2SASA

Structure of a sarcoplasmic calcium-binding protein from amphioxus refined at 2.4 angstroms resolution
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
185
structure length
185
Chain Sequence
GLNDFQKQKIKFTFDFFLDMNHDGSIQDNDFEDMMTRYKEVNKGSLSDADYKSMQASLEDEWRDLKGRADINKDDVVSWEEYLAMWEKTIATCKSVADLPAWCQNRIPFLFKGMDVSGDGIVDLEEFQNYCKNFQLQCADVPAVYNVITDGGKVTFDLNRYKELYYRLLTSPAADAGNTLMGQKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a sarcoplasmic calcium-binding protein from amphioxus refined at 2.4 A resolution.
pubmed doi rcsb
source organism Branchiostoma lanceolatum
molecule tags Calcium-binding protein
molecule keywords SARCOPLASMIC CALCIUM-BINDING PROTEIN
total genus 66
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 1993-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2sasA00
5HKZA 4OV2A 2I18A 4AQJA 2LANA 2KAVA 2NZ0A 1BLQA 2L51A 2WOSA 1FPWA 1PVAA 2JXCA 5HKWA 1AP4A 1WRZA 4MBEA 4YGDB 1B47A 2L4HA 3FWBA 4PE4A 3NSOA 1KK8C 1KQVA 1TTXA 1QVIZ 2KGBC 2KBMA 2TN4A 1RROA 4PHJA 1RJVA 5D7FA 2KAXA 1ALWA 5D69A 2LLTA 3C1VA 5CSIA 4QJ4B 1SR6B 1WRKA 3PATA 2CXJA 1KWOC 4I5LB 1RFJA 3WXAA 2JQ6A 3IQQA 1TNQA 1Y1XA 2QACA 1QXPA 4YGAA 4YRUA 3BOWA 4BY4A 5DKQA 5DKNA 3I5IC 2MA2A 2GGZA 1SL9A 2L4IA 1KK7Y 1V1FA 2ZNEA 1B8LA 3KHEA 3CTNA 3AAJA 1KWOB 2Q91A 2NXQA 4YBHB 2MHHA 1YR5A 4OVNF 5HKYA 1IKUA 1CMFA 4GPLB 3KEVA 2KOTA 1XFUO 1RECA 2CTNA 1K2HA 1TNXA 5KTYA 2EHBA 3E3RA 1ZUZA 2LNKA 4XJKA 1YUTA 2QPTA 1JFJA 2E6WA 1M39A 1G8IA 1FBVA 2NCOA 1IJ6A 1LXFC 2BCAA 1JUOA 2I2RE 2JT3A 2JZIA 1Q80A 1Y6WA 1QLSA 4M2QA 3SG2A 2ZRTA 1WY9A 1PSRA 4HSZA 4OR9B 4QJ3B 1TCOB 1WLZA 3ZWHA 1OZOA 3O4YA 1IQ5A 1W7JB 2DOQA 1WRLA 1AUIB 1KK8B 2BCBA 1BJFA 2PMYA 1C7VA 1CB1A 1YRTB 2KDHA 1DJGA 2HPSA 4PCWA 1DF0B 4MRXA 3SG3A 1CM1A 2H2KA 4CPVA 2HF5A 1AJ4A 3GK2A 3GK1A 4YGCB 3DVMA 2M8UA 4R1EA 4WRIA 1DJXA 3CWGA 5HLVA 1OMVA 1S3PA 2KGRA 2M9GA 1H4BA 1AHRA 5HLOA 3MSEB 4XYNA 5CSFA 5K89A 2IS9A 2K7BA 2D8NA 2ZN8A 4JPZB 4N1FA 1MUXA 4OKHA 1CDPA 1D1OA 2COLB 1K96A 3K21A 4JWQA 1QX5B 1ZFSA 2KI6C 1K93D 1F4QA 2EC6C 2JTTA 1CDNA 3IF7A 4C0LA 1XK4A 5AFPA 3D0YA 1L7ZA 1S5GY 2AUCA 3OX5A 4PDZA 2MRDA 3OB1B 1DF0A 5TNCA 3VRRA 4GGFC 1N0YA 3JVTB 1R2UA 1QV1A 2LVJA 1HT9A 1BT6A 1UURA 2M1UA 1CDLA 3EK4A 3SG5A 1MXLC 5I2LA 1DVIA 5BPJA 2LV7A 2WORA 1SCMB 1LA3A 5GQQC 3LK0A 1OMDA 2I7AA 1GGZA 1CFFA 3DF0B 3OP0A 1EH2A 3GOFA 1R6PA 3SG7A 1NCZA 3DVKA 4GGFA 1TNWA 2BECA 2L98A 1RWYA 1QLKA 4HREE 4C0JA 3NSIA 2PRUA 4USLA 4XJKB 1B8CA 1EG4A 4N5XA 1QX7A 2LVIA 5I2QA 1OE9B 1PALA 4YI9A 1DGUA 1TIZA 3CLNA 2O60A 2MAZA 1M46A 4Q04A 4MRYA 1FF1A 3A4UB 3AKAA 1AVSA 1G4YR 5AANA 1SCMC 1K8UA 2K2AA 1QS7A 1BODA 3CR5X 2K0JA 2KBIA 1G33A 1CLLA 2CT9A 1KCYA 1LA0A 3JVTC 2LC5A 3PALA 2KYCA 1J55A 1MWNA 1C07A 1F55A 3EVVA 1B4CA 2K8MB 1NIWA 1PK0D 2KFGA 1QJTA 5FYXA 1AJ5A 4UPGA 3EKJA 2JT8A 2BKIB 3FIAA 5CSNA 1L2OB 2HETA 1UHHA 4YGBB 5DKRA 3I5FC 1DGVA 2SASA 1SPYA 2KQ6A 1HQVA 1C7WA 1EL4A 4WQ3A 1BF5A 3LL8B 2LAPA 1CMGA 3NXAA 2I94A 2PSRA 2OTGB 4GUKA 2KQYA 4ORAB 2VRGA 2JULA 4P5OE 1UHIA 1KFXS 2CNPA 2M0RA 2BE6A 1ZACA 1NYAA 1K94A 3D0YB 5AEQA 2KAYA 3SIBA 1N65A 2AMIA 1CLBA 1DJIA 1VRKA 1B8RA 1SRAA 1Y1UA 1J7PA 1K95A 2SCPA 1Y0VH 2K7DA 2M1KB 2KI6D 2JU0A 1XFYO 1LINA 4GNKB 1IRJA 2G9BA 3PN7B 1F4OA 2K7OA 1A29A 1SNLA 5CPVA 2LVVA 3SJSA 3BUOB 3ICBA 1SW8A 2KI4B 4AQIA 2HQWA 1A4PA 3I5GC 2BBMA 1OQPA 1UHJA 2Q4UA 3TS5B 2JWWA 1TCFA 1QIWA 1BOCA 4GGNA 1EJ3A 2M49B 1GGWA 2R2IA 1M31A 3I5HB 1SY9A 1QV0A 3TUYB 3VGOA 2FJUB 4HRHA 1NSHA 2BKHB 3LLEA 1SMGA 4U8DA 2M7LA 1YUSA 1DJYA 4F0ZB 3M0WA 1SCVA 4BY5A 2LLUA 2M29A 3OHMB 2WC8A 1X02A 4PE7A 1A75B 1XK4C 5B8IB 1ODBA 1SL7A 3O78A 1BG1A 2LCPA 3GK4X 1M63B 1SBJA 4IL1A 1EXRA 4M2PA 3EK8A 3EVRA 1TN4A 2LVKA 4TNCA 5AXIA 4NDCA 3BQ3A 4GBAA 4C0KA 1MXEA 2LUXA 1NX2A 2L5XB 2F2PA 4DCKA 2E30A 1GQMA 1QVIY 4PHNA 3F45A 3VRQA 1XYDA 1N2DA 4I5KA 1QASA 1NP8A 1SYMA 2H61C 2LLSA 5AERA 4ICBA 1J7QA 3VRNA 4FQOA 1YX8A 2WCEA 1V1GA 4YI8A 2GV5A 3SG6A 2ZN9A 3SG4A 4ORCB 1QTXA 3FS7A 1KFXL 1JF2A 1Y1AA 4YGEB 3KO0A 1S26D 1XFXO 2K61A 1PVBA 2KYFA 2MBXA 3NSKA 3EK7A 1KQMC 3DVEA 4CFQA 1CM4A 1UUSA 4DS7A 1QX2A 1SK6D 1CTRA 1NPQA 1NCXA 1MF8B 1ALVA 1JF0A 1OZSA 1CFDA 3KPXA 3I5HC 3IQOA 3CR2A 1U5IA 2CBLA 1WDCB 2JNXA 3DD4A 3D10A 1IJ5A 4MVFA 1K9UA 1NWDA 1DMOA 1ZMZA 2WCBA 4PALA 1YTZC 2K7CA 3TS5C 1LKJA 1XFVO 1CLMA 4E68A 1FW4A 1UP5A 1MQ1A 1XFZO 1MR8A 2OPOA 2AAOA 1A03A 5KU1A 1SR6C 3CR4X 3KF9A 1NUBA 2EC6B 4CIDA 1A75A 1S1EA 3JTDC 3PN7C 1CNPA 1FI6A 1CFCA 2FCDA 1LVCD 3SIAA 4DIRA 2ISDA 2Y5IA 1K90D 1CDMA 4MZKA 2KNEA 3I5GB 1PULA 1WDCC 2ZNDA 3JTDB 3DVJA 3CZTX 3EKHA 2F2OA 2Y1NA 5PALA 4PHMA 1KFUS 3TDIA 1JBAA 1TOPA 1JSAA 1XA5A 1DTLA 5F6TA 1XVJA 2FOTA 2L0PA 4A4CA 1UWOA 2LP3A 1YUUA 1RTP1 2KFFA 2L50A 2JXLA 3PM8A 3BXKA 2OS8B 3AKBA 2MLFC 4GAOA 4ETOA 4WQ2A 1NX0A 2M7NA 4FTGA 4MZJA 2A4JA 4M2OA 4QJ5B 4MN0A 1M45A 1BMOA 1KFUL 3TZ1A 1IG5A 3TDUA 4MLWA 1RK9A 3HX4A 4MZLA 5HYDA 3A8RA 1NCYA 3LK1A 1CFPA 1YVLA 2CCMA 5CSJA 1KQMB 1OMRA 1ZOTB 2JNFA 2P6BB 4PE0A 1YX7A 2OTGC 2Y4QA 2LHLA 2RGIA 1KSMA 2WCFA 1MHOA 3PFVA 5ER5A 1IH0A 3I5FB 1JFKA 2JOJA 3QRXA 5I8NA 3NSLA 2KHNA 3LCPC 1L2OC 5I2OA 4NDDA 5G08A 1QIVA 5JOLA 1E8AA 1SKTA 2LMTA 1S6IA 2BE4A 4DRWA 1PSBA 2M3WA 1K9PA 3BUWB 3AAKA 1S6JA 4I5NB 1JWDA 3DF0A 1GJYA 1F54A 3BYAA 4MEWA 1OOJA 4CLNA 2NLNA 3HCMA 2LM5A 2PALA 3PLFB 3VRPA 4CFRA 3OB2B 1S36A 2LMVA 3TDZA 1NX1A 3WHUB 5KSZA 1DJZA 1UHKA 2LHIA 1F71A 3RLZA 1S5GZ 2KSPA 1OSAA 3O6BA 1DT7B 1F8HA 1KK7Z 2ZKMX 2G2BA 3OX6A 2K2FA 1NX3A 2MLEC 1PRWA 1B1GA 5IBWA 1UHNA 1A2XA 4MSPA 1EG3A 3I5IB 2JT0A 2V53A 3H4SE 1TRFA 4JQ0D 1YRUB 4ZCVA 2F3ZA 3WNXB 3WHTB 1TNPA 1F70A 1J1DA 2KI4C 3CGAA 1CKKA 1YURA 3CS1A 4PHKA 5JJGA 1B7TZ 3TUYC 2EGDA 1U5IB 2JTZA 2F33A 4NDBA 4ORBB 2L2EA 2PVBA 4L9MA 4ZCUA 3ZNIA 2BBNA 3PSRA 4OCIA 2H61A 1FI5A 2LE9B 1B9AA 1BU3A 4I5JA 4DUQA 4D1EA 2HQ8A 4A4BA 1J1EA 3RM1A 4AOMA 4P2YB 3O2PA 3FWCA 2LUCA 4N1GA 1J7OA 1BR1B 1QATA 2F3YA 2NCPA 3BUMB 2JPTA 2B1UA 4NQGA 1XFWO 4PE1A 1S6CA 2O5GA 2JRFA 2GGMA 1IGVA 1H8BA 2F8PA 2FCEA 5J3XA 2BL0B 4GFTA 2WNDA 3BOWB 2BCXA 1IWQA 1DJHA 1DJWA 1J7RA 1XO5A 3EVUA 1YVHA 1IQ3A 1W7IB 1KSOA 2OS8C 5ER4X 2JC2A 1JC2A 2Y1MA 4HRGA 1SL8A 2LMUA 2M97A 1K9KA 1AK8A 1BR4B 2LP2A 2PASA 1WLMA 2KFHA 2ZRSA 3BUXB 2ZFDA 2BL0C 2MJWB 3BUNB 3VROA 1B7TY
chains in the Genus database with same CATH superfamily
5HKZA 2WCMA 4OV2A 2I18A 4AQJA 2LANA 2KAVA 2NZ0A 3L4LA 1BLQA 2L51A 2WOSA 3S0FA 1PVAA 2JXCA 5HKWA 1FPWA 1AP4A 1WRZA 4MBEA 4YGDB 1B47A 2L4HA 3FWBA 4PE4A 3NSOA 1KK8C 1KQVA 1TTXA 1QVIZ 2KGBC 2KBMA 3K1EA 2TN4A 1RROA 2QEHA 1RJVA 4PHJA 5D7FA 2KAXA 1ALWA 5D69A 2L5YA 2LLTA 3C1VA 5CSIA 4QJ4B 1SR6B 1WRKA 3PATA 2CXJA 1KWOC 4I5LB 4JKTA 4INXA 3V2LA 1RFJA 3WXAA 2JQ6A 3IQQA 5D3OA 1TNQA 1Y1XA 2QACA 1QXPA 4YGAA 4YRUA 3BOWA 4BY4A 4INWA 5DKQA 5DKNA 3I5IC 4KYNA 2MA2A 2GTEA 2GGZA 1SL9A 2L4IA 1KK7Y 1V1FA 2ZNEA 1B8LA 3KHEA 3CTNA 3AAJA 1KWOB 2Q91A 2NXQA 4YBHB 2MHHA 1YR5A 4OVNF 3N7HA 5HKYA 1IKUA 4F7FA 4GPLB 3KEVA 1CMFA 4JD9A 2KOTA 1XFUO 2CTNA 1RECA 1K2HA 1TNXA 5KTYA 2WC5A 2EHBA 3E3RA 1ZUZA 2LNKA 1OOGA 4XJKA 1YUTA 2QPTA 1JFJA 1GM0A 2E6WA 1M39A 1OOIX 1G8IA 1FBVA 2NCOA 1IJ6A 1LXFC 2BCAA 1JUOA 2I2RE 2JT3A 2JZIA 1Q80A 1Y6WA 1QLSA 4M2QA 3SG2A 2ZRTA 1WY9A 1PSRA 4HSZA 4OR9B 1DC1A 4QJ3B 1TCOB 1WLZA 3ZWHA 2BNXA 1OZOA 3FE9A 3O4YA 2YGUA 1IQ5A 1W7JB 2DOQA 1WRLA 1AUIB 1KK8B 2BCBA 1BJFA 2PMYA 3S0DA 1C7VA 3OBVA 1CB1A 1YRTB 2KDHA 1DJGA 2HPSA 4PCWA 1DF0B 4MRXA 3SG3A 1CM1A 2H2KA 4CPVA 2HF5A 1AJ4A 3GK2A 3GK1A 4YGCB 3DVMA 2M8UA 4R1EA 4WRIA 1DJXA 3CWGA 5HLVA 1OMVA 1S3PA 2KGRA 2M9GA 3S0GA 1H4BA 1AHRA 5HLOA 2PYQA 3MSEB 4XYNA 1SSEB 2QEVA 2IS9A 5CSFA 2K7BA 5K89A 2D8NA 2ZN8A 4JPZB 4N1FA 1MUXA 4OKHA 1CDPA 1D1OA 2COLB 1K96A 3D76A 3K21A 4JWQA 1QX5B 1ZFSA 2KI6C 1K93D 1DQEA 1F4QA 2EC6C 2JTTA 3R1OA 1CDNA 3IF7A 4C0LA 1XK4A 5AFPA 3D0YA 1L7ZA 1S5GY 2AUCA 3OX5A 3D74A 4PDZA 2MRDA 3OB1B 1DF0A 5TNCA 3VRRA 4GGFC 1N0YA 3JVTB 1R2UA 1QV1A 2LVJA 1HT9A 1BT6A 1UURA 2M1UA 1CDLA 3EK4A 3SG5A 1MXLC 5I2LA 1DVIA 2K60A 5BPJA 2LV7A 2WORA 1SCMB 1LA3A 5GQQC 3LK0A 3RZSA 1OMDA 2I7AA 1GGZA 1CFFA 3DF0B 3OP0A 1EH2A 3GOFA 1R6PA 3SG7A 1NCZA 3DVKA 4GGFA 1TNWA 2BECA 2L98A 1RWYA 3R1PA 1QLKA 4HREE 4C0JA 3NHTA 3NSIA 2PRUA 3O4XA 4USLA 4XJKB 1B8CA 1EG4A 4N5XA 2P70A 1IIOA 1QX7A 2LVIA 5I2QA 1OE9B 5FI7A 1PALA 4YI9A 1DGUA 1TIZA 2P71A 3CLNA 2O60A 2MAZA 1M46A 4Q04A 4MRYA 1FF1A 3A4UB 3AKAA 1AVSA 1G4YR 2WC6A 5AANA 1SCMC 1K8UA 2K2AA 1QS7A 1BODA 3CR5X 2PQLA 2K0JA 2KBIA 3DY9A 1G33A 1CLLA 2CT9A 1KCYA 1LA0A 3JVTC 2LC5A 3NGVA 3PALA 2KYCA 1J55A 1MWNA 1TUZA 1C07A 1F55A 1TUJA 3EVVA 1B4CA 2K8MB 1NIWA 1PK0D 2KFGA 1QJTA 5FYXA 1AJ5A 3DXLA 4UPGA 3EKJA 2JT8A 2BKIB 3FIAA 5CSNA 1L2OB 2QEOA 2HETA 3VB1A 1UHHA 3BFBA 3SS5A 3B88A 4YGBB 5DKRA 3I5FC 1DGVA 3QMEA 2SASA 1SPYA 2KQ6A 1HQVA 1C7WA 1EL4A 4WQ3A 1BF5A 3LL8B 2LAPA 1CMGA 3NXAA 2I94A 2PSRA 2OTGB 3R1VA 4GUKA 2KQYA 4ORAB 2WCKA 2VRGA 2JULA 3SS3A 4P5OE 1UHIA 1KFXS 2CNPA 2M0RA 2BE6A 3CZ2A 1ZACA 1NYAA 1K94A 3D0YB 5AEQA 3CABA 2KAYA 3SIBA 1N65A 2AMIA 1CLBA 1DJIA 3OGNA 3PJIA 1VRKA 1B8RA 1Y1UA 1SRAA 1J7PA 4OZDA 1K95A 2SCPA 1Y0VH 2K7DA 2M1KB 2KPHA 2KI6D 2JU0A 1XFYO 1LINA 4GNKB 3D73A 1IRJA 2G9BA 3PN7B 1F4OA 2K7OA 1A29A 2H8VA 1SNLA 5CPVA 2LVVA 3SJSA 3CDNA 3BUOB 3ICBA 1SW8A 2KI4B 4AQIA 2HQWA 1A4PA 3I5GC 2BAPA 2BBMA 1OQPA 1UHJA 2Q4UA 3TS5B 2JWWA 1TCFA 1QIWA 1BOCA 4GGNA 1EJ3A 2M49B 1GGWA 2R2IA 1M31A 3I5HB 3IVTA 3NHIA 1SY9A 1QV0A 3TUYB 3VGOA 2FJUB 4HRHA 1NSHA 2BKHB 3LLEA 1SMGA 4U8DA 2M7LA 1YUSA 1DJYA 2ERBA 4F0ZB 3M0WA 1SCVA 4BY5A 2LLUA 2M29A 3OHMB 3R72A 3D78A 2WC8A 1X02A 4PE7A 1A75B 1XK4C 5B8IB 1ODBA 1SL7A 3O78A 3B87A 2LCPA 1BG1A 3GK4X 1M63B 1SBJA 4IL1A 1EXRA 5FI2A 4M2PA 3EK8A 3EVRA 1TN4A 2LVKA 4TNCA 5AXIA 4NDCA 3BQ3A 4GBAA 4C0KA 1MXEA 2LUXA 1NX2A 2L5XB 3FE6A 1OOFA 2F2PA 4DCKA 2E30A 1GQMA 1QVIY 4PHNA 3UO9A 3F45A 3VRQA 1XYDA 1N2DA 4I5KA 1QASA 1NP8A 1SYMA 1C3ZA 2H61C 3UNWA 2QDIA 2LLSA 5AERA 4ICBA 1J7QA 3VRNA 4FQOA 1YX8A 2WCEA 1V1GA 3SS4A 4YI8A 5I94A 2GV5A 3SG6A 2ZN9A 3L4AA 4ORCB 3SG4A 1QTXA 3FS7A 1KFXL 1JF2A 1Y1AA 4YGEB 3KO0A 1S26D 1XFXO 2K61A 1PVBA 2KYFA 2MBXA 3NSKA 3EK7A 1KQMC 3DVEA 4CFQA 1CM4A 1UUSA 4DS7A 1QX2A 1SK6D 1CTRA 1NPQA 1NCXA 1MF8B 3FE8A 1ALVA 1JF0A 1OZSA 1CFDA 3CZ0A 3KPXA 3BFAA 3S0AA 3I5HC 2FJYA 3IQOA 3CR2A 1U5IA 2CBLA 1WDCB 2JNXA 3DD4A 3D10A 1IJ5A 4MVFA 1K9UA 1NWDA 1DMOA 1ZMZA 2WCBA 4PALA 1YTZC 2K7CA 3TS5C 1DEKA 4PT1A 3B86A 1LKJA 1XFVO 1CLMA 4E68A 1FW4A 1UP5A 3S0EA 1MQ1A 1LS8A 1XFZO 1MR8A 2OPOA 2AAOA 1A03A 5KU1A 1SR6C 3CR4X 3KF9A 1NUBA 2EC6B 1ORGA 1A75A 1S1EA 3JTDC 3PN7C 2KLDA 4CIDA 1CNPA 2KLEA 1FI6A 1CFCA 2FCDA 1LVCD 3SIAA 4DIRA 2ISDA 2Y5IA 1K90D 1CDMA 2WCJA 3D75A 4MZKA 2KNEA 3BFHA 1PULA 1WDCC 2ZNDA 3I5GB 3JTDB 3DVJA 3CZTX 3EKHA 2F2OA 2Y1NA 3CZ1A 3L47A 1KFUS 4PHMA 5PALA 3TDIA 1JBAA 1TOPA 1JSAA 1XA5A 1DTLA 5F6TA 1XVJA 2FOTA 2L0PA 3B6XA 4A4CA 1UWOA 2LP3A 1YUUA 1RTP1 2KFFA 2L50A 2JXLA 3PM8A 3BXKA 2OS8B 3AKBA 2MLFC 4GAOA 3BJHA 4WQ2A 1NX0A 4ETOA 2M7NA 2WCHA 4FTGA 4MZJA 2A4JA 4IJ7A 4M2OA 4QJ5B 4MN0A 1M45A 1BMOA 1KFUL 3TZ1A 1IG5A 5DICA 3TDUA 4MLWA 1RK9A 3HX4A 4MZLA 5HYDA 3A8RA 1NCYA 3LK1A 1CFPA 1YVLA 1DELA 2CCMA 5CSJA 1KQMB 1OMRA 1ZOTB 2JNFA 2P6BB 4PE0A 1YX7A 2OTGC 2Y4QA 2LHLA 2RGIA 1OW4A 1KSMA 2WCFA 1MHOA 3PFVA 5ER5A 1IH0A 1OOHA 3I5FB 1JFKA 2JOJA 3QRXA 5I8NA 3NSLA 2KHNA 3LCPC 1L2OC 5I2OA 4NDDA 5G08A 1QIVA 5JOLA 1E8AA 1SKTA 2LMTA 1S6IA 2BE4A 4DRWA 1PSBA 2M3WA 1K9PA 3BUWB 3AAKA 1S6JA 4I5NB 1JWDA 2QEBA 3DF0A 1GJYA 1F54A 3BYAA 4MEWA 1OOJA 1TWOA 4CLNA 2NLNA 3HCMA 2WCLA 2LM5A 2PALA 3PLFB 3VRPA 4CFRA 3OB2B 1S36A 1Z4HA 2LMVA 3TDZA 1NX1A 3WHUB 5KSZA 3S0BA 1DJZA 1UHKA 2LHIA 1F71A 3RLZA 1S5GZ 2KSPA 1OSAA 3O6BA 1DT7B 1F8HA 1KK7Z 2ZKMX 2G2BA 3OX6A 2K2FA 1NX3A 2MLEC 1PRWA 3PM2A 1B1GA 5IBWA 1UHNA 1A2XA 4MSPA 1EG3A 5FI6A 3B7AA 3I5IB 2JT0A 2V53A 3H4SE 1TRFA 1XFRA 1YRUB 4JQ0D 4ZCVA 3Q8IA 2F3ZA 3WNXB 3EG5B 3WHTB 1TNPA 1F70A 1J1DA 2KI4C 3CGAA 1CKKA 1YURA 3CS1A 4PHKA 5JJGA 1B7TZ 3TUYC 2EGDA 1U5IB 2JTZA 2F33A 4NDBA 1Z2CB 4ORBB 2L2EA 2PVBA 4L9MA 4ZCUA 3ZNIA 2BBNA 3PSRA 4OCIA 2H61A 1FI5A 1QWVA 2LE9B 1B9AA 1BU3A 4I5JA 4DUQA 4D1EA 3D77A 2HQ8A 4A4BA 1J1EA 3RM1A 4AOMA 4P2YB 3O2PA 3FWCA 2LUCA 4FQTA 4N1GA 1J7OA 1BR1B 5EL2A 1QATA 2F3YA 2NCPA 3BUMB 2JPTA 2B1UA 4NQGA 1XFWO 4PE1A 1C3YA 1S6CA 2O5GA 2JRFA 1IGVA 2GGMA 1H8BA 2F8PA 1W9ZA 2FCEA 2BL0B 4GFTA 5J3XA 5HL1A 2WNDA 3BOWB 2BCXA 2JPOA 1IWQA 1DJHA 1DJWA 1J7RA 1XO5A 3DZTA 1YVHA 3EVUA 1W7IB 1KSOA 2OS8C 5ER4X 2JC2A 1IQ3A 1JC2A 3DYEA 2Y1MA 3CYZA 1SL8A 2LMUA 2L2CA 2M97A 1P28A 4HRGA 1K9KA 1T14A 1AK8A 1BR4B 2LP2A 2PASA 1WLMA 2KFHA 2ZRSA 3BUXB 2ZFDA 2BL0C 2MJWB 3BUNB 3VROA 1B7TY
chains in the Genus database with same CATH topology
5HKZA 4OV2A 2I18A 4AQJA 2LANA 2KAVA 2NZ0A 1BLQA 2L51A 2WOSA 1FPWA 1PVAA 2JXCA 5HKWA 1AP4A 1WRZA 4MBEA 4YGDB 1B47A 2L4HA 3FWBA 4PE4A 3NSOA 1KK8C 1KQVA 1TTXA 1QVIZ 2KGBC 2KBMA 2TN4A 1RROA 4PHJA 1RJVA 5D7FA 2KAXA 1ALWA 5D69A 2LLTA 3C1VA 5CSIA 4QJ4B 1SR6B 1WRKA 3PATA 2CXJA 1KWOC 4I5LB 1RFJA 3WXAA 2JQ6A 3IQQA 1TNQA 1Y1XA 2QACA 1QXPA 4YGAA 4YRUA 3BOWA 4BY4A 5DKQA 5DKNA 3I5IC 2MA2A 2GGZA 1SL9A 2L4IA 1KK7Y 1V1FA 2ZNEA 1B8LA 3KHEA 3CTNA 3AAJA 1KWOB 2Q91A 2NXQA 4YBHB 2MHHA 1YR5A 4OVNF 5HKYA 1IKUA 1CMFA 4GPLB 3KEVA 2KOTA 1XFUO 1RECA 2CTNA 1K2HA 1TNXA 5KTYA 2EHBA 3E3RA 1ZUZA 2LNKA 4XJKA 1YUTA 2QPTA 1JFJA 2E6WA 1M39A 1G8IA 1FBVA 2NCOA 1IJ6A 1LXFC 2BCAA 1JUOA 2I2RE 2JT3A 2JZIA 1Q80A 1Y6WA 1QLSA 4M2QA 3SG2A 2ZRTA 1WY9A 1PSRA 4HSZA 4OR9B 4QJ3B 1TCOB 1WLZA 3ZWHA 1OZOA 3O4YA 1IQ5A 1W7JB 2DOQA 1WRLA 1AUIB 1KK8B 2BCBA 1BJFA 2PMYA 1C7VA 1CB1A 1YRTB 2KDHA 1DJGA 2HPSA 4PCWA 1DF0B 4MRXA 3SG3A 1CM1A 2H2KA 4CPVA 2HF5A 1AJ4A 3GK2A 3GK1A 4YGCB 3DVMA 2M8UA 4R1EA 4WRIA 1DJXA 3CWGA 5HLVA 1OMVA 1S3PA 2KGRA 2M9GA 1H4BA 1AHRA 5HLOA 3MSEB 4XYNA 5CSFA 5K89A 2IS9A 2K7BA 2D8NA 2ZN8A 4JPZB 4N1FA 1MUXA 4OKHA 1CDPA 1D1OA 2COLB 1K96A 3K21A 4JWQA 1QX5B 1ZFSA 2KI6C 1K93D 1F4QA 2EC6C 2JTTA 1CDNA 3IF7A 4C0LA 1XK4A 5AFPA 3D0YA 1L7ZA 1S5GY 2AUCA 3OX5A 4PDZA 2MRDA 3OB1B 1DF0A 5TNCA 3VRRA 4GGFC 1N0YA 3JVTB 1R2UA 1QV1A 2LVJA 1HT9A 1BT6A 1UURA 2M1UA 1CDLA 3EK4A 3SG5A 1MXLC 5I2LA 1DVIA 5BPJA 2LV7A 2WORA 1SCMB 1LA3A 5GQQC 3LK0A 1OMDA 2I7AA 1GGZA 1CFFA 3DF0B 3OP0A 1EH2A 3GOFA 1R6PA 3SG7A 1NCZA 3DVKA 4GGFA 1TNWA 2BECA 2L98A 1RWYA 1QLKA 4HREE 4C0JA 3NSIA 2PRUA 4USLA 4XJKB 1B8CA 1EG4A 4N5XA 1QX7A 2LVIA 5I2QA 1OE9B 1PALA 4YI9A 1DGUA 1TIZA 3CLNA 2O60A 2MAZA 1M46A 4Q04A 4MRYA 1FF1A 3A4UB 3AKAA 1AVSA 1G4YR 5AANA 1SCMC 1K8UA 2K2AA 1QS7A 1BODA 3CR5X 2K0JA 2KBIA 1G33A 1CLLA 2CT9A 1KCYA 1LA0A 3JVTC 2LC5A 3PALA 2KYCA 1J55A 1MWNA 1C07A 1F55A 3EVVA 1B4CA 2K8MB 1NIWA 1PK0D 2KFGA 1QJTA 5FYXA 1AJ5A 4UPGA 3EKJA 2JT8A 2BKIB 3FIAA 5CSNA 1L2OB 2HETA 1UHHA 4YGBB 5DKRA 3I5FC 1DGVA 2SASA 1SPYA 2KQ6A 1HQVA 1C7WA 1EL4A 4WQ3A 1BF5A 3LL8B 2LAPA 1CMGA 3NXAA 2I94A 2PSRA 2OTGB 4GUKA 2KQYA 4ORAB 2VRGA 2JULA 4P5OE 1UHIA 1KFXS 2CNPA 2M0RA 2BE6A 1ZACA 1NYAA 1K94A 3D0YB 5AEQA 2KAYA 3SIBA 1N65A 2AMIA 1CLBA 1DJIA 1VRKA 1B8RA 1SRAA 1Y1UA 1J7PA 1K95A 2SCPA 1Y0VH 2K7DA 2M1KB 2KI6D 2JU0A 1XFYO 1LINA 4GNKB 1IRJA 2G9BA 3PN7B 1F4OA 2K7OA 1A29A 1SNLA 5CPVA 2LVVA 3SJSA 3BUOB 3ICBA 1SW8A 2KI4B 4AQIA 2HQWA 1A4PA 3I5GC 2BBMA 1OQPA 1UHJA 2Q4UA 3TS5B 2JWWA 1TCFA 1QIWA 1BOCA 4GGNA 1EJ3A 2M49B 1GGWA 2R2IA 1M31A 3I5HB 1SY9A 1QV0A 3TUYB 3VGOA 2FJUB 4HRHA 1NSHA 2BKHB 3LLEA 1SMGA 4U8DA 2M7LA 1YUSA 1DJYA 4F0ZB 3M0WA 1SCVA 4BY5A 2LLUA 2M29A 3OHMB 2WC8A 1X02A 4PE7A 1A75B 1XK4C 5B8IB 1ODBA 1SL7A 3O78A 1BG1A 2LCPA 3GK4X 1M63B 1SBJA 4IL1A 1EXRA 4M2PA 3EK8A 3EVRA 1TN4A 2LVKA 4TNCA 5AXIA 4NDCA 3BQ3A 4GBAA 4C0KA 1MXEA 2LUXA 1NX2A 2L5XB 2F2PA 4DCKA 2E30A 1GQMA 1QVIY 4PHNA 3F45A 3VRQA 1XYDA 1N2DA 4I5KA 1QASA 1NP8A 1SYMA 2H61C 2LLSA 5AERA 4ICBA 1J7QA 3VRNA 4FQOA 1YX8A 2WCEA 1V1GA 4YI8A 2GV5A 3SG6A 2ZN9A 3SG4A 4ORCB 1QTXA 3FS7A 1KFXL 1JF2A 1Y1AA 4YGEB 3KO0A 1S26D 1XFXO 2K61A 1PVBA 2KYFA 2MBXA 3NSKA 3EK7A 1KQMC 3DVEA 4CFQA 1CM4A 1UUSA 4DS7A 1QX2A 1SK6D 1CTRA 1NPQA 1NCXA 1MF8B 1ALVA 1JF0A 1OZSA 1CFDA 3KPXA 3I5HC 3IQOA 3CR2A 1U5IA 2CBLA 1WDCB 2JNXA 3DD4A 3D10A 1IJ5A 4MVFA 1K9UA 1NWDA 1DMOA 1ZMZA 2WCBA 4PALA 1YTZC 2K7CA 3TS5C 1LKJA 1XFVO 1CLMA 4E68A 1FW4A 1UP5A 1MQ1A 1XFZO 1MR8A 2OPOA 2AAOA 1A03A 5KU1A 1SR6C 3CR4X 3KF9A 1NUBA 2EC6B 4CIDA 1A75A 1S1EA 3JTDC 3PN7C 1CNPA 1FI6A 1CFCA 2FCDA 1LVCD 3SIAA 4DIRA 2ISDA 2Y5IA 1K90D 1CDMA 4MZKA 2KNEA 3I5GB 1PULA 1WDCC 2ZNDA 3JTDB 3DVJA 3CZTX 3EKHA 2F2OA 2Y1NA 5PALA 4PHMA 1KFUS 3TDIA 1JBAA 1TOPA 1JSAA 1XA5A 1DTLA 5F6TA 1XVJA 2FOTA 2L0PA 4A4CA 1UWOA 2LP3A 1YUUA 1RTP1 2KFFA 2L50A 2JXLA 3PM8A 3BXKA 2OS8B 3AKBA 2MLFC 4GAOA 4ETOA 4WQ2A 1NX0A 2M7NA 4FTGA 4MZJA 2A4JA 4M2OA 4QJ5B 4MN0A 1M45A 1BMOA 1KFUL 3TZ1A 1IG5A 3TDUA 4MLWA 1RK9A 3HX4A 4MZLA 5HYDA 3A8RA 1NCYA 3LK1A 1CFPA 1YVLA 2CCMA 5CSJA 1KQMB 1OMRA 1ZOTB 2JNFA 2P6BB 4PE0A 1YX7A 2OTGC 2Y4QA 2LHLA 2RGIA 1KSMA 2WCFA 1MHOA 3PFVA 5ER5A 1IH0A 3I5FB 1JFKA 2JOJA 3QRXA 5I8NA 3NSLA 2KHNA 3LCPC 1L2OC 5I2OA 4NDDA 5G08A 1QIVA 5JOLA 1E8AA 1SKTA 2LMTA 1S6IA 2BE4A 4DRWA 1PSBA 2M3WA 1K9PA 3BUWB 3AAKA 1S6JA 4I5NB 1JWDA 3DF0A 1GJYA 1F54A 3BYAA 4MEWA 1OOJA 4CLNA 2NLNA 3HCMA 2LM5A 2PALA 3PLFB 3VRPA 4CFRA 3OB2B 1S36A 2LMVA 3TDZA 1NX1A 3WHUB 5KSZA 1DJZA 1UHKA 2LHIA 1F71A 3RLZA 1S5GZ 2KSPA 1OSAA 3O6BA 1DT7B 1F8HA 1KK7Z 2ZKMX 2G2BA 3OX6A 2K2FA 1NX3A 2MLEC 1PRWA 1B1GA 5IBWA 1UHNA 1A2XA 4MSPA 1EG3A 3I5IB 2JT0A 2V53A 3H4SE 1TRFA 4JQ0D 1YRUB 4ZCVA 2F3ZA 3WNXB 3WHTB 1TNPA 1F70A 1J1DA 2KI4C 3CGAA 1CKKA 1YURA 3CS1A 4PHKA 5JJGA 1B7TZ 3TUYC 2EGDA 1U5IB 2JTZA 2F33A 4NDBA 4ORBB 2L2EA 2PVBA 4L9MA 4ZCUA 3ZNIA 2BBNA 3PSRA 4OCIA 2H61A 1FI5A 2LE9B 1B9AA 1BU3A 4I5JA 4DUQA 4D1EA 2HQ8A 4A4BA 1J1EA 3RM1A 4AOMA 4P2YB 3O2PA 3FWCA 2LUCA 4N1GA 1J7OA 1BR1B 1QATA 2F3YA 2NCPA 3BUMB 2JPTA 2B1UA 4NQGA 1XFWO 4PE1A 1S6CA 2O5GA 2JRFA 2GGMA 1IGVA 1H8BA 2F8PA 2FCEA 5J3XA 2BL0B 4GFTA 2WNDA 3BOWB 2BCXA 1IWQA 1DJHA 1DJWA 1J7RA 1XO5A 3EVUA 1YVHA 1IQ3A 1W7IB 1KSOA 2OS8C 5ER4X 2JC2A 1JC2A 2Y1MA 4HRGA 1SL8A 2LMUA 2M97A 1K9KA 1AK8A 1BR4B 2LP2A 2PASA 1WLMA 2KFHA 2ZRSA 3BUXB 2ZFDA 2BL0C 2MJWB 3BUNB 3VROA 1B7TY
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HKZ A;  4OV2 A;  2I18 A;  4AQJ A;  2LAN A;  2KAV A;  2NZ0 A;  1BLQ A;  2L51 A;  2WOS A;  1FPW A;  1PVA A;  2JXC A;  5HKW A;  1AP4 A;  1WRZ A;  4MBE A;  4YGD B;  1B47 A;  2L4H A;  3FWB A;  4PE4 A;  3NSO A;  1KK8 C;  1KQV A;  1TTX A;  1QVI Z;  2KGB C;  2KBM A;  2TN4 A;  1RRO A;  4PHJ A;  1RJV A;  5D7F A;  2KAX A;  1ALW A;  5D69 A;  2LLT A;  3C1V A;  5CSI A;  4QJ4 B;  1SR6 B;  1WRK A;  3PAT A;  2CXJ A;  1KWO C;  4I5L B;  1RFJ A;  3WXA A;  2JQ6 A;  3IQQ A;  1TNQ A;  1Y1X A;  2QAC A;  1QXP A;  4YGA A;  4YRU A;  3BOW A;  4BY4 A;  5DKQ A;  5DKN A;  3I5I C;  2MA2 A;  2GGZ A;  1SL9 A;  2L4I A;  1KK7 Y;  1V1F A;  2ZNE A;  1B8L A;  3KHE A;  3CTN A;  3AAJ A;  1KWO B;  2Q91 A;  2NXQ A;  4YBH B;  2MHH A;  1YR5 A;  4OVN F;  5HKY A;  1IKU A;  1CMF A;  4GPL B;  3KEV A;  2KOT A;  1XFU O;  1REC A;  2CTN A;  1K2H A;  1TNX A;  5KTY A;  2EHB A;  3E3R A;  1ZUZ A;  2LNK A;  4XJK A;  1YUT A;  2QPT A;  1JFJ A;  2E6W A;  1M39 A;  1G8I A;  1FBV A;  2NCO A;  1IJ6 A;  1LXF C;  2BCA A;  1JUO A;  2I2R E;  2JT3 A;  2JZI A;  1Q80 A;  1Y6W A;  1QLS A;  4M2Q A;  3SG2 A;  2ZRT A;  1WY9 A;  1PSR A;  4HSZ A;  4OR9 B;  4QJ3 B;  1TCO B;  1WLZ A;  3ZWH A;  1OZO A;  3O4Y A;  1IQ5 A;  1W7J B;  2DOQ A;  1WRL A;  1AUI B;  1KK8 B;  2BCB A;  1BJF A;  2PMY A;  1C7V A;  1CB1 A;  1YRT B;  2KDH A;  1DJG A;  2HPS A;  4PCW A;  1DF0 B;  4MRX A;  3SG3 A;  1CM1 A;  2H2K A;  4CPV A;  2HF5 A;  1AJ4 A;  3GK2 A;  3GK1 A;  4YGC B;  3DVM A;  2M8U A;  4R1E A;  4WRI A;  1DJX A;  3CWG A;  5HLV A;  1OMV A;  1S3P A;  2KGR A;  2M9G A;  1H4B A;  1AHR A;  5HLO A;  3MSE B;  4XYN A;  5CSF A;  5K89 A;  2IS9 A;  2K7B A;  2D8N A;  2ZN8 A;  4JPZ B;  4N1F A;  1MUX A;  4OKH A;  1CDP A;  1D1O A;  2COL B;  1K96 A;  3K21 A;  4JWQ A;  1QX5 B;  1ZFS A;  2KI6 C;  1K93 D;  1F4Q A;  2EC6 C;  2JTT A;  1CDN A;  3IF7 A;  4C0L A;  1XK4 A;  5AFP A;  3D0Y A;  1L7Z A;  1S5G Y;  2AUC A;  3OX5 A;  4PDZ A;  2MRD A;  3OB1 B;  1DF0 A;  5TNC A;  3VRR A;  4GGF C;  1N0Y A;  3JVT B;  1R2U A;  1QV1 A;  2LVJ A;  1HT9 A;  1BT6 A;  1UUR A;  2M1U A;  1CDL A;  3EK4 A;  3SG5 A;  1MXL C;  5I2L A;  1DVI A;  5BPJ A;  2LV7 A;  2WOR A;  1SCM B;  1LA3 A;  5GQQ C;  3LK0 A;  1OMD A;  2I7A A;  1GGZ A;  1CFF A;  3DF0 B;  3OP0 A;  1EH2 A;  3GOF A;  1R6P A;  3SG7 A;  1NCZ A;  3DVK A;  4GGF A;  1TNW A;  2BEC A;  2L98 A;  1RWY A;  1QLK A;  4HRE E;  4C0J A;  3NSI A;  2PRU A;  4USL A;  4XJK B;  1B8C A;  1EG4 A;  4N5X A;  1QX7 A;  2LVI A;  5I2Q A;  1OE9 B;  1PAL A;  4YI9 A;  1DGU A;  1TIZ A;  3CLN A;  2O60 A;  2MAZ A;  1M46 A;  4Q04 A;  4MRY A;  1FF1 A;  3A4U B;  3AKA A;  1AVS A;  1G4Y R;  5AAN A;  1SCM C;  1K8U A;  2K2A A;  1QS7 A;  1BOD A;  3CR5 X;  2K0J A;  2KBI A;  1G33 A;  1CLL A;  2CT9 A;  1KCY A;  1LA0 A;  3JVT C;  2LC5 A;  3PAL A;  2KYC A;  1J55 A;  1MWN A;  1C07 A;  1F55 A;  3EVV A;  1B4C A;  2K8M B;  1NIW A;  1PK0 D;  2KFG A;  1QJT A;  5FYX A;  1AJ5 A;  4UPG A;  3EKJ A;  2JT8 A;  2BKI B;  3FIA A;  5CSN A;  1L2O B;  2HET A;  1UHH A;  4YGB B;  5DKR A;  3I5F C;  1DGV A;  2SAS A;  1SPY A;  2KQ6 A;  1HQV A;  1C7W A;  1EL4 A;  4WQ3 A;  1BF5 A;  3LL8 B;  2LAP A;  1CMG A;  3NXA A;  2I94 A;  2PSR A;  2OTG B;  4GUK A;  2KQY A;  4ORA B;  2VRG A;  2JUL A;  4P5O E;  1UHI A;  1KFX S;  2CNP A;  2M0R A;  2BE6 A;  1ZAC A;  1NYA A;  1K94 A;  3D0Y B;  5AEQ A;  2KAY A;  3SIB A;  1N65 A;  2AMI A;  1CLB A;  1DJI A;  1VRK A;  1B8R A;  1SRA A;  1Y1U A;  1J7P A;  1K95 A;  2SCP A;  1Y0V H;  2K7D A;  2M1K B;  2KI6 D;  2JU0 A;  1XFY O;  1LIN A;  4GNK B;  1IRJ A;  2G9B A;  3PN7 B;  1F4O A;  2K7O A;  1A29 A;  1SNL A;  5CPV A;  2LVV A;  3SJS A;  3BUO B;  3ICB A;  1SW8 A;  2KI4 B;  4AQI A;  2HQW A;  1A4P A;  3I5G C;  2BBM A;  1OQP A;  1UHJ A;  2Q4U A;  3TS5 B;  2JWW A;  1TCF A;  1QIW A;  1BOC A;  4GGN A;  1EJ3 A;  2M49 B;  1GGW A;  2R2I A;  1M31 A;  3I5H B;  1SY9 A;  1QV0 A;  3TUY B;  3VGO A;  2FJU B;  4HRH A;  1NSH A;  2BKH B;  3LLE A;  1SMG A;  4U8D A;  2M7L A;  1YUS A;  1DJY A;  4F0Z B;  3M0W A;  1SCV A;  4BY5 A;  2LLU A;  2M29 A;  3OHM B;  2WC8 A;  1X02 A;  4PE7 A;  1A75 B;  1XK4 C;  5B8I B;  1ODB A;  1SL7 A;  3O78 A;  1BG1 A;  2LCP A;  3GK4 X;  1M63 B;  1SBJ A;  4IL1 A;  1EXR A;  4M2P A;  3EK8 A;  3EVR A;  1TN4 A;  2LVK A;  4TNC A;  5AXI A;  4NDC A;  3BQ3 A;  4GBA A;  4C0K A;  1MXE A;  2LUX A;  1NX2 A;  2L5X B;  2F2P A;  4DCK A;  2E30 A;  1GQM A;  1QVI Y;  4PHN A;  3F45 A;  3VRQ A;  1XYD A;  1N2D A;  4I5K A;  1QAS A;  1NP8 A;  1SYM A;  2H61 C;  2LLS A;  5AER A;  4ICB A;  1J7Q A;  3VRN A;  4FQO A;  1YX8 A;  2WCE A;  1V1G A;  4YI8 A;  2GV5 A;  3SG6 A;  2ZN9 A;  3SG4 A;  4ORC B;  1QTX A;  3FS7 A;  1KFX L;  1JF2 A;  1Y1A A;  4YGE B;  3KO0 A;  1S26 D;  1XFX O;  2K61 A;  1PVB A;  2KYF A;  2MBX A;  3NSK A;  3EK7 A;  1KQM C;  3DVE A;  4CFQ A;  1CM4 A;  1UUS A;  4DS7 A;  1QX2 A;  1SK6 D;  1CTR A;  1NPQ A;  1NCX A;  1MF8 B;  1ALV A;  1JF0 A;  1OZS A;  1CFD A;  3KPX A;  3I5H C;  3IQO A;  3CR2 A;  1U5I A;  2CBL A;  1WDC B;  2JNX A;  3DD4 A;  3D10 A;  1IJ5 A;  4MVF A;  1K9U A;  1NWD A;  1DMO A;  1ZMZ A;  2WCB A;  4PAL A;  1YTZ C;  2K7C A;  3TS5 C;  1LKJ A;  1XFV O;  1CLM A;  4E68 A;  1FW4 A;  1UP5 A;  1MQ1 A;  1XFZ O;  1MR8 A;  2OPO A;  2AAO A;  1A03 A;  5KU1 A;  1SR6 C;  3CR4 X;  3KF9 A;  1NUB A;  2EC6 B;  4CID A;  1A75 A;  1S1E A;  3JTD C;  3PN7 C;  1CNP A;  1FI6 A;  1CFC A;  2FCD A;  1LVC D;  3SIA A;  4DIR A;  2ISD A;  2Y5I A;  1K90 D;  1CDM A;  4MZK A;  2KNE A;  3I5G B;  1PUL A;  1WDC C;  2ZND A;  3JTD B;  3DVJ A;  3CZT X;  3EKH A;  2F2O A;  2Y1N A;  5PAL A;  4PHM A;  1KFU S;  3TDI A;  1JBA A;  1TOP A;  1JSA A;  1XA5 A;  1DTL A;  5F6T A;  1XVJ A;  2FOT A;  2L0P A;  4A4C A;  1UWO A;  2LP3 A;  1YUU A;  1RTP 1;  2KFF A;  2L50 A;  2JXL A;  3PM8 A;  3BXK A;  2OS8 B;  3AKB A;  2MLF C;  4GAO A;  4ETO A;  4WQ2 A;  1NX0 A;  2M7N A;  4FTG A;  4MZJ A;  2A4J A;  4M2O A;  4QJ5 B;  4MN0 A;  1M45 A;  1BMO A;  1KFU L;  3TZ1 A;  1IG5 A;  3TDU A;  4MLW A;  1RK9 A;  3HX4 A;  4MZL A;  5HYD A;  3A8R A;  1NCY A;  3LK1 A;  1CFP A;  1YVL A;  2CCM A;  5CSJ A;  1KQM B;  1OMR A;  1ZOT B;  2JNF A;  2P6B B;  4PE0 A;  1YX7 A;  2OTG C;  2Y4Q A;  2LHL A;  2RGI A;  1KSM A;  2WCF A;  1MHO A;  3PFV A;  5ER5 A;  1IH0 A;  3I5F B;  1JFK A;  2JOJ A;  3QRX A;  5I8N A;  3NSL A;  2KHN A;  3LCP C;  1L2O C;  5I2O A;  4NDD A;  5G08 A;  1QIV A;  5JOL A;  1E8A A;  1SKT A;  2LMT A;  1S6I A;  2BE4 A;  4DRW A;  1PSB A;  2M3W A;  1K9P A;  3BUW B;  3AAK A;  1S6J A;  4I5N B;  1JWD A;  3DF0 A;  1GJY A;  1F54 A;  3BYA A;  4MEW A;  1OOJ A;  4CLN A;  2NLN A;  3HCM A;  2LM5 A;  2PAL A;  3PLF B;  3VRP A;  4CFR A;  3OB2 B;  1S36 A;  2LMV A;  3TDZ A;  1NX1 A;  3WHU B;  5KSZ A;  1DJZ A;  1UHK A;  2LHI A;  1F71 A;  3RLZ A;  1S5G Z;  2KSP A;  1OSA A;  3O6B A;  1DT7 B;  1F8H A;  1KK7 Z;  2ZKM X;  2G2B A;  3OX6 A;  2K2F A;  1NX3 A;  2MLE C;  1PRW A;  1B1G A;  5IBW A;  1UHN A;  1A2X A;  4MSP A;  1EG3 A;  3I5I B;  2JT0 A;  2V53 A;  3H4S E;  1TRF A;  4JQ0 D;  1YRU B;  4ZCV A;  2F3Z A;  3WNX B;  3WHT B;  1TNP A;  1F70 A;  1J1D A;  2KI4 C;  3CGA A;  1CKK A;  1YUR A;  3CS1 A;  4PHK A;  5JJG A;  1B7T Z;  3TUY C;  2EGD A;  1U5I B;  2JTZ A;  2F33 A;  4NDB A;  4ORB B;  2L2E A;  2PVB A;  4L9M A;  4ZCU A;  3ZNI A;  2BBN A;  3PSR A;  4OCI A;  2H61 A;  1FI5 A;  2LE9 B;  1B9A A;  1BU3 A;  4I5J A;  4DUQ A;  4D1E A;  2HQ8 A;  4A4B A;  1J1E A;  3RM1 A;  4AOM A;  4P2Y B;  3O2P A;  3FWC A;  2LUC A;  4N1G A;  1J7O A;  1BR1 B;  1QAT A;  2F3Y A;  2NCP A;  3BUM B;  2JPT A;  2B1U A;  4NQG A;  1XFW O;  4PE1 A;  1S6C A;  2O5G A;  2JRF A;  2GGM A;  1IGV A;  1H8B A;  2F8P A;  2FCE A;  5J3X A;  2BL0 B;  4GFT A;  2WND A;  3BOW B;  2BCX A;  1IWQ A;  1DJH A;  1DJW A;  1J7R A;  1XO5 A;  3EVU A;  1YVH A;  1IQ3 A;  1W7I B;  1KSO A;  2OS8 C;  5ER4 X;  2JC2 A;  1JC2 A;  2Y1M A;  4HRG A;  1SL8 A;  2LMU A;  2M97 A;  1K9K A;  1AK8 A;  1BR4 B;  2LP2 A;  2PAS A;  1WLM A;  2KFH A;  2ZRS A;  3BUX B;  2ZFD A;  2BL0 C;  2MJW B;  3BUN B;  3VRO A;  1B7T Y; 
#chains in the Genus database with same CATH topology
 5HKZ A;  2WCM A;  4OV2 A;  2I18 A;  4AQJ A;  2LAN A;  2KAV A;  2NZ0 A;  3L4L A;  1BLQ A;  2L51 A;  2WOS A;  3S0F A;  1PVA A;  2JXC A;  5HKW A;  1FPW A;  1AP4 A;  1WRZ A;  4MBE A;  4YGD B;  1B47 A;  2L4H A;  3FWB A;  4PE4 A;  3NSO A;  1KK8 C;  1KQV A;  1TTX A;  1QVI Z;  2KGB C;  2KBM A;  3K1E A;  2TN4 A;  1RRO A;  2QEH A;  1RJV A;  4PHJ A;  5D7F A;  2KAX A;  1ALW A;  5D69 A;  2L5Y A;  2LLT A;  3C1V A;  5CSI A;  4QJ4 B;  1SR6 B;  1WRK A;  3PAT A;  2CXJ A;  1KWO C;  4I5L B;  4JKT A;  4INX A;  3V2L A;  1RFJ A;  3WXA A;  2JQ6 A;  3IQQ A;  5D3O A;  1TNQ A;  1Y1X A;  2QAC A;  1QXP A;  4YGA A;  4YRU A;  3BOW A;  4BY4 A;  4INW A;  5DKQ A;  5DKN A;  3I5I C;  4KYN A;  2MA2 A;  2GTE A;  2GGZ A;  1SL9 A;  2L4I A;  1KK7 Y;  1V1F A;  2ZNE A;  1B8L A;  3KHE A;  3CTN A;  3AAJ A;  1KWO B;  2Q91 A;  2NXQ A;  4YBH B;  2MHH A;  1YR5 A;  4OVN F;  3N7H A;  5HKY A;  1IKU A;  4F7F A;  4GPL B;  3KEV A;  1CMF A;  4JD9 A;  2KOT A;  1XFU O;  2CTN A;  1REC A;  1K2H A;  1TNX A;  5KTY A;  2WC5 A;  2EHB A;  3E3R A;  1ZUZ A;  2LNK A;  1OOG A;  4XJK A;  1YUT A;  2QPT A;  1JFJ A;  1GM0 A;  2E6W A;  1M39 A;  1OOI X;  1G8I A;  1FBV A;  2NCO A;  1IJ6 A;  1LXF C;  2BCA A;  1JUO A;  2I2R E;  2JT3 A;  2JZI A;  1Q80 A;  1Y6W A;  1QLS A;  4M2Q A;  3SG2 A;  2ZRT A;  1WY9 A;  1PSR A;  4HSZ A;  4OR9 B;  1DC1 A;  4QJ3 B;  1TCO B;  1WLZ A;  3ZWH A;  2BNX A;  1OZO A;  3FE9 A;  3O4Y A;  2YGU A;  1IQ5 A;  1W7J B;  2DOQ A;  1WRL A;  1AUI B;  1KK8 B;  2BCB A;  1BJF A;  2PMY A;  3S0D A;  1C7V A;  3OBV A;  1CB1 A;  1YRT B;  2KDH A;  1DJG A;  2HPS A;  4PCW A;  1DF0 B;  4MRX A;  3SG3 A;  1CM1 A;  2H2K A;  4CPV A;  2HF5 A;  1AJ4 A;  3GK2 A;  3GK1 A;  4YGC B;  3DVM A;  2M8U A;  4R1E A;  4WRI A;  1DJX A;  3CWG A;  5HLV A;  1OMV A;  1S3P A;  2KGR A;  2M9G A;  3S0G A;  1H4B A;  1AHR A;  5HLO A;  2PYQ A;  3MSE B;  4XYN A;  1SSE B;  2QEV A;  2IS9 A;  5CSF A;  2K7B A;  5K89 A;  2D8N A;  2ZN8 A;  4JPZ B;  4N1F A;  1MUX A;  4OKH A;  1CDP A;  1D1O A;  2COL B;  1K96 A;  3D76 A;  3K21 A;  4JWQ A;  1QX5 B;  1ZFS A;  2KI6 C;  1K93 D;  1DQE A;  1F4Q A;  2EC6 C;  2JTT A;  3R1O A;  1CDN A;  3IF7 A;  4C0L A;  1XK4 A;  5AFP A;  3D0Y A;  1L7Z A;  1S5G Y;  2AUC A;  3OX5 A;  3D74 A;  4PDZ A;  2MRD A;  3OB1 B;  1DF0 A;  5TNC A;  3VRR A;  4GGF C;  1N0Y A;  3JVT B;  1R2U A;  1QV1 A;  2LVJ A;  1HT9 A;  1BT6 A;  1UUR A;  2M1U A;  1CDL A;  3EK4 A;  3SG5 A;  1MXL C;  5I2L A;  1DVI A;  2K60 A;  5BPJ A;  2LV7 A;  2WOR A;  1SCM B;  1LA3 A;  5GQQ C;  3LK0 A;  3RZS A;  1OMD A;  2I7A A;  1GGZ A;  1CFF A;  3DF0 B;  3OP0 A;  1EH2 A;  3GOF A;  1R6P A;  3SG7 A;  1NCZ A;  3DVK A;  4GGF A;  1TNW A;  2BEC A;  2L98 A;  1RWY A;  3R1P A;  1QLK A;  4HRE E;  4C0J A;  3NHT A;  3NSI A;  2PRU A;  3O4X A;  4USL A;  4XJK B;  1B8C A;  1EG4 A;  4N5X A;  2P70 A;  1IIO A;  1QX7 A;  2LVI A;  5I2Q A;  1OE9 B;  5FI7 A;  1PAL A;  4YI9 A;  1DGU A;  1TIZ A;  2P71 A;  3CLN A;  2O60 A;  2MAZ A;  1M46 A;  4Q04 A;  4MRY A;  1FF1 A;  3A4U B;  3AKA A;  1AVS A;  1G4Y R;  2WC6 A;  5AAN A;  1SCM C;  1K8U A;  2K2A A;  1QS7 A;  1BOD A;  3CR5 X;  2PQL A;  2K0J A;  2KBI A;  3DY9 A;  1G33 A;  1CLL A;  2CT9 A;  1KCY A;  1LA0 A;  3JVT C;  2LC5 A;  3NGV A;  3PAL A;  2KYC A;  1J55 A;  1MWN A;  1TUZ A;  1C07 A;  1F55 A;  1TUJ A;  3EVV A;  1B4C A;  2K8M B;  1NIW A;  1PK0 D;  2KFG A;  1QJT A;  5FYX A;  1AJ5 A;  3DXL A;  4UPG A;  3EKJ A;  2JT8 A;  2BKI B;  3FIA A;  5CSN A;  1L2O B;  2QEO A;  2HET A;  3VB1 A;  1UHH A;  3BFB A;  3SS5 A;  3B88 A;  4YGB B;  5DKR A;  3I5F C;  1DGV A;  3QME A;  2SAS A;  1SPY A;  2KQ6 A;  1HQV A;  1C7W A;  1EL4 A;  4WQ3 A;  1BF5 A;  3LL8 B;  2LAP A;  1CMG A;  3NXA A;  2I94 A;  2PSR A;  2OTG B;  3R1V A;  4GUK A;  2KQY A;  4ORA B;  2WCK A;  2VRG A;  2JUL A;  3SS3 A;  4P5O E;  1UHI A;  1KFX S;  2CNP A;  2M0R A;  2BE6 A;  3CZ2 A;  1ZAC A;  1NYA A;  1K94 A;  3D0Y B;  5AEQ A;  3CAB A;  2KAY A;  3SIB A;  1N65 A;  2AMI A;  1CLB A;  1DJI A;  3OGN A;  3PJI A;  1VRK A;  1B8R A;  1Y1U A;  1SRA A;  1J7P A;  4OZD A;  1K95 A;  2SCP A;  1Y0V H;  2K7D A;  2M1K B;  2KPH A;  2KI6 D;  2JU0 A;  1XFY O;  1LIN A;  4GNK B;  3D73 A;  1IRJ A;  2G9B A;  3PN7 B;  1F4O A;  2K7O A;  1A29 A;  2H8V A;  1SNL A;  5CPV A;  2LVV A;  3SJS A;  3CDN A;  3BUO B;  3ICB A;  1SW8 A;  2KI4 B;  4AQI A;  2HQW A;  1A4P A;  3I5G C;  2BAP A;  2BBM A;  1OQP A;  1UHJ A;  2Q4U A;  3TS5 B;  2JWW A;  1TCF A;  1QIW A;  1BOC A;  4GGN A;  1EJ3 A;  2M49 B;  1GGW A;  2R2I A;  1M31 A;  3I5H B;  3IVT A;  3NHI A;  1SY9 A;  1QV0 A;  3TUY B;  3VGO A;  2FJU B;  4HRH A;  1NSH A;  2BKH B;  3LLE A;  1SMG A;  4U8D A;  2M7L A;  1YUS A;  1DJY A;  2ERB A;  4F0Z B;  3M0W A;  1SCV A;  4BY5 A;  2LLU A;  2M29 A;  3OHM B;  3R72 A;  3D78 A;  2WC8 A;  1X02 A;  4PE7 A;  1A75 B;  1XK4 C;  5B8I B;  1ODB A;  1SL7 A;  3O78 A;  3B87 A;  2LCP A;  1BG1 A;  3GK4 X;  1M63 B;  1SBJ A;  4IL1 A;  1EXR A;  5FI2 A;  4M2P A;  3EK8 A;  3EVR A;  1TN4 A;  2LVK A;  4TNC A;  5AXI A;  4NDC A;  3BQ3 A;  4GBA A;  4C0K A;  1MXE A;  2LUX A;  1NX2 A;  2L5X B;  3FE6 A;  1OOF A;  2F2P A;  4DCK A;  2E30 A;  1GQM A;  1QVI Y;  4PHN A;  3UO9 A;  3F45 A;  3VRQ A;  1XYD A;  1N2D A;  4I5K A;  1QAS A;  1NP8 A;  1SYM A;  1C3Z A;  2H61 C;  3UNW A;  2QDI A;  2LLS A;  5AER A;  4ICB A;  1J7Q A;  3VRN A;  4FQO A;  1YX8 A;  2WCE A;  1V1G A;  3SS4 A;  4YI8 A;  5I94 A;  2GV5 A;  3SG6 A;  2ZN9 A;  3L4A A;  4ORC B;  3SG4 A;  1QTX A;  3FS7 A;  1KFX L;  1JF2 A;  1Y1A A;  4YGE B;  3KO0 A;  1S26 D;  1XFX O;  2K61 A;  1PVB A;  2KYF A;  2MBX A;  3NSK A;  3EK7 A;  1KQM C;  3DVE A;  4CFQ A;  1CM4 A;  1UUS A;  4DS7 A;  1QX2 A;  1SK6 D;  1CTR A;  1NPQ A;  1NCX A;  1MF8 B;  3FE8 A;  1ALV A;  1JF0 A;  1OZS A;  1CFD A;  3CZ0 A;  3KPX A;  3BFA A;  3S0A A;  3I5H C;  2FJY A;  3IQO A;  3CR2 A;  1U5I A;  2CBL A;  1WDC B;  2JNX A;  3DD4 A;  3D10 A;  1IJ5 A;  4MVF A;  1K9U A;  1NWD A;  1DMO A;  1ZMZ A;  2WCB A;  4PAL A;  1YTZ C;  2K7C A;  3TS5 C;  1DEK A;  4PT1 A;  3B86 A;  1LKJ A;  1XFV O;  1CLM A;  4E68 A;  1FW4 A;  1UP5 A;  3S0E A;  1MQ1 A;  1LS8 A;  1XFZ O;  1MR8 A;  2OPO A;  2AAO A;  1A03 A;  5KU1 A;  1SR6 C;  3CR4 X;  3KF9 A;  1NUB A;  2EC6 B;  1ORG A;  1A75 A;  1S1E A;  3JTD C;  3PN7 C;  2KLD A;  4CID A;  1CNP A;  2KLE A;  1FI6 A;  1CFC A;  2FCD A;  1LVC D;  3SIA A;  4DIR A;  2ISD A;  2Y5I A;  1K90 D;  1CDM A;  2WCJ A;  3D75 A;  4MZK A;  2KNE A;  3BFH A;  1PUL A;  1WDC C;  2ZND A;  3I5G B;  3JTD B;  3DVJ A;  3CZT X;  3EKH A;  2F2O A;  2Y1N A;  3CZ1 A;  3L47 A;  1KFU S;  4PHM A;  5PAL A;  3TDI A;  1JBA A;  1TOP A;  1JSA A;  1XA5 A;  1DTL A;  5F6T A;  1XVJ A;  2FOT A;  2L0P A;  3B6X A;  4A4C A;  1UWO A;  2LP3 A;  1YUU A;  1RTP 1;  2KFF A;  2L50 A;  2JXL A;  3PM8 A;  3BXK A;  2OS8 B;  3AKB A;  2MLF C;  4GAO A;  3BJH A;  4WQ2 A;  1NX0 A;  4ETO A;  2M7N A;  2WCH A;  4FTG A;  4MZJ A;  2A4J A;  4IJ7 A;  4M2O A;  4QJ5 B;  4MN0 A;  1M45 A;  1BMO A;  1KFU L;  3TZ1 A;  1IG5 A;  5DIC A;  3TDU A;  4MLW A;  1RK9 A;  3HX4 A;  4MZL A;  5HYD A;  3A8R A;  1NCY A;  3LK1 A;  1CFP A;  1YVL A;  1DEL A;  2CCM A;  5CSJ A;  1KQM B;  1OMR A;  1ZOT B;  2JNF A;  2P6B B;  4PE0 A;  1YX7 A;  2OTG C;  2Y4Q A;  2LHL A;  2RGI A;  1OW4 A;  1KSM A;  2WCF A;  1MHO A;  3PFV A;  5ER5 A;  1IH0 A;  1OOH A;  3I5F B;  1JFK A;  2JOJ A;  3QRX A;  5I8N A;  3NSL A;  2KHN A;  3LCP C;  1L2O C;  5I2O A;  4NDD A;  5G08 A;  1QIV A;  5JOL A;  1E8A A;  1SKT A;  2LMT A;  1S6I A;  2BE4 A;  4DRW A;  1PSB A;  2M3W A;  1K9P A;  3BUW B;  3AAK A;  1S6J A;  4I5N B;  1JWD A;  2QEB A;  3DF0 A;  1GJY A;  1F54 A;  3BYA A;  4MEW A;  1OOJ A;  1TWO A;  4CLN A;  2NLN A;  3HCM A;  2WCL A;  2LM5 A;  2PAL A;  3PLF B;  3VRP A;  4CFR A;  3OB2 B;  1S36 A;  1Z4H A;  2LMV A;  3TDZ A;  1NX1 A;  3WHU B;  5KSZ A;  3S0B A;  1DJZ A;  1UHK A;  2LHI A;  1F71 A;  3RLZ A;  1S5G Z;  2KSP A;  1OSA A;  3O6B A;  1DT7 B;  1F8H A;  1KK7 Z;  2ZKM X;  2G2B A;  3OX6 A;  2K2F A;  1NX3 A;  2MLE C;  1PRW A;  3PM2 A;  1B1G A;  5IBW A;  1UHN A;  1A2X A;  4MSP A;  1EG3 A;  5FI6 A;  3B7A A;  3I5I B;  2JT0 A;  2V53 A;  3H4S E;  1TRF A;  1XFR A;  1YRU B;  4JQ0 D;  4ZCV A;  3Q8I A;  2F3Z A;  3WNX B;  3EG5 B;  3WHT B;  1TNP A;  1F70 A;  1J1D A;  2KI4 C;  3CGA A;  1CKK A;  1YUR A;  3CS1 A;  4PHK A;  5JJG A;  1B7T Z;  3TUY C;  2EGD A;  1U5I B;  2JTZ A;  2F33 A;  4NDB A;  1Z2C B;  4ORB B;  2L2E A;  2PVB A;  4L9M A;  4ZCU A;  3ZNI A;  2BBN A;  3PSR A;  4OCI A;  2H61 A;  1FI5 A;  1QWV A;  2LE9 B;  1B9A A;  1BU3 A;  4I5J A;  4DUQ A;  4D1E A;  3D77 A;  2HQ8 A;  4A4B A;  1J1E A;  3RM1 A;  4AOM A;  4P2Y B;  3O2P A;  3FWC A;  2LUC A;  4FQT A;  4N1G A;  1J7O A;  1BR1 B;  5EL2 A;  1QAT A;  2F3Y A;  2NCP A;  3BUM B;  2JPT A;  2B1U A;  4NQG A;  1XFW O;  4PE1 A;  1C3Y A;  1S6C A;  2O5G A;  2JRF A;  1IGV A;  2GGM A;  1H8B A;  2F8P A;  1W9Z A;  2FCE A;  2BL0 B;  4GFT A;  5J3X A;  5HL1 A;  2WND A;  3BOW B;  2BCX A;  2JPO A;  1IWQ A;  1DJH A;  1DJW A;  1J7R A;  1XO5 A;  3DZT A;  1YVH A;  3EVU A;  1W7I B;  1KSO A;  2OS8 C;  5ER4 X;  2JC2 A;  1IQ3 A;  1JC2 A;  3DYE A;  2Y1M A;  3CYZ A;  1SL8 A;  2LMU A;  2L2C A;  2M97 A;  1P28 A;  4HRG A;  1K9K A;  1T14 A;  1AK8 A;  1BR4 B;  2LP2 A;  2PAS A;  1WLM A;  2KFH A;  2ZRS A;  3BUX B;  2ZFD A;  2BL0 C;  2MJW B;  3BUN B;  3VRO A;  1B7T Y; 
#chains in the Genus database with same CATH homology
 5HKZ A;  4OV2 A;  2I18 A;  4AQJ A;  2LAN A;  2KAV A;  2NZ0 A;  1BLQ A;  2L51 A;  2WOS A;  1FPW A;  1PVA A;  2JXC A;  5HKW A;  1AP4 A;  1WRZ A;  4MBE A;  4YGD B;  1B47 A;  2L4H A;  3FWB A;  4PE4 A;  3NSO A;  1KK8 C;  1KQV A;  1TTX A;  1QVI Z;  2KGB C;  2KBM A;  2TN4 A;  1RRO A;  4PHJ A;  1RJV A;  5D7F A;  2KAX A;  1ALW A;  5D69 A;  2LLT A;  3C1V A;  5CSI A;  4QJ4 B;  1SR6 B;  1WRK A;  3PAT A;  2CXJ A;  1KWO C;  4I5L B;  1RFJ A;  3WXA A;  2JQ6 A;  3IQQ A;  1TNQ A;  1Y1X A;  2QAC A;  1QXP A;  4YGA A;  4YRU A;  3BOW A;  4BY4 A;  5DKQ A;  5DKN A;  3I5I C;  2MA2 A;  2GGZ A;  1SL9 A;  2L4I A;  1KK7 Y;  1V1F A;  2ZNE A;  1B8L A;  3KHE A;  3CTN A;  3AAJ A;  1KWO B;  2Q91 A;  2NXQ A;  4YBH B;  2MHH A;  1YR5 A;  4OVN F;  5HKY A;  1IKU A;  1CMF A;  4GPL B;  3KEV A;  2KOT A;  1XFU O;  1REC A;  2CTN A;  1K2H A;  1TNX A;  5KTY A;  2EHB A;  3E3R A;  1ZUZ A;  2LNK A;  4XJK A;  1YUT A;  2QPT A;  1JFJ A;  2E6W A;  1M39 A;  1G8I A;  1FBV A;  2NCO A;  1IJ6 A;  1LXF C;  2BCA A;  1JUO A;  2I2R E;  2JT3 A;  2JZI A;  1Q80 A;  1Y6W A;  1QLS A;  4M2Q A;  3SG2 A;  2ZRT A;  1WY9 A;  1PSR A;  4HSZ A;  4OR9 B;  4QJ3 B;  1TCO B;  1WLZ A;  3ZWH A;  1OZO A;  3O4Y A;  1IQ5 A;  1W7J B;  2DOQ A;  1WRL A;  1AUI B;  1KK8 B;  2BCB A;  1BJF A;  2PMY A;  1C7V A;  1CB1 A;  1YRT B;  2KDH A;  1DJG A;  2HPS A;  4PCW A;  1DF0 B;  4MRX A;  3SG3 A;  1CM1 A;  2H2K A;  4CPV A;  2HF5 A;  1AJ4 A;  3GK2 A;  3GK1 A;  4YGC B;  3DVM A;  2M8U A;  4R1E A;  4WRI A;  1DJX A;  3CWG A;  5HLV A;  1OMV A;  1S3P A;  2KGR A;  2M9G A;  1H4B A;  1AHR A;  5HLO A;  3MSE B;  4XYN A;  5CSF A;  5K89 A;  2IS9 A;  2K7B A;  2D8N A;  2ZN8 A;  4JPZ B;  4N1F A;  1MUX A;  4OKH A;  1CDP A;  1D1O A;  2COL B;  1K96 A;  3K21 A;  4JWQ A;  1QX5 B;  1ZFS A;  2KI6 C;  1K93 D;  1F4Q A;  2EC6 C;  2JTT A;  1CDN A;  3IF7 A;  4C0L A;  1XK4 A;  5AFP A;  3D0Y A;  1L7Z A;  1S5G Y;  2AUC A;  3OX5 A;  4PDZ A;  2MRD A;  3OB1 B;  1DF0 A;  5TNC A;  3VRR A;  4GGF C;  1N0Y A;  3JVT B;  1R2U A;  1QV1 A;  2LVJ A;  1HT9 A;  1BT6 A;  1UUR A;  2M1U A;  1CDL A;  3EK4 A;  3SG5 A;  1MXL C;  5I2L A;  1DVI A;  5BPJ A;  2LV7 A;  2WOR A;  1SCM B;  1LA3 A;  5GQQ C;  3LK0 A;  1OMD A;  2I7A A;  1GGZ A;  1CFF A;  3DF0 B;  3OP0 A;  1EH2 A;  3GOF A;  1R6P A;  3SG7 A;  1NCZ A;  3DVK A;  4GGF A;  1TNW A;  2BEC A;  2L98 A;  1RWY A;  1QLK A;  4HRE E;  4C0J A;  3NSI A;  2PRU A;  4USL A;  4XJK B;  1B8C A;  1EG4 A;  4N5X A;  1QX7 A;  2LVI A;  5I2Q A;  1OE9 B;  1PAL A;  4YI9 A;  1DGU A;  1TIZ A;  3CLN A;  2O60 A;  2MAZ A;  1M46 A;  4Q04 A;  4MRY A;  1FF1 A;  3A4U B;  3AKA A;  1AVS A;  1G4Y R;  5AAN A;  1SCM C;  1K8U A;  2K2A A;  1QS7 A;  1BOD A;  3CR5 X;  2K0J A;  2KBI A;  1G33 A;  1CLL A;  2CT9 A;  1KCY A;  1LA0 A;  3JVT C;  2LC5 A;  3PAL A;  2KYC A;  1J55 A;  1MWN A;  1C07 A;  1F55 A;  3EVV A;  1B4C A;  2K8M B;  1NIW A;  1PK0 D;  2KFG A;  1QJT A;  5FYX A;  1AJ5 A;  4UPG A;  3EKJ A;  2JT8 A;  2BKI B;  3FIA A;  5CSN A;  1L2O B;  2HET A;  1UHH A;  4YGB B;  5DKR A;  3I5F C;  1DGV A;  2SAS A;  1SPY A;  2KQ6 A;  1HQV A;  1C7W A;  1EL4 A;  4WQ3 A;  1BF5 A;  3LL8 B;  2LAP A;  1CMG A;  3NXA A;  2I94 A;  2PSR A;  2OTG B;  4GUK A;  2KQY A;  4ORA B;  2VRG A;  2JUL A;  4P5O E;  1UHI A;  1KFX S;  2CNP A;  2M0R A;  2BE6 A;  1ZAC A;  1NYA A;  1K94 A;  3D0Y B;  5AEQ A;  2KAY A;  3SIB A;  1N65 A;  2AMI A;  1CLB A;  1DJI A;  1VRK A;  1B8R A;  1SRA A;  1Y1U A;  1J7P A;  1K95 A;  2SCP A;  1Y0V H;  2K7D A;  2M1K B;  2KI6 D;  2JU0 A;  1XFY O;  1LIN A;  4GNK B;  1IRJ A;  2G9B A;  3PN7 B;  1F4O A;  2K7O A;  1A29 A;  1SNL A;  5CPV A;  2LVV A;  3SJS A;  3BUO B;  3ICB A;  1SW8 A;  2KI4 B;  4AQI A;  2HQW A;  1A4P A;  3I5G C;  2BBM A;  1OQP A;  1UHJ A;  2Q4U A;  3TS5 B;  2JWW A;  1TCF A;  1QIW A;  1BOC A;  4GGN A;  1EJ3 A;  2M49 B;  1GGW A;  2R2I A;  1M31 A;  3I5H B;  1SY9 A;  1QV0 A;  3TUY B;  3VGO A;  2FJU B;  4HRH A;  1NSH A;  2BKH B;  3LLE A;  1SMG A;  4U8D A;  2M7L A;  1YUS A;  1DJY A;  4F0Z B;  3M0W A;  1SCV A;  4BY5 A;  2LLU A;  2M29 A;  3OHM B;  2WC8 A;  1X02 A;  4PE7 A;  1A75 B;  1XK4 C;  5B8I B;  1ODB A;  1SL7 A;  3O78 A;  1BG1 A;  2LCP A;  3GK4 X;  1M63 B;  1SBJ A;  4IL1 A;  1EXR A;  4M2P A;  3EK8 A;  3EVR A;  1TN4 A;  2LVK A;  4TNC A;  5AXI A;  4NDC A;  3BQ3 A;  4GBA A;  4C0K A;  1MXE A;  2LUX A;  1NX2 A;  2L5X B;  2F2P A;  4DCK A;  2E30 A;  1GQM A;  1QVI Y;  4PHN A;  3F45 A;  3VRQ A;  1XYD A;  1N2D A;  4I5K A;  1QAS A;  1NP8 A;  1SYM A;  2H61 C;  2LLS A;  5AER A;  4ICB A;  1J7Q A;  3VRN A;  4FQO A;  1YX8 A;  2WCE A;  1V1G A;  4YI8 A;  2GV5 A;  3SG6 A;  2ZN9 A;  3SG4 A;  4ORC B;  1QTX A;  3FS7 A;  1KFX L;  1JF2 A;  1Y1A A;  4YGE B;  3KO0 A;  1S26 D;  1XFX O;  2K61 A;  1PVB A;  2KYF A;  2MBX A;  3NSK A;  3EK7 A;  1KQM C;  3DVE A;  4CFQ A;  1CM4 A;  1UUS A;  4DS7 A;  1QX2 A;  1SK6 D;  1CTR A;  1NPQ A;  1NCX A;  1MF8 B;  1ALV A;  1JF0 A;  1OZS A;  1CFD A;  3KPX A;  3I5H C;  3IQO A;  3CR2 A;  1U5I A;  2CBL A;  1WDC B;  2JNX A;  3DD4 A;  3D10 A;  1IJ5 A;  4MVF A;  1K9U A;  1NWD A;  1DMO A;  1ZMZ A;  2WCB A;  4PAL A;  1YTZ C;  2K7C A;  3TS5 C;  1LKJ A;  1XFV O;  1CLM A;  4E68 A;  1FW4 A;  1UP5 A;  1MQ1 A;  1XFZ O;  1MR8 A;  2OPO A;  2AAO A;  1A03 A;  5KU1 A;  1SR6 C;  3CR4 X;  3KF9 A;  1NUB A;  2EC6 B;  4CID A;  1A75 A;  1S1E A;  3JTD C;  3PN7 C;  1CNP A;  1FI6 A;  1CFC A;  2FCD A;  1LVC D;  3SIA A;  4DIR A;  2ISD A;  2Y5I A;  1K90 D;  1CDM A;  4MZK A;  2KNE A;  3I5G B;  1PUL A;  1WDC C;  2ZND A;  3JTD B;  3DVJ A;  3CZT X;  3EKH A;  2F2O A;  2Y1N A;  5PAL A;  4PHM A;  1KFU S;  3TDI A;  1JBA A;  1TOP A;  1JSA A;  1XA5 A;  1DTL A;  5F6T A;  1XVJ A;  2FOT A;  2L0P A;  4A4C A;  1UWO A;  2LP3 A;  1YUU A;  1RTP 1;  2KFF A;  2L50 A;  2JXL A;  3PM8 A;  3BXK A;  2OS8 B;  3AKB A;  2MLF C;  4GAO A;  4ETO A;  4WQ2 A;  1NX0 A;  2M7N A;  4FTG A;  4MZJ A;  2A4J A;  4M2O A;  4QJ5 B;  4MN0 A;  1M45 A;  1BMO A;  1KFU L;  3TZ1 A;  1IG5 A;  3TDU A;  4MLW A;  1RK9 A;  3HX4 A;  4MZL A;  5HYD A;  3A8R A;  1NCY A;  3LK1 A;  1CFP A;  1YVL A;  2CCM A;  5CSJ A;  1KQM B;  1OMR A;  1ZOT B;  2JNF A;  2P6B B;  4PE0 A;  1YX7 A;  2OTG C;  2Y4Q A;  2LHL A;  2RGI A;  1KSM A;  2WCF A;  1MHO A;  3PFV A;  5ER5 A;  1IH0 A;  3I5F B;  1JFK A;  2JOJ A;  3QRX A;  5I8N A;  3NSL A;  2KHN A;  3LCP C;  1L2O C;  5I2O A;  4NDD A;  5G08 A;  1QIV A;  5JOL A;  1E8A A;  1SKT A;  2LMT A;  1S6I A;  2BE4 A;  4DRW A;  1PSB A;  2M3W A;  1K9P A;  3BUW B;  3AAK A;  1S6J A;  4I5N B;  1JWD A;  3DF0 A;  1GJY A;  1F54 A;  3BYA A;  4MEW A;  1OOJ A;  4CLN A;  2NLN A;  3HCM A;  2LM5 A;  2PAL A;  3PLF B;  3VRP A;  4CFR A;  3OB2 B;  1S36 A;  2LMV A;  3TDZ A;  1NX1 A;  3WHU B;  5KSZ A;  1DJZ A;  1UHK A;  2LHI A;  1F71 A;  3RLZ A;  1S5G Z;  2KSP A;  1OSA A;  3O6B A;  1DT7 B;  1F8H A;  1KK7 Z;  2ZKM X;  2G2B A;  3OX6 A;  2K2F A;  1NX3 A;  2MLE C;  1PRW A;  1B1G A;  5IBW A;  1UHN A;  1A2X A;  4MSP A;  1EG3 A;  3I5I B;  2JT0 A;  2V53 A;  3H4S E;  1TRF A;  4JQ0 D;  1YRU B;  4ZCV A;  2F3Z A;  3WNX B;  3WHT B;  1TNP A;  1F70 A;  1J1D A;  2KI4 C;  3CGA A;  1CKK A;  1YUR A;  3CS1 A;  4PHK A;  5JJG A;  1B7T Z;  3TUY C;  2EGD A;  1U5I B;  2JTZ A;  2F33 A;  4NDB A;  4ORB B;  2L2E A;  2PVB A;  4L9M A;  4ZCU A;  3ZNI A;  2BBN A;  3PSR A;  4OCI A;  2H61 A;  1FI5 A;  2LE9 B;  1B9A A;  1BU3 A;  4I5J A;  4DUQ A;  4D1E A;  2HQ8 A;  4A4B A;  1J1E A;  3RM1 A;  4AOM A;  4P2Y B;  3O2P A;  3FWC A;  2LUC A;  4N1G A;  1J7O A;  1BR1 B;  1QAT A;  2F3Y A;  2NCP A;  3BUM B;  2JPT A;  2B1U A;  4NQG A;  1XFW O;  4PE1 A;  1S6C A;  2O5G A;  2JRF A;  2GGM A;  1IGV A;  1H8B A;  2F8P A;  2FCE A;  5J3X A;  2BL0 B;  4GFT A;  2WND A;  3BOW B;  2BCX A;  1IWQ A;  1DJH A;  1DJW A;  1J7R A;  1XO5 A;  3EVU A;  1YVH A;  1IQ3 A;  1W7I B;  1KSO A;  2OS8 C;  5ER4 X;  2JC2 A;  1JC2 A;  2Y1M A;  4HRG A;  1SL8 A;  2LMU A;  2M97 A;  1K9K A;  1AK8 A;  1BR4 B;  2LP2 A;  2PAS A;  1WLM A;  2KFH A;  2ZRS A;  3BUX B;  2ZFD A;  2BL0 C;  2MJW B;  3BUN B;  3VRO A;  1B7T Y; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...