I5HB 1N0YA 1B9AA 2BKHB 3EK4A 1YURA 4WRIA 1LVCD 4OKHA 1XK4C 4MVFA 2KI4B 1NSHA 2OTGB 1TTXA 1NX0A 1WRZA 2FJUB 4JWQA 3DF0A 3SG4A 4UPGA 2BCXA 1Y6WA 3D75A 2LP2A 4I5JA 3KO0A 1S5GY 1PSRA 2ZNEA 4YBHB 1QTXA 1GQMA 1N65A 4MZLA 4WQ3A 2WCEA 1KK7Y 1Y0VH 1OMVA 1NP8A 3Q8IA 2JT3A 3CLNA 3JVTB 2A4JA 5D7FA 2AAOA 1OQPA 2L98A 1DGUA 3NGVA 1IWQA 1BR1B 3VB1A 1YUSA 3SS4A 2WCFA 4OCIA 2KAXA 2OS8B 3R1OA 2ZRSA 1JSAA 3B6XA 1DGVA 4YGCB 2K2AA 2KGRA 1YUTA 3CZTX 2WCJA 3A8RA 3D73A 1QX5B 3NSKA 1F70A 1A4PA 2DOQA 3DVEA 1EJ3A 2ZN8A 4C0JA 1DTLA 5I94A 2HQ8A 2JXCA 3AKBA 4FQOA 2L4IA 5HL1A 2K61A 3H4SE 4OZDA 4YGEB 3BFAA 1Q80A 1YX7A 2ZFDA 4MZJA 3OBVA 2MAZA 1SL8A 2M7LA 1IQ3A 1B4CA 4MEWA 2L2EA 1VRKA 1FI5A 1IJ6A 2LUCA 3BOWB 1KQMB 2Q4UA 3PATA 1S1EA 5DKRA 4L9MA 2KBMA 2KPHA 1XFXO 2LLTA 1SK6D 1NCYA 2JRFA 3PLFB 1JUOA 4YGBB 4OVNF 1OOGA 4CFRA 3SIBA 1N2DA 4GNKB 2SCPA 1OE9B 3B86A 2KLDA 1C7VA 2LHLA 4GBAA 4QJ5B 2CXJA 1UHNA 1HQVA 2LMUA 2P6BB 1UUSA 2I94A 2WCKA 1TNXA 1UHJA 2BKIB 2CT9A 2SASA 1G33A 4GGNA 3SS5A 3TUYB 3WHTB 2WCLA 3L4LA 1YRTB 1MWNA 3R1PA 4YI9A 1CFFA 2JTZA 2LLUA 5K89A 1KFXS 1S6IA 1QJTA 1QS7A 2I7AA 5CSFA 1EXRA 3LL8B 4PE7A 3BUXB 2I18A 1M45A 2R2IA 1EH2A 1ZACA 1KFUL 3I5FB 2MHHA 1SBJA 4HRHA 1CDNA 1CTRA 1Z2CB 1YVHA 1QX7A 2CTNA 2PALA 1TWOA 1UHKA 2COLB 2M1KB 3CTNA 1MXLC 2TN4A 5CSNA 3EKJA 1LXFC 2HPSA 3SG2A 1OW4A 2QEBA 1CDMA 3S0DA 3BJHA 3D74A 4YI8A 4YRUA 1ALWA 1M39A 1XFVO 2WORA 3JTDC 2NCPA 3D0YA 1C3ZA 2JOJA 2QEOA 1RK9A 2EC6C 2M9GA 2G2BA 2ZN9A 1CM4A 4KYNA 5AXIA 5JOLA 3KF9A 5HLOA 3NSOA 1K93D 5I8NA 3EK8A 2EHBA 2YGUA 1K90D 1YVLA 1GGZA 2L5XB 1H8BA 3EK7A 2M0RA 1F71A 1SNLA 2BCBA 1MR8A 3F45A 4PCWA 4PE1A 2CCMA 1RECA 2Y5IA 3O4YA 4PE0A 2M3WA 1DVIA 2KGBC 2QDIA 1TRFA 4DUQA 3TDIA 4M2OA 1BT6A 2JWWA 1TIZA 1Y1XA 2FCDA 2M97A 1IG5A 4PHJA 5DKQA 1TN4A 1BR4B 3CZ1A 4CFQA 2JC2A 1ALVA 3EKHA 3NSLA 1NCXA 4P2YB 1ZUZA 3EVVA 2JXLA 1DF0B 5HKZA 3SG7A 1XFWO 3AAKA 1BG1A 3D10A 3VROA 2QPTA 1W9ZA 3RLZA 4OV2A 2L4HA 2LMTA 4HREE 1HT9A 1PALA 1DT7B 1ORGA 1IQ5A 3PM8A 1B8LA 1TCOB 4C0KA 1B7TZ 3K21A 4HRGA 5B8IB 1SCMC 5I2OA 1D1OA 2F33A 1ZOTB 4NDCA 5FI2A 1LA3A 2K60A 2JU0A 1PSBA 3HX4A 5J3XA 4ZCUA 5AFPA 1QATA 4YGAA 2JTTA 2KYCA 4GUKA 1WLMA 3CS1A 1SMGA 3QRXA 3BFBA 1E8AA 1OZSA 4I5KA 3ICBA 1CDLA 2BCAA 2LM5A 4A4BA 1JFKA 3WHUB 4F0ZB 3SIAA 4GAOA 4JQ0D 3LCPC 1NPQA 2JPTA 5D69A 3PJIA 1QVIY 3FE8A 3PALA 1U5IA 4N5XA 4PHKA 3TDUA 4ZCVA 3VRQA 3PN7C 4AOMA 1QIVA 1S5GZ 2KAYA 2KQYA 1MHOA 1NX3A 5KU1A 4MZKA 2MA2A 2PYQA 2JT0A 4DCKA 1KK7Z 2F2OA 1OMDA 2JT8A 2MLFC 1DC1A 2WNDA 5CPVA 1Y1UA 1A75A 2L2CA 3BYAA 2WC5A 3UO9A 1QLKA 3D77A 1CDPA 2P70A 2JULA 3CDNA 3FE6A 1BLQA 1JC2A 1SRAA 2KHNA 1TUZA 2LVKA 4MLWA 1JFJA 1SKTA 2ERBA 1K9UA 4XJKA 2KDHA 3AAJA 3CABA 1OZOA 3GK4X 3B88A 1AK8A 1M63B 1G4YR 1RWYA 2E6WA 3IQQA 2E30A 3OB1B 2MJWB 3D0YB 1A03A 2L51A 2VRGA 2WOSA 4M2PA 1YRUB 2NXQA 2QEVA 1RJVA 1K9PA 2OPOA 5DKNA 2NZ0A 4F7FA 2BE6A 3B7AA 3S0FA 1XFZO 2O5GA 3LLEA 3JTDB 3N7HA 4DRWA 1J55A 3TZ1A 1CFDA 2LV7A 3CWGA 1CB1A 1S36A 3DD4A 3DXLA 4GGFA 2EC6B 4NQGA 4PT1A 1J1DA 2HF5A 1S6JA 1WDCC 3TS5C 1DJYA 1EG3A 1F4OA 1L7ZA 5HLVA 1OOJA 1SY9A 2K7BA 1MUXA 1TUJA 2KQ6A 2PVBA 1NIWA 1QV0A 2LE9B 1AP4A 1QLSA 3FE9A 2K7CA 5I2LA 1WY9A 1A2XA 2M8UA 3OGNA 2BNXA 2ZKMX 3SG5A 2JZIA 4MRXA 1DJZA 3D76A 4AQJA 3LK0A 3EVUA 2GV5A 1CLMA 4ETOA 3UNWA 5I2QA 2GGMA 4ORBB 1TCFA 1CNPA 1JF2A 2CNPA 3S0GA 1B1GA 1X02A 3DF0B 1IRJA 1KSOA 3K1EA 2BE4A 3BUMB 3O4XA 2LMVA 1KWOC 2F2PA 3VGOA 1MQ1A 3O2PA 3BUNB 4CIDA 3SJSA 2AMIA 5AERA 3S0EA 1LS8A 4M2QA 1XFUO 1DELA 5JJGA 1J7QA 3C1VA 1QXPA 2BBNA 1SL7A 1OOFA 1WRKA 2KSPA 2G9BA 2BL0C 1DJWA 1YX8A 2AUCA 1MXEA 2LVVA 2WC6A 3BOWA 3WXAA 1OOHA 2LP3A 2LLSA 2ZRTA 3L47A 5FYXA 1B8RA 1NUBA 1FI6A 3IVTA 1SCMB 3CYZA 3ZWHA 1G8IA 1AJ4A 3B87A 2LCPA 2ISDA 1XO5A 2LC5A 3I5GC 4YGDB 1Z4HA 2K8MB 4MBEA 1K8UA 1ZFSA 2HQWA 1RFJA 4PE4A 1JWDA 1OSAA 1CLLA 3BXKA 1NYAA 1AJ5A 2KBIA 1J7RA 1SPYA 3CR5X 1KSMA 1TNQA 2LAPA 3DYEA 3AKAA 5DICA 4GPLB 1DMOA 1EG4A 2Q91A 1GM0A 1TNWA 3GOFA 3QMEA 2WCHA 1A75B 2FCEA 1OOIX 1DJGA 2L5YA 1NX1A 3I5IC 4XYNA 3PN7B 2Y4QA 5D3OA 5F6TA 1UURA 3NHTA 2Y1NA 1C07A 4XJKB 4A4CA 1BU3A 1AHRA 1QX2A 1XFYO 1XYDA 2FJYA 2H61A 2L0PA 2LNKA 4R1EA 5HKYA 1BF5A 1K9KA 1K95A 1L2OC 2NLNA 3PM2A 5AEQA 1CLBA 4U8DA 2JPOA 1NX2A 2LVJA 3MSEB 4MRYA 2H2KA 5BPJA 1QWVA 3R72A 3CGAA 3KHEA 1F55A 1M31A 1F54A 1BMOA 4N1FA 2CBLA 3S0BA 3PSRA 4N1GA 1DJHA 2F3YA 1WRLA 1FPWA 1IKUA 1J1EA 1QIWA 1SR6C 1J7OA 5AANA 2KI6D 1XK4A 1K96A 2PRUA 1KK8C 1Y1AA 2I2RE 3D78A 2F8PA 2HETA 3VRRA 1XVJA 4E68A 1ZMZA 1GJYA 2BBMA 1A29A 1NCZA 1SYMA 2KFFA 1LINA 1EL4A 1WDCB 3TS5B 1JF0A 4GFTA 3BQ3A 1KFUS 3KEVA 3R1VA 3LK1A 5EL2A 3V2LA 1F4QA 1DQEA 1K2HA 3NHIA 2H8VA 4QJ3B 1YR5A 1CM1A 4WQ2A 4PALA 1R6PA 4AQIA 2JQ6A 1UWOA 2KFHA 4HSZA 1SCVA 1WLZA 4C0LA 4CPVA 5KTYA 3I5HC 1AVSA
chains in the Genus database with same CATH topology
2L50A 4DIRA 2MLEC 2IS9A 4QJ4B 1CKKA 3SG6A 1ODBA 2KI4C 1QV1A 2B1UA 3VRPA 1S26D 2OTGC 1PRWA 2LHIA 2ZNDA 3A4UB 4GGFC 3CR2A 3OB2B 2JNXA 1CMFA 1GGWA 2LUXA 5TNCA 2PSRA 5ER4X 1BOCA 1KWOB 2KNEA 1UHHA 4MSPA 1QVIZ 1PK0D 1IGVA 2KOTA 3O78A 3RM1A 4JPZB 4BY5A 1DF0A 1LA0A 1OMRA 1QASA 1SL9A 2GGZA 3JVTC 2V53A 1IJ5A 1AUIB 5HKWA 2K7DA 1TOPA 2M29A 1CFCA 2WC8A 3NXAA 1S3PA 3PFVA 1H4BA 1RTP1 2BL0B 3E3RA 2OS8C 4I5LB 4NDBA 1BJFA 3IF7A 4PHMA 5PALA 3FWBA 3FIAA 5CSIA 2KYFA 1W7IB 2BECA 4BY4A 1CMGA 3I5GB 3CR4X 1R2UA 5KSZA 2LANA 2K2FA 2K7OA 1DJIA 5G08A 1KCYA 1TNPA 1FBVA 4ORAB 1C7WA 3BUWB 3BUOB 4FTGA 1UHIA 1SW8A 3OX6A 5IBWA 2FOTA 2PASA 1XA5A 3ZNIA 3IQOA 1PVAA 1KQMC 1IH0A 2F3ZA 3FS7A 4IL1A 4OR9B 3GK1A 3KPXA 3OHMB 3OP0A 3I5IB 1M46A 4TNCA 4ORCB 2KFGA 5ER5A 3VRNA 1JBAA 2WCBA 3DVJA 1RROA 3EVRA 1CFPA 3NSIA 4CLNA 1L2OB 2KAVA 2D8NA 4MN0A 2KI6C 4DS7A 2LVIA 3GK2A 1LKJA 4PHNA 1W7JB 3DVMA 2Y1MA 1BODA 2K0JA 3DVKA 2M7NA 2JNFA 4ICBA 1F8HA 3TUYC 4I5NB 3HCMA 1YTZC 1PVBA 1U5IB 1NWDA 1B47A 2RGIA 3OX5A 3FWCA 3M0WA 3TDZA 3SG3A 1FF1A 1SR6B 1K94A 2MBXA 2M49B 5CSJA 2H61C 1KK8B 4P5OE 2M1UA 1DJXA 2NCOA 4PDZA 1UP5A 2MRDA 4Q04A 5I2LA 3O6BA 1MF8B 1J7PA 3I5FC 1KFXL 5HYDA 1B7TY 2QACA 1PULA 2EGDA 1FW4A 1B8CA 4D1EA 1S6CA 1YUUA 4USLA 5GQQC 1KQVA 3WNXB 4NDDA 1V1FA 2O60A 2PMYA 1V1GA 3I5HB 1N0YA 1B9AA 2BKHB 3EK4A 1YURA 4WRIA 1LVCD 4OKHA 1XK4C 4MVFA 2KI4B 1NSHA 2OTGB 1TTXA 1NX0A 1WRZA 2FJUB 4JWQA 3DF0A 3SG4A 4UPGA 2BCXA 1Y6WA 2LP2A 4I5JA 3KO0A 1S5GY 1PSRA 2ZNEA 4YBHB 1QTXA 1GQMA 1N65A 4MZLA 4WQ3A 2WCEA 1KK7Y 1Y0VH 1OMVA 1NP8A 2JT3A 3CLNA 3JVTB 2A4JA 5D7FA 2AAOA 1OQPA 2L98A 1DGUA 1IWQA 1BR1B 1YUSA 2WCFA 4OCIA 2KAXA 2OS8B 2ZRSA 1JSAA 1DGVA 4YGCB 2K2AA 2KGRA 1YUTA 3CZTX 3A8RA 1QX5B 3NSKA 1F70A 1A4PA 2DOQA 3DVEA 1EJ3A 2ZN8A 4C0JA 1DTLA 2HQ8A 2JXCA 3AKBA 4FQOA 2L4IA 2K61A 3H4SE 4YGEB 1Q80A 1YX7A 2ZFDA 4MZJA 2MAZA 1SL8A 2M7LA 1IQ3A 1B4CA 4MEWA 2L2EA 1VRKA 1FI5A 1IJ6A 2LUCA 3BOWB 1KQMB 2Q4UA 3PATA 1S1EA 5DKRA 4L9MA 2KBMA 1XFXO 2LLTA 1SK6D 1NCYA 2JRFA 3PLFB 1JUOA 4YGBB 4OVNF 4CFRA 3SIBA 1N2DA 4GNKB 2SCPA 1OE9B 1C7VA 2LHLA 4GBAA 4QJ5B 2CXJA 1UHNA 1HQVA 2LMUA 2P6BB 1UUSA 2I94A 1TNXA 1UHJA 2BKIB 2CT9A 2SASA 1G33A 4GGNA 3TUYB 3WHTB 1YRTB 1MWNA 4YI9A 1CFFA 2JTZA 2LLUA 5K89A 1KFXS 1S6IA 1QJTA 1QS7A 2I7AA 5CSFA 1EXRA 3LL8B 4PE7A 3BUXB 2I18A 1M45A 2R2IA 1EH2A 1ZACA 1KFUL 3I5FB 2MHHA 1SBJA 4HRHA 1CTRA 1YVHA 1QX7A 2CTNA 2PALA 2COLB 1UHKA 2M1KB 3CTNA 1MXLC 2TN4A 5CSNA 3EKJA 1LXFC 2HPSA 3SG2A 1CDMA 4YI8A 4YRUA 1ALWA 1M39A 1XFVO 2WORA 3JTDC 2NCPA 3D0YA 2JOJA 1RK9A 2EC6C 2M9GA 2G2BA 2ZN9A 1CM4A 5AXIA 5JOLA 3KF9A 5HLOA 3NSOA 1K93D 5I8NA 3EK8A 2EHBA 1K90D 1YVLA 1GGZA 2L5XB 1H8BA 3EK7A 2M0RA 1F71A 1SNLA 2BCBA 1MR8A 3F45A 4PCWA 4PE1A 2CCMA 1RECA 2Y5IA 3O4YA 4PE0A 2M3WA 1DVIA 2KGBC 4DUQA 1TRFA 3TDIA 4M2OA 1BT6A 2JWWA 1TIZA 1Y1XA 2FCDA 2M97A 1IG5A 4PHJA 5DKQA 1TN4A 1BR4B 4CFQA 2JC2A 1ALVA 3EKHA 3NSLA 1NCXA 4P2YB 1ZUZA 3EVVA 2JXLA 1DF0B 5HKZA 3SG7A 1XFWO 3AAKA 1BG1A 3D10A 3VROA 2QPTA 3RLZA 4OV2A 2L4HA 2LMTA 4HREE 1HT9A 1PALA 1DT7B 1IQ5A 3PM8A 1B8LA 1TCOB 4C0KA 1B7TZ 3K21A 4HRGA 5B8IB 1SCMC 5I2OA 1D1OA 2F33A 1ZOTB 4NDCA 1LA3A 3HX4A 2JU0A 1PSBA 5J3XA 4ZCUA 5AFPA 1QATA 4YGAA 2JTTA 2KYCA 4GUKA 1WLMA 3CS1A 1SMGA 3QRXA 1E8AA 1OZSA 4I5KA 3ICBA 1CDLA 2BCAA 2LM5A 4A4BA 1JFKA 3WHUB 4F0ZB 3SIAA 4GAOA 4JQ0D 3LCPC 1NPQA 2JPTA 5D69A 1QVIY 4N5XA 3PALA 1U5IA 4PHKA 3TDUA 3VRQA 4ZCVA 4AOMA 3PN7C 1QIVA 1S5GZ 2KAYA 2KQYA 1MHOA 1NX3A 5KU1A 4MZKA 2MA2A 2JT0A 4DCKA 1KK7Z 2F2OA 1OMDA 2JT8A 2MLFC 2WNDA 5CPVA 1Y1UA 1A75A 3BYAA 1QLKA 1CDPA 2JULA 1BLQA 1JC2A 1SRAA 2KHNA 2LVKA 4MLWA 1JFJA 1SKTA 4XJKA 1K9UA 2KDHA 3AAJA 3GK4X 1OZOA 1AK8A 1M63B 1G4YR 1RWYA 2E6WA 3IQQA 2E30A 3OB1B 2MJWB 3D0YB 1A03A 2L51A 2VRGA 2WOSA 4M2PA 1YRUB 2NXQA 1RJVA 1K9PA 2OPOA 5DKNA 2NZ0A 2BE6A 1XFZO 2O5GA 3LLEA 3JTDB 4DRWA 1J55A 3TZ1A 1CFDA 2LV7A 3CWGA 1CB1A 1S36A 3DD4A 4GGFA 4NQGA 2EC6B 1J1DA 2HF5A 1S6JA 1WDCC 3TS5C 1DJYA 1EG3A 1F4OA 1L7ZA 5HLVA 1OOJA 1SY9A 2K7BA 1MUXA 2KQ6A 2PVBA 3BXKA 1NIWA 1QV0A 2LE9B 1AP4A 1QLSA 2K7CA 1WY9A 1A2XA 2M8UA 2ZKMX 3SG5A 2JZIA 4MRXA 1DJZA 4AQJA 3LK0A 3EVUA 2GV5A 1CLMA 4ETOA 5I2QA 2GGMA 4ORBB 1TCFA 1CNPA 1JF2A 2CNPA 1B1GA 1X02A 3DF0B 1IRJA 1KSOA 2BE4A 3BUMB 2LMVA 1KWOC 2F2PA 3VGOA 1MQ1A 3O2PA 3BUNB 4CIDA 3SJSA 2AMIA 5AERA 4M2QA 1XFUO 5JJGA 1J7QA 3C1VA 1QXPA 2BBNA 1SL7A 1WRKA 2KSPA 2G9BA 2BL0C 1DJWA 1YX8A 2AUCA 1MXEA 2LVVA 3BOWA 3WXAA 2LP3A 2LLSA 2ZRTA 5FYXA 1FI6A 1B8RA 1NUBA 1SCMB 3ZWHA 1G8IA 1AJ4A 2LCPA 2ISDA 1XO5A 2LC5A 3I5GC 4YGDB 2K8MB 4MBEA 1K8UA 1ZFSA 2HQWA 1RFJA 4PE4A 1JWDA 1OSAA 1CLLA 1NYAA 1AJ5A 2KBIA 1J7RA 1SPYA 3CR5X 1KSMA 1TNQA 2LAPA 1DMOA 3AKAA 4GPLB 1EG4A 2Q91A 1TNWA 3GOFA 1A75B 2FCEA 1DJGA 4XYNA 1NX1A 3I5IC 3PN7B 2Y4QA 5F6TA 1UURA 2Y1NA 1C07A 4XJKB 4A4CA 1BU3A 1AHRA 1QX2A 1XFYO 1XYDA 2H61A 2L0PA 2LNKA 4R1EA 5HKYA 1BF5A 1CDNA 1K9KA 1K95A 1L2OC 2NLNA 5AEQA 1CLBA 4U8DA 1NX2A 2LVJA 3MSEB 4MRYA 2H2KA 5BPJA 3CGAA 3KHEA 1F55A 1M31A 1F54A 1BMOA 4N1FA 2CBLA 3PSRA 4N1GA 1DJHA 2F3YA 1WRLA 1FPWA 1IKUA 1J1EA 1QIWA 1SR6C 1J7OA 5AANA 2KI6D 1XK4A 1K96A 2PRUA 1KK8C 1Y1AA 2I2RE 2F8PA 2HETA 3VRRA 1XVJA 4E68A 1ZMZA 1GJYA 2BBMA 1A29A 1NCZA 1SYMA 2KFFA 1LINA 1EL4A 1WDCB 3TS5B 1JF0A 4GFTA 3BQ3A 1KFUS 3KEVA 1K2HA 3LK1A 1F4QA 4QJ3B 1YR5A 1CM1A 4WQ2A 4PALA 1R6PA 4AQIA 2JQ6A 1UWOA 2KFHA 4HSZA 1SCVA 1WLZA 4C0LA 4CPVA 5KTYA 3I5HC 1AVSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L50 A;  4DIR A;  2MLE C;  2IS9 A;  4QJ4 B;  1CKK A;  3SG6 A;  1ODB A;  2KI4 C;  1QV1 A;  2B1U A;  3VRP A;  1S26 D;  2OTG C;  1PRW A;  2LHI A;  2ZND A;  3A4U B;  4GGF C;  3CR2 A;  3OB2 B;  2JNX A;  1CMF A;  1GGW A;  2LUX A;  5TNC A;  2PSR A;  5ER4 X;  1BOC A;  1KWO B;  2KNE A;  1UHH A;  4MSP A;  1QVI Z;  1PK0 D;  1IGV A;  2KOT A;  3O78 A;  3RM1 A;  4JPZ B;  4BY5 A;  1DF0 A;  1LA0 A;  1OMR A;  1QAS A;  1SL9 A;  2GGZ A;  3JVT C;  2V53 A;  1IJ5 A;  1AUI B;  5HKW A;  2K7D A;  1TOP A;  2M29 A;  1CFC A;  2WC8 A;  3NXA A;  1S3P A;  3PFV A;  1H4B A;  1RTP 1;  2BL0 B;  3E3R A;  2OS8 C;  4I5L B;  4NDB A;  1BJF A;  3IF7 A;  4PHM A;  5PAL A;  3FWB A;  3FIA A;  5CSI A;  2KYF A;  1W7I B;  2BEC A;  4BY4 A;  1CMG A;  3I5G B;  3CR4 X;  1R2U A;  5KSZ A;  2LAN A;  2K2F A;  2K7O A;  1DJI A;  5G08 A;  1KCY A;  1TNP A;  1FBV A;  4ORA B;  1C7W A;  3BUW B;  3BUO B;  4FTG A;  1UHI A;  1SW8 A;  3OX6 A;  5IBW A;  2FOT A;  2PAS A;  1XA5 A;  3ZNI A;  3IQO A;  1PVA A;  1KQM C;  1IH0 A;  2F3Z A;  3FS7 A;  4IL1 A;  4OR9 B;  3GK1 A;  3KPX A;  3OHM B;  3OP0 A;  3I5I B;  1M46 A;  4TNC A;  4ORC B;  2KFG A;  5ER5 A;  3VRN A;  1JBA A;  2WCB A;  3DVJ A;  1RRO A;  3EVR A;  1CFP A;  3NSI A;  4CLN A;  1L2O B;  2KAV A;  2D8N A;  4MN0 A;  2KI6 C;  4DS7 A;  2LVI A;  3GK2 A;  1LKJ A;  4PHN A;  1W7J B;  3DVM A;  2Y1M A;  1BOD A;  2K0J A;  3DVK A;  2M7N A;  2JNF A;  4ICB A;  1F8H A;  3TUY C;  4I5N B;  3HCM A;  1YTZ C;  1PVB A;  1U5I B;  1NWD A;  1B47 A;  2RGI A;  3OX5 A;  3FWC A;  3M0W A;  3TDZ A;  3SG3 A;  1FF1 A;  1SR6 B;  1K94 A;  2MBX A;  2M49 B;  5CSJ A;  2H61 C;  1KK8 B;  4P5O E;  2M1U A;  1DJX A;  2NCO A;  4PDZ A;  1UP5 A;  2MRD A;  4Q04 A;  5I2L A;  3O6B A;  1MF8 B;  1J7P A;  3I5F C;  1KFX L;  5HYD A;  1B7T Y;  2QAC A;  1PUL A;  2EGD A;  1FW4 A;  1B8C A;  4D1E A;  1S6C A;  1YUU A;  4USL A;  5GQQ C;  1KQV A;  3WNX B;  4NDD A;  1V1F A;  2O60 A;  2PMY A;  1V1G A;  3I5H B;  1N0Y A;  1B9A A;  2BKH B;  3EK4 A;  1YUR A;  4WRI A;  1LVC D;  4OKH A;  1XK4 C;  4MVF A;  2KI4 B;  1NSH A;  2OTG B;  1TTX A;  1NX0 A;  1WRZ A;  2FJU B;  4JWQ A;  3DF0 A;  3SG4 A;  4UPG A;  2BCX A;  1Y6W A;  2LP2 A;  4I5J A;  3KO0 A;  1S5G Y;  1PSR A;  2ZNE A;  4YBH B;  1QTX A;  1GQM A;  1N65 A;  4MZL A;  4WQ3 A;  2WCE A;  1KK7 Y;  1Y0V H;  1OMV A;  1NP8 A;  2JT3 A;  3CLN A;  3JVT B;  2A4J A;  5D7F A;  2AAO A;  1OQP A;  2L98 A;  1DGU A;  1IWQ A;  1BR1 B;  1YUS A;  2WCF A;  4OCI A;  2KAX A;  2OS8 B;  2ZRS A;  1JSA A;  1DGV A;  4YGC B;  2K2A A;  2KGR A;  1YUT A;  3CZT X;  3A8R A;  1QX5 B;  3NSK A;  1F70 A;  1A4P A;  2DOQ A;  3DVE A;  1EJ3 A;  2ZN8 A;  4C0J A;  1DTL A;  2HQ8 A;  2JXC A;  3AKB A;  4FQO A;  2L4I A;  2K61 A;  3H4S E;  4YGE B;  1Q80 A;  1YX7 A;  2ZFD A;  4MZJ A;  2MAZ A;  1SL8 A;  2M7L A;  1IQ3 A;  1B4C A;  4MEW A;  2L2E A;  1VRK A;  1FI5 A;  1IJ6 A;  2LUC A;  3BOW B;  1KQM B;  2Q4U A;  3PAT A;  1S1E A;  5DKR A;  4L9M A;  2KBM A;  1XFX O;  2LLT A;  1SK6 D;  1NCY A;  2JRF A;  3PLF B;  1JUO A;  4YGB B;  4OVN F;  4CFR A;  3SIB A;  1N2D A;  4GNK B;  2SCP A;  1OE9 B;  1C7V A;  2LHL A;  4GBA A;  4QJ5 B;  2CXJ A;  1UHN A;  1HQV A;  2LMU A;  2P6B B;  1UUS A;  2I94 A;  1TNX A;  1UHJ A;  2BKI B;  2CT9 A;  2SAS A;  1G33 A;  4GGN A;  3TUY B;  3WHT B;  1YRT B;  1MWN A;  4YI9 A;  1CFF A;  2JTZ A;  2LLU A;  5K89 A;  1KFX S;  1S6I A;  1QJT A;  1QS7 A;  2I7A A;  5CSF A;  1EXR A;  3LL8 B;  4PE7 A;  3BUX B;  2I18 A;  1M45 A;  2R2I A;  1EH2 A;  1ZAC A;  1KFU L;  3I5F B;  2MHH A;  1SBJ A;  4HRH A;  1CTR A;  1YVH A;  1QX7 A;  2CTN A;  2PAL A;  2COL B;  1UHK A;  2M1K B;  3CTN A;  1MXL C;  2TN4 A;  5CSN A;  3EKJ A;  1LXF C;  2HPS A;  3SG2 A;  1CDM A;  4YI8 A;  4YRU A;  1ALW A;  1M39 A;  1XFV O;  2WOR A;  3JTD C;  2NCP A;  3D0Y A;  2JOJ A;  1RK9 A;  2EC6 C;  2M9G A;  2G2B A;  2ZN9 A;  1CM4 A;  5AXI A;  5JOL A;  3KF9 A;  5HLO A;  3NSO A;  1K93 D;  5I8N A;  3EK8 A;  2EHB A;  1K90 D;  1YVL A;  1GGZ A;  2L5X B;  1H8B A;  3EK7 A;  2M0R A;  1F71 A;  1SNL A;  2BCB A;  1MR8 A;  3F45 A;  4PCW A;  4PE1 A;  2CCM A;  1REC A;  2Y5I A;  3O4Y A;  4PE0 A;  2M3W A;  1DVI A;  2KGB C;  4DUQ A;  1TRF A;  3TDI A;  4M2O A;  1BT6 A;  2JWW A;  1TIZ A;  1Y1X A;  2FCD A;  2M97 A;  1IG5 A;  4PHJ A;  5DKQ A;  1TN4 A;  1BR4 B;  4CFQ A;  2JC2 A;  1ALV A;  3EKH A;  3NSL A;  1NCX A;  4P2Y B;  1ZUZ A;  3EVV A;  2JXL A;  1DF0 B;  5HKZ A;  3SG7 A;  1XFW O;  3AAK A;  1BG1 A;  3D10 A;  3VRO A;  2QPT A;  3RLZ A;  4OV2 A;  2L4H A;  2LMT A;  4HRE E;  1HT9 A;  1PAL A;  1DT7 B;  1IQ5 A;  3PM8 A;  1B8L A;  1TCO B;  4C0K A;  1B7T Z;  3K21 A;  4HRG A;  5B8I B;  1SCM C;  5I2O A;  1D1O A;  2F33 A;  1ZOT B;  4NDC A;  1LA3 A;  3HX4 A;  2JU0 A;  1PSB A;  5J3X A;  4ZCU A;  5AFP A;  1QAT A;  4YGA A;  2JTT A;  2KYC A;  4GUK A;  1WLM A;  3CS1 A;  1SMG A;  3QRX A;  1E8A A;  1OZS A;  4I5K A;  3ICB A;  1CDL A;  2BCA A;  2LM5 A;  4A4B A;  1JFK A;  3WHU B;  4F0Z B;  3SIA A;  4GAO A;  4JQ0 D;  3LCP C;  1NPQ A;  2JPT A;  5D69 A;  1QVI Y;  4N5X A;  3PAL A;  1U5I A;  4PHK A;  3TDU A;  3VRQ A;  4ZCV A;  4AOM A;  3PN7 C;  1QIV A;  1S5G Z;  2KAY A;  2KQY A;  1MHO A;  1NX3 A;  5KU1 A;  4MZK A;  2MA2 A;  2JT0 A;  4DCK A;  1KK7 Z;  2F2O A;  1OMD A;  2JT8 A;  2MLF C;  2WND A;  5CPV A;  1Y1U A;  1A75 A;  3BYA A;  1QLK A;  1CDP A;  2JUL A;  1BLQ A;  1JC2 A;  1SRA A;  2KHN A;  2LVK A;  4MLW A;  1JFJ A;  1SKT A;  4XJK A;  1K9U A;  2KDH A;  3AAJ A;  3GK4 X;  1OZO A;  1AK8 A;  1M63 B;  1G4Y R;  1RWY A;  2E6W A;  3IQQ A;  2E30 A;  3OB1 B;  2MJW B;  3D0Y B;  1A03 A;  2L51 A;  2VRG A;  2WOS A;  4M2P A;  1YRU B;  2NXQ A;  1RJV A;  1K9P A;  2OPO A;  5DKN A;  2NZ0 A;  2BE6 A;  1XFZ O;  2O5G A;  3LLE A;  3JTD B;  4DRW A;  1J55 A;  3TZ1 A;  1CFD A;  2LV7 A;  3CWG A;  1CB1 A;  1S36 A;  3DD4 A;  4GGF A;  4NQG A;  2EC6 B;  1J1D A;  2HF5 A;  1S6J A;  1WDC C;  3TS5 C;  1DJY A;  1EG3 A;  1F4O A;  1L7Z A;  5HLV A;  1OOJ A;  1SY9 A;  2K7B A;  1MUX A;  2KQ6 A;  2PVB A;  3BXK A;  1NIW A;  1QV0 A;  2LE9 B;  1AP4 A;  1QLS A;  2K7C A;  1WY9 A;  1A2X A;  2M8U A;  2ZKM X;  3SG5 A;  2JZI A;  4MRX A;  1DJZ A;  4AQJ A;  3LK0 A;  3EVU A;  2GV5 A;  1CLM A;  4ETO A;  5I2Q A;  2GGM A;  4ORB B;  1TCF A;  1CNP A;  1JF2 A;  2CNP A;  1B1G A;  1X02 A;  3DF0 B;  1IRJ A;  1KSO A;  2BE4 A;  3BUM B;  2LMV A;  1KWO C;  2F2P A;  3VGO A;  1MQ1 A;  3O2P A;  3BUN B;  4CID A;  3SJS A;  2AMI A;  5AER A;  4M2Q A;  1XFU O;  5JJG A;  1J7Q A;  3C1V A;  1QXP A;  2BBN A;  1SL7 A;  1WRK A;  2KSP A;  2G9B A;  2BL0 C;  1DJW A;  1YX8 A;  2AUC A;  1MXE A;  2LVV A;  3BOW A;  3WXA A;  2LP3 A;  2LLS A;  2ZRT A;  5FYX A;  1FI6 A;  1B8R A;  1NUB A;  1SCM B;  3ZWH A;  1G8I A;  1AJ4 A;  2LCP A;  2ISD A;  1XO5 A;  2LC5 A;  3I5G C;  4YGD B;  2K8M B;  4MBE A;  1K8U A;  1ZFS A;  2HQW A;  1RFJ A;  4PE4 A;  1JWD A;  1OSA A;  1CLL A;  1NYA A;  1AJ5 A;  2KBI A;  1J7R A;  1SPY A;  3CR5 X;  1KSM A;  1TNQ A;  2LAP A;  1DMO A;  3AKA A;  4GPL B;  1EG4 A;  2Q91 A;  1TNW A;  3GOF A;  1A75 B;  2FCE A;  1DJG A;  4XYN A;  1NX1 A;  3I5I C;  3PN7 B;  2Y4Q A;  5F6T A;  1UUR A;  2Y1N A;  1C07 A;  4XJK B;  4A4C A;  1BU3 A;  1AHR A;  1QX2 A;  1XFY O;  1XYD A;  2H61 A;  2L0P A;  2LNK A;  4R1E A;  5HKY A;  1BF5 A;  1CDN A;  1K9K A;  1K95 A;  1L2O C;  2NLN A;  5AEQ A;  1CLB A;  4U8D A;  1NX2 A;  2LVJ A;  3MSE B;  4MRY A;  2H2K A;  5BPJ A;  3CGA A;  3KHE A;  1F55 A;  1M31 A;  1F54 A;  1BMO A;  4N1F A;  2CBL A;  3PSR A;  4N1G A;  1DJH A;  2F3Y A;  1WRL A;  1FPW A;  1IKU A;  1J1E A;  1QIW A;  1SR6 C;  1J7O A;  5AAN A;  2KI6 D;  1XK4 A;  1K96 A;  2PRU A;  1KK8 C;  1Y1A A;  2I2R E;  2F8P A;  2HET A;  3VRR A;  1XVJ A;  4E68 A;  1ZMZ A;  1GJY A;  2BBM A;  1A29 A;  1NCZ A;  1SYM A;  2KFF A;  1LIN A;  1EL4 A;  1WDC B;  3TS5 B;  1JF0 A;  4GFT A;  3BQ3 A;  1KFU S;  3KEV A;  1K2H A;  3LK1 A;  1F4Q A;  4QJ3 B;  1YR5 A;  1CM1 A;  4WQ2 A;  4PAL A;  1R6P A;  4AQI A;  2JQ6 A;  1UWO A;  2KFH A;  4HSZ A;  1SCV A;  1WLZ A;  4C0L A;  4CPV A;  5KTY A;  3I5H C;  1AVS A; 
#chains in the Genus database with same CATH topology
 2L50 A;  4DIR A;  2MLE C;  2IS9 A;  4QJ4 B;  1CKK A;  3SG6 A;  1ODB A;  2KI4 C;  1QV1 A;  2B1U A;  3VRP A;  1S26 D;  2OTG C;  1PRW A;  3S0A A;  2LHI A;  2ZND A;  4INX A;  3A4U B;  4GGF C;  3CR2 A;  3OB2 B;  2JNX A;  1CMF A;  1GGW A;  2LUX A;  5TNC A;  1C3Y A;  2PSR A;  5ER4 X;  1BOC A;  1KWO B;  2KNE A;  1UHH A;  4MSP A;  1QVI Z;  1PK0 D;  1IGV A;  2KOT A;  3EG5 B;  3O78 A;  3RM1 A;  4JPZ B;  4BY5 A;  1DF0 A;  1LA0 A;  1OMR A;  1QAS A;  1SL9 A;  2GGZ A;  2KLE A;  3JVT C;  2V53 A;  1IJ5 A;  4FQT A;  1AUI B;  4JKT A;  5HKW A;  2K7D A;  1TOP A;  2M29 A;  1CFC A;  2WC8 A;  3NXA A;  1S3P A;  3PFV A;  1H4B A;  1RTP 1;  2BL0 B;  1XFR A;  3E3R A;  2OS8 C;  4I5L B;  4NDB A;  1BJF A;  3IF7 A;  2GTE A;  4PHM A;  5PAL A;  1J7P A;  2BAP A;  3FWB A;  2PQL A;  3FIA A;  5CSI A;  2KYF A;  1W7I B;  2BEC A;  4BY4 A;  1CMG A;  3I5G B;  3CR4 X;  1R2U A;  5KSZ A;  2LAN A;  2K2F A;  2K7O A;  1DJI A;  5G08 A;  1KCY A;  1TNP A;  1FBV A;  4ORA B;  1C7W A;  3CZ2 A;  3BUW B;  3BUO B;  4FTG A;  1UHI A;  1SW8 A;  5FI6 A;  3OX6 A;  3BFH A;  2FOT A;  5IBW A;  2PAS A;  1XA5 A;  3ZNI A;  4IJ7 A;  3IQO A;  1PVA A;  1KQM C;  1IH0 A;  2F3Z A;  3FS7 A;  4IL1 A;  4OR9 B;  3GK1 A;  3KPX A;  3OHM B;  3OP0 A;  3I5I B;  1M46 A;  4TNC A;  4ORC B;  2KFG A;  5ER5 A;  3VRN A;  1JBA A;  2WCB A;  3DVJ A;  1RRO A;  3EVR A;  3DY9 A;  1CFP A;  5FI7 A;  3NSI A;  4CLN A;  1L2O B;  2KAV A;  2D8N A;  4MN0 A;  2KI6 C;  4DS7 A;  2LVI A;  3GK2 A;  1LKJ A;  4PHN A;  1W7J B;  3DVM A;  2Y1M A;  1BOD A;  3SS3 A;  2K0J A;  3DVK A;  2M7N A;  2JNF A;  1DEK A;  3L4A A;  4ICB A;  3TUY C;  1F8H A;  4I5N B;  2QEH A;  3HCM A;  1YTZ C;  1PVB A;  1U5I B;  3RZS A;  1NWD A;  1B47 A;  2RGI A;  3OX5 A;  3FWC A;  3M0W A;  3TDZ A;  3SG3 A;  1FF1 A;  1SR6 B;  1SSE B;  1K94 A;  2MBX A;  2M49 B;  5CSJ A;  2H61 C;  1KK8 B;  4JD9 A;  4P5O E;  2M1U A;  1DJX A;  2NCO A;  4PDZ A;  1P28 A;  1UP5 A;  2MRD A;  2P71 A;  2WCM A;  1MF8 B;  3O6B A;  3I5F C;  1KFX L;  4Q04 A;  1B7T Y;  5HYD A;  4INW A;  2QAC A;  1IIO A;  1PUL A;  2EGD A;  1FW4 A;  1B8C A;  1T14 A;  4D1E A;  1S6C A;  1YUU A;  3DZT A;  4USL A;  5GQQ C;  1KQV A;  3WNX B;  4NDD A;  1V1F A;  2O60 A;  2PMY A;  1V1G A;  3CZ0 A;  3I5H B;  1N0Y A;  1B9A A;  2BKH B;  3EK4 A;  1YUR A;  4WRI A;  1LVC D;  4OKH A;  1XK4 C;  4MVF A;  2KI4 B;  1NSH A;  2OTG B;  1TTX A;  1NX0 A;  1WRZ A;  2FJU B;  4JWQ A;  3DF0 A;  3SG4 A;  4UPG A;  2BCX A;  1Y6W A;  3D75 A;  2LP2 A;  4I5J A;  3KO0 A;  1S5G Y;  1PSR A;  2ZNE A;  4YBH B;  1QTX A;  1GQM A;  1N65 A;  4MZL A;  4WQ3 A;  2WCE A;  1KK7 Y;  1Y0V H;  1OMV A;  1NP8 A;  3Q8I A;  2JT3 A;  3CLN A;  3JVT B;  2A4J A;  5D7F A;  2AAO A;  1OQP A;  2L98 A;  1DGU A;  3NGV A;  1IWQ A;  1BR1 B;  3VB1 A;  1YUS A;  3SS4 A;  2WCF A;  4OCI A;  2KAX A;  2OS8 B;  3R1O A;  2ZRS A;  1JSA A;  3B6X A;  1DGV A;  4YGC B;  2K2A A;  2KGR A;  1YUT A;  3CZT X;  2WCJ A;  3A8R A;  3D73 A;  1QX5 B;  3NSK A;  1F70 A;  1A4P A;  2DOQ A;  3DVE A;  1EJ3 A;  2ZN8 A;  4C0J A;  1DTL A;  5I94 A;  2HQ8 A;  2JXC A;  3AKB A;  4FQO A;  2L4I A;  5HL1 A;  2K61 A;  3H4S E;  4OZD A;  4YGE B;  3BFA A;  1Q80 A;  1YX7 A;  2ZFD A;  4MZJ A;  3OBV A;  2MAZ A;  1SL8 A;  2M7L A;  1IQ3 A;  1B4C A;  4MEW A;  2L2E A;  1VRK A;  1FI5 A;  1IJ6 A;  2LUC A;  3BOW B;  1KQM B;  2Q4U A;  3PAT A;  1S1E A;  5DKR A;  4L9M A;  2KBM A;  2KPH A;  1XFX O;  2LLT A;  1SK6 D;  1NCY A;  2JRF A;  3PLF B;  1JUO A;  4YGB B;  4OVN F;  1OOG A;  4CFR A;  3SIB A;  1N2D A;  4GNK B;  2SCP A;  1OE9 B;  3B86 A;  2KLD A;  1C7V A;  2LHL A;  4GBA A;  4QJ5 B;  2CXJ A;  1UHN A;  1HQV A;  2LMU A;  2P6B B;  1UUS A;  2I94 A;  2WCK A;  1TNX A;  1UHJ A;  2BKI B;  2CT9 A;  2SAS A;  1G33 A;  4GGN A;  3SS5 A;  3TUY B;  3WHT B;  2WCL A;  3L4L A;  1YRT B;  1MWN A;  3R1P A;  4YI9 A;  1CFF A;  2JTZ A;  2LLU A;  5K89 A;  1KFX S;  1S6I A;  1QJT A;  1QS7 A;  2I7A A;  5CSF A;  1EXR A;  3LL8 B;  4PE7 A;  3BUX B;  2I18 A;  1M45 A;  2R2I A;  1EH2 A;  1ZAC A;  1KFU L;  3I5F B;  2MHH A;  1SBJ A;  4HRH A;  1CDN A;  1CTR A;  1Z2C B;  1YVH A;  1QX7 A;  2CTN A;  2PAL A;  1TWO A;  1UHK A;  2COL B;  2M1K B;  3CTN A;  1MXL C;  2TN4 A;  5CSN A;  3EKJ A;  1LXF C;  2HPS A;  3SG2 A;  1OW4 A;  2QEB A;  1CDM A;  3S0D A;  3BJH A;  3D74 A;  4YI8 A;  4YRU A;  1ALW A;  1M39 A;  1XFV O;  2WOR A;  3JTD C;  2NCP A;  3D0Y A;  1C3Z A;  2JOJ A;  2QEO A;  1RK9 A;  2EC6 C;  2M9G A;  2G2B A;  2ZN9 A;  1CM4 A;  4KYN A;  5AXI A;  5JOL A;  3KF9 A;  5HLO A;  3NSO A;  1K93 D;  5I8N A;  3EK8 A;  2EHB A;  2YGU A;  1K90 D;  1YVL A;  1GGZ A;  2L5X B;  1H8B A;  3EK7 A;  2M0R A;  1F71 A;  1SNL A;  2BCB A;  1MR8 A;  3F45 A;  4PCW A;  4PE1 A;  2CCM A;  1REC A;  2Y5I A;  3O4Y A;  4PE0 A;  2M3W A;  1DVI A;  2KGB C;  2QDI A;  1TRF A;  4DUQ A;  3TDI A;  4M2O A;  1BT6 A;  2JWW A;  1TIZ A;  1Y1X A;  2FCD A;  2M97 A;  1IG5 A;  4PHJ A;  5DKQ A;  1TN4 A;  1BR4 B;  3CZ1 A;  4CFQ A;  2JC2 A;  1ALV A;  3EKH A;  3NSL A;  1NCX A;  4P2Y B;  1ZUZ A;  3EVV A;  2JXL A;  1DF0 B;  5HKZ A;  3SG7 A;  1XFW O;  3AAK A;  1BG1 A;  3D10 A;  3VRO A;  2QPT A;  1W9Z A;  3RLZ A;  4OV2 A;  2L4H A;  2LMT A;  4HRE E;  1HT9 A;  1PAL A;  1DT7 B;  1ORG A;  1IQ5 A;  3PM8 A;  1B8L A;  1TCO B;  4C0K A;  1B7T Z;  3K21 A;  4HRG A;  5B8I B;  1SCM C;  5I2O A;  1D1O A;  2F33 A;  1ZOT B;  4NDC A;  5FI2 A;  1LA3 A;  2K60 A;  2JU0 A;  1PSB A;  3HX4 A;  5J3X A;  4ZCU A;  5AFP A;  1QAT A;  4YGA A;  2JTT A;  2KYC A;  4GUK A;  1WLM A;  3CS1 A;  1SMG A;  3QRX A;  3BFB A;  1E8A A;  1OZS A;  4I5K A;  3ICB A;  1CDL A;  2BCA A;  2LM5 A;  4A4B A;  1JFK A;  3WHU B;  4F0Z B;  3SIA A;  4GAO A;  4JQ0 D;  3LCP C;  1NPQ A;  2JPT A;  5D69 A;  3PJI A;  1QVI Y;  3FE8 A;  3PAL A;  1U5I A;  4N5X A;  4PHK A;  3TDU A;  4ZCV A;  3VRQ A;  3PN7 C;  4AOM A;  1QIV A;  1S5G Z;  2KAY A;  2KQY A;  1MHO A;  1NX3 A;  5KU1 A;  4MZK A;  2MA2 A;  2PYQ A;  2JT0 A;  4DCK A;  1KK7 Z;  2F2O A;  1OMD A;  2JT8 A;  2MLF C;  1DC1 A;  2WND A;  5CPV A;  1Y1U A;  1A75 A;  2L2C A;  3BYA A;  2WC5 A;  3UO9 A;  1QLK A;  3D77 A;  1CDP A;  2P70 A;  2JUL A;  3CDN A;  3FE6 A;  1BLQ A;  1JC2 A;  1SRA A;  2KHN A;  1TUZ A;  2LVK A;  4MLW A;  1JFJ A;  1SKT A;  2ERB A;  1K9U A;  4XJK A;  2KDH A;  3AAJ A;  3CAB A;  1OZO A;  3GK4 X;  3B88 A;  1AK8 A;  1M63 B;  1G4Y R;  1RWY A;  2E6W A;  3IQQ A;  2E30 A;  3OB1 B;  2MJW B;  3D0Y B;  1A03 A;  2L51 A;  2VRG A;  2WOS A;  4M2P A;  1YRU B;  2NXQ A;  2QEV A;  1RJV A;  1K9P A;  2OPO A;  5DKN A;  2NZ0 A;  4F7F A;  2BE6 A;  3B7A A;  3S0F A;  1XFZ O;  2O5G A;  3LLE A;  3JTD B;  3N7H A;  4DRW A;  1J55 A;  3TZ1 A;  1CFD A;  2LV7 A;  3CWG A;  1CB1 A;  1S36 A;  3DD4 A;  3DXL A;  4GGF A;  2EC6 B;  4NQG A;  4PT1 A;  1J1D A;  2HF5 A;  1S6J A;  1WDC C;  3TS5 C;  1DJY A;  1EG3 A;  1F4O A;  1L7Z A;  5HLV A;  1OOJ A;  1SY9 A;  2K7B A;  1MUX A;  1TUJ A;  2KQ6 A;  2PVB A;  1NIW A;  1QV0 A;  2LE9 B;  1AP4 A;  1QLS A;  3FE9 A;  2K7C A;  5I2L A;  1WY9 A;  1A2X A;  2M8U A;  3OGN A;  2BNX A;  2ZKM X;  3SG5 A;  2JZI A;  4MRX A;  1DJZ A;  3D76 A;  4AQJ A;  3LK0 A;  3EVU A;  2GV5 A;  1CLM A;  4ETO A;  3UNW A;  5I2Q A;  2GGM A;  4ORB B;  1TCF A;  1CNP A;  1JF2 A;  2CNP A;  3S0G A;  1B1G A;  1X02 A;  3DF0 B;  1IRJ A;  1KSO A;  3K1E A;  2BE4 A;  3BUM B;  3O4X A;  2LMV A;  1KWO C;  2F2P A;  3VGO A;  1MQ1 A;  3O2P A;  3BUN B;  4CID A;  3SJS A;  2AMI A;  5AER A;  3S0E A;  1LS8 A;  4M2Q A;  1XFU O;  1DEL A;  5JJG A;  1J7Q A;  3C1V A;  1QXP A;  2BBN A;  1SL7 A;  1OOF A;  1WRK A;  2KSP A;  2G9B A;  2BL0 C;  1DJW A;  1YX8 A;  2AUC A;  1MXE A;  2LVV A;  2WC6 A;  3BOW A;  3WXA A;  1OOH A;  2LP3 A;  2LLS A;  2ZRT A;  3L47 A;  5FYX A;  1B8R A;  1NUB A;  1FI6 A;  3IVT A;  1SCM B;  3CYZ A;  3ZWH A;  1G8I A;  1AJ4 A;  3B87 A;  2LCP A;  2ISD A;  1XO5 A;  2LC5 A;  3I5G C;  4YGD B;  1Z4H A;  2K8M B;  4MBE A;  1K8U A;  1ZFS A;  2HQW A;  1RFJ A;  4PE4 A;  1JWD A;  1OSA A;  1CLL A;  3BXK A;  1NYA A;  1AJ5 A;  2KBI A;  1J7R A;  1SPY A;  3CR5 X;  1KSM A;  1TNQ A;  2LAP A;  3DYE A;  3AKA A;  5DIC A;  4GPL B;  1DMO A;  1EG4 A;  2Q91 A;  1GM0 A;  1TNW A;  3GOF A;  3QME A;  2WCH A;  1A75 B;  2FCE A;  1OOI X;  1DJG A;  2L5Y A;  1NX1 A;  3I5I C;  4XYN A;  3PN7 B;  2Y4Q A;  5D3O A;  5F6T A;  1UUR A;  3NHT A;  2Y1N A;  1C07 A;  4XJK B;  4A4C A;  1BU3 A;  1AHR A;  1QX2 A;  1XFY O;  1XYD A;  2FJY A;  2H61 A;  2L0P A;  2LNK A;  4R1E A;  5HKY A;  1BF5 A;  1K9K A;  1K95 A;  1L2O C;  2NLN A;  3PM2 A;  5AEQ A;  1CLB A;  4U8D A;  2JPO A;  1NX2 A;  2LVJ A;  3MSE B;  4MRY A;  2H2K A;  5BPJ A;  1QWV A;  3R72 A;  3CGA A;  3KHE A;  1F55 A;  1M31 A;  1F54 A;  1BMO A;  4N1F A;  2CBL A;  3S0B A;  3PSR A;  4N1G A;  1DJH A;  2F3Y A;  1WRL A;  1FPW A;  1IKU A;  1J1E A;  1QIW A;  1SR6 C;  1J7O A;  5AAN A;  2KI6 D;  1XK4 A;  1K96 A;  2PRU A;  1KK8 C;  1Y1A A;  2I2R E;  3D78 A;  2F8P A;  2HET A;  3VRR A;  1XVJ A;  4E68 A;  1ZMZ A;  1GJY A;  2BBM A;  1A29 A;  1NCZ A;  1SYM A;  2KFF A;  1LIN A;  1EL4 A;  1WDC B;  3TS5 B;  1JF0 A;  4GFT A;  3BQ3 A;  1KFU S;  3KEV A;  3R1V A;  3LK1 A;  5EL2 A;  3V2L A;  1F4Q A;  1DQE A;  1K2H A;  3NHI A;  2H8V A;  4QJ3 B;  1YR5 A;  1CM1 A;  4WQ2 A;  4PAL A;  1R6P A;  4AQI A;  2JQ6 A;  1UWO A;  2KFH A;  4HSZ A;  1SCV A;  1WLZ A;  4C0L A;  4CPV A;  5KTY A;  3I5H C;  1AVS A; 
#chains in the Genus database with same CATH homology
 2L50 A;  4DIR A;  2MLE C;  2IS9 A;  4QJ4 B;  1CKK A;  3SG6 A;  1ODB A;  2KI4 C;  1QV1 A;  2B1U A;  3VRP A;  1S26 D;  2OTG C;  1PRW A;  2LHI A;  2ZND A;  3A4U B;  4GGF C;  3CR2 A;  3OB2 B;  2JNX A;  1CMF A;  1GGW A;  2LUX A;  5TNC A;  2PSR A;  5ER4 X;  1BOC A;  1KWO B;  2KNE A;  1UHH A;  4MSP A;  1QVI Z;  1PK0 D;  1IGV A;  2KOT A;  3O78 A;  3RM1 A;  4JPZ B;  4BY5 A;  1DF0 A;  1LA0 A;  1OMR A;  1QAS A;  1SL9 A;  2GGZ A;  3JVT C;  2V53 A;  1IJ5 A;  1AUI B;  5HKW A;  2K7D A;  1TOP A;  2M29 A;  1CFC A;  2WC8 A;  3NXA A;  1S3P A;  3PFV A;  1H4B A;  1RTP 1;  2BL0 B;  3E3R A;  2OS8 C;  4I5L B;  4NDB A;  1BJF A;  3IF7 A;  4PHM A;  5PAL A;  3FWB A;  3FIA A;  5CSI A;  2KYF A;  1W7I B;  2BEC A;  4BY4 A;  1CMG A;  3I5G B;  3CR4 X;  1R2U A;  5KSZ A;  2LAN A;  2K2F A;  2K7O A;  1DJI A;  5G08 A;  1KCY A;  1TNP A;  1FBV A;  4ORA B;  1C7W A;  3BUW B;  3BUO B;  4FTG A;  1UHI A;  1SW8 A;  3OX6 A;  5IBW A;  2FOT A;  2PAS A;  1XA5 A;  3ZNI A;  3IQO A;  1PVA A;  1KQM C;  1IH0 A;  2F3Z A;  3FS7 A;  4IL1 A;  4OR9 B;  3GK1 A;  3KPX A;  3OHM B;  3OP0 A;  3I5I B;  1M46 A;  4TNC A;  4ORC B;  2KFG A;  5ER5 A;  3VRN A;  1JBA A;  2WCB A;  3DVJ A;  1RRO A;  3EVR A;  1CFP A;  3NSI A;  4CLN A;  1L2O B;  2KAV A;  2D8N A;  4MN0 A;  2KI6 C;  4DS7 A;  2LVI A;  3GK2 A;  1LKJ A;  4PHN A;  1W7J B;  3DVM A;  2Y1M A;  1BOD A;  2K0J A;  3DVK A;  2M7N A;  2JNF A;  4ICB A;  1F8H A;  3TUY C;  4I5N B;  3HCM A;  1YTZ C;  1PVB A;  1U5I B;  1NWD A;  1B47 A;  2RGI A;  3OX5 A;  3FWC A;  3M0W A;  3TDZ A;  3SG3 A;  1FF1 A;  1SR6 B;  1K94 A;  2MBX A;  2M49 B;  5CSJ A;  2H61 C;  1KK8 B;  4P5O E;  2M1U A;  1DJX A;  2NCO A;  4PDZ A;  1UP5 A;  2MRD A;  4Q04 A;  5I2L A;  3O6B A;  1MF8 B;  1J7P A;  3I5F C;  1KFX L;  5HYD A;  1B7T Y;  2QAC A;  1PUL A;  2EGD A;  1FW4 A;  1B8C A;  4D1E A;  1S6C A;  1YUU A;  4USL A;  5GQQ C;  1KQV A;  3WNX B;  4NDD A;  1V1F A;  2O60 A;  2PMY A;  1V1G A;  3I5H B;  1N0Y A;  1B9A A;  2BKH B;  3EK4 A;  1YUR A;  4WRI A;  1LVC D;  4OKH A;  1XK4 C;  4MVF A;  2KI4 B;  1NSH A;  2OTG B;  1TTX A;  1NX0 A;  1WRZ A;  2FJU B;  4JWQ A;  3DF0 A;  3SG4 A;  4UPG A;  2BCX A;  1Y6W A;  2LP2 A;  4I5J A;  3KO0 A;  1S5G Y;  1PSR A;  2ZNE A;  4YBH B;  1QTX A;  1GQM A;  1N65 A;  4MZL A;  4WQ3 A;  2WCE A;  1KK7 Y;  1Y0V H;  1OMV A;  1NP8 A;  2JT3 A;  3CLN A;  3JVT B;  2A4J A;  5D7F A;  2AAO A;  1OQP A;  2L98 A;  1DGU A;  1IWQ A;  1BR1 B;  1YUS A;  2WCF A;  4OCI A;  2KAX A;  2OS8 B;  2ZRS A;  1JSA A;  1DGV A;  4YGC B;  2K2A A;  2KGR A;  1YUT A;  3CZT X;  3A8R A;  1QX5 B;  3NSK A;  1F70 A;  1A4P A;  2DOQ A;  3DVE A;  1EJ3 A;  2ZN8 A;  4C0J A;  1DTL A;  2HQ8 A;  2JXC A;  3AKB A;  4FQO A;  2L4I A;  2K61 A;  3H4S E;  4YGE B;  1Q80 A;  1YX7 A;  2ZFD A;  4MZJ A;  2MAZ A;  1SL8 A;  2M7L A;  1IQ3 A;  1B4C A;  4MEW A;  2L2E A;  1VRK A;  1FI5 A;  1IJ6 A;  2LUC A;  3BOW B;  1KQM B;  2Q4U A;  3PAT A;  1S1E A;  5DKR A;  4L9M A;  2KBM A;  1XFX O;  2LLT A;  1SK6 D;  1NCY A;  2JRF A;  3PLF B;  1JUO A;  4YGB B;  4OVN F;  4CFR A;  3SIB A;  1N2D A;  4GNK B;  2SCP A;  1OE9 B;  1C7V A;  2LHL A;  4GBA A;  4QJ5 B;  2CXJ A;  1UHN A;  1HQV A;  2LMU A;  2P6B B;  1UUS A;  2I94 A;  1TNX A;  1UHJ A;  2BKI B;  2CT9 A;  2SAS A;  1G33 A;  4GGN A;  3TUY B;  3WHT B;  1YRT B;  1MWN A;  4YI9 A;  1CFF A;  2JTZ A;  2LLU A;  5K89 A;  1KFX S;  1S6I A;  1QJT A;  1QS7 A;  2I7A A;  5CSF A;  1EXR A;  3LL8 B;  4PE7 A;  3BUX B;  2I18 A;  1M45 A;  2R2I A;  1EH2 A;  1ZAC A;  1KFU L;  3I5F B;  2MHH A;  1SBJ A;  4HRH A;  1CTR A;  1YVH A;  1QX7 A;  2CTN A;  2PAL A;  2COL B;  1UHK A;  2M1K B;  3CTN A;  1MXL C;  2TN4 A;  5CSN A;  3EKJ A;  1LXF C;  2HPS A;  3SG2 A;  1CDM A;  4YI8 A;  4YRU A;  1ALW A;  1M39 A;  1XFV O;  2WOR A;  3JTD C;  2NCP A;  3D0Y A;  2JOJ A;  1RK9 A;  2EC6 C;  2M9G A;  2G2B A;  2ZN9 A;  1CM4 A;  5AXI A;  5JOL A;  3KF9 A;  5HLO A;  3NSO A;  1K93 D;  5I8N A;  3EK8 A;  2EHB A;  1K90 D;  1YVL A;  1GGZ A;  2L5X B;  1H8B A;  3EK7 A;  2M0R A;  1F71 A;  1SNL A;  2BCB A;  1MR8 A;  3F45 A;  4PCW A;  4PE1 A;  2CCM A;  1REC A;  2Y5I A;  3O4Y A;  4PE0 A;  2M3W A;  1DVI A;  2KGB C;  4DUQ A;  1TRF A;  3TDI A;  4M2O A;  1BT6 A;  2JWW A;  1TIZ A;  1Y1X A;  2FCD A;  2M97 A;  1IG5 A;  4PHJ A;  5DKQ A;  1TN4 A;  1BR4 B;  4CFQ A;  2JC2 A;  1ALV A;  3EKH A;  3NSL A;  1NCX A;  4P2Y B;  1ZUZ A;  3EVV A;  2JXL A;  1DF0 B;  5HKZ A;  3SG7 A;  1XFW O;  3AAK A;  1BG1 A;  3D10 A;  3VRO A;  2QPT A;  3RLZ A;  4OV2 A;  2L4H A;  2LMT A;  4HRE E;  1HT9 A;  1PAL A;  1DT7 B;  1IQ5 A;  3PM8 A;  1B8L A;  1TCO B;  4C0K A;  1B7T Z;  3K21 A;  4HRG A;  5B8I B;  1SCM C;  5I2O A;  1D1O A;  2F33 A;  1ZOT B;  4NDC A;  1LA3 A;  3HX4 A;  2JU0 A;  1PSB A;  5J3X A;  4ZCU A;  5AFP A;  1QAT A;  4YGA A;  2JTT A;  2KYC A;  4GUK A;  1WLM A;  3CS1 A;  1SMG A;  3QRX A;  1E8A A;  1OZS A;  4I5K A;  3ICB A;  1CDL A;  2BCA A;  2LM5 A;  4A4B A;  1JFK A;  3WHU B;  4F0Z B;  3SIA A;  4GAO A;  4JQ0 D;  3LCP C;  1NPQ A;  2JPT A;  5D69 A;  1QVI Y;  4N5X A;  3PAL A;  1U5I A;  4PHK A;  3TDU A;  3VRQ A;  4ZCV A;  4AOM A;  3PN7 C;  1QIV A;  1S5G Z;  2KAY A;  2KQY A;  1MHO A;  1NX3 A;  5KU1 A;  4MZK A;  2MA2 A;  2JT0 A;  4DCK A;  1KK7 Z;  2F2O A;  1OMD A;  2JT8 A;  2MLF C;  2WND A;  5CPV A;  1Y1U A;  1A75 A;  3BYA A;  1QLK A;  1CDP A;  2JUL A;  1BLQ A;  1JC2 A;  1SRA A;  2KHN A;  2LVK A;  4MLW A;  1JFJ A;  1SKT A;  4XJK A;  1K9U A;  2KDH A;  3AAJ A;  3GK4 X;  1OZO A;  1AK8 A;  1M63 B;  1G4Y R;  1RWY A;  2E6W A;  3IQQ A;  2E30 A;  3OB1 B;  2MJW B;  3D0Y B;  1A03 A;  2L51 A;  2VRG A;  2WOS A;  4M2P A;  1YRU B;  2NXQ A;  1RJV A;  1K9P A;  2OPO A;  5DKN A;  2NZ0 A;  2BE6 A;  1XFZ O;  2O5G A;  3LLE A;  3JTD B;  4DRW A;  1J55 A;  3TZ1 A;  1CFD A;  2LV7 A;  3CWG A;  1CB1 A;  1S36 A;  3DD4 A;  4GGF A;  4NQG A;  2EC6 B;  1J1D A;  2HF5 A;  1S6J A;  1WDC C;  3TS5 C;  1DJY A;  1EG3 A;  1F4O A;  1L7Z A;  5HLV A;  1OOJ A;  1SY9 A;  2K7B A;  1MUX A;  2KQ6 A;  2PVB A;  3BXK A;  1NIW A;  1QV0 A;  2LE9 B;  1AP4 A;  1QLS A;  2K7C A;  1WY9 A;  1A2X A;  2M8U A;  2ZKM X;  3SG5 A;  2JZI A;  4MRX A;  1DJZ A;  4AQJ A;  3LK0 A;  3EVU A;  2GV5 A;  1CLM A;  4ETO A;  5I2Q A;  2GGM A;  4ORB B;  1TCF A;  1CNP A;  1JF2 A;  2CNP A;  1B1G A;  1X02 A;  3DF0 B;  1IRJ A;  1KSO A;  2BE4 A;  3BUM B;  2LMV A;  1KWO C;  2F2P A;  3VGO A;  1MQ1 A;  3O2P A;  3BUN B;  4CID A;  3SJS A;  2AMI A;  5AER A;  4M2Q A;  1XFU O;  5JJG A;  1J7Q A;  3C1V A;  1QXP A;  2BBN A;  1SL7 A;  1WRK A;  2KSP A;  2G9B A;  2BL0 C;  1DJW A;  1YX8 A;  2AUC A;  1MXE A;  2LVV A;  3BOW A;  3WXA A;  2LP3 A;  2LLS A;  2ZRT A;  5FYX A;  1FI6 A;  1B8R A;  1NUB A;  1SCM B;  3ZWH A;  1G8I A;  1AJ4 A;  2LCP A;  2ISD A;  1XO5 A;  2LC5 A;  3I5G C;  4YGD B;  2K8M B;  4MBE A;  1K8U A;  1ZFS A;  2HQW A;  1RFJ A;  4PE4 A;  1JWD A;  1OSA A;  1CLL A;  1NYA A;  1AJ5 A;  2KBI A;  1J7R A;  1SPY A;  3CR5 X;  1KSM A;  1TNQ A;  2LAP A;  1DMO A;  3AKA A;  4GPL B;  1EG4 A;  2Q91 A;  1TNW A;  3GOF A;  1A75 B;  2FCE A;  1DJG A;  4XYN A;  1NX1 A;  3I5I C;  3PN7 B;  2Y4Q A;  5F6T A;  1UUR A;  2Y1N A;  1C07 A;  4XJK B;  4A4C A;  1BU3 A;  1AHR A;  1QX2 A;  1XFY O;  1XYD A;  2H61 A;  2L0P A;  2LNK A;  4R1E A;  5HKY A;  1BF5 A;  1CDN A;  1K9K A;  1K95 A;  1L2O C;  2NLN A;  5AEQ A;  1CLB A;  4U8D A;  1NX2 A;  2LVJ A;  3MSE B;  4MRY A;  2H2K A;  5BPJ A;  3CGA A;  3KHE A;  1F55 A;  1M31 A;  1F54 A;  1BMO A;  4N1F A;  2CBL A;  3PSR A;  4N1G A;  1DJH A;  2F3Y A;  1WRL A;  1FPW A;  1IKU A;  1J1E A;  1QIW A;  1SR6 C;  1J7O A;  5AAN A;  2KI6 D;  1XK4 A;  1K96 A;  2PRU A;  1KK8 C;  1Y1A A;  2I2R E;  2F8P A;  2HET A;  3VRR A;  1XVJ A;  4E68 A;  1ZMZ A;  1GJY A;  2BBM A;  1A29 A;  1NCZ A;  1SYM A;  2KFF A;  1LIN A;  1EL4 A;  1WDC B;  3TS5 B;  1JF0 A;  4GFT A;  3BQ3 A;  1KFU S;  3KEV A;  1K2H A;  3LK1 A;  1F4Q A;  4QJ3 B;  1YR5 A;  1CM1 A;  4WQ2 A;  4PAL A;  1R6P A;  4AQI A;  2JQ6 A;  1UWO A;  2KFH A;  4HSZ A;  1SCV A;  1WLZ A;  4C0L A;  4CPV A;  5KTY A;  3I5H C;  1AVS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...