2SASA

Structure of a sarcoplasmic calcium-binding protein from amphioxus refined at 2.4 angstroms resolution
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
185
structure length
185
Chain Sequence
GLNDFQKQKIKFTFDFFLDMNHDGSIQDNDFEDMMTRYKEVNKGSLSDADYKSMQASLEDEWRDLKGRADINKDDVVSWEEYLAMWEKTIATCKSVADLPAWCQNRIPFLFKGMDVSGDGIVDLEEFQNYCKNFQLQCADVPAVYNVITDGGKVTFDLNRYKELYYRLLTSPAADAGNTLMGQKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SARCOPLASMIC CALCIUM-BINDING PROTEIN
publication title Structure of a sarcoplasmic calcium-binding protein from amphioxus refined at 2.4 A resolution.
pubmed doi rcsb
source organism Branchiostoma lanceolatum
molecule tags Calcium-binding protein
total genus 66
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 1993-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2sasA00
1BU3A 4N1FA 4QJ4B 1KK8B 4MRXA 3DF0A 3SIAA 3BQ3A 4MZLA 4OVNF 3DVKA 1CTRA 2JTZA 1SCMB 1UP5A 2K7CA 2ZNEA 4OKHA 1BT6A 2O60A 2SCPA 2FJUB 2ZN9A 1OE9B 2EGDA 4GGFA 1BLQA 1K94A 1LXFC 4TNCA 3CR2A 1CB1A 2E6WA 1QVIY 1QX5B 5CSJA 3CGAA 1M31A 1TNQA 1UUSA 1CM4A 3I5HC 4PHMA 4YGEB 4XYNA 3GK4X 3TUYB 1K95A 3OX5A 3EK7A 5F6TA 1FBVA 2HQWA 1SRAA 2K2FA 3CWGA 4I5LB 5G08A 1KFXS 1K9UA 1ODBA 1Y1AA 2FOTA 2KFGA 1XYDA 1PALA 3D0YB 1KQMC 2LLSA 5AEQA 4OCIA 1EXRA 2COLB 3MSEB 2OTGC 4WRIA 1CDMA 1RROA 1OMDA 5B8IB 2LVKA 3WNXB 5JOLA 1F55A 1XO5A 1A4PA 2L0PA 4YBHB 4AOMA 3DVEA 1B4CA 2K0JA 2JTTA 2LC5A 1DJIA 1CFFA 4N5XA 1CLMA 1H4BA 3KPXA 4YGBB 1DJYA 1PRWA 1WY9A 1M46A 2ZRTA 1MQ1A 2GGMA 1XFZO 2CTNA 4JWQA 2P6BB 4PE7A 2PVBA 3PM8A 4NDBA 1VRKA 1NWDA 1QATA 3C1VA 4R1EA 5DKRA 4ZCUA 2EC6B 2I2RE 1A75A 3TS5C 4QJ3B 1QS7A 1YX8A 4M2QA 4NQGA 5D69A 1AUIB 1QIVA 4PE4A 1OMRA 4PDZA 1G33A 2KAVA 2ZRSA 2JQ6A 4GNKB 2QPTA 4MN0A 2M97A 1KCYA 2LCPA 1G8IA 2F8PA 4GAOA 1EG3A 1AJ5A 1QV1A 2D8NA 3BYAA 1MWNA 1DJXA 1M63B 1WRKA 1DF0A 1UURA 3I5HB 2M7LA 2K7BA 1BOCA 2JXCA 1OMVA 1S3PA 2JNFA 1IJ6A 4PHKA 2I7AA 1B7TY 1OZSA 1BR1B 3CS1A 1WRLA 2AMIA 1IQ5A 1NCYA 1CNPA 1TNPA 1RFJA 2L5XB 2KAXA 2KBIA 1DJHA 1LINA 1TNWA 2KI4C 3KF9A 2WORA 2MLFC 1TIZA 3D0YA 3TDIA 1KSOA 1SKTA 3KHEA 2OTGB 4BY4A 2LNKA 2LVVA 2G2BA 1QLSA 1SBJA 4D1EA 5KU1A 1FI6A 1SK6D 2Y4QA 2M49B 1C7WA 3NSIA 5IBWA 4NDCA 1E8AA 1XVJA 1WDCC 4P2YB 1B47A 5HKYA 5AXIA 3A8RA 1QTXA 4PHJA 3E3RA 4ORAB 2Q91A 2L4IA 2BECA 2KYFA 5I2QA 2M9GA 3FIAA 4JPZB 3CR4X 3TS5B 2GGZA 4YGCB 1DVIA 1G4YR 2HF5A 1J1DA 3K21A 5HKZA 2MLEC 1B1GA 1KK7Y 2LE9B 1XK4C 3EK8A 1KWOC 3CZTX 2LAPA 3IQQA 4MRYA 2KSPA 2Y1MA 2LVIA 1UHNA 3FS7A 3FWBA 2BL0C 5CPVA 4C0LA 2H61A 3DVJA 3SG2A 1AVSA 1PULA 2KFHA 2KAYA 3D10A 3HX4A 1SL9A 4DUQA 4PALA 4GBAA 1LA3A 2BCAA 3BUOB 1QLKA 4A4BA 1HT9A 3I5GC 4GFTA 1YVLA 5PALA 4ORCB 4Q04A 1IWQA 2ZKMX 3AKBA 1CFDA 1BMOA 1TRFA 2NXQA 3CTNA 2LM5A 3TZ1A 5K89A 2PMYA 3PN7C 1CDNA 2GV5A 3BOWA 3TDZA 1K9PA 1MHOA 4HRHA 5FYXA 2Y1NA 1Y6WA 1DJZA 2WCBA 2BCXA 4GGNA 1J7PA 1Y0VH 2LUXA 2NCOA 1RJVA 4CIDA 5BPJA 3ZWHA 5I2OA 2AUCA 3LK1A 1UHIA 2MAZA 2RGIA 1TNXA 3SG7A 1B8CA 1SCVA 2PSRA 1HQVA 3BUWB 1NIWA 3AAKA 1UHKA 1XFVO 2QACA 1V1FA 2EHBA 4USLA 2MRDA 1WDCB 2JZIA 3SJSA 3VRNA 3H4SE 1K9KA 5DKQA 1QVIZ 4YI9A 3VRPA 3A4UB 1V1GA 2TN4A 1FW4A 4YRUA 4M2PA 1CDPA 1CDLA 3BUMB 4CFRA 1UHJA 1IH0A 1SY9A 1M39A 1W7JB 4GGFC 1ALWA 1QASA 1IQ3A 3SG6A 2IS9A 3I5FC 1U5IB 2L50A 3WXAA 2OPOA 3LK0A 2F2OA 3EKJA 1KWOB 1SMGA 2KGBC 1S6CA 3OX6A 2BL0B 5KSZA 3EK4A 5HLOA 4YGDB 3PLFB 4YI8A 1YR5A 1K2HA 2E30A 2JU0A 5J3XA 1EH2A 1FF1A 4MEWA 3BUXB 1NPQA 2KYCA 4N1GA 3PALA 4MLWA 5AANA 3I5GB 1XFUO 1F8HA 2V53A 2LHIA 3EVVA 4PE1A 1B8LA 3WHTB 3OHMB 2K61A 3RM1A 4YGAA 3PN7B 1BR4B 2JOJA 1SR6C 2AAOA 1S6JA 4FTGA 2ZFDA 1S26D 1S5GY 1MXEA 1PSBA 2PASA 2MJWB 1FPWA 3DD4A 3IF7A 2L4HA 2G9BA 1S6IA 2M0RA 1JUOA 4A4CA 1F70A 2K8MB 2M29A 2VRGA 1JFJA 1YUTA 1JF2A 2LMUA 2I18A 4GPLB 1D1OA 3DF0B 4JQ0D 1KQMB 4ICBA 4WQ3A 4DRWA 2JPTA 2HQ8A 3SG3A 1JSAA 1A03A 1R2UA 4OR9B 1AK8A 2LLTA 2LHLA 1H8BA 1SL7A 1R6PA 1YRUB 5CSNA 1KFUS 2JXLA 3CLNA 1B7TZ 1L2OC 1FI5A 2NZ0A 4CLNA 1ZUZA 3I5FB 1TCOB 3FWCA 3F45A 2I94A 1JFKA 3SG5A 1OOJA 1A29A 3ZNIA 1TOPA 4I5NB 1TCFA 2M3WA 1SNLA 1DT7B 2LLUA 2KI6C 1K8UA 3DVMA 3O4YA 3O78A 1XFXO 1J7RA 1Y1XA 1MR8A 2KNEA 1GGZA 1IRJA 1F4QA 4QJ5B 2BKHB 1ZACA 1Q80A 1NX3A 3BUNB 5HKWA 4E68A 4I5JA 3VGOA 2K2AA 3OB1B 4PHNA 4AQJA 4PE0A 1KSMA 1ZFSA 1QX2A 1CM1A 4BY5A 3NSKA 1NYAA 2MA2A 1X02A 2JC2A 1DJWA 1CLLA 1RTP1 3O2PA 3ICBA 1DTLA 3OB2B 3SG4A 2HPSA 1IJ5A 4F0ZB 3O6BA 2WC8A 2LMVA 2ISDA 1EJ3A 1TN4A 1CMGA 1S1EA 4MVFA 2PRUA 1GJYA 2LP2A 5HYDA 4ZCVA 1RWYA 4DCKA 1MUXA 2NCPA 2PALA 3JTDC 1CKKA 3I5IC 1NX0A 2L98A 4U8DA 2KI4B 2LV7A 4PCWA 1A75B 2KDHA 1N2DA 2H2KA 2JULA 4DIRA 2EC6C 1KQVA 2FCDA 1J7OA 5GQQC 3VRQA 5I2LA 4M2OA 1KFXL 2H61C 1L2OB 2F3YA 1QXPA 4AQIA 2F33A 1Y1UA 3PFVA 4I5KA 1NUBA 2JT8A 3NSOA 3PATA 2LVJA 2CXJA 1DF0B 1XA5A 1YUSA 3GK1A 1QIWA 5AFPA 1DMOA 2OS8C 2MBXA 1CMFA 1RECA 1YVHA 1YTZC 4C0KA 1ZMZA 2JRFA 1DGVA 1QX7A 1L7ZA 4DS7A 3NXAA 2O5GA 4P5OE 1NP8A 2BE6A 2DOQA 1IG5A 4XJKB 1BODA 1B9AA 1ZOTB 1JBAA 1N0YA 3QRXA 1DJGA 2LANA 3CR5X 2FCEA 2WCFA 5ER5A 4UPGA 1CLBA 2JNXA 1UWOA 1F54A 3LCPC 1BG1A 3KO0A 2CBLA 3GK2A 2MHHA 3NSLA 1OQPA 1SPYA 2K7DA 1F71A 1YX7A 2CNPA 2JT0A 1B8RA 1W7IB 4IL1A 1AP4A 1C7VA 2BKIB 2WNDA 2KI6D 1BJFA 2BBNA 3JVTC 3JTDB 1UHHA 1WRZA 3I5IB 1J1EA 1CFPA 2JT3A 3LL8B 2L2EA 2LMTA 2JWWA 1EL4A 1C07A 2M1UA 3VROA 1NCZA 2B1UA 2LUCA 2M8UA 1LKJA 1PSRA 2ZN8A 1GQMA 1SW8A 1XFYO 1EG4A 1SYMA 4MZJA 1MXLC 1NCXA 4ORBB 1PVBA 3EVRA 2KQ6A 3HCMA 2KGRA 1PK0D 2Q4UA 2WCEA 1A2XA 4C0JA 1LA0A 1KK8C 2KQYA 1J55A 1JWDA 3TDUA 2BCBA 1DGUA 1N65A 1S5GZ 1SCMC 1OSAA 2OS8B 2M1KB 1LVCD 1AHRA 3LLEA 1KFUL 3IQOA 4OV2A 2KHNA 1S36A 1TTXA 1PVAA 3RLZA 1SL8A 3BOWB 1U5IA 1GGWA 2R2IA 3M0WA 1J7QA 3PSRA 5ER4X 4CFQA 2KOTA 1BF5A 1XK4A 2L51A 2BE4A 2NLNA 4XJKA 1RK9A 1YURA 3TUYC 1MF8B 4MBEA 1XFWO 3KEVA 1AJ4A 2F3ZA 2WOSA 1K96A 2KFFA 2KBMA 4ETOA 2ZNDA 4NDDA 1ALVA 3WHUB 2Y5IA 1YUUA 1JC2A 4HRGA 2SASA 3AAJA 5HLVA 1JF0A 2M7NA 3OP0A 4HSZA 3VRRA 5AERA 3BXKA 4GUKA 4FQOA 4WQ2A 2A4JA 5I8NA 1QJTA 3AKAA 3GOFA 1QV0A 3EVUA 1M45A 1F4OA 3JVTB 1CFCA 1SR6B 3SIBA 1IGVA 2CCMA 2K7OA 2BBMA 1WLZA 2LP3A 4MSPA 1YRTB 4CPVA 5CSFA 1K90D 5TNCA 1IKUA 1KK7Z 5CSIA 2CT9A 3EKHA 5JJGA 4MZKA 4L9MA 5DKNA 2F2PA 5KTYA 1WLMA 5D7FA 1OZOA 1NSHA 4HREE 2HETA 1NX2A 1K93D 1NX1A
chains in the Genus database with same CATH superfamily
1C3YA 1BU3A 4N1FA 4QJ4B 1KK8B 4MRXA 3DF0A 4PT1A 3SIAA 3BQ3A 4MZLA 4OVNF 2BAPA 3DVKA 1CTRA 2JTZA 1SCMB 1UP5A 2K7CA 2ZNEA 4OKHA 1BT6A 2O60A 2SCPA 2FJUB 2ZN9A 3L47A 3S0FA 1OE9B 2EGDA 4GGFA 1BLQA 1K94A 1LXFC 4TNCA 1OOFA 3CR2A 1CB1A 2E6WA 5HL1A 1QVIY 1QX5B 5CSJA 3CGAA 1M31A 1TNQA 1UUSA 1CM4A 3I5HC 4PHMA 4YGEB 3SS4A 4XYNA 3GK4X 1SSEB 1K95A 3OX5A 3TUYB 3EK7A 5F6TA 2WCMA 1LS8A 1FBVA 2HQWA 1SRAA 2K2FA 3CWGA 4I5LB 5G08A 1KFXS 1K9UA 1ODBA 1Y1AA 2FOTA 2KFGA 1XYDA 1PALA 3D0YB 1KQMC 2LLSA 5AEQA 1IIOA 4OCIA 1EXRA 2COLB 3MSEB 2OTGC 4WRIA 1CDMA 1RROA 1OMDA 1QWVA 5B8IB 2LVKA 3WNXB 5JOLA 1F55A 1XO5A 1A4PA 2L0PA 2H8VA 3PM2A 4YBHB 2WCHA 4AOMA 3DVEA 3DYEA 3V2LA 1B4CA 2K0JA 2JTTA 2LC5A 1DJIA 1CFFA 3CZ2A 4N5XA 1CLMA 2KPHA 1H4BA 3KPXA 4YGBB 1DJYA 1PRWA 1WY9A 1M46A 5DICA 2ZRTA 1ORGA 1MQ1A 2GGMA 3CDNA 1XFZO 2CTNA 4JWQA 2P6BB 4PE7A 2PVBA 3PM8A 4NDBA 1VRKA 3VB1A 1NWDA 1QATA 3C1VA 4R1EA 5DKRA 4ZCUA 2EC6B 2I2RE 1A75A 3TS5C 4QJ3B 1QS7A 1YX8A 4M2QA 4NQGA 5D69A 1AUIB 1QIVA 4PE4A 1OMRA 4PDZA 1G33A 2KAVA 2QDIA 2ZRSA 2JQ6A 2QEOA 4GNKB 2QPTA 4MN0A 2M97A 1KCYA 2LCPA 1G8IA 2F8PA 2PYQA 4GAOA 1EG3A 1AJ5A 1QV1A 2D8NA 3BYAA 1MWNA 4OZDA 1DJXA 1M63B 1WRKA 1DF0A 1UURA 3I5HB 2M7LA 2K7BA 1BOCA 2JXCA 1OMVA 1S3PA 3BFHA 2JNFA 1IJ6A 4PHKA 2I7AA 1B7TY 1OZSA 1BR1B 3R1VA 3CS1A 1WRLA 2AMIA 1IQ5A 1NCYA 1CNPA 1TNPA 1RFJA 2L5XB 2KAXA 2KBIA 1DJHA 1LINA 1TNWA 2KI4C 3KF9A 2WORA 2MLFC 1TIZA 3D0YA 3TDIA 1KSOA 1SKTA 3KHEA 2OTGB 4BY4A 1P28A 2LNKA 3DZTA 2LVVA 3PJIA 2FJYA 1QLSA 1SBJA 2G2BA 4D1EA 5KU1A 1FI6A 1SK6D 2Y4QA 2M49B 1C7WA 3NSIA 5IBWA 4NDCA 1E8AA 1XVJA 1WDCC 4P2YB 1B47A 5HKYA 5I94A 5AXIA 3A8RA 1QTXA 3B7AA 3E3RA 4ORAB 2Q91A 4PHJA 2L4IA 2BECA 2KYFA 5I2QA 2KLDA 2M9GA 3FIAA 3CR4X 4JPZB 2GGZA 4YGCB 3TS5B 1DVIA 1G4YR 2HF5A 3B86A 4JD9A 1J1DA 3K21A 5HKZA 2MLEC 1B1GA 1KK7Y 2LE9B 1XK4C 3EK8A 1KWOC 3CZTX 2LAPA 3IQQA 4MRYA 2KSPA 2Y1MA 2LVIA 1UHNA 3FS7A 3FWBA 2BL0C 5CPVA 4C0LA 1OOHA 2H61A 3DVJA 3K1EA 3SG2A 1AVSA 1PULA 4INWA 2KFHA 3B87A 1TUJA 2KAYA 3D10A 1SL9A 3HX4A 4DUQA 4PALA 3SS5A 4GBAA 1LA3A 2BCAA 3BUOB 1QLKA 4A4BA 1HT9A 3I5GC 4GFTA 1YVLA 5PALA 4ORCB 4Q04A 1IWQA 2ZKMX 3AKBA 1CFDA 1BMOA 1TRFA 3N7HA 2NXQA 3CTNA 1W9ZA 2LM5A 3TZ1A 5K89A 2PMYA 3PN7C 1CDNA 2GV5A 3BOWA 3TDZA 1K9PA 1MHOA 1OOIX 1T14A 4HRHA 2Y1NA 5FYXA 1Y6WA 1DJZA 2WCBA 2BCXA 4GGNA 5D3OA 1Y0VH 2LUXA 2NCOA 1RJVA 4CIDA 5BPJA 3S0EA 3ZWHA 5I2OA 2AUCA 3LK1A 1UHIA 2MAZA 2RGIA 3D76A 1TNXA 3SG7A 1B8CA 1SCVA 2PSRA 1HQVA 3BUWB 1NIWA 3AAKA 1UHKA 1XFVO 2QACA 4INXA 1V1FA 2EHBA 4USLA 2MRDA 1WDCB 2JZIA 2WCKA 3SJSA 3H4SE 1K9KA 5DKQA 1QVIZ 3NHTA 3UNWA 4YI9A 3VRPA 3A4UB 1V1GA 2TN4A 1FW4A 4YRUA 4M2PA 1CDPA 1CDLA 3BUMB 4CFRA 1UHJA 1IH0A 1SY9A 1M39A 1W7JB 3VRNA 4GGFC 1ALWA 1QASA 1IQ3A 5FI6A 2IS9A 3I5FC 1U5IB 2L50A 3SG6A 3WXAA 2OPOA 3LK0A 2F2OA 3EKJA 3Q8IA 1DC1A 1KWOB 1SMGA 2KGBC 1S6CA 3OX6A 2BL0B 5KSZA 3EK4A 5HLOA 4YGDB 3PLFB 4YI8A 1YR5A 1K2HA 2E30A 2JU0A 1Z2CB 5J3XA 1EH2A 1FF1A 4MEWA 2WC5A 1NPQA 3BUXB 2KYCA 4N1GA 3PALA 4MLWA 5AANA 3I5GB 1XFUO 3D75A 2YGUA 1F8HA 2V53A 2LHIA 3EVVA 4PE1A 1B8LA 3WHTB 1C3ZA 3CZ0A 3OHMB 2K61A 3RM1A 4YGAA 3PN7B 1BR4B 2JOJA 3NHIA 1SR6C 2AAOA 1S6JA 4FTGA 2BNXA 1S26D 2ZFDA 1S5GY 1MXEA 1PSBA 2PASA 2MJWB 1FPWA 3DD4A 3IF7A 2L4HA 2G9BA 1S6IA 2M0RA 2QEVA 1JUOA 4A4CA 2P71A 1F70A 4KYNA 2K8MB 2M29A 2VRGA 4JKTA 1JFJA 1TWOA 1YUTA 1JF2A 2LMUA 2I18A 3EG5B 3D73A 3DF0B 4GPLB 1KQMB 4ICBA 4JQ0D 4WQ3A 1D1OA 2WC6A 4DRWA 3FE6A 2JPTA 2HQ8A 3SG3A 1JSAA 1A03A 1R2UA 3O4XA 4OR9B 1AK8A 2LLTA 2LHLA 1H8BA 1SL7A 1R6PA 1YRUB 5CSNA 1KFUS 2JXLA 3CLNA 1B7TZ 1L2OC 1FI5A 2NZ0A 3IVTA 4CLNA 1ZUZA 1DEKA 3I5FB 1TCOB 3FWCA 3F45A 2I94A 3BJHA 1JFKA 3SG5A 1OOJA 1A29A 3ZNIA 1TOPA 4I5NB 1TCFA 2M3WA 1SNLA 1DT7B 2LLUA 2KI6C 3CYZA 1K8UA 3DVMA 3O4YA 3O78A 1XFXO 1J7RA 1Y1XA 1MR8A 2KNEA 1GGZA 1DQEA 1IRJA 1F4QA 4QJ5B 2BKHB 1ZACA 3DXLA 1Q80A 1NX3A 3BUNB 5HKWA 4E68A 4I5JA 3L4AA 5FI2A 3VGOA 2K2AA 3OB1B 4PHNA 4AQJA 4PE0A 1KSMA 1ZFSA 1QX2A 1CM1A 3QMEA 3S0GA 4BY5A 3NSKA 1GM0A 2WCLA 1NYAA 2MA2A 1X02A 2JC2A 1DJWA 1CLLA 1RTP1 3O2PA 3ICBA 1DTLA 3OB2B 3SG4A 4F7FA 2HPSA 1IJ5A 2L5YA 4F0ZB 3O6BA 2WC8A 3RZSA 2LMVA 3D78A 2ISDA 1EJ3A 1TN4A 1CMGA 1S1EA 4MVFA 2PRUA 1GJYA 2LP2A 5HYDA 2L2CA 4ZCVA 1RWYA 3B88A 4DCKA 1MUXA 2NCPA 2PALA 3JTDC 1CKKA 3I5IC 1NX0A 2L98A 4U8DA 2KI4B 2LV7A 4PCWA 1A75B 2KDHA 1N2DA 2H2KA 2JULA 2WCJA 4DIRA 2EC6C 1KQVA 2FCDA 1DELA 1J7OA 5GQQC 3VRQA 5I2LA 4M2OA 1KFXL 2H61C 1L2OB 2F3YA 1QXPA 4AQIA 3BFBA 2F33A 1Y1UA 3PFVA 4I5KA 1NUBA 2JT8A 3NSOA 4IJ7A 3PATA 2K60A 2LVJA 2CXJA 1DF0B 1XA5A 1YUSA 3GK1A 1QIWA 3B6XA 5AFPA 1DMOA 2OS8C 3CABA 2MBXA 1RECA 1CMFA 1YVHA 1YTZC 4C0KA 1ZMZA 2JRFA 1DGVA 1QX7A 1L7ZA 4DS7A 3NXAA 2O5GA 3R1OA 4P5OE 1NP8A 2BE6A 2DOQA 1IG5A 4XJKB 1BODA 3NGVA 1B9AA 1ZOTB 1JBAA 1N0YA 3QRXA 1DJGA 2LANA 3CR5X 5FI7A 2FCEA 2WCFA 5ER5A 4UPGA 1OW4A 1CLBA 2JNXA 1UWOA 1F54A 3LCPC 2KLEA 2QEBA 1BG1A 3KO0A 2CBLA 3GK2A 2MHHA 3NSLA 3FE8A 1OQPA 1SPYA 2K7DA 1F71A 1YX7A 2CNPA 3OBVA 2JT0A 2ERBA 1B8RA 1W7IB 4IL1A 1AP4A 3FE9A 1C7VA 2QEHA 2BKIB 2WNDA 2KI6D 1BJFA 2BBNA 3JVTC 2GTEA 3JTDB 1UHHA 1WRZA 3I5IB 1J1EA 1CFPA 2JT3A 3LL8B 2L2EA 2LMTA 2JWWA 1EL4A 1C07A 2M1UA 3VROA 1NCZA 2B1UA 2LUCA 3R72A 2M8UA 1LKJA 1PSRA 2ZN8A 3SS3A 1GQMA 1SW8A 1XFYO 1EG4A 3D74A 1SYMA 4MZJA 1MXLC 1NCXA 1OOGA 3L4LA 4ORBB 1PVBA 3EVRA 2KQ6A 3HCMA 2KGRA 1PK0D 2Q4UA 2WCEA 1A2XA 5EL2A 4C0JA 1LA0A 1KK8C 3D77A 2KQYA 1J55A 1JWDA 3TDUA 2BCBA 1DGUA 1N65A 1S5GZ 2P70A 1SCMC 1OSAA 2PQLA 2OS8B 2M1KB 1TUZA 1LVCD 1AHRA 3LLEA 1KFUL 3IQOA 4OV2A 2KHNA 1S36A 3OGNA 1TTXA 3S0DA 3CZ1A 1PVAA 3S0AA 3RLZA 1SL8A 3BOWB 1U5IA 1GGWA 2R2IA 3M0WA 1J7QA 3PSRA 5ER4X 4CFQA 2KOTA 1BF5A 1XK4A 2L51A 2BE4A 2NLNA 4XJKA 1RK9A 1YURA 3TUYC 1MF8B 4MBEA 1XFWO 3KEVA 1AJ4A 2F3ZA 2WOSA 1K96A 2JPOA 2KFFA 2KBMA 4ETOA 2ZNDA 4NDDA 1ALVA 1XFRA 3WHUB 2Y5IA 1YUUA 1JC2A 4HRGA 2SASA 3AAJA 5HLVA 1JF0A 2M7NA 3OP0A 4HSZA 3VRRA 3UO9A 5AERA 3BXKA 4GUKA 4FQOA 4WQ2A 2A4JA 5I8NA 3DY9A 1QJTA 3AKAA 3GOFA 1QV0A 3EVUA 1M45A 1F4OA 3JVTB 1CFCA 1SR6B 3SIBA 1IGVA 2CCMA 2K7OA 2BBMA 1WLZA 2LP3A 4MSPA 1YRTB 3S0BA 4CPVA 5CSFA 1K90D 3BFAA 4FQTA 5TNCA 1IKUA 1KK7Z 5CSIA 2CT9A 3EKHA 1Z4HA 5JJGA 4MZKA 1J7PA 4L9MA 5DKNA 2F2PA 5KTYA 1WLMA 5D7FA 3R1PA 1OZOA 1NSHA 4HREE 2HETA 1NX2A 1K93D 1NX1A
chains in the Genus database with same CATH topology
1BU3A 4N1FA 4QJ4B 1KK8B 4MRXA 3DF0A 3SIAA 3BQ3A 4MZLA 4OVNF 3DVKA 1CTRA 2JTZA 1SCMB 1UP5A 2K7CA 2ZNEA 4OKHA 1BT6A 2O60A 2SCPA 2FJUB 2ZN9A 1OE9B 2EGDA 4GGFA 1BLQA 1K94A 1LXFC 4TNCA 3CR2A 1CB1A 2E6WA 1QVIY 1QX5B 5CSJA 3CGAA 1M31A 1TNQA 1UUSA 1CM4A 3I5HC 4PHMA 4YGEB 4XYNA 3GK4X 3TUYB 1K95A 3OX5A 3EK7A 5F6TA 1FBVA 2HQWA 1SRAA 2K2FA 3CWGA 4I5LB 5G08A 1KFXS 1K9UA 1ODBA 1Y1AA 2FOTA 2KFGA 1XYDA 1PALA 3D0YB 1KQMC 2LLSA 5AEQA 4OCIA 1EXRA 2COLB 3MSEB 2OTGC 4WRIA 1CDMA 1RROA 1OMDA 5B8IB 2LVKA 3WNXB 5JOLA 1F55A 1XO5A 1A4PA 2L0PA 4YBHB 4AOMA 3DVEA 1B4CA 2K0JA 2JTTA 2LC5A 1DJIA 1CFFA 4N5XA 1CLMA 1H4BA 3KPXA 4YGBB 1DJYA 1PRWA 1WY9A 1M46A 2ZRTA 1MQ1A 2GGMA 1XFZO 2CTNA 4JWQA 2P6BB 4PE7A 2PVBA 3PM8A 4NDBA 1VRKA 1NWDA 1QATA 3C1VA 4R1EA 5DKRA 4ZCUA 2EC6B 2I2RE 1A75A 3TS5C 4QJ3B 1QS7A 1YX8A 4M2QA 4NQGA 5D69A 1AUIB 1QIVA 4PE4A 1OMRA 4PDZA 1G33A 2KAVA 2ZRSA 2JQ6A 4GNKB 2QPTA 4MN0A 2M97A 1KCYA 2LCPA 1G8IA 2F8PA 4GAOA 1EG3A 1AJ5A 1QV1A 2D8NA 3BYAA 1MWNA 1DJXA 1M63B 1WRKA 1DF0A 1UURA 3I5HB 2M7LA 2K7BA 1BOCA 2JXCA 1OMVA 1S3PA 2JNFA 1IJ6A 4PHKA 2I7AA 1B7TY 1OZSA 1BR1B 3CS1A 1WRLA 2AMIA 1IQ5A 1NCYA 1CNPA 1TNPA 1RFJA 2L5XB 2KAXA 2KBIA 1DJHA 1LINA 1TNWA 2KI4C 3KF9A 2WORA 2MLFC 1TIZA 3D0YA 3TDIA 1KSOA 1SKTA 3KHEA 2OTGB 4BY4A 2LNKA 2LVVA 2G2BA 1QLSA 1SBJA 4D1EA 5KU1A 1FI6A 1SK6D 2Y4QA 2M49B 1C7WA 3NSIA 5IBWA 4NDCA 1E8AA 1XVJA 1WDCC 4P2YB 1B47A 5HKYA 5AXIA 3A8RA 1QTXA 4PHJA 3E3RA 4ORAB 2Q91A 2L4IA 2BECA 2KYFA 5I2QA 2M9GA 3FIAA 4JPZB 3CR4X 3TS5B 2GGZA 4YGCB 1DVIA 1G4YR 2HF5A 1J1DA 3K21A 5HKZA 2MLEC 1B1GA 1KK7Y 2LE9B 1XK4C 3EK8A 1KWOC 3CZTX 2LAPA 3IQQA 4MRYA 2KSPA 2Y1MA 2LVIA 1UHNA 3FS7A 3FWBA 2BL0C 5CPVA 4C0LA 2H61A 3DVJA 3SG2A 1AVSA 1PULA 2KFHA 2KAYA 3D10A 3HX4A 1SL9A 4DUQA 4PALA 4GBAA 1LA3A 2BCAA 3BUOB 1QLKA 4A4BA 1HT9A 3I5GC 4GFTA 1YVLA 5PALA 4ORCB 4Q04A 1IWQA 2ZKMX 3AKBA 1CFDA 1BMOA 1TRFA 2NXQA 3CTNA 2LM5A 3TZ1A 5K89A 2PMYA 3PN7C 1CDNA 2GV5A 3BOWA 3TDZA 1K9PA 1MHOA 4HRHA 5FYXA 2Y1NA 1Y6WA 1DJZA 2WCBA 2BCXA 4GGNA 1J7PA 1Y0VH 2LUXA 2NCOA 1RJVA 4CIDA 5BPJA 3ZWHA 5I2OA 2AUCA 3LK1A 1UHIA 2MAZA 2RGIA 1TNXA 3SG7A 1B8CA 1SCVA 2PSRA 1HQVA 3BUWB 1NIWA 3AAKA 1UHKA 1XFVO 2QACA 1V1FA 2EHBA 4USLA 2MRDA 1WDCB 2JZIA 3SJSA 3VRNA 3H4SE 1K9KA 5DKQA 1QVIZ 4YI9A 3VRPA 3A4UB 1V1GA 2TN4A 1FW4A 4YRUA 4M2PA 1CDPA 1CDLA 3BUMB 4CFRA 1UHJA 1IH0A 1SY9A 1M39A 1W7JB 4GGFC 1ALWA 1QASA 1IQ3A 3SG6A 2IS9A 3I5FC 1U5IB 2L50A 3WXAA 2OPOA 3LK0A 2F2OA 3EKJA 1KWOB 1SMGA 2KGBC 1S6CA 3OX6A 2BL0B 5KSZA 3EK4A 5HLOA 4YGDB 3PLFB 4YI8A 1YR5A 1K2HA 2E30A 2JU0A 5J3XA 1EH2A 1FF1A 4MEWA 3BUXB 1NPQA 2KYCA 4N1GA 3PALA 4MLWA 5AANA 3I5GB 1XFUO 1F8HA 2V53A 2LHIA 3EVVA 4PE1A 1B8LA 3WHTB 3OHMB 2K61A 3RM1A 4YGAA 3PN7B 1BR4B 2JOJA 1SR6C 2AAOA 1S6JA 4FTGA 2ZFDA 1S26D 1S5GY 1MXEA 1PSBA 2PASA 2MJWB 1FPWA 3DD4A 3IF7A 2L4HA 2G9BA 1S6IA 2M0RA 1JUOA 4A4CA 1F70A 2K8MB 2M29A 2VRGA 1JFJA 1YUTA 1JF2A 2LMUA 2I18A 4GPLB 1D1OA 3DF0B 4JQ0D 1KQMB 4ICBA 4WQ3A 4DRWA 2JPTA 2HQ8A 3SG3A 1JSAA 1A03A 1R2UA 4OR9B 1AK8A 2LLTA 2LHLA 1H8BA 1SL7A 1R6PA 1YRUB 5CSNA 1KFUS 2JXLA 3CLNA 1B7TZ 1L2OC 1FI5A 2NZ0A 4CLNA 1ZUZA 3I5FB 1TCOB 3FWCA 3F45A 2I94A 1JFKA 3SG5A 1OOJA 1A29A 3ZNIA 1TOPA 4I5NB 1TCFA 2M3WA 1SNLA 1DT7B 2LLUA 2KI6C 1K8UA 3DVMA 3O4YA 3O78A 1XFXO 1J7RA 1Y1XA 1MR8A 2KNEA 1GGZA 1IRJA 1F4QA 4QJ5B 2BKHB 1ZACA 1Q80A 1NX3A 3BUNB 5HKWA 4E68A 4I5JA 3VGOA 2K2AA 3OB1B 4PHNA 4AQJA 4PE0A 1KSMA 1ZFSA 1QX2A 1CM1A 4BY5A 3NSKA 1NYAA 2MA2A 1X02A 2JC2A 1DJWA 1CLLA 1RTP1 3O2PA 3ICBA 1DTLA 3OB2B 3SG4A 2HPSA 1IJ5A 4F0ZB 3O6BA 2WC8A 2LMVA 2ISDA 1EJ3A 1TN4A 1CMGA 1S1EA 4MVFA 2PRUA 1GJYA 2LP2A 5HYDA 4ZCVA 1RWYA 4DCKA 1MUXA 2NCPA 2PALA 3JTDC 1CKKA 3I5IC 1NX0A 2L98A 4U8DA 2KI4B 2LV7A 4PCWA 1A75B 2KDHA 1N2DA 2H2KA 2JULA 4DIRA 2EC6C 1KQVA 2FCDA 1J7OA 5GQQC 3VRQA 5I2LA 4M2OA 1KFXL 2H61C 1L2OB 2F3YA 1QXPA 4AQIA 2F33A 1Y1UA 3PFVA 4I5KA 1NUBA 2JT8A 3NSOA 3PATA 2LVJA 2CXJA 1DF0B 1XA5A 1YUSA 3GK1A 1QIWA 5AFPA 1DMOA 2OS8C 2MBXA 1CMFA 1RECA 1YVHA 1YTZC 4C0KA 1ZMZA 2JRFA 1DGVA 1QX7A 1L7ZA 4DS7A 3NXAA 2O5GA 4P5OE 1NP8A 2BE6A 2DOQA 1IG5A 4XJKB 1BODA 1B9AA 1ZOTB 1JBAA 1N0YA 3QRXA 1DJGA 2LANA 3CR5X 2FCEA 2WCFA 5ER5A 4UPGA 1CLBA 2JNXA 1UWOA 1F54A 3LCPC 1BG1A 3KO0A 2CBLA 3GK2A 2MHHA 3NSLA 1OQPA 1SPYA 2K7DA 1F71A 1YX7A 2CNPA 2JT0A 1B8RA 1W7IB 4IL1A 1AP4A 1C7VA 2BKIB 2WNDA 2KI6D 1BJFA 2BBNA 3JVTC 3JTDB 1UHHA 1WRZA 3I5IB 1J1EA 1CFPA 2JT3A 3LL8B 2L2EA 2LMTA 2JWWA 1EL4A 1C07A 2M1UA 3VROA 1NCZA 2B1UA 2LUCA 2M8UA 1LKJA 1PSRA 2ZN8A 1GQMA 1SW8A 1XFYO 1EG4A 1SYMA 4MZJA 1MXLC 1NCXA 4ORBB 1PVBA 3EVRA 2KQ6A 3HCMA 2KGRA 1PK0D 2Q4UA 2WCEA 1A2XA 4C0JA 1LA0A 1KK8C 2KQYA 1J55A 1JWDA 3TDUA 2BCBA 1DGUA 1N65A 1S5GZ 1SCMC 1OSAA 2OS8B 2M1KB 1LVCD 1AHRA 3LLEA 1KFUL 3IQOA 4OV2A 2KHNA 1S36A 1TTXA 1PVAA 3RLZA 1SL8A 3BOWB 1U5IA 1GGWA 2R2IA 3M0WA 1J7QA 3PSRA 5ER4X 4CFQA 2KOTA 1BF5A 1XK4A 2L51A 2BE4A 2NLNA 4XJKA 1RK9A 1YURA 3TUYC 1MF8B 4MBEA 1XFWO 3KEVA 1AJ4A 2F3ZA 2WOSA 1K96A 2KFFA 2KBMA 4ETOA 2ZNDA 4NDDA 1ALVA 3WHUB 2Y5IA 1YUUA 1JC2A 4HRGA 2SASA 3AAJA 5HLVA 1JF0A 2M7NA 3OP0A 4HSZA 3VRRA 5AERA 3BXKA 4GUKA 4FQOA 4WQ2A 2A4JA 5I8NA 1QJTA 3AKAA 3GOFA 1QV0A 3EVUA 1M45A 1F4OA 3JVTB 1CFCA 1SR6B 3SIBA 1IGVA 2CCMA 2K7OA 2BBMA 1WLZA 2LP3A 4MSPA 1YRTB 4CPVA 5CSFA 1K90D 5TNCA 1IKUA 1KK7Z 5CSIA 2CT9A 3EKHA 5JJGA 4MZKA 4L9MA 5DKNA 2F2PA 5KTYA 1WLMA 5D7FA 1OZOA 1NSHA 4HREE 2HETA 1NX2A 1K93D 1NX1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BU3 A;  4N1F A;  4QJ4 B;  1KK8 B;  4MRX A;  3DF0 A;  3SIA A;  3BQ3 A;  4MZL A;  4OVN F;  3DVK A;  1CTR A;  2JTZ A;  1SCM B;  1UP5 A;  2K7C A;  2ZNE A;  4OKH A;  1BT6 A;  2O60 A;  2SCP A;  2FJU B;  2ZN9 A;  1OE9 B;  2EGD A;  4GGF A;  1BLQ A;  1K94 A;  1LXF C;  4TNC A;  3CR2 A;  1CB1 A;  2E6W A;  1QVI Y;  1QX5 B;  5CSJ A;  3CGA A;  1M31 A;  1TNQ A;  1UUS A;  1CM4 A;  3I5H C;  4PHM A;  4YGE B;  4XYN A;  3GK4 X;  3TUY B;  1K95 A;  3OX5 A;  3EK7 A;  5F6T A;  1FBV A;  2HQW A;  1SRA A;  2K2F A;  3CWG A;  4I5L B;  5G08 A;  1KFX S;  1K9U A;  1ODB A;  1Y1A A;  2FOT A;  2KFG A;  1XYD A;  1PAL A;  3D0Y B;  1KQM C;  2LLS A;  5AEQ A;  4OCI A;  1EXR A;  2COL B;  3MSE B;  2OTG C;  4WRI A;  1CDM A;  1RRO A;  1OMD A;  5B8I B;  2LVK A;  3WNX B;  5JOL A;  1F55 A;  1XO5 A;  1A4P A;  2L0P A;  4YBH B;  4AOM A;  3DVE A;  1B4C A;  2K0J A;  2JTT A;  2LC5 A;  1DJI A;  1CFF A;  4N5X A;  1CLM A;  1H4B A;  3KPX A;  4YGB B;  1DJY A;  1PRW A;  1WY9 A;  1M46 A;  2ZRT A;  1MQ1 A;  2GGM A;  1XFZ O;  2CTN A;  4JWQ A;  2P6B B;  4PE7 A;  2PVB A;  3PM8 A;  4NDB A;  1VRK A;  1NWD A;  1QAT A;  3C1V A;  4R1E A;  5DKR A;  4ZCU A;  2EC6 B;  2I2R E;  1A75 A;  3TS5 C;  4QJ3 B;  1QS7 A;  1YX8 A;  4M2Q A;  4NQG A;  5D69 A;  1AUI B;  1QIV A;  4PE4 A;  1OMR A;  4PDZ A;  1G33 A;  2KAV A;  2ZRS A;  2JQ6 A;  4GNK B;  2QPT A;  4MN0 A;  2M97 A;  1KCY A;  2LCP A;  1G8I A;  2F8P A;  4GAO A;  1EG3 A;  1AJ5 A;  1QV1 A;  2D8N A;  3BYA A;  1MWN A;  1DJX A;  1M63 B;  1WRK A;  1DF0 A;  1UUR A;  3I5H B;  2M7L A;  2K7B A;  1BOC A;  2JXC A;  1OMV A;  1S3P A;  2JNF A;  1IJ6 A;  4PHK A;  2I7A A;  1B7T Y;  1OZS A;  1BR1 B;  3CS1 A;  1WRL A;  2AMI A;  1IQ5 A;  1NCY A;  1CNP A;  1TNP A;  1RFJ A;  2L5X B;  2KAX A;  2KBI A;  1DJH A;  1LIN A;  1TNW A;  2KI4 C;  3KF9 A;  2WOR A;  2MLF C;  1TIZ A;  3D0Y A;  3TDI A;  1KSO A;  1SKT A;  3KHE A;  2OTG B;  4BY4 A;  2LNK A;  2LVV A;  2G2B A;  1QLS A;  1SBJ A;  4D1E A;  5KU1 A;  1FI6 A;  1SK6 D;  2Y4Q A;  2M49 B;  1C7W A;  3NSI A;  5IBW A;  4NDC A;  1E8A A;  1XVJ A;  1WDC C;  4P2Y B;  1B47 A;  5HKY A;  5AXI A;  3A8R A;  1QTX A;  4PHJ A;  3E3R A;  4ORA B;  2Q91 A;  2L4I A;  2BEC A;  2KYF A;  5I2Q A;  2M9G A;  3FIA A;  4JPZ B;  3CR4 X;  3TS5 B;  2GGZ A;  4YGC B;  1DVI A;  1G4Y R;  2HF5 A;  1J1D A;  3K21 A;  5HKZ A;  2MLE C;  1B1G A;  1KK7 Y;  2LE9 B;  1XK4 C;  3EK8 A;  1KWO C;  3CZT X;  2LAP A;  3IQQ A;  4MRY A;  2KSP A;  2Y1M A;  2LVI A;  1UHN A;  3FS7 A;  3FWB A;  2BL0 C;  5CPV A;  4C0L A;  2H61 A;  3DVJ A;  3SG2 A;  1AVS A;  1PUL A;  2KFH A;  2KAY A;  3D10 A;  3HX4 A;  1SL9 A;  4DUQ A;  4PAL A;  4GBA A;  1LA3 A;  2BCA A;  3BUO B;  1QLK A;  4A4B A;  1HT9 A;  3I5G C;  4GFT A;  1YVL A;  5PAL A;  4ORC B;  4Q04 A;  1IWQ A;  2ZKM X;  3AKB A;  1CFD A;  1BMO A;  1TRF A;  2NXQ A;  3CTN A;  2LM5 A;  3TZ1 A;  5K89 A;  2PMY A;  3PN7 C;  1CDN A;  2GV5 A;  3BOW A;  3TDZ A;  1K9P A;  1MHO A;  4HRH A;  5FYX A;  2Y1N A;  1Y6W A;  1DJZ A;  2WCB A;  2BCX A;  4GGN A;  1J7P A;  1Y0V H;  2LUX A;  2NCO A;  1RJV A;  4CID A;  5BPJ A;  3ZWH A;  5I2O A;  2AUC A;  3LK1 A;  1UHI A;  2MAZ A;  2RGI A;  1TNX A;  3SG7 A;  1B8C A;  1SCV A;  2PSR A;  1HQV A;  3BUW B;  1NIW A;  3AAK A;  1UHK A;  1XFV O;  2QAC A;  1V1F A;  2EHB A;  4USL A;  2MRD A;  1WDC B;  2JZI A;  3SJS A;  3VRN A;  3H4S E;  1K9K A;  5DKQ A;  1QVI Z;  4YI9 A;  3VRP A;  3A4U B;  1V1G A;  2TN4 A;  1FW4 A;  4YRU A;  4M2P A;  1CDP A;  1CDL A;  3BUM B;  4CFR A;  1UHJ A;  1IH0 A;  1SY9 A;  1M39 A;  1W7J B;  4GGF C;  1ALW A;  1QAS A;  1IQ3 A;  3SG6 A;  2IS9 A;  3I5F C;  1U5I B;  2L50 A;  3WXA A;  2OPO A;  3LK0 A;  2F2O A;  3EKJ A;  1KWO B;  1SMG A;  2KGB C;  1S6C A;  3OX6 A;  2BL0 B;  5KSZ A;  3EK4 A;  5HLO A;  4YGD B;  3PLF B;  4YI8 A;  1YR5 A;  1K2H A;  2E30 A;  2JU0 A;  5J3X A;  1EH2 A;  1FF1 A;  4MEW A;  3BUX B;  1NPQ A;  2KYC A;  4N1G A;  3PAL A;  4MLW A;  5AAN A;  3I5G B;  1XFU O;  1F8H A;  2V53 A;  2LHI A;  3EVV A;  4PE1 A;  1B8L A;  3WHT B;  3OHM B;  2K61 A;  3RM1 A;  4YGA A;  3PN7 B;  1BR4 B;  2JOJ A;  1SR6 C;  2AAO A;  1S6J A;  4FTG A;  2ZFD A;  1S26 D;  1S5G Y;  1MXE A;  1PSB A;  2PAS A;  2MJW B;  1FPW A;  3DD4 A;  3IF7 A;  2L4H A;  2G9B A;  1S6I A;  2M0R A;  1JUO A;  4A4C A;  1F70 A;  2K8M B;  2M29 A;  2VRG A;  1JFJ A;  1YUT A;  1JF2 A;  2LMU A;  2I18 A;  4GPL B;  1D1O A;  3DF0 B;  4JQ0 D;  1KQM B;  4ICB A;  4WQ3 A;  4DRW A;  2JPT A;  2HQ8 A;  3SG3 A;  1JSA A;  1A03 A;  1R2U A;  4OR9 B;  1AK8 A;  2LLT A;  2LHL A;  1H8B A;  1SL7 A;  1R6P A;  1YRU B;  5CSN A;  1KFU S;  2JXL A;  3CLN A;  1B7T Z;  1L2O C;  1FI5 A;  2NZ0 A;  4CLN A;  1ZUZ A;  3I5F B;  1TCO B;  3FWC A;  3F45 A;  2I94 A;  1JFK A;  3SG5 A;  1OOJ A;  1A29 A;  3ZNI A;  1TOP A;  4I5N B;  1TCF A;  2M3W A;  1SNL A;  1DT7 B;  2LLU A;  2KI6 C;  1K8U A;  3DVM A;  3O4Y A;  3O78 A;  1XFX O;  1J7R A;  1Y1X A;  1MR8 A;  2KNE A;  1GGZ A;  1IRJ A;  1F4Q A;  4QJ5 B;  2BKH B;  1ZAC A;  1Q80 A;  1NX3 A;  3BUN B;  5HKW A;  4E68 A;  4I5J A;  3VGO A;  2K2A A;  3OB1 B;  4PHN A;  4AQJ A;  4PE0 A;  1KSM A;  1ZFS A;  1QX2 A;  1CM1 A;  4BY5 A;  3NSK A;  1NYA A;  2MA2 A;  1X02 A;  2JC2 A;  1DJW A;  1CLL A;  1RTP 1;  3O2P A;  3ICB A;  1DTL A;  3OB2 B;  3SG4 A;  2HPS A;  1IJ5 A;  4F0Z B;  3O6B A;  2WC8 A;  2LMV A;  2ISD A;  1EJ3 A;  1TN4 A;  1CMG A;  1S1E A;  4MVF A;  2PRU A;  1GJY A;  2LP2 A;  5HYD A;  4ZCV A;  1RWY A;  4DCK A;  1MUX A;  2NCP A;  2PAL A;  3JTD C;  1CKK A;  3I5I C;  1NX0 A;  2L98 A;  4U8D A;  2KI4 B;  2LV7 A;  4PCW A;  1A75 B;  2KDH A;  1N2D A;  2H2K A;  2JUL A;  4DIR A;  2EC6 C;  1KQV A;  2FCD A;  1J7O A;  5GQQ C;  3VRQ A;  5I2L A;  4M2O A;  1KFX L;  2H61 C;  1L2O B;  2F3Y A;  1QXP A;  4AQI A;  2F33 A;  1Y1U A;  3PFV A;  4I5K A;  1NUB A;  2JT8 A;  3NSO A;  3PAT A;  2LVJ A;  2CXJ A;  1DF0 B;  1XA5 A;  1YUS A;  3GK1 A;  1QIW A;  5AFP A;  1DMO A;  2OS8 C;  2MBX A;  1CMF A;  1REC A;  1YVH A;  1YTZ C;  4C0K A;  1ZMZ A;  2JRF A;  1DGV A;  1QX7 A;  1L7Z A;  4DS7 A;  3NXA A;  2O5G A;  4P5O E;  1NP8 A;  2BE6 A;  2DOQ A;  1IG5 A;  4XJK B;  1BOD A;  1B9A A;  1ZOT B;  1JBA A;  1N0Y A;  3QRX A;  1DJG A;  2LAN A;  3CR5 X;  2FCE A;  2WCF A;  5ER5 A;  4UPG A;  1CLB A;  2JNX A;  1UWO A;  1F54 A;  3LCP C;  1BG1 A;  3KO0 A;  2CBL A;  3GK2 A;  2MHH A;  3NSL A;  1OQP A;  1SPY A;  2K7D A;  1F71 A;  1YX7 A;  2CNP A;  2JT0 A;  1B8R A;  1W7I B;  4IL1 A;  1AP4 A;  1C7V A;  2BKI B;  2WND A;  2KI6 D;  1BJF A;  2BBN A;  3JVT C;  3JTD B;  1UHH A;  1WRZ A;  3I5I B;  1J1E A;  1CFP A;  2JT3 A;  3LL8 B;  2L2E A;  2LMT A;  2JWW A;  1EL4 A;  1C07 A;  2M1U A;  3VRO A;  1NCZ A;  2B1U A;  2LUC A;  2M8U A;  1LKJ A;  1PSR A;  2ZN8 A;  1GQM A;  1SW8 A;  1XFY O;  1EG4 A;  1SYM A;  4MZJ A;  1MXL C;  1NCX A;  4ORB B;  1PVB A;  3EVR A;  2KQ6 A;  3HCM A;  2KGR A;  1PK0 D;  2Q4U A;  2WCE A;  1A2X A;  4C0J A;  1LA0 A;  1KK8 C;  2KQY A;  1J55 A;  1JWD A;  3TDU A;  2BCB A;  1DGU A;  1N65 A;  1S5G Z;  1SCM C;  1OSA A;  2OS8 B;  2M1K B;  1LVC D;  1AHR A;  3LLE A;  1KFU L;  3IQO A;  4OV2 A;  2KHN A;  1S36 A;  1TTX A;  1PVA A;  3RLZ A;  1SL8 A;  3BOW B;  1U5I A;  1GGW A;  2R2I A;  3M0W A;  1J7Q A;  3PSR A;  5ER4 X;  4CFQ A;  2KOT A;  1BF5 A;  1XK4 A;  2L51 A;  2BE4 A;  2NLN A;  4XJK A;  1RK9 A;  1YUR A;  3TUY C;  1MF8 B;  4MBE A;  1XFW O;  3KEV A;  1AJ4 A;  2F3Z A;  2WOS A;  1K96 A;  2KFF A;  2KBM A;  4ETO A;  2ZND A;  4NDD A;  1ALV A;  3WHU B;  2Y5I A;  1YUU A;  1JC2 A;  4HRG A;  2SAS A;  3AAJ A;  5HLV A;  1JF0 A;  2M7N A;  3OP0 A;  4HSZ A;  3VRR A;  5AER A;  3BXK A;  4GUK A;  4FQO A;  4WQ2 A;  2A4J A;  5I8N A;  1QJT A;  3AKA A;  3GOF A;  1QV0 A;  3EVU A;  1M45 A;  1F4O A;  3JVT B;  1CFC A;  1SR6 B;  3SIB A;  1IGV A;  2CCM A;  2K7O A;  2BBM A;  1WLZ A;  2LP3 A;  4MSP A;  1YRT B;  4CPV A;  5CSF A;  1K90 D;  5TNC A;  1IKU A;  1KK7 Z;  5CSI A;  2CT9 A;  3EKH A;  5JJG A;  4MZK A;  4L9M A;  5DKN A;  2F2P A;  5KTY A;  1WLM A;  5D7F A;  1OZO A;  1NSH A;  4HRE E;  2HET A;  1NX2 A;  1K93 D;  1NX1 A; 
#chains in the Genus database with same CATH topology
 1C3Y A;  1BU3 A;  4N1F A;  4QJ4 B;  1KK8 B;  4MRX A;  3DF0 A;  4PT1 A;  3SIA A;  3BQ3 A;  4MZL A;  4OVN F;  2BAP A;  3DVK A;  1CTR A;  2JTZ A;  1SCM B;  1UP5 A;  2K7C A;  2ZNE A;  4OKH A;  1BT6 A;  2O60 A;  2SCP A;  2FJU B;  2ZN9 A;  3L47 A;  3S0F A;  1OE9 B;  2EGD A;  4GGF A;  1BLQ A;  1K94 A;  1LXF C;  4TNC A;  1OOF A;  3CR2 A;  1CB1 A;  2E6W A;  5HL1 A;  1QVI Y;  1QX5 B;  5CSJ A;  3CGA A;  1M31 A;  1TNQ A;  1UUS A;  1CM4 A;  3I5H C;  4PHM A;  4YGE B;  3SS4 A;  4XYN A;  3GK4 X;  1SSE B;  1K95 A;  3OX5 A;  3TUY B;  3EK7 A;  5F6T A;  2WCM A;  1LS8 A;  1FBV A;  2HQW A;  1SRA A;  2K2F A;  3CWG A;  4I5L B;  5G08 A;  1KFX S;  1K9U A;  1ODB A;  1Y1A A;  2FOT A;  2KFG A;  1XYD A;  1PAL A;  3D0Y B;  1KQM C;  2LLS A;  5AEQ A;  1IIO A;  4OCI A;  1EXR A;  2COL B;  3MSE B;  2OTG C;  4WRI A;  1CDM A;  1RRO A;  1OMD A;  1QWV A;  5B8I B;  2LVK A;  3WNX B;  5JOL A;  1F55 A;  1XO5 A;  1A4P A;  2L0P A;  2H8V A;  3PM2 A;  4YBH B;  2WCH A;  4AOM A;  3DVE A;  3DYE A;  3V2L A;  1B4C A;  2K0J A;  2JTT A;  2LC5 A;  1DJI A;  1CFF A;  3CZ2 A;  4N5X A;  1CLM A;  2KPH A;  1H4B A;  3KPX A;  4YGB B;  1DJY A;  1PRW A;  1WY9 A;  1M46 A;  5DIC A;  2ZRT A;  1ORG A;  1MQ1 A;  2GGM A;  3CDN A;  1XFZ O;  2CTN A;  4JWQ A;  2P6B B;  4PE7 A;  2PVB A;  3PM8 A;  4NDB A;  1VRK A;  3VB1 A;  1NWD A;  1QAT A;  3C1V A;  4R1E A;  5DKR A;  4ZCU A;  2EC6 B;  2I2R E;  1A75 A;  3TS5 C;  4QJ3 B;  1QS7 A;  1YX8 A;  4M2Q A;  4NQG A;  5D69 A;  1AUI B;  1QIV A;  4PE4 A;  1OMR A;  4PDZ A;  1G33 A;  2KAV A;  2QDI A;  2ZRS A;  2JQ6 A;  2QEO A;  4GNK B;  2QPT A;  4MN0 A;  2M97 A;  1KCY A;  2LCP A;  1G8I A;  2F8P A;  2PYQ A;  4GAO A;  1EG3 A;  1AJ5 A;  1QV1 A;  2D8N A;  3BYA A;  1MWN A;  4OZD A;  1DJX A;  1M63 B;  1WRK A;  1DF0 A;  1UUR A;  3I5H B;  2M7L A;  2K7B A;  1BOC A;  2JXC A;  1OMV A;  1S3P A;  3BFH A;  2JNF A;  1IJ6 A;  4PHK A;  2I7A A;  1B7T Y;  1OZS A;  1BR1 B;  3R1V A;  3CS1 A;  1WRL A;  2AMI A;  1IQ5 A;  1NCY A;  1CNP A;  1TNP A;  1RFJ A;  2L5X B;  2KAX A;  2KBI A;  1DJH A;  1LIN A;  1TNW A;  2KI4 C;  3KF9 A;  2WOR A;  2MLF C;  1TIZ A;  3D0Y A;  3TDI A;  1KSO A;  1SKT A;  3KHE A;  2OTG B;  4BY4 A;  1P28 A;  2LNK A;  3DZT A;  2LVV A;  3PJI A;  2FJY A;  1QLS A;  1SBJ A;  2G2B A;  4D1E A;  5KU1 A;  1FI6 A;  1SK6 D;  2Y4Q A;  2M49 B;  1C7W A;  3NSI A;  5IBW A;  4NDC A;  1E8A A;  1XVJ A;  1WDC C;  4P2Y B;  1B47 A;  5HKY A;  5I94 A;  5AXI A;  3A8R A;  1QTX A;  3B7A A;  3E3R A;  4ORA B;  2Q91 A;  4PHJ A;  2L4I A;  2BEC A;  2KYF A;  5I2Q A;  2KLD A;  2M9G A;  3FIA A;  3CR4 X;  4JPZ B;  2GGZ A;  4YGC B;  3TS5 B;  1DVI A;  1G4Y R;  2HF5 A;  3B86 A;  4JD9 A;  1J1D A;  3K21 A;  5HKZ A;  2MLE C;  1B1G A;  1KK7 Y;  2LE9 B;  1XK4 C;  3EK8 A;  1KWO C;  3CZT X;  2LAP A;  3IQQ A;  4MRY A;  2KSP A;  2Y1M A;  2LVI A;  1UHN A;  3FS7 A;  3FWB A;  2BL0 C;  5CPV A;  4C0L A;  1OOH A;  2H61 A;  3DVJ A;  3K1E A;  3SG2 A;  1AVS A;  1PUL A;  4INW A;  2KFH A;  3B87 A;  1TUJ A;  2KAY A;  3D10 A;  1SL9 A;  3HX4 A;  4DUQ A;  4PAL A;  3SS5 A;  4GBA A;  1LA3 A;  2BCA A;  3BUO B;  1QLK A;  4A4B A;  1HT9 A;  3I5G C;  4GFT A;  1YVL A;  5PAL A;  4ORC B;  4Q04 A;  1IWQ A;  2ZKM X;  3AKB A;  1CFD A;  1BMO A;  1TRF A;  3N7H A;  2NXQ A;  3CTN A;  1W9Z A;  2LM5 A;  3TZ1 A;  5K89 A;  2PMY A;  3PN7 C;  1CDN A;  2GV5 A;  3BOW A;  3TDZ A;  1K9P A;  1MHO A;  1OOI X;  1T14 A;  4HRH A;  2Y1N A;  5FYX A;  1Y6W A;  1DJZ A;  2WCB A;  2BCX A;  4GGN A;  5D3O A;  1Y0V H;  2LUX A;  2NCO A;  1RJV A;  4CID A;  5BPJ A;  3S0E A;  3ZWH A;  5I2O A;  2AUC A;  3LK1 A;  1UHI A;  2MAZ A;  2RGI A;  3D76 A;  1TNX A;  3SG7 A;  1B8C A;  1SCV A;  2PSR A;  1HQV A;  3BUW B;  1NIW A;  3AAK A;  1UHK A;  1XFV O;  2QAC A;  4INX A;  1V1F A;  2EHB A;  4USL A;  2MRD A;  1WDC B;  2JZI A;  2WCK A;  3SJS A;  3H4S E;  1K9K A;  5DKQ A;  1QVI Z;  3NHT A;  3UNW A;  4YI9 A;  3VRP A;  3A4U B;  1V1G A;  2TN4 A;  1FW4 A;  4YRU A;  4M2P A;  1CDP A;  1CDL A;  3BUM B;  4CFR A;  1UHJ A;  1IH0 A;  1SY9 A;  1M39 A;  1W7J B;  3VRN A;  4GGF C;  1ALW A;  1QAS A;  1IQ3 A;  5FI6 A;  2IS9 A;  3I5F C;  1U5I B;  2L50 A;  3SG6 A;  3WXA A;  2OPO A;  3LK0 A;  2F2O A;  3EKJ A;  3Q8I A;  1DC1 A;  1KWO B;  1SMG A;  2KGB C;  1S6C A;  3OX6 A;  2BL0 B;  5KSZ A;  3EK4 A;  5HLO A;  4YGD B;  3PLF B;  4YI8 A;  1YR5 A;  1K2H A;  2E30 A;  2JU0 A;  1Z2C B;  5J3X A;  1EH2 A;  1FF1 A;  4MEW A;  2WC5 A;  1NPQ A;  3BUX B;  2KYC A;  4N1G A;  3PAL A;  4MLW A;  5AAN A;  3I5G B;  1XFU O;  3D75 A;  2YGU A;  1F8H A;  2V53 A;  2LHI A;  3EVV A;  4PE1 A;  1B8L A;  3WHT B;  1C3Z A;  3CZ0 A;  3OHM B;  2K61 A;  3RM1 A;  4YGA A;  3PN7 B;  1BR4 B;  2JOJ A;  3NHI A;  1SR6 C;  2AAO A;  1S6J A;  4FTG A;  2BNX A;  1S26 D;  2ZFD A;  1S5G Y;  1MXE A;  1PSB A;  2PAS A;  2MJW B;  1FPW A;  3DD4 A;  3IF7 A;  2L4H A;  2G9B A;  1S6I A;  2M0R A;  2QEV A;  1JUO A;  4A4C A;  2P71 A;  1F70 A;  4KYN A;  2K8M B;  2M29 A;  2VRG A;  4JKT A;  1JFJ A;  1TWO A;  1YUT A;  1JF2 A;  2LMU A;  2I18 A;  3EG5 B;  3D73 A;  3DF0 B;  4GPL B;  1KQM B;  4ICB A;  4JQ0 D;  4WQ3 A;  1D1O A;  2WC6 A;  4DRW A;  3FE6 A;  2JPT A;  2HQ8 A;  3SG3 A;  1JSA A;  1A03 A;  1R2U A;  3O4X A;  4OR9 B;  1AK8 A;  2LLT A;  2LHL A;  1H8B A;  1SL7 A;  1R6P A;  1YRU B;  5CSN A;  1KFU S;  2JXL A;  3CLN A;  1B7T Z;  1L2O C;  1FI5 A;  2NZ0 A;  3IVT A;  4CLN A;  1ZUZ A;  1DEK A;  3I5F B;  1TCO B;  3FWC A;  3F45 A;  2I94 A;  3BJH A;  1JFK A;  3SG5 A;  1OOJ A;  1A29 A;  3ZNI A;  1TOP A;  4I5N B;  1TCF A;  2M3W A;  1SNL A;  1DT7 B;  2LLU A;  2KI6 C;  3CYZ A;  1K8U A;  3DVM A;  3O4Y A;  3O78 A;  1XFX O;  1J7R A;  1Y1X A;  1MR8 A;  2KNE A;  1GGZ A;  1DQE A;  1IRJ A;  1F4Q A;  4QJ5 B;  2BKH B;  1ZAC A;  3DXL A;  1Q80 A;  1NX3 A;  3BUN B;  5HKW A;  4E68 A;  4I5J A;  3L4A A;  5FI2 A;  3VGO A;  2K2A A;  3OB1 B;  4PHN A;  4AQJ A;  4PE0 A;  1KSM A;  1ZFS A;  1QX2 A;  1CM1 A;  3QME A;  3S0G A;  4BY5 A;  3NSK A;  1GM0 A;  2WCL A;  1NYA A;  2MA2 A;  1X02 A;  2JC2 A;  1DJW A;  1CLL A;  1RTP 1;  3O2P A;  3ICB A;  1DTL A;  3OB2 B;  3SG4 A;  4F7F A;  2HPS A;  1IJ5 A;  2L5Y A;  4F0Z B;  3O6B A;  2WC8 A;  3RZS A;  2LMV A;  3D78 A;  2ISD A;  1EJ3 A;  1TN4 A;  1CMG A;  1S1E A;  4MVF A;  2PRU A;  1GJY A;  2LP2 A;  5HYD A;  2L2C A;  4ZCV A;  1RWY A;  3B88 A;  4DCK A;  1MUX A;  2NCP A;  2PAL A;  3JTD C;  1CKK A;  3I5I C;  1NX0 A;  2L98 A;  4U8D A;  2KI4 B;  2LV7 A;  4PCW A;  1A75 B;  2KDH A;  1N2D A;  2H2K A;  2JUL A;  2WCJ A;  4DIR A;  2EC6 C;  1KQV A;  2FCD A;  1DEL A;  1J7O A;  5GQQ C;  3VRQ A;  5I2L A;  4M2O A;  1KFX L;  2H61 C;  1L2O B;  2F3Y A;  1QXP A;  4AQI A;  3BFB A;  2F33 A;  1Y1U A;  3PFV A;  4I5K A;  1NUB A;  2JT8 A;  3NSO A;  4IJ7 A;  3PAT A;  2K60 A;  2LVJ A;  2CXJ A;  1DF0 B;  1XA5 A;  1YUS A;  3GK1 A;  1QIW A;  3B6X A;  5AFP A;  1DMO A;  2OS8 C;  3CAB A;  2MBX A;  1REC A;  1CMF A;  1YVH A;  1YTZ C;  4C0K A;  1ZMZ A;  2JRF A;  1DGV A;  1QX7 A;  1L7Z A;  4DS7 A;  3NXA A;  2O5G A;  3R1O A;  4P5O E;  1NP8 A;  2BE6 A;  2DOQ A;  1IG5 A;  4XJK B;  1BOD A;  3NGV A;  1B9A A;  1ZOT B;  1JBA A;  1N0Y A;  3QRX A;  1DJG A;  2LAN A;  3CR5 X;  5FI7 A;  2FCE A;  2WCF A;  5ER5 A;  4UPG A;  1OW4 A;  1CLB A;  2JNX A;  1UWO A;  1F54 A;  3LCP C;  2KLE A;  2QEB A;  1BG1 A;  3KO0 A;  2CBL A;  3GK2 A;  2MHH A;  3NSL A;  3FE8 A;  1OQP A;  1SPY A;  2K7D A;  1F71 A;  1YX7 A;  2CNP A;  3OBV A;  2JT0 A;  2ERB A;  1B8R A;  1W7I B;  4IL1 A;  1AP4 A;  3FE9 A;  1C7V A;  2QEH A;  2BKI B;  2WND A;  2KI6 D;  1BJF A;  2BBN A;  3JVT C;  2GTE A;  3JTD B;  1UHH A;  1WRZ A;  3I5I B;  1J1E A;  1CFP A;  2JT3 A;  3LL8 B;  2L2E A;  2LMT A;  2JWW A;  1EL4 A;  1C07 A;  2M1U A;  3VRO A;  1NCZ A;  2B1U A;  2LUC A;  3R72 A;  2M8U A;  1LKJ A;  1PSR A;  2ZN8 A;  3SS3 A;  1GQM A;  1SW8 A;  1XFY O;  1EG4 A;  3D74 A;  1SYM A;  4MZJ A;  1MXL C;  1NCX A;  1OOG A;  3L4L A;  4ORB B;  1PVB A;  3EVR A;  2KQ6 A;  3HCM A;  2KGR A;  1PK0 D;  2Q4U A;  2WCE A;  1A2X A;  5EL2 A;  4C0J A;  1LA0 A;  1KK8 C;  3D77 A;  2KQY A;  1J55 A;  1JWD A;  3TDU A;  2BCB A;  1DGU A;  1N65 A;  1S5G Z;  2P70 A;  1SCM C;  1OSA A;  2PQL A;  2OS8 B;  2M1K B;  1TUZ A;  1LVC D;  1AHR A;  3LLE A;  1KFU L;  3IQO A;  4OV2 A;  2KHN A;  1S36 A;  3OGN A;  1TTX A;  3S0D A;  3CZ1 A;  1PVA A;  3S0A A;  3RLZ A;  1SL8 A;  3BOW B;  1U5I A;  1GGW A;  2R2I A;  3M0W A;  1J7Q A;  3PSR A;  5ER4 X;  4CFQ A;  2KOT A;  1BF5 A;  1XK4 A;  2L51 A;  2BE4 A;  2NLN A;  4XJK A;  1RK9 A;  1YUR A;  3TUY C;  1MF8 B;  4MBE A;  1XFW O;  3KEV A;  1AJ4 A;  2F3Z A;  2WOS A;  1K96 A;  2JPO A;  2KFF A;  2KBM A;  4ETO A;  2ZND A;  4NDD A;  1ALV A;  1XFR A;  3WHU B;  2Y5I A;  1YUU A;  1JC2 A;  4HRG A;  2SAS A;  3AAJ A;  5HLV A;  1JF0 A;  2M7N A;  3OP0 A;  4HSZ A;  3VRR A;  3UO9 A;  5AER A;  3BXK A;  4GUK A;  4FQO A;  4WQ2 A;  2A4J A;  5I8N A;  3DY9 A;  1QJT A;  3AKA A;  3GOF A;  1QV0 A;  3EVU A;  1M45 A;  1F4O A;  3JVT B;  1CFC A;  1SR6 B;  3SIB A;  1IGV A;  2CCM A;  2K7O A;  2BBM A;  1WLZ A;  2LP3 A;  4MSP A;  1YRT B;  3S0B A;  4CPV A;  5CSF A;  1K90 D;  3BFA A;  4FQT A;  5TNC A;  1IKU A;  1KK7 Z;  5CSI A;  2CT9 A;  3EKH A;  1Z4H A;  5JJG A;  4MZK A;  1J7P A;  4L9M A;  5DKN A;  2F2P A;  5KTY A;  1WLM A;  5D7F A;  3R1P A;  1OZO A;  1NSH A;  4HRE E;  2HET A;  1NX2 A;  1K93 D;  1NX1 A; 
#chains in the Genus database with same CATH homology
 1BU3 A;  4N1F A;  4QJ4 B;  1KK8 B;  4MRX A;  3DF0 A;  3SIA A;  3BQ3 A;  4MZL A;  4OVN F;  3DVK A;  1CTR A;  2JTZ A;  1SCM B;  1UP5 A;  2K7C A;  2ZNE A;  4OKH A;  1BT6 A;  2O60 A;  2SCP A;  2FJU B;  2ZN9 A;  1OE9 B;  2EGD A;  4GGF A;  1BLQ A;  1K94 A;  1LXF C;  4TNC A;  3CR2 A;  1CB1 A;  2E6W A;  1QVI Y;  1QX5 B;  5CSJ A;  3CGA A;  1M31 A;  1TNQ A;  1UUS A;  1CM4 A;  3I5H C;  4PHM A;  4YGE B;  4XYN A;  3GK4 X;  3TUY B;  1K95 A;  3OX5 A;  3EK7 A;  5F6T A;  1FBV A;  2HQW A;  1SRA A;  2K2F A;  3CWG A;  4I5L B;  5G08 A;  1KFX S;  1K9U A;  1ODB A;  1Y1A A;  2FOT A;  2KFG A;  1XYD A;  1PAL A;  3D0Y B;  1KQM C;  2LLS A;  5AEQ A;  4OCI A;  1EXR A;  2COL B;  3MSE B;  2OTG C;  4WRI A;  1CDM A;  1RRO A;  1OMD A;  5B8I B;  2LVK A;  3WNX B;  5JOL A;  1F55 A;  1XO5 A;  1A4P A;  2L0P A;  4YBH B;  4AOM A;  3DVE A;  1B4C A;  2K0J A;  2JTT A;  2LC5 A;  1DJI A;  1CFF A;  4N5X A;  1CLM A;  1H4B A;  3KPX A;  4YGB B;  1DJY A;  1PRW A;  1WY9 A;  1M46 A;  2ZRT A;  1MQ1 A;  2GGM A;  1XFZ O;  2CTN A;  4JWQ A;  2P6B B;  4PE7 A;  2PVB A;  3PM8 A;  4NDB A;  1VRK A;  1NWD A;  1QAT A;  3C1V A;  4R1E A;  5DKR A;  4ZCU A;  2EC6 B;  2I2R E;  1A75 A;  3TS5 C;  4QJ3 B;  1QS7 A;  1YX8 A;  4M2Q A;  4NQG A;  5D69 A;  1AUI B;  1QIV A;  4PE4 A;  1OMR A;  4PDZ A;  1G33 A;  2KAV A;  2ZRS A;  2JQ6 A;  4GNK B;  2QPT A;  4MN0 A;  2M97 A;  1KCY A;  2LCP A;  1G8I A;  2F8P A;  4GAO A;  1EG3 A;  1AJ5 A;  1QV1 A;  2D8N A;  3BYA A;  1MWN A;  1DJX A;  1M63 B;  1WRK A;  1DF0 A;  1UUR A;  3I5H B;  2M7L A;  2K7B A;  1BOC A;  2JXC A;  1OMV A;  1S3P A;  2JNF A;  1IJ6 A;  4PHK A;  2I7A A;  1B7T Y;  1OZS A;  1BR1 B;  3CS1 A;  1WRL A;  2AMI A;  1IQ5 A;  1NCY A;  1CNP A;  1TNP A;  1RFJ A;  2L5X B;  2KAX A;  2KBI A;  1DJH A;  1LIN A;  1TNW A;  2KI4 C;  3KF9 A;  2WOR A;  2MLF C;  1TIZ A;  3D0Y A;  3TDI A;  1KSO A;  1SKT A;  3KHE A;  2OTG B;  4BY4 A;  2LNK A;  2LVV A;  2G2B A;  1QLS A;  1SBJ A;  4D1E A;  5KU1 A;  1FI6 A;  1SK6 D;  2Y4Q A;  2M49 B;  1C7W A;  3NSI A;  5IBW A;  4NDC A;  1E8A A;  1XVJ A;  1WDC C;  4P2Y B;  1B47 A;  5HKY A;  5AXI A;  3A8R A;  1QTX A;  4PHJ A;  3E3R A;  4ORA B;  2Q91 A;  2L4I A;  2BEC A;  2KYF A;  5I2Q A;  2M9G A;  3FIA A;  4JPZ B;  3CR4 X;  3TS5 B;  2GGZ A;  4YGC B;  1DVI A;  1G4Y R;  2HF5 A;  1J1D A;  3K21 A;  5HKZ A;  2MLE C;  1B1G A;  1KK7 Y;  2LE9 B;  1XK4 C;  3EK8 A;  1KWO C;  3CZT X;  2LAP A;  3IQQ A;  4MRY A;  2KSP A;  2Y1M A;  2LVI A;  1UHN A;  3FS7 A;  3FWB A;  2BL0 C;  5CPV A;  4C0L A;  2H61 A;  3DVJ A;  3SG2 A;  1AVS A;  1PUL A;  2KFH A;  2KAY A;  3D10 A;  3HX4 A;  1SL9 A;  4DUQ A;  4PAL A;  4GBA A;  1LA3 A;  2BCA A;  3BUO B;  1QLK A;  4A4B A;  1HT9 A;  3I5G C;  4GFT A;  1YVL A;  5PAL A;  4ORC B;  4Q04 A;  1IWQ A;  2ZKM X;  3AKB A;  1CFD A;  1BMO A;  1TRF A;  2NXQ A;  3CTN A;  2LM5 A;  3TZ1 A;  5K89 A;  2PMY A;  3PN7 C;  1CDN A;  2GV5 A;  3BOW A;  3TDZ A;  1K9P A;  1MHO A;  4HRH A;  5FYX A;  2Y1N A;  1Y6W A;  1DJZ A;  2WCB A;  2BCX A;  4GGN A;  1J7P A;  1Y0V H;  2LUX A;  2NCO A;  1RJV A;  4CID A;  5BPJ A;  3ZWH A;  5I2O A;  2AUC A;  3LK1 A;  1UHI A;  2MAZ A;  2RGI A;  1TNX A;  3SG7 A;  1B8C A;  1SCV A;  2PSR A;  1HQV A;  3BUW B;  1NIW A;  3AAK A;  1UHK A;  1XFV O;  2QAC A;  1V1F A;  2EHB A;  4USL A;  2MRD A;  1WDC B;  2JZI A;  3SJS A;  3VRN A;  3H4S E;  1K9K A;  5DKQ A;  1QVI Z;  4YI9 A;  3VRP A;  3A4U B;  1V1G A;  2TN4 A;  1FW4 A;  4YRU A;  4M2P A;  1CDP A;  1CDL A;  3BUM B;  4CFR A;  1UHJ A;  1IH0 A;  1SY9 A;  1M39 A;  1W7J B;  4GGF C;  1ALW A;  1QAS A;  1IQ3 A;  3SG6 A;  2IS9 A;  3I5F C;  1U5I B;  2L50 A;  3WXA A;  2OPO A;  3LK0 A;  2F2O A;  3EKJ A;  1KWO B;  1SMG A;  2KGB C;  1S6C A;  3OX6 A;  2BL0 B;  5KSZ A;  3EK4 A;  5HLO A;  4YGD B;  3PLF B;  4YI8 A;  1YR5 A;  1K2H A;  2E30 A;  2JU0 A;  5J3X A;  1EH2 A;  1FF1 A;  4MEW A;  3BUX B;  1NPQ A;  2KYC A;  4N1G A;  3PAL A;  4MLW A;  5AAN A;  3I5G B;  1XFU O;  1F8H A;  2V53 A;  2LHI A;  3EVV A;  4PE1 A;  1B8L A;  3WHT B;  3OHM B;  2K61 A;  3RM1 A;  4YGA A;  3PN7 B;  1BR4 B;  2JOJ A;  1SR6 C;  2AAO A;  1S6J A;  4FTG A;  2ZFD A;  1S26 D;  1S5G Y;  1MXE A;  1PSB A;  2PAS A;  2MJW B;  1FPW A;  3DD4 A;  3IF7 A;  2L4H A;  2G9B A;  1S6I A;  2M0R A;  1JUO A;  4A4C A;  1F70 A;  2K8M B;  2M29 A;  2VRG A;  1JFJ A;  1YUT A;  1JF2 A;  2LMU A;  2I18 A;  4GPL B;  1D1O A;  3DF0 B;  4JQ0 D;  1KQM B;  4ICB A;  4WQ3 A;  4DRW A;  2JPT A;  2HQ8 A;  3SG3 A;  1JSA A;  1A03 A;  1R2U A;  4OR9 B;  1AK8 A;  2LLT A;  2LHL A;  1H8B A;  1SL7 A;  1R6P A;  1YRU B;  5CSN A;  1KFU S;  2JXL A;  3CLN A;  1B7T Z;  1L2O C;  1FI5 A;  2NZ0 A;  4CLN A;  1ZUZ A;  3I5F B;  1TCO B;  3FWC A;  3F45 A;  2I94 A;  1JFK A;  3SG5 A;  1OOJ A;  1A29 A;  3ZNI A;  1TOP A;  4I5N B;  1TCF A;  2M3W A;  1SNL A;  1DT7 B;  2LLU A;  2KI6 C;  1K8U A;  3DVM A;  3O4Y A;  3O78 A;  1XFX O;  1J7R A;  1Y1X A;  1MR8 A;  2KNE A;  1GGZ A;  1IRJ A;  1F4Q A;  4QJ5 B;  2BKH B;  1ZAC A;  1Q80 A;  1NX3 A;  3BUN B;  5HKW A;  4E68 A;  4I5J A;  3VGO A;  2K2A A;  3OB1 B;  4PHN A;  4AQJ A;  4PE0 A;  1KSM A;  1ZFS A;  1QX2 A;  1CM1 A;  4BY5 A;  3NSK A;  1NYA A;  2MA2 A;  1X02 A;  2JC2 A;  1DJW A;  1CLL A;  1RTP 1;  3O2P A;  3ICB A;  1DTL A;  3OB2 B;  3SG4 A;  2HPS A;  1IJ5 A;  4F0Z B;  3O6B A;  2WC8 A;  2LMV A;  2ISD A;  1EJ3 A;  1TN4 A;  1CMG A;  1S1E A;  4MVF A;  2PRU A;  1GJY A;  2LP2 A;  5HYD A;  4ZCV A;  1RWY A;  4DCK A;  1MUX A;  2NCP A;  2PAL A;  3JTD C;  1CKK A;  3I5I C;  1NX0 A;  2L98 A;  4U8D A;  2KI4 B;  2LV7 A;  4PCW A;  1A75 B;  2KDH A;  1N2D A;  2H2K A;  2JUL A;  4DIR A;  2EC6 C;  1KQV A;  2FCD A;  1J7O A;  5GQQ C;  3VRQ A;  5I2L A;  4M2O A;  1KFX L;  2H61 C;  1L2O B;  2F3Y A;  1QXP A;  4AQI A;  2F33 A;  1Y1U A;  3PFV A;  4I5K A;  1NUB A;  2JT8 A;  3NSO A;  3PAT A;  2LVJ A;  2CXJ A;  1DF0 B;  1XA5 A;  1YUS A;  3GK1 A;  1QIW A;  5AFP A;  1DMO A;  2OS8 C;  2MBX A;  1CMF A;  1REC A;  1YVH A;  1YTZ C;  4C0K A;  1ZMZ A;  2JRF A;  1DGV A;  1QX7 A;  1L7Z A;  4DS7 A;  3NXA A;  2O5G A;  4P5O E;  1NP8 A;  2BE6 A;  2DOQ A;  1IG5 A;  4XJK B;  1BOD A;  1B9A A;  1ZOT B;  1JBA A;  1N0Y A;  3QRX A;  1DJG A;  2LAN A;  3CR5 X;  2FCE A;  2WCF A;  5ER5 A;  4UPG A;  1CLB A;  2JNX A;  1UWO A;  1F54 A;  3LCP C;  1BG1 A;  3KO0 A;  2CBL A;  3GK2 A;  2MHH A;  3NSL A;  1OQP A;  1SPY A;  2K7D A;  1F71 A;  1YX7 A;  2CNP A;  2JT0 A;  1B8R A;  1W7I B;  4IL1 A;  1AP4 A;  1C7V A;  2BKI B;  2WND A;  2KI6 D;  1BJF A;  2BBN A;  3JVT C;  3JTD B;  1UHH A;  1WRZ A;  3I5I B;  1J1E A;  1CFP A;  2JT3 A;  3LL8 B;  2L2E A;  2LMT A;  2JWW A;  1EL4 A;  1C07 A;  2M1U A;  3VRO A;  1NCZ A;  2B1U A;  2LUC A;  2M8U A;  1LKJ A;  1PSR A;  2ZN8 A;  1GQM A;  1SW8 A;  1XFY O;  1EG4 A;  1SYM A;  4MZJ A;  1MXL C;  1NCX A;  4ORB B;  1PVB A;  3EVR A;  2KQ6 A;  3HCM A;  2KGR A;  1PK0 D;  2Q4U A;  2WCE A;  1A2X A;  4C0J A;  1LA0 A;  1KK8 C;  2KQY A;  1J55 A;  1JWD A;  3TDU A;  2BCB A;  1DGU A;  1N65 A;  1S5G Z;  1SCM C;  1OSA A;  2OS8 B;  2M1K B;  1LVC D;  1AHR A;  3LLE A;  1KFU L;  3IQO A;  4OV2 A;  2KHN A;  1S36 A;  1TTX A;  1PVA A;  3RLZ A;  1SL8 A;  3BOW B;  1U5I A;  1GGW A;  2R2I A;  3M0W A;  1J7Q A;  3PSR A;  5ER4 X;  4CFQ A;  2KOT A;  1BF5 A;  1XK4 A;  2L51 A;  2BE4 A;  2NLN A;  4XJK A;  1RK9 A;  1YUR A;  3TUY C;  1MF8 B;  4MBE A;  1XFW O;  3KEV A;  1AJ4 A;  2F3Z A;  2WOS A;  1K96 A;  2KFF A;  2KBM A;  4ETO A;  2ZND A;  4NDD A;  1ALV A;  3WHU B;  2Y5I A;  1YUU A;  1JC2 A;  4HRG A;  2SAS A;  3AAJ A;  5HLV A;  1JF0 A;  2M7N A;  3OP0 A;  4HSZ A;  3VRR A;  5AER A;  3BXK A;  4GUK A;  4FQO A;  4WQ2 A;  2A4J A;  5I8N A;  1QJT A;  3AKA A;  3GOF A;  1QV0 A;  3EVU A;  1M45 A;  1F4O A;  3JVT B;  1CFC A;  1SR6 B;  3SIB A;  1IGV A;  2CCM A;  2K7O A;  2BBM A;  1WLZ A;  2LP3 A;  4MSP A;  1YRT B;  4CPV A;  5CSF A;  1K90 D;  5TNC A;  1IKU A;  1KK7 Z;  5CSI A;  2CT9 A;  3EKH A;  5JJG A;  4MZK A;  4L9M A;  5DKN A;  2F2P A;  5KTY A;  1WLM A;  5D7F A;  1OZO A;  1NSH A;  4HRE E;  2HET A;  1NX2 A;  1K93 D;  1NX1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...