1WRKA

Crystal structure of the n-terminal domain of human cardiac troponin c in complex with trifluoperazine (orthrombic crystal form)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
82
structure length
82
Chain Sequence
IYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGSISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRSM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Contractile protein
molecule keywords Troponin C, slow skeletal and cardiac muscles
publication title Crystal structure of the N-terminal domain of human cardiac troponin C in complex with trifluoperazine
rcsb
source organism Homo sapiens
total genus 31
structure length 82
sequence length 82
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1wrkA00
2NXQA 2F3ZA 1S5GY 1KFXS 4XJKB 5CSJA 1AVSA 2BE6A 2KAVA 2L98A 4TNCA 2JWWA 1R2UA 2KFFA 1TNPA 2L4IA 2Y4QA 1J1EA 3IQOA 3LK1A 3CR5X 4MZLA 1K93D 2LUCA 1M46A 3KF9A 1H8BA 2Y5IA 4IL1A 1GQMA 2A4JA 4F0ZB 1CMFA 1QS7A 1XVJA 2AMIA 5JOLA 1ZFSA 1NX3A 1MR8A 2KQ6A 4CIDA 3BUNB 1TNWA 1Q80A 1WRLA 4YGEB 1JWDA 2CBLA 5J3XA 3AAKA 3KPXA 3PLFB 4DS7A 2M97A 2EGDA 3EK7A 1TN4A 3VRRA 1RWYA 1SL8A 1PALA 3KHEA 3DVMA 2M1UA 2LANA 4M2QA 3TUYB 4MBEA 5AFPA 2BKHB 2LVKA 2LLUA 1SCVA 3O4YA 2BL0B 1N2DA 2RGIA 2JRFA 5DKNA 1L2OC 2CNPA 3SG4A 1CKKA 2WORA 1DJZA 1M39A 1UHIA 2GV5A 4FTGA 4OKHA 4C0KA 1XFZO 2L0PA 1BLQA 2EC6B 3CLNA 3I5HC 3FWCA 2COLB 1QX2A 1WY9A 4MRYA 4Q04A 1RJVA 1KQMC 1GGZA 4GUKA 4MEWA 1IJ5A 4I5JA 3KEVA 3TZ1A 1OMRA 3OB1B 1DMOA 2ZKMX 2KFGA 2GGZA 3RLZA 1TNXA 2LVJA 2I2RE 3I5IB 1MHOA 1CDNA 1SR6C 1S6CA 5CSIA 3SG7A 1C07A 5FYXA 2KAXA 3LL8B 2JTTA 2ZN9A 2G9BA 2MAZA 1DJGA 3BUXB 3SJSA 5HKYA 1OOJA 1FPWA 2LCPA 1DT7B 2ZRTA 1IJ6A 2ZRSA 1FF1A 1NP8A 3LCPC 1EXRA 1C7WA 3DVKA 4C0LA 3BUMB 1AUIB 1B47A 2Q4UA 1JF2A 1MXLC 4N1FA 1QX7A 5I2QA 1S6IA 2O60A 4QJ5B 1W7JB 4AQIA 1SYMA 5HYDA 1LA3A 2ISDA 1A4PA 2SASA 3NXAA 4WRIA 2TN4A 1NCYA 1NCZA 1RTP1 2LHIA 2WCEA 1PSBA 1KSOA 1YURA 1ZOTB 2MLFC 1CFDA 3WHTB 1NX1A 1UHHA 3O2PA 4YBHB 1AHRA 2LE9B 4HSZA 5DKRA 3TDUA 2OS8C 4MZKA 4CPVA 2M0RA 3PATA 1A29A 2JT3A 2E30A 1NX0A 2KI4C 1KK7Z 1SW8A 3BXKA 2NCOA 4ZCUA 1XFUO 3VRQA 1MXEA 1JF0A 4GGNA 1DJWA 4M2PA 3BOWA 1CLMA 4MRXA 3WHUB 5AERA 5HLOA 1J55A 1A2XA 1IRJA 1LXFC 1XK4A 2JXLA 2P6BB 3NSLA 4I5LB 2MHHA 1F8HA 1KWOC 2K61A 1NYAA 2PRUA 1DF0A 2M7LA 2LP3A 1SBJA 3FS7A 2Y1MA 1XFYO 1QTXA 1ALWA 1CFCA 1EH2A 2KOTA 1XA5A 1Y1AA 2JTZA 4MN0A 4PCWA 1EL4A 1QLKA 1V1FA 4DIRA 1YTZC 3BOWB 1ZUZA 1XO5A 3BYAA 4USLA 4PE0A 1SK6D 1FBVA 2FJUB 2M9GA 4WQ3A 1WDCB 4UPGA 2L4HA 1JC2A 1RECA 1DF0B 1F71A 2ZN8A 4ETOA 4ZCVA 1MQ1A 4N1GA 1NCXA 3AKBA 3WNXB 3CGAA 2M8UA 1DJHA 1BODA 1UHNA 1J7OA 3BUWB 4MVFA 1H4BA 4BY5A 1N65A 3VRPA 1KK7Y 1Y1UA 2I18A 1QJTA 2EHBA 4CFRA 2GGMA 2L50A 1DJIA 4CFQA 2QACA 2F2PA 2LMTA 5KSZA 4NDBA 1IWQA 4GBAA 2KDHA 4L9MA 5I2OA 2KI6C 2K7DA 1IQ5A 4AQJA 1MUXA 5CSFA 3SG2A 4YGCB 3TS5B 2PASA 4JPZB 4PHNA 1GGWA 1J7PA 3FIAA 2BBMA 2K2AA 3D10A 1KSMA 2Y1NA 4PHKA 1KFUL 1G4YR 3I5FB 4JWQA 2L51A 2Q91A 1YX7A 4ICBA 1CDLA 5HKZA 3SIBA 3HX4A 2JXCA 3I5GC 1KQVA 1YR5A 1G8IA 3LK0A 4PDZA 1F55A 1PULA 1B8RA 5KTYA 1A03A 1IKUA 1BT6A 4PHJA 1KK8B 1S3PA 2MJWB 4I5NB 4PE1A 1D1OA 2JPTA 2NZ0A 5D69A 2KGRA 3EKHA 1XK4C 3SG6A 2KYFA 1ODBA 3JVTB 1DJXA 2KGBC 5HLVA 2K7OA 1WRZA 4MZJA 1YX8A 2LP2A 2LV7A 1K8UA 3FWBA 1TOPA 4I5KA 3NSOA 4GGFC 1FI5A 1RFJA 1BR4B 2V53A 4A4BA 2JNFA 1SPYA 5CPVA 2H61A 1HQVA 1CTRA 2OTGB 4P2YB 2JOJA 1B7TZ 4YGBB 1YUUA 2E6WA 2KBIA 2MA2A 4U8DA 1BU3A 1B4CA 1AJ4A 1DJYA 5KU1A 1PVAA 2F2OA 1M45A 5PALA 4XYNA 2M29A 3RM1A 1OQPA 1F4OA 5ER4X 1RROA 2K0JA 2JT8A 1A75B 1OMDA 2FCEA 3TUYC 2MRDA 3KO0A 2HETA 1S26D 1XYDA 3I5FC 3EKJA 1QV1A 2LNKA 2BL0C 2LVIA 3GOFA 4BY4A 2M3WA 2CT9A 4M2OA 2HQWA 3VRNA 2KSPA 3GK1A 2HQ8A 5I2LA 1Y1XA 2F3YA 2JU0A 2KQYA 1CFFA 4HRHA 2BKIB 2MLEC 1YVHA 1B7TY 3VROA 1SL7A 1LINA 2EC6C 2KHNA 1NIWA 5JJGA 3EVUA 5G08A 2WCFA 1JBAA 1OZSA 1V1GA 2LM5A 2LVVA 3ICBA 1VRKA 4GAOA 2LC5A 1QASA 1XFXO 4MLWA 4NQGA 1UWOA 4P5OE 3D0YA 1W7IB 2QPTA 1K9KA 2JZIA 4YI8A 1PRWA 1M63B 1NUBA 2B1UA 1EG4A 2JQ6A 1U5IA 1B9AA 3GK4X 3I5IC 4JQ0D 1JSAA 1LKJA 1NX2A 1WLZA 2G2BA 1JFJA 4PE4A 4GFTA 1SNLA 2MBXA 2H2KA 1SCMB 3NSKA 1ALVA 3CR2A 3DF0B 3K21A 1CMGA 3D0YB 2I94A 5DKQA 1K90D 1OZOA 4PE7A 3OB2B 2BCBA 4QJ4B 1FI6A 1U5IB 1YUTA 5K89A 1J1DA 1N0YA 3ZWHA 4AOMA 2ZFDA 1BG1A 3DD4A 2H61C 3CTNA 1UHJA 2LMUA 3SG5A 1L2OB 1NSHA 1NPQA 1DVIA 1KFXL 2HF5A 1OSAA 2WNDA 5ER5A 3PN7B 2WOSA 1B8LA 1K9PA 1CM1A 1PSRA 1FW4A 2ZNDA 3DVEA 3A4UB 3TDZA 4C0JA 3H4SE 1ZMZA 3I5HB 1AP4A 3PALA 5B8IB 4NDDA 1LA0A 4OR9B 3JTDB 1F70A 4HREE 1K95A 2BBNA 2LLSA 1KQMB 1BJFA 1OMVA 2CTNA 3EVVA 1E8AA 1ZACA 2JNXA 4WQ2A 1B1GA 5AANA 5GQQC 3HCMA 2LAPA 1DGVA 1TCFA 1XFWO 2L2EA 3CR4X 3O78A 4FQOA 1S1EA 1WRKA 1J7RA 1SKTA 1SR6B 1M31A 1OE9B 2PMYA 3BQ3A 4HRGA 1G33A 1K2HA 1XFVO 4OVNF 1K96A 1S6JA 2K7BA 3C1VA 1SL9A 2K8MB 3IF7A 4DUQA 3CZTX 2BECA 1TIZA 1UURA 1YVLA 2AAOA 2KAYA 2NLNA 2F8PA 1SCMC 1TCOB 5TNCA 3AAJA 1QX5B 1F54A 1CLBA 2WCBA 1KFUS 2LLTA 2KFHA 2K2FA 1IG5A 2ZNEA 4QJ3B 1WDCC 4PHMA 3M0WA 2KBMA 3EK8A 3TDIA 1J7QA 1SRAA 1L7ZA 1F4QA 2D8NA 1JFKA 1UHKA 4A4CA 1YRUB 1SMGA 3PN7C 2M7NA 1BMOA 2BCAA 2KNEA 3GK2A 2O5GA 3DVJA 2OS8B 4OV2A 5IBWA 4YGDB 1A75A 1LVCD 2KI4B 3OX5A 1MWNA 1QATA 1BOCA 2SCPA 3JTDC 1YRTB 1Y0VH 4OCIA 3IQQA 2R2IA 1R6PA 1NWDA 3NSIA 1QLSA 1S36A 1QVIZ 3EK4A 1HT9A 2AUCA 5AXIA 3TS5C 3OP0A 2BCXA 2KYCA 3AKAA 1KWOB 3ZNIA 2JULA 3CS1A 4MSPA 1DGUA 2JC2A 2LHLA 5CSNA 4DCKA 3A8RA 4YGAA 4E68A 1BR1B 1UUSA 1UP5A 2HPSA 1IGVA 2PSRA 1RK9A 1PVBA 1TTXA 2I7AA 2M1KB 4R1EA 1AK8A 1K94A 2VRGA 3PM8A 1EG3A 1TNQA 2CCMA 2LUXA 4D1EA 4YRUA 5I8NA 3QRXA 1CNPA 1KK8C 3SG3A 1IH0A 1YUSA 3PSRA 1CB1A 5AEQA 1B8CA 2BE4A 1TRFA 4N5XA 3JVTC 3CWGA 4NDCA 1WLMA 5D7FA 2FCDA 2OPOA 2M49B 3OX6A 3DF0A 2WC8A 1QVIY 1CM4A 1PK0D 2K7CA 1QXPA 4ORCB 4GPLB 3EVRA 2L5XB 1S5GZ 2LMVA 2PALA 5F6TA 2OTGC 3SIAA 1GJYA 4CLNA 1EJ3A 4DRWA 1IQ3A 5BPJA 1KCYA 3E3RA 4YI9A 2JT0A 1JUOA 1Y6WA 1QV0A 2NCPA 3BUOB 5HKWA 3MSEB 3VGOA 2FOTA 1CFPA 3WXAA 1MF8B 1DTLA 1AJ5A 1C7VA 1K9UA 2PVBA 4ORAB 1CDPA 3I5GB 3LLEA 2CXJA 3F45A 4XJKA 1SY9A 4ORBB 2DOQA 4PALA 4GGFA 1BF5A 2KI6D 3O6BA 1X02A 2F33A 3OHMB 2IS9A 1QIVA 1CDMA 1CLLA 1QIWA 3PFVA 4GNKB
chains in the Genus database with same CATH superfamily
3NGVA 2NXQA 2F3ZA 1S5GY 1KFXS 4XJKB 5CSJA 1AVSA 2BE6A 3RZSA 2KAVA 2L98A 4TNCA 3R1OA 2JWWA 1R2UA 2KFFA 1TNPA 2L4IA 2Y4QA 1J1EA 3IQOA 3LK1A 3CR5X 4MZLA 1K93D 2LUCA 1M46A 3KF9A 4OZDA 1H8BA 2Y5IA 4IL1A 1GQMA 3O4XA 2A4JA 4F0ZB 1CMFA 1QS7A 1XVJA 2AMIA 5JOLA 1ZFSA 1NX3A 1MR8A 2KQ6A 2WCLA 3CZ1A 4CIDA 2H8VA 3BUNB 1TNWA 1Q80A 1WRLA 4YGEB 1JWDA 2CBLA 5J3XA 3AAKA 2JPOA 5FI7A 3KPXA 3PLFB 4DS7A 1TWOA 2M97A 2EGDA 3EK7A 1TN4A 3VRRA 1RWYA 1SL8A 2K60A 1PALA 3KHEA 3DVMA 2M1UA 2LANA 4M2QA 3L4LA 3TUYB 4MBEA 5AFPA 2BKHB 1QWVA 2LVKA 2LLUA 1SCVA 3O4YA 2BL0B 1N2DA 2RGIA 2JRFA 5DKNA 1L2OC 2CNPA 5FI6A 3SG4A 1CKKA 2WORA 1IIOA 1DJZA 1M39A 1UHIA 2GV5A 4FTGA 1OW4A 3R1VA 4OKHA 4C0KA 1XFZO 3SS4A 2L0PA 4PT1A 1BLQA 2EC6B 3CLNA 3I5HC 3FWCA 2COLB 1QX2A 3D73A 1WY9A 2YGUA 1OOIX 4INXA 4MRYA 4Q04A 1RJVA 3B6XA 1KQMC 1GGZA 4GUKA 4MEWA 1IJ5A 2QEOA 4I5JA 3KEVA 3TZ1A 1OMRA 1C3YA 3OB1B 1DMOA 2ZKMX 2KFGA 2GGZA 3RLZA 1TNXA 2LVJA 2I2RE 3I5IB 1MHOA 2PYQA 1CDNA 1SR6C 1S6CA 5CSIA 3SG7A 1C07A 5FYXA 2KAXA 3LL8B 2JTTA 3EG5B 2ZN9A 2G9BA 2MAZA 1DJGA 3BUXB 3SJSA 5HKYA 3R1PA 1OOJA 1FPWA 2LCPA 1DT7B 2ZRTA 1IJ6A 2ZRSA 1FF1A 1NP8A 1OOFA 2KLDA 3K1EA 3LCPC 1EXRA 1C7WA 3DVKA 4C0LA 1LS8A 3BUMB 1AUIB 1B47A 2WCJA 2Q4UA 1JF2A 1MXLC 4N1FA 1QX7A 5I2QA 2KPHA 1S6IA 2O60A 4QJ5B 1W7JB 4AQIA 1SYMA 5HYDA 2WCKA 3NHTA 1LA3A 3DYEA 2ISDA 1A4PA 2SASA 3NXAA 4WRIA 2TN4A 1NCYA 3D74A 1NCZA 1RTP1 2LHIA 2WCEA 1PSBA 1DC1A 1KSOA 1YURA 1ZOTB 2MLFC 1CFDA 3WHTB 1NX1A 1UHHA 3O2PA 4YBHB 1AHRA 2LE9B 4HSZA 5DKRA 5FI2A 3TDUA 2OS8C 4MZKA 2GTEA 4CPVA 2M0RA 3PATA 1A29A 2JT3A 2E30A 1NX0A 2KI4C 1KK7Z 1SW8A 3BXKA 2NCOA 4ZCUA 3DXLA 1XFUO 3VRQA 1MXEA 1JF0A 3D76A 4GGNA 1DJWA 4M2PA 3BOWA 1CLMA 4MRXA 3WHUB 3D78A 5AERA 5HLOA 1J55A 1A2XA 1IRJA 1LXFC 1XK4A 2JXLA 2P6BB 3NSLA 4I5LB 2MHHA 1F8HA 1KWOC 2K61A 1NYAA 2PRUA 1DF0A 2M7LA 3FE9A 2LP3A 1SBJA 3FS7A 2Y1MA 1XFYO 1QTXA 1ALWA 3Q8IA 1CFCA 1EH2A 2KOTA 1XA5A 1Y1AA 3UO9A 2JTZA 4MN0A 4PCWA 1EL4A 1QLKA 1V1FA 4DIRA 1YTZC 3FE6A 3BOWB 1ZUZA 1XO5A 3BYAA 4USLA 4PE0A 1T14A 1SK6D 1FBVA 2FJUB 2M9GA 3B87A 4WQ3A 1WDCB 4UPGA 2L4HA 1JC2A 1RECA 1DF0B 1F71A 2ZN8A 4ETOA 4ZCVA 1MQ1A 4N1GA 1NCXA 3AKBA 3WNXB 3CGAA 1DQEA 2WC6A 2M8UA 3DY9A 1DJHA 1BODA 1UHNA 1J7OA 3BUWB 4MVFA 1H4BA 3SS3A 4BY5A 1N65A 3VRPA 1KK7Y 1Z2CB 1Y1UA 2I18A 1QJTA 2EHBA 4CFRA 2GGMA 2L50A 1DJIA 4CFQA 2QACA 2F2PA 2LMTA 5KSZA 4NDBA 1IWQA 4GBAA 2KDHA 1TUJA 3S0AA 4L9MA 5I2OA 2KI6C 3B88A 2K7DA 3PM2A 1IQ5A 4AQJA 1MUXA 5CSFA 3SG2A 4YGCB 3TS5B 2BNXA 2PASA 4JPZB 4PHNA 1GGWA 1J7PA 3FIAA 2BBMA 2K2AA 3D10A 1KSMA 2Y1NA 4PHKA 1KFUL 1G4YR 3I5FB 4JWQA 2L51A 2Q91A 1YX7A 4ICBA 1CDLA 5HKZA 3SIBA 3HX4A 2JXCA 3I5GC 1KQVA 1YR5A 1G8IA 3LK0A 4PDZA 1F55A 1PULA 1B8RA 5KTYA 1A03A 3L47A 1IKUA 1BT6A 4PHJA 1KK8B 1S3PA 2MJWB 4I5NB 4PE1A 1D1OA 2JPTA 2NZ0A 3CYZA 5D69A 1XFRA 2WCMA 2KGRA 3EKHA 1XK4C 1C3ZA 3SG6A 2KYFA 1ODBA 3JVTB 1DJXA 2KGBC 3BFAA 5HLVA 2K7OA 1WRZA 4MZJA 1YX8A 2LP2A 2LV7A 1K8UA 3FWBA 1TOPA 4I5KA 3NSOA 4GGFC 1FI5A 1RFJA 1BR4B 2V53A 4A4BA 2JNFA 1SPYA 5CPVA 2H61A 2WCHA 1HQVA 1CTRA 2OTGB 3R72A 4P2YB 2JOJA 1B7TZ 4INWA 4YGBB 1YUUA 2E6WA 2KBIA 2MA2A 4U8DA 3DZTA 1BU3A 1B4CA 1AJ4A 1DJYA 5KU1A 1PVAA 2F2OA 3BFBA 1M45A 5PALA 1P28A 4XYNA 2M29A 3RM1A 1OQPA 1F4OA 5ER4X 2P70A 3OGNA 1RROA 2K0JA 2JT8A 1A75B 1OMDA 2FCEA 3TUYC 2MRDA 3KO0A 2HETA 1S26D 1XYDA 3I5FC 3EKJA 1QV1A 2LNKA 4F7FA 2BL0C 2LVIA 3N7HA 3GOFA 4BY4A 2M3WA 2CT9A 4M2OA 2HQWA 3VRNA 2KSPA 3GK1A 2HQ8A 5I2LA 1Y1XA 2F3YA 2JU0A 2KQYA 1CFFA 4HRHA 3NHIA 2BKIB 2MLEC 1YVHA 1B7TY 3VROA 1SL7A 1LINA 2EC6C 2KHNA 1NIWA 5JJGA 3EVUA 5G08A 3D77A 2WCFA 1JBAA 1OZSA 1V1GA 2LM5A 2LVVA 3CZ0A 3ICBA 1VRKA 4GAOA 2LC5A 1QASA 1XFXO 4JKTA 4MLWA 4NQGA 1UWOA 4P5OE 3D0YA 4IJ7A 1W7IB 3BJHA 2QPTA 1K9KA 2JZIA 4YI8A 1PRWA 1M63B 1NUBA 2B1UA 1EG4A 2JQ6A 3L4AA 1U5IA 3VB1A 1B9AA 3GK4X 3I5IC 4JQ0D 1JSAA 3UNWA 1LKJA 1NX2A 1WLZA 2G2BA 1JFJA 3B7AA 4PE4A 4GFTA 1SNLA 2MBXA 2H2KA 1SCMB 3NSKA 1ALVA 3CR2A 3DF0B 3K21A 1CMGA 3D0YB 2I94A 5DKQA 1K90D 1OZOA 4PE7A 3OB2B 2PQLA 2BCBA 2QEBA 4QJ4B 1FI6A 1U5IB 1YUTA 5EL2A 1J1DA 5K89A 1N0YA 3ZWHA 2FJYA 2ZFDA 4AOMA 3DD4A 2H61C 3CTNA 1BG1A 1UHJA 2LMUA 3SG5A 1L2OB 1NSHA 1NPQA 1DVIA 1KFXL 2HF5A 2P71A 1OSAA 2WNDA 5ER5A 3B86A 3PN7B 3CABA 2WOSA 1B8LA 1K9PA 1CM1A 1PSRA 1FW4A 2ZNDA 3DVEA 3A4UB 3TDZA 4C0JA 3D75A 3H4SE 1ZMZA 2BAPA 3S0BA 3I5HB 1AP4A 3PALA 5B8IB 4NDDA 1LA0A 4OR9B 3JTDB 1F70A 4HREE 1K95A 2BBNA 2LLSA 1KQMB 1BJFA 1OMVA 2CTNA 3EVVA 1E8AA 1ZACA 2JNXA 4WQ2A 1B1GA 5AANA 5GQQC 3HCMA 2LAPA 1DGVA 1TCFA 1XFWO 2L2EA 3CR4X 3O78A 4KYNA 4FQOA 1S1EA 1WRKA 1DEKA 1J7RA 1ORGA 1SKTA 1SR6B 1M31A 1OE9B 2PMYA 3S0GA 1DELA 3BQ3A 4HRGA 1G33A 1K2HA 1XFVO 5HL1A 4OVNF 1K96A 1S6JA 1TUZA 2K7BA 3C1VA 1SL9A 2K8MB 3IF7A 4DUQA 3CZTX 2BECA 1TIZA 2L5YA 1SSEB 1UURA 1YVLA 2AAOA 2KAYA 2NLNA 2F8PA 1SCMC 1TCOB 5TNCA 3AAJA 1QX5B 1F54A 1CLBA 2WCBA 5DICA 4JD9A 3S0EA 1KFUS 2LLTA 2KFHA 2K2FA 3OBVA 1IG5A 2ZNEA 4QJ3B 1WDCC 4PHMA 3CZ2A 3M0WA 2KBMA 3EK8A 3TDIA 1J7QA 1SRAA 1L7ZA 1F4QA 3SS5A 2D8NA 1JFKA 1UHKA 4A4CA 1YRUB 1SMGA 3FE8A 3PN7C 2M7NA 1BMOA 2BCAA 2KNEA 3GK2A 2O5GA 3DVJA 2OS8B 4OV2A 5IBWA 4YGDB 2L2CA 1A75A 1LVCD 3V2LA 2KI4B 3OX5A 3QMEA 1MWNA 1QATA 1BOCA 2SCPA 3JTDC 1YRTB 1Y0VH 4OCIA 3IQQA 2R2IA 1R6PA 1NWDA 3NSIA 1QLSA 1S36A 1QVIZ 3EK4A 1HT9A 2AUCA 5AXIA 3TS5C 3OP0A 3S0FA 2BCXA 2KYCA 3AKAA 1KWOB 3ZNIA 2JULA 3CS1A 4MSPA 1OOHA 1DGUA 2JC2A 1OOGA 2LHLA 5CSNA 4DCKA 3A8RA 3BFHA 2QEHA 4YGAA 4E68A 1BR1B 1UUSA 1UP5A 2HPSA 3S0DA 2QEVA 1IGVA 2PSRA 1RK9A 1PVBA 2WC5A 1TTXA 2I7AA 2M1KB 4R1EA 1AK8A 1K94A 2VRGA 3PM8A 1EG3A 1TNQA 2CCMA 2LUXA 4D1EA 4YRUA 5I8NA 3QRXA 1CNPA 1KK8C 3SG3A 1GM0A 1IH0A 1YUSA 3PSRA 1CB1A 5AEQA 1B8CA 2BE4A 4FQTA 1TRFA 4N5XA 3JVTC 3CWGA 4NDCA 1WLMA 5D7FA 2FCDA 2OPOA 2M49B 3OX6A 3DF0A 2WC8A 1QVIY 1CM4A 1PK0D 2K7CA 1QXPA 3IVTA 4ORCB 4GPLB 3EVRA 2L5XB 1S5GZ 2LMVA 2PALA 5F6TA 2OTGC 3SIAA 1GJYA 4CLNA 1EJ3A 4DRWA 2ERBA 1IQ3A 5BPJA 1KCYA 1W9ZA 3E3RA 4YI9A 2JT0A 1JUOA 1Y6WA 1QV0A 2NCPA 3BUOB 5HKWA 3MSEB 1Z4HA 3VGOA 2FOTA 1CFPA 5I94A 3WXAA 1MF8B 1DTLA 2QDIA 1AJ5A 1C7VA 1K9UA 2PVBA 5D3OA 4ORAB 1CDPA 3I5GB 3LLEA 2CXJA 3F45A 4XJKA 1SY9A 4ORBB 2DOQA 4PALA 4GGFA 1BF5A 2KI6D 3O6BA 1X02A 2F33A 3OHMB 2IS9A 1QIVA 3PJIA 2KLEA 1CDMA 1CLLA 1QIWA 3PFVA 4GNKB 3CDNA
chains in the Genus database with same CATH topology
2NXQA 2F3ZA 1S5GY 1KFXS 4XJKB 5CSJA 1AVSA 2BE6A 2KAVA 2L98A 4TNCA 2JWWA 1R2UA 2KFFA 1TNPA 2L4IA 2Y4QA 1J1EA 3IQOA 3LK1A 3CR5X 4MZLA 1K93D 2LUCA 1M46A 3KF9A 1H8BA 2Y5IA 4IL1A 1GQMA 2A4JA 4F0ZB 1CMFA 1QS7A 1XVJA 2AMIA 5JOLA 1ZFSA 1NX3A 1MR8A 2KQ6A 4CIDA 3BUNB 1TNWA 1Q80A 1WRLA 4YGEB 1JWDA 2CBLA 5J3XA 3AAKA 3KPXA 3PLFB 4DS7A 2M97A 2EGDA 3EK7A 1TN4A 3VRRA 1RWYA 1SL8A 1PALA 3KHEA 3DVMA 2M1UA 2LANA 4M2QA 3TUYB 4MBEA 5AFPA 2BKHB 2LVKA 2LLUA 1SCVA 3O4YA 2BL0B 1N2DA 2RGIA 2JRFA 5DKNA 1L2OC 2CNPA 3SG4A 1CKKA 2WORA 1DJZA 1M39A 1UHIA 2GV5A 4FTGA 4OKHA 4C0KA 1XFZO 2L0PA 1BLQA 2EC6B 3CLNA 3I5HC 3FWCA 2COLB 1QX2A 1WY9A 4MRYA 4Q04A 1RJVA 1KQMC 1GGZA 4GUKA 4MEWA 1IJ5A 4I5JA 3KEVA 3TZ1A 1OMRA 3OB1B 1DMOA 2ZKMX 2KFGA 2GGZA 3RLZA 1TNXA 2LVJA 2I2RE 3I5IB 1MHOA 1CDNA 1SR6C 1S6CA 5CSIA 3SG7A 1C07A 5FYXA 2KAXA 3LL8B 2JTTA 2ZN9A 2G9BA 2MAZA 1DJGA 3BUXB 3SJSA 5HKYA 1OOJA 1FPWA 2LCPA 1DT7B 2ZRTA 1IJ6A 2ZRSA 1FF1A 1NP8A 3LCPC 1EXRA 1C7WA 3DVKA 4C0LA 3BUMB 1AUIB 1B47A 2Q4UA 1JF2A 1MXLC 4N1FA 1QX7A 5I2QA 1S6IA 2O60A 4QJ5B 1W7JB 4AQIA 1SYMA 5HYDA 1LA3A 2ISDA 1A4PA 2SASA 3NXAA 4WRIA 2TN4A 1NCYA 1NCZA 1RTP1 2LHIA 2WCEA 1PSBA 1KSOA 1YURA 1ZOTB 2MLFC 1CFDA 3WHTB 1NX1A 1UHHA 3O2PA 4YBHB 1AHRA 2LE9B 4HSZA 5DKRA 3TDUA 2OS8C 4MZKA 4CPVA 2M0RA 3PATA 1A29A 2JT3A 2E30A 1NX0A 2KI4C 1KK7Z 1SW8A 3BXKA 2NCOA 4ZCUA 1XFUO 3VRQA 1MXEA 1JF0A 4GGNA 1DJWA 4M2PA 3BOWA 1CLMA 4MRXA 3WHUB 5AERA 5HLOA 1J55A 1A2XA 1IRJA 1LXFC 1XK4A 2JXLA 2P6BB 3NSLA 4I5LB 2MHHA 1F8HA 1KWOC 2K61A 1NYAA 2PRUA 1DF0A 2M7LA 2LP3A 1SBJA 3FS7A 2Y1MA 1XFYO 1QTXA 1ALWA 1CFCA 1EH2A 2KOTA 1XA5A 1Y1AA 2JTZA 4MN0A 4PCWA 1EL4A 1QLKA 1V1FA 4DIRA 1YTZC 3BOWB 1ZUZA 1XO5A 3BYAA 4USLA 4PE0A 1SK6D 1FBVA 2FJUB 2M9GA 4WQ3A 1WDCB 4UPGA 2L4HA 1JC2A 1RECA 1DF0B 1F71A 2ZN8A 4ETOA 4ZCVA 1MQ1A 4N1GA 1NCXA 3AKBA 3WNXB 3CGAA 2M8UA 1DJHA 1BODA 1UHNA 1J7OA 3BUWB 4MVFA 1H4BA 4BY5A 1N65A 3VRPA 1KK7Y 1Y1UA 2I18A 1QJTA 2EHBA 4CFRA 2GGMA 2L50A 1DJIA 4CFQA 2QACA 2F2PA 2LMTA 5KSZA 4NDBA 1IWQA 4GBAA 2KDHA 4L9MA 5I2OA 2KI6C 2K7DA 1IQ5A 4AQJA 1MUXA 5CSFA 3SG2A 4YGCB 3TS5B 2PASA 4JPZB 4PHNA 1GGWA 1J7PA 3FIAA 2BBMA 2K2AA 3D10A 1KSMA 2Y1NA 4PHKA 1KFUL 1G4YR 3I5FB 4JWQA 2L51A 2Q91A 1YX7A 4ICBA 1CDLA 5HKZA 3SIBA 3HX4A 2JXCA 3I5GC 1KQVA 1YR5A 1G8IA 3LK0A 4PDZA 1F55A 1PULA 1B8RA 5KTYA 1A03A 1IKUA 1BT6A 4PHJA 1KK8B 1S3PA 2MJWB 4I5NB 4PE1A 1D1OA 2JPTA 2NZ0A 5D69A 2KGRA 3EKHA 1XK4C 3SG6A 2KYFA 1ODBA 3JVTB 1DJXA 2KGBC 5HLVA 2K7OA 1WRZA 4MZJA 1YX8A 2LP2A 2LV7A 1K8UA 3FWBA 1TOPA 4I5KA 3NSOA 4GGFC 1FI5A 1RFJA 1BR4B 2V53A 4A4BA 2JNFA 1SPYA 5CPVA 2H61A 1HQVA 1CTRA 2OTGB 4P2YB 2JOJA 1B7TZ 4YGBB 1YUUA 2E6WA 2KBIA 2MA2A 4U8DA 1BU3A 1B4CA 1AJ4A 1DJYA 5KU1A 1PVAA 2F2OA 1M45A 5PALA 4XYNA 2M29A 3RM1A 1OQPA 1F4OA 5ER4X 1RROA 2K0JA 2JT8A 1A75B 1OMDA 2FCEA 3TUYC 2MRDA 3KO0A 2HETA 1S26D 1XYDA 3I5FC 3EKJA 1QV1A 2LNKA 2BL0C 2LVIA 3GOFA 4BY4A 2M3WA 2CT9A 4M2OA 2HQWA 3VRNA 2KSPA 3GK1A 2HQ8A 5I2LA 1Y1XA 2F3YA 2JU0A 2KQYA 1CFFA 4HRHA 2BKIB 2MLEC 1YVHA 1B7TY 3VROA 1SL7A 1LINA 2EC6C 2KHNA 1NIWA 5JJGA 3EVUA 5G08A 2WCFA 1JBAA 1OZSA 1V1GA 2LM5A 2LVVA 3ICBA 1VRKA 4GAOA 2LC5A 1QASA 1XFXO 4MLWA 4NQGA 1UWOA 4P5OE 3D0YA 1W7IB 2QPTA 1K9KA 2JZIA 4YI8A 1PRWA 1M63B 1NUBA 2B1UA 1EG4A 2JQ6A 1U5IA 1B9AA 3GK4X 3I5IC 4JQ0D 1JSAA 1LKJA 1NX2A 1WLZA 2G2BA 1JFJA 4PE4A 4GFTA 1SNLA 2MBXA 2H2KA 1SCMB 3NSKA 1ALVA 3CR2A 3DF0B 3K21A 1CMGA 3D0YB 2I94A 5DKQA 1K90D 1OZOA 4PE7A 3OB2B 2BCBA 4QJ4B 1FI6A 1U5IB 1YUTA 5K89A 1J1DA 1N0YA 3ZWHA 4AOMA 2ZFDA 1BG1A 3DD4A 2H61C 3CTNA 1UHJA 2LMUA 3SG5A 1L2OB 1NSHA 1NPQA 1DVIA 1KFXL 2HF5A 1OSAA 2WNDA 5ER5A 3PN7B 2WOSA 1B8LA 1K9PA 1CM1A 1PSRA 1FW4A 2ZNDA 3DVEA 3A4UB 3TDZA 4C0JA 3H4SE 1ZMZA 3I5HB 1AP4A 3PALA 5B8IB 4NDDA 1LA0A 4OR9B 3JTDB 1F70A 4HREE 1K95A 2BBNA 2LLSA 1KQMB 1BJFA 1OMVA 2CTNA 3EVVA 1E8AA 1ZACA 2JNXA 4WQ2A 1B1GA 5AANA 5GQQC 3HCMA 2LAPA 1DGVA 1TCFA 1XFWO 2L2EA 3CR4X 3O78A 4FQOA 1S1EA 1WRKA 1J7RA 1SKTA 1SR6B 1M31A 1OE9B 2PMYA 3BQ3A 4HRGA 1G33A 1K2HA 1XFVO 4OVNF 1K96A 1S6JA 2K7BA 3C1VA 1SL9A 2K8MB 3IF7A 4DUQA 3CZTX 2BECA 1TIZA 1UURA 1YVLA 2AAOA 2KAYA 2NLNA 2F8PA 1SCMC 1TCOB 5TNCA 3AAJA 1QX5B 1F54A 1CLBA 2WCBA 1KFUS 2LLTA 2KFHA 2K2FA 1IG5A 2ZNEA 4QJ3B 1WDCC 4PHMA 3M0WA 2KBMA 3EK8A 3TDIA 1J7QA 1SRAA 1L7ZA 1F4QA 2D8NA 1JFKA 1UHKA 4A4CA 1YRUB 1SMGA 3PN7C 2M7NA 1BMOA 2BCAA 2KNEA 3GK2A 2O5GA 3DVJA 2OS8B 4OV2A 5IBWA 4YGDB 1A75A 1LVCD 2KI4B 3OX5A 1MWNA 1QATA 1BOCA 2SCPA 3JTDC 1YRTB 1Y0VH 4OCIA 3IQQA 2R2IA 1R6PA 1NWDA 3NSIA 1QLSA 1S36A 1QVIZ 3EK4A 1HT9A 2AUCA 5AXIA 3TS5C 3OP0A 2BCXA 2KYCA 3AKAA 1KWOB 3ZNIA 2JULA 3CS1A 4MSPA 1DGUA 2JC2A 2LHLA 5CSNA 4DCKA 3A8RA 4YGAA 4E68A 1BR1B 1UUSA 1UP5A 2HPSA 1IGVA 2PSRA 1RK9A 1PVBA 1TTXA 2I7AA 2M1KB 4R1EA 1AK8A 1K94A 2VRGA 3PM8A 1EG3A 1TNQA 2CCMA 2LUXA 4D1EA 4YRUA 5I8NA 3QRXA 1CNPA 1KK8C 3SG3A 1IH0A 1YUSA 3PSRA 1CB1A 5AEQA 1B8CA 2BE4A 1TRFA 4N5XA 3JVTC 3CWGA 4NDCA 1WLMA 5D7FA 2FCDA 2OPOA 2M49B 3OX6A 3DF0A 2WC8A 1QVIY 1CM4A 1PK0D 2K7CA 1QXPA 4ORCB 4GPLB 3EVRA 2L5XB 1S5GZ 2LMVA 2PALA 5F6TA 2OTGC 3SIAA 1GJYA 4CLNA 1EJ3A 4DRWA 1IQ3A 5BPJA 1KCYA 3E3RA 4YI9A 2JT0A 1JUOA 1Y6WA 1QV0A 2NCPA 3BUOB 5HKWA 3MSEB 3VGOA 2FOTA 1CFPA 3WXAA 1MF8B 1DTLA 1AJ5A 1C7VA 1K9UA 2PVBA 4ORAB 1CDPA 3I5GB 3LLEA 2CXJA 3F45A 4XJKA 1SY9A 4ORBB 2DOQA 4PALA 4GGFA 1BF5A 2KI6D 3O6BA 1X02A 2F33A 3OHMB 2IS9A 1QIVA 1CDMA 1CLLA 1QIWA 3PFVA 4GNKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NXQ A;  2F3Z A;  1S5G Y;  1KFX S;  4XJK B;  5CSJ A;  1AVS A;  2BE6 A;  2KAV A;  2L98 A;  4TNC A;  2JWW A;  1R2U A;  2KFF A;  1TNP A;  2L4I A;  2Y4Q A;  1J1E A;  3IQO A;  3LK1 A;  3CR5 X;  4MZL A;  1K93 D;  2LUC A;  1M46 A;  3KF9 A;  1H8B A;  2Y5I A;  4IL1 A;  1GQM A;  2A4J A;  4F0Z B;  1CMF A;  1QS7 A;  1XVJ A;  2AMI A;  5JOL A;  1ZFS A;  1NX3 A;  1MR8 A;  2KQ6 A;  4CID A;  3BUN B;  1TNW A;  1Q80 A;  1WRL A;  4YGE B;  1JWD A;  2CBL A;  5J3X A;  3AAK A;  3KPX A;  3PLF B;  4DS7 A;  2M97 A;  2EGD A;  3EK7 A;  1TN4 A;  3VRR A;  1RWY A;  1SL8 A;  1PAL A;  3KHE A;  3DVM A;  2M1U A;  2LAN A;  4M2Q A;  3TUY B;  4MBE A;  5AFP A;  2BKH B;  2LVK A;  2LLU A;  1SCV A;  3O4Y A;  2BL0 B;  1N2D A;  2RGI A;  2JRF A;  5DKN A;  1L2O C;  2CNP A;  3SG4 A;  1CKK A;  2WOR A;  1DJZ A;  1M39 A;  1UHI A;  2GV5 A;  4FTG A;  4OKH A;  4C0K A;  1XFZ O;  2L0P A;  1BLQ A;  2EC6 B;  3CLN A;  3I5H C;  3FWC A;  2COL B;  1QX2 A;  1WY9 A;  4MRY A;  4Q04 A;  1RJV A;  1KQM C;  1GGZ A;  4GUK A;  4MEW A;  1IJ5 A;  4I5J A;  3KEV A;  3TZ1 A;  1OMR A;  3OB1 B;  1DMO A;  2ZKM X;  2KFG A;  2GGZ A;  3RLZ A;  1TNX A;  2LVJ A;  2I2R E;  3I5I B;  1MHO A;  1CDN A;  1SR6 C;  1S6C A;  5CSI A;  3SG7 A;  1C07 A;  5FYX A;  2KAX A;  3LL8 B;  2JTT A;  2ZN9 A;  2G9B A;  2MAZ A;  1DJG A;  3BUX B;  3SJS A;  5HKY A;  1OOJ A;  1FPW A;  2LCP A;  1DT7 B;  2ZRT A;  1IJ6 A;  2ZRS A;  1FF1 A;  1NP8 A;  3LCP C;  1EXR A;  1C7W A;  3DVK A;  4C0L A;  3BUM B;  1AUI B;  1B47 A;  2Q4U A;  1JF2 A;  1MXL C;  4N1F A;  1QX7 A;  5I2Q A;  1S6I A;  2O60 A;  4QJ5 B;  1W7J B;  4AQI A;  1SYM A;  5HYD A;  1LA3 A;  2ISD A;  1A4P A;  2SAS A;  3NXA A;  4WRI A;  2TN4 A;  1NCY A;  1NCZ A;  1RTP 1;  2LHI A;  2WCE A;  1PSB A;  1KSO A;  1YUR A;  1ZOT B;  2MLF C;  1CFD A;  3WHT B;  1NX1 A;  1UHH A;  3O2P A;  4YBH B;  1AHR A;  2LE9 B;  4HSZ A;  5DKR A;  3TDU A;  2OS8 C;  4MZK A;  4CPV A;  2M0R A;  3PAT A;  1A29 A;  2JT3 A;  2E30 A;  1NX0 A;  2KI4 C;  1KK7 Z;  1SW8 A;  3BXK A;  2NCO A;  4ZCU A;  1XFU O;  3VRQ A;  1MXE A;  1JF0 A;  4GGN A;  1DJW A;  4M2P A;  3BOW A;  1CLM A;  4MRX A;  3WHU B;  5AER A;  5HLO A;  1J55 A;  1A2X A;  1IRJ A;  1LXF C;  1XK4 A;  2JXL A;  2P6B B;  3NSL A;  4I5L B;  2MHH A;  1F8H A;  1KWO C;  2K61 A;  1NYA A;  2PRU A;  1DF0 A;  2M7L A;  2LP3 A;  1SBJ A;  3FS7 A;  2Y1M A;  1XFY O;  1QTX A;  1ALW A;  1CFC A;  1EH2 A;  2KOT A;  1XA5 A;  1Y1A A;  2JTZ A;  4MN0 A;  4PCW A;  1EL4 A;  1QLK A;  1V1F A;  4DIR A;  1YTZ C;  3BOW B;  1ZUZ A;  1XO5 A;  3BYA A;  4USL A;  4PE0 A;  1SK6 D;  1FBV A;  2FJU B;  2M9G A;  4WQ3 A;  1WDC B;  4UPG A;  2L4H A;  1JC2 A;  1REC A;  1DF0 B;  1F71 A;  2ZN8 A;  4ETO A;  4ZCV A;  1MQ1 A;  4N1G A;  1NCX A;  3AKB A;  3WNX B;  3CGA A;  2M8U A;  1DJH A;  1BOD A;  1UHN A;  1J7O A;  3BUW B;  4MVF A;  1H4B A;  4BY5 A;  1N65 A;  3VRP A;  1KK7 Y;  1Y1U A;  2I18 A;  1QJT A;  2EHB A;  4CFR A;  2GGM A;  2L50 A;  1DJI A;  4CFQ A;  2QAC A;  2F2P A;  2LMT A;  5KSZ A;  4NDB A;  1IWQ A;  4GBA A;  2KDH A;  4L9M A;  5I2O A;  2KI6 C;  2K7D A;  1IQ5 A;  4AQJ A;  1MUX A;  5CSF A;  3SG2 A;  4YGC B;  3TS5 B;  2PAS A;  4JPZ B;  4PHN A;  1GGW A;  1J7P A;  3FIA A;  2BBM A;  2K2A A;  3D10 A;  1KSM A;  2Y1N A;  4PHK A;  1KFU L;  1G4Y R;  3I5F B;  4JWQ A;  2L51 A;  2Q91 A;  1YX7 A;  4ICB A;  1CDL A;  5HKZ A;  3SIB A;  3HX4 A;  2JXC A;  3I5G C;  1KQV A;  1YR5 A;  1G8I A;  3LK0 A;  4PDZ A;  1F55 A;  1PUL A;  1B8R A;  5KTY A;  1A03 A;  1IKU A;  1BT6 A;  4PHJ A;  1KK8 B;  1S3P A;  2MJW B;  4I5N B;  4PE1 A;  1D1O A;  2JPT A;  2NZ0 A;  5D69 A;  2KGR A;  3EKH A;  1XK4 C;  3SG6 A;  2KYF A;  1ODB A;  3JVT B;  1DJX A;  2KGB C;  5HLV A;  2K7O A;  1WRZ A;  4MZJ A;  1YX8 A;  2LP2 A;  2LV7 A;  1K8U A;  3FWB A;  1TOP A;  4I5K A;  3NSO A;  4GGF C;  1FI5 A;  1RFJ A;  1BR4 B;  2V53 A;  4A4B A;  2JNF A;  1SPY A;  5CPV A;  2H61 A;  1HQV A;  1CTR A;  2OTG B;  4P2Y B;  2JOJ A;  1B7T Z;  4YGB B;  1YUU A;  2E6W A;  2KBI A;  2MA2 A;  4U8D A;  1BU3 A;  1B4C A;  1AJ4 A;  1DJY A;  5KU1 A;  1PVA A;  2F2O A;  1M45 A;  5PAL A;  4XYN A;  2M29 A;  3RM1 A;  1OQP A;  1F4O A;  5ER4 X;  1RRO A;  2K0J A;  2JT8 A;  1A75 B;  1OMD A;  2FCE A;  3TUY C;  2MRD A;  3KO0 A;  2HET A;  1S26 D;  1XYD A;  3I5F C;  3EKJ A;  1QV1 A;  2LNK A;  2BL0 C;  2LVI A;  3GOF A;  4BY4 A;  2M3W A;  2CT9 A;  4M2O A;  2HQW A;  3VRN A;  2KSP A;  3GK1 A;  2HQ8 A;  5I2L A;  1Y1X A;  2F3Y A;  2JU0 A;  2KQY A;  1CFF A;  4HRH A;  2BKI B;  2MLE C;  1YVH A;  1B7T Y;  3VRO A;  1SL7 A;  1LIN A;  2EC6 C;  2KHN A;  1NIW A;  5JJG A;  3EVU A;  5G08 A;  2WCF A;  1JBA A;  1OZS A;  1V1G A;  2LM5 A;  2LVV A;  3ICB A;  1VRK A;  4GAO A;  2LC5 A;  1QAS A;  1XFX O;  4MLW A;  4NQG A;  1UWO A;  4P5O E;  3D0Y A;  1W7I B;  2QPT A;  1K9K A;  2JZI A;  4YI8 A;  1PRW A;  1M63 B;  1NUB A;  2B1U A;  1EG4 A;  2JQ6 A;  1U5I A;  1B9A A;  3GK4 X;  3I5I C;  4JQ0 D;  1JSA A;  1LKJ A;  1NX2 A;  1WLZ A;  2G2B A;  1JFJ A;  4PE4 A;  4GFT A;  1SNL A;  2MBX A;  2H2K A;  1SCM B;  3NSK A;  1ALV A;  3CR2 A;  3DF0 B;  3K21 A;  1CMG A;  3D0Y B;  2I94 A;  5DKQ A;  1K90 D;  1OZO A;  4PE7 A;  3OB2 B;  2BCB A;  4QJ4 B;  1FI6 A;  1U5I B;  1YUT A;  5K89 A;  1J1D A;  1N0Y A;  3ZWH A;  4AOM A;  2ZFD A;  1BG1 A;  3DD4 A;  2H61 C;  3CTN A;  1UHJ A;  2LMU A;  3SG5 A;  1L2O B;  1NSH A;  1NPQ A;  1DVI A;  1KFX L;  2HF5 A;  1OSA A;  2WND A;  5ER5 A;  3PN7 B;  2WOS A;  1B8L A;  1K9P A;  1CM1 A;  1PSR A;  1FW4 A;  2ZND A;  3DVE A;  3A4U B;  3TDZ A;  4C0J A;  3H4S E;  1ZMZ A;  3I5H B;  1AP4 A;  3PAL A;  5B8I B;  4NDD A;  1LA0 A;  4OR9 B;  3JTD B;  1F70 A;  4HRE E;  1K95 A;  2BBN A;  2LLS A;  1KQM B;  1BJF A;  1OMV A;  2CTN A;  3EVV A;  1E8A A;  1ZAC A;  2JNX A;  4WQ2 A;  1B1G A;  5AAN A;  5GQQ C;  3HCM A;  2LAP A;  1DGV A;  1TCF A;  1XFW O;  2L2E A;  3CR4 X;  3O78 A;  4FQO A;  1S1E A;  1WRK A;  1J7R A;  1SKT A;  1SR6 B;  1M31 A;  1OE9 B;  2PMY A;  3BQ3 A;  4HRG A;  1G33 A;  1K2H A;  1XFV O;  4OVN F;  1K96 A;  1S6J A;  2K7B A;  3C1V A;  1SL9 A;  2K8M B;  3IF7 A;  4DUQ A;  3CZT X;  2BEC A;  1TIZ A;  1UUR A;  1YVL A;  2AAO A;  2KAY A;  2NLN A;  2F8P A;  1SCM C;  1TCO B;  5TNC A;  3AAJ A;  1QX5 B;  1F54 A;  1CLB A;  2WCB A;  1KFU S;  2LLT A;  2KFH A;  2K2F A;  1IG5 A;  2ZNE A;  4QJ3 B;  1WDC C;  4PHM A;  3M0W A;  2KBM A;  3EK8 A;  3TDI A;  1J7Q A;  1SRA A;  1L7Z A;  1F4Q A;  2D8N A;  1JFK A;  1UHK A;  4A4C A;  1YRU B;  1SMG A;  3PN7 C;  2M7N A;  1BMO A;  2BCA A;  2KNE A;  3GK2 A;  2O5G A;  3DVJ A;  2OS8 B;  4OV2 A;  5IBW A;  4YGD B;  1A75 A;  1LVC D;  2KI4 B;  3OX5 A;  1MWN A;  1QAT A;  1BOC A;  2SCP A;  3JTD C;  1YRT B;  1Y0V H;  4OCI A;  3IQQ A;  2R2I A;  1R6P A;  1NWD A;  3NSI A;  1QLS A;  1S36 A;  1QVI Z;  3EK4 A;  1HT9 A;  2AUC A;  5AXI A;  3TS5 C;  3OP0 A;  2BCX A;  2KYC A;  3AKA A;  1KWO B;  3ZNI A;  2JUL A;  3CS1 A;  4MSP A;  1DGU A;  2JC2 A;  2LHL A;  5CSN A;  4DCK A;  3A8R A;  4YGA A;  4E68 A;  1BR1 B;  1UUS A;  1UP5 A;  2HPS A;  1IGV A;  2PSR A;  1RK9 A;  1PVB A;  1TTX A;  2I7A A;  2M1K B;  4R1E A;  1AK8 A;  1K94 A;  2VRG A;  3PM8 A;  1EG3 A;  1TNQ A;  2CCM A;  2LUX A;  4D1E A;  4YRU A;  5I8N A;  3QRX A;  1CNP A;  1KK8 C;  3SG3 A;  1IH0 A;  1YUS A;  3PSR A;  1CB1 A;  5AEQ A;  1B8C A;  2BE4 A;  1TRF A;  4N5X A;  3JVT C;  3CWG A;  4NDC A;  1WLM A;  5D7F A;  2FCD A;  2OPO A;  2M49 B;  3OX6 A;  3DF0 A;  2WC8 A;  1QVI Y;  1CM4 A;  1PK0 D;  2K7C A;  1QXP A;  4ORC B;  4GPL B;  3EVR A;  2L5X B;  1S5G Z;  2LMV A;  2PAL A;  5F6T A;  2OTG C;  3SIA A;  1GJY A;  4CLN A;  1EJ3 A;  4DRW A;  1IQ3 A;  5BPJ A;  1KCY A;  3E3R A;  4YI9 A;  2JT0 A;  1JUO A;  1Y6W A;  1QV0 A;  2NCP A;  3BUO B;  5HKW A;  3MSE B;  3VGO A;  2FOT A;  1CFP A;  3WXA A;  1MF8 B;  1DTL A;  1AJ5 A;  1C7V A;  1K9U A;  2PVB A;  4ORA B;  1CDP A;  3I5G B;  3LLE A;  2CXJ A;  3F45 A;  4XJK A;  1SY9 A;  4ORB B;  2DOQ A;  4PAL A;  4GGF A;  1BF5 A;  2KI6 D;  3O6B A;  1X02 A;  2F33 A;  3OHM B;  2IS9 A;  1QIV A;  1CDM A;  1CLL A;  1QIW A;  3PFV A;  4GNK B; 
#chains in the Genus database with same CATH topology
 3NGV A;  2NXQ A;  2F3Z A;  1S5G Y;  1KFX S;  4XJK B;  5CSJ A;  1AVS A;  2BE6 A;  3RZS A;  2KAV A;  2L98 A;  4TNC A;  3R1O A;  2JWW A;  1R2U A;  2KFF A;  1TNP A;  2L4I A;  2Y4Q A;  1J1E A;  3IQO A;  3LK1 A;  3CR5 X;  4MZL A;  1K93 D;  2LUC A;  1M46 A;  3KF9 A;  4OZD A;  1H8B A;  2Y5I A;  4IL1 A;  1GQM A;  3O4X A;  2A4J A;  4F0Z B;  1CMF A;  1QS7 A;  1XVJ A;  2AMI A;  5JOL A;  1ZFS A;  1NX3 A;  1MR8 A;  2KQ6 A;  2WCL A;  3CZ1 A;  4CID A;  2H8V A;  3BUN B;  1TNW A;  1Q80 A;  1WRL A;  4YGE B;  1JWD A;  2CBL A;  5J3X A;  3AAK A;  2JPO A;  5FI7 A;  3KPX A;  3PLF B;  4DS7 A;  1TWO A;  2M97 A;  2EGD A;  3EK7 A;  1TN4 A;  3VRR A;  1RWY A;  1SL8 A;  2K60 A;  1PAL A;  3KHE A;  3DVM A;  2M1U A;  2LAN A;  4M2Q A;  3L4L A;  3TUY B;  4MBE A;  5AFP A;  2BKH B;  1QWV A;  2LVK A;  2LLU A;  1SCV A;  3O4Y A;  2BL0 B;  1N2D A;  2RGI A;  2JRF A;  5DKN A;  1L2O C;  2CNP A;  5FI6 A;  3SG4 A;  1CKK A;  2WOR A;  1IIO A;  1DJZ A;  1M39 A;  1UHI A;  2GV5 A;  4FTG A;  1OW4 A;  3R1V A;  4OKH A;  4C0K A;  1XFZ O;  3SS4 A;  2L0P A;  4PT1 A;  1BLQ A;  2EC6 B;  3CLN A;  3I5H C;  3FWC A;  2COL B;  1QX2 A;  3D73 A;  1WY9 A;  2YGU A;  1OOI X;  4INX A;  4MRY A;  4Q04 A;  1RJV A;  3B6X A;  1KQM C;  1GGZ A;  4GUK A;  4MEW A;  1IJ5 A;  2QEO A;  4I5J A;  3KEV A;  3TZ1 A;  1OMR A;  1C3Y A;  3OB1 B;  1DMO A;  2ZKM X;  2KFG A;  2GGZ A;  3RLZ A;  1TNX A;  2LVJ A;  2I2R E;  3I5I B;  1MHO A;  2PYQ A;  1CDN A;  1SR6 C;  1S6C A;  5CSI A;  3SG7 A;  1C07 A;  5FYX A;  2KAX A;  3LL8 B;  2JTT A;  3EG5 B;  2ZN9 A;  2G9B A;  2MAZ A;  1DJG A;  3BUX B;  3SJS A;  5HKY A;  3R1P A;  1OOJ A;  1FPW A;  2LCP A;  1DT7 B;  2ZRT A;  1IJ6 A;  2ZRS A;  1FF1 A;  1NP8 A;  1OOF A;  2KLD A;  3K1E A;  3LCP C;  1EXR A;  1C7W A;  3DVK A;  4C0L A;  1LS8 A;  3BUM B;  1AUI B;  1B47 A;  2WCJ A;  2Q4U A;  1JF2 A;  1MXL C;  4N1F A;  1QX7 A;  5I2Q A;  2KPH A;  1S6I A;  2O60 A;  4QJ5 B;  1W7J B;  4AQI A;  1SYM A;  5HYD A;  2WCK A;  3NHT A;  1LA3 A;  3DYE A;  2ISD A;  1A4P A;  2SAS A;  3NXA A;  4WRI A;  2TN4 A;  1NCY A;  3D74 A;  1NCZ A;  1RTP 1;  2LHI A;  2WCE A;  1PSB A;  1DC1 A;  1KSO A;  1YUR A;  1ZOT B;  2MLF C;  1CFD A;  3WHT B;  1NX1 A;  1UHH A;  3O2P A;  4YBH B;  1AHR A;  2LE9 B;  4HSZ A;  5DKR A;  5FI2 A;  3TDU A;  2OS8 C;  4MZK A;  2GTE A;  4CPV A;  2M0R A;  3PAT A;  1A29 A;  2JT3 A;  2E30 A;  1NX0 A;  2KI4 C;  1KK7 Z;  1SW8 A;  3BXK A;  2NCO A;  4ZCU A;  3DXL A;  1XFU O;  3VRQ A;  1MXE A;  1JF0 A;  3D76 A;  4GGN A;  1DJW A;  4M2P A;  3BOW A;  1CLM A;  4MRX A;  3WHU B;  3D78 A;  5AER A;  5HLO A;  1J55 A;  1A2X A;  1IRJ A;  1LXF C;  1XK4 A;  2JXL A;  2P6B B;  3NSL A;  4I5L B;  2MHH A;  1F8H A;  1KWO C;  2K61 A;  1NYA A;  2PRU A;  1DF0 A;  2M7L A;  3FE9 A;  2LP3 A;  1SBJ A;  3FS7 A;  2Y1M A;  1XFY O;  1QTX A;  1ALW A;  3Q8I A;  1CFC A;  1EH2 A;  2KOT A;  1XA5 A;  1Y1A A;  3UO9 A;  2JTZ A;  4MN0 A;  4PCW A;  1EL4 A;  1QLK A;  1V1F A;  4DIR A;  1YTZ C;  3FE6 A;  3BOW B;  1ZUZ A;  1XO5 A;  3BYA A;  4USL A;  4PE0 A;  1T14 A;  1SK6 D;  1FBV A;  2FJU B;  2M9G A;  3B87 A;  4WQ3 A;  1WDC B;  4UPG A;  2L4H A;  1JC2 A;  1REC A;  1DF0 B;  1F71 A;  2ZN8 A;  4ETO A;  4ZCV A;  1MQ1 A;  4N1G A;  1NCX A;  3AKB A;  3WNX B;  3CGA A;  1DQE A;  2WC6 A;  2M8U A;  3DY9 A;  1DJH A;  1BOD A;  1UHN A;  1J7O A;  3BUW B;  4MVF A;  1H4B A;  3SS3 A;  4BY5 A;  1N65 A;  3VRP A;  1KK7 Y;  1Z2C B;  1Y1U A;  2I18 A;  1QJT A;  2EHB A;  4CFR A;  2GGM A;  2L50 A;  1DJI A;  4CFQ A;  2QAC A;  2F2P A;  2LMT A;  5KSZ A;  4NDB A;  1IWQ A;  4GBA A;  2KDH A;  1TUJ A;  3S0A A;  4L9M A;  5I2O A;  2KI6 C;  3B88 A;  2K7D A;  3PM2 A;  1IQ5 A;  4AQJ A;  1MUX A;  5CSF A;  3SG2 A;  4YGC B;  3TS5 B;  2BNX A;  2PAS A;  4JPZ B;  4PHN A;  1GGW A;  1J7P A;  3FIA A;  2BBM A;  2K2A A;  3D10 A;  1KSM A;  2Y1N A;  4PHK A;  1KFU L;  1G4Y R;  3I5F B;  4JWQ A;  2L51 A;  2Q91 A;  1YX7 A;  4ICB A;  1CDL A;  5HKZ A;  3SIB A;  3HX4 A;  2JXC A;  3I5G C;  1KQV A;  1YR5 A;  1G8I A;  3LK0 A;  4PDZ A;  1F55 A;  1PUL A;  1B8R A;  5KTY A;  1A03 A;  3L47 A;  1IKU A;  1BT6 A;  4PHJ A;  1KK8 B;  1S3P A;  2MJW B;  4I5N B;  4PE1 A;  1D1O A;  2JPT A;  2NZ0 A;  3CYZ A;  5D69 A;  1XFR A;  2WCM A;  2KGR A;  3EKH A;  1XK4 C;  1C3Z A;  3SG6 A;  2KYF A;  1ODB A;  3JVT B;  1DJX A;  2KGB C;  3BFA A;  5HLV A;  2K7O A;  1WRZ A;  4MZJ A;  1YX8 A;  2LP2 A;  2LV7 A;  1K8U A;  3FWB A;  1TOP A;  4I5K A;  3NSO A;  4GGF C;  1FI5 A;  1RFJ A;  1BR4 B;  2V53 A;  4A4B A;  2JNF A;  1SPY A;  5CPV A;  2H61 A;  2WCH A;  1HQV A;  1CTR A;  2OTG B;  3R72 A;  4P2Y B;  2JOJ A;  1B7T Z;  4INW A;  4YGB B;  1YUU A;  2E6W A;  2KBI A;  2MA2 A;  4U8D A;  3DZT A;  1BU3 A;  1B4C A;  1AJ4 A;  1DJY A;  5KU1 A;  1PVA A;  2F2O A;  3BFB A;  1M45 A;  5PAL A;  1P28 A;  4XYN A;  2M29 A;  3RM1 A;  1OQP A;  1F4O A;  5ER4 X;  2P70 A;  3OGN A;  1RRO A;  2K0J A;  2JT8 A;  1A75 B;  1OMD A;  2FCE A;  3TUY C;  2MRD A;  3KO0 A;  2HET A;  1S26 D;  1XYD A;  3I5F C;  3EKJ A;  1QV1 A;  2LNK A;  4F7F A;  2BL0 C;  2LVI A;  3N7H A;  3GOF A;  4BY4 A;  2M3W A;  2CT9 A;  4M2O A;  2HQW A;  3VRN A;  2KSP A;  3GK1 A;  2HQ8 A;  5I2L A;  1Y1X A;  2F3Y A;  2JU0 A;  2KQY A;  1CFF A;  4HRH A;  3NHI A;  2BKI B;  2MLE C;  1YVH A;  1B7T Y;  3VRO A;  1SL7 A;  1LIN A;  2EC6 C;  2KHN A;  1NIW A;  5JJG A;  3EVU A;  5G08 A;  3D77 A;  2WCF A;  1JBA A;  1OZS A;  1V1G A;  2LM5 A;  2LVV A;  3CZ0 A;  3ICB A;  1VRK A;  4GAO A;  2LC5 A;  1QAS A;  1XFX O;  4JKT A;  4MLW A;  4NQG A;  1UWO A;  4P5O E;  3D0Y A;  4IJ7 A;  1W7I B;  3BJH A;  2QPT A;  1K9K A;  2JZI A;  4YI8 A;  1PRW A;  1M63 B;  1NUB A;  2B1U A;  1EG4 A;  2JQ6 A;  3L4A A;  1U5I A;  3VB1 A;  1B9A A;  3GK4 X;  3I5I C;  4JQ0 D;  1JSA A;  3UNW A;  1LKJ A;  1NX2 A;  1WLZ A;  2G2B A;  1JFJ A;  3B7A A;  4PE4 A;  4GFT A;  1SNL A;  2MBX A;  2H2K A;  1SCM B;  3NSK A;  1ALV A;  3CR2 A;  3DF0 B;  3K21 A;  1CMG A;  3D0Y B;  2I94 A;  5DKQ A;  1K90 D;  1OZO A;  4PE7 A;  3OB2 B;  2PQL A;  2BCB A;  2QEB A;  4QJ4 B;  1FI6 A;  1U5I B;  1YUT A;  5EL2 A;  1J1D A;  5K89 A;  1N0Y A;  3ZWH A;  2FJY A;  2ZFD A;  4AOM A;  3DD4 A;  2H61 C;  3CTN A;  1BG1 A;  1UHJ A;  2LMU A;  3SG5 A;  1L2O B;  1NSH A;  1NPQ A;  1DVI A;  1KFX L;  2HF5 A;  2P71 A;  1OSA A;  2WND A;  5ER5 A;  3B86 A;  3PN7 B;  3CAB A;  2WOS A;  1B8L A;  1K9P A;  1CM1 A;  1PSR A;  1FW4 A;  2ZND A;  3DVE A;  3A4U B;  3TDZ A;  4C0J A;  3D75 A;  3H4S E;  1ZMZ A;  2BAP A;  3S0B A;  3I5H B;  1AP4 A;  3PAL A;  5B8I B;  4NDD A;  1LA0 A;  4OR9 B;  3JTD B;  1F70 A;  4HRE E;  1K95 A;  2BBN A;  2LLS A;  1KQM B;  1BJF A;  1OMV A;  2CTN A;  3EVV A;  1E8A A;  1ZAC A;  2JNX A;  4WQ2 A;  1B1G A;  5AAN A;  5GQQ C;  3HCM A;  2LAP A;  1DGV A;  1TCF A;  1XFW O;  2L2E A;  3CR4 X;  3O78 A;  4KYN A;  4FQO A;  1S1E A;  1WRK A;  1DEK A;  1J7R A;  1ORG A;  1SKT A;  1SR6 B;  1M31 A;  1OE9 B;  2PMY A;  3S0G A;  1DEL A;  3BQ3 A;  4HRG A;  1G33 A;  1K2H A;  1XFV O;  5HL1 A;  4OVN F;  1K96 A;  1S6J A;  1TUZ A;  2K7B A;  3C1V A;  1SL9 A;  2K8M B;  3IF7 A;  4DUQ A;  3CZT X;  2BEC A;  1TIZ A;  2L5Y A;  1SSE B;  1UUR A;  1YVL A;  2AAO A;  2KAY A;  2NLN A;  2F8P A;  1SCM C;  1TCO B;  5TNC A;  3AAJ A;  1QX5 B;  1F54 A;  1CLB A;  2WCB A;  5DIC A;  4JD9 A;  3S0E A;  1KFU S;  2LLT A;  2KFH A;  2K2F A;  3OBV A;  1IG5 A;  2ZNE A;  4QJ3 B;  1WDC C;  4PHM A;  3CZ2 A;  3M0W A;  2KBM A;  3EK8 A;  3TDI A;  1J7Q A;  1SRA A;  1L7Z A;  1F4Q A;  3SS5 A;  2D8N A;  1JFK A;  1UHK A;  4A4C A;  1YRU B;  1SMG A;  3FE8 A;  3PN7 C;  2M7N A;  1BMO A;  2BCA A;  2KNE A;  3GK2 A;  2O5G A;  3DVJ A;  2OS8 B;  4OV2 A;  5IBW A;  4YGD B;  2L2C A;  1A75 A;  1LVC D;  3V2L A;  2KI4 B;  3OX5 A;  3QME A;  1MWN A;  1QAT A;  1BOC A;  2SCP A;  3JTD C;  1YRT B;  1Y0V H;  4OCI A;  3IQQ A;  2R2I A;  1R6P A;  1NWD A;  3NSI A;  1QLS A;  1S36 A;  1QVI Z;  3EK4 A;  1HT9 A;  2AUC A;  5AXI A;  3TS5 C;  3OP0 A;  3S0F A;  2BCX A;  2KYC A;  3AKA A;  1KWO B;  3ZNI A;  2JUL A;  3CS1 A;  4MSP A;  1OOH A;  1DGU A;  2JC2 A;  1OOG A;  2LHL A;  5CSN A;  4DCK A;  3A8R A;  3BFH A;  2QEH A;  4YGA A;  4E68 A;  1BR1 B;  1UUS A;  1UP5 A;  2HPS A;  3S0D A;  2QEV A;  1IGV A;  2PSR A;  1RK9 A;  1PVB A;  2WC5 A;  1TTX A;  2I7A A;  2M1K B;  4R1E A;  1AK8 A;  1K94 A;  2VRG A;  3PM8 A;  1EG3 A;  1TNQ A;  2CCM A;  2LUX A;  4D1E A;  4YRU A;  5I8N A;  3QRX A;  1CNP A;  1KK8 C;  3SG3 A;  1GM0 A;  1IH0 A;  1YUS A;  3PSR A;  1CB1 A;  5AEQ A;  1B8C A;  2BE4 A;  4FQT A;  1TRF A;  4N5X A;  3JVT C;  3CWG A;  4NDC A;  1WLM A;  5D7F A;  2FCD A;  2OPO A;  2M49 B;  3OX6 A;  3DF0 A;  2WC8 A;  1QVI Y;  1CM4 A;  1PK0 D;  2K7C A;  1QXP A;  3IVT A;  4ORC B;  4GPL B;  3EVR A;  2L5X B;  1S5G Z;  2LMV A;  2PAL A;  5F6T A;  2OTG C;  3SIA A;  1GJY A;  4CLN A;  1EJ3 A;  4DRW A;  2ERB A;  1IQ3 A;  5BPJ A;  1KCY A;  1W9Z A;  3E3R A;  4YI9 A;  2JT0 A;  1JUO A;  1Y6W A;  1QV0 A;  2NCP A;  3BUO B;  5HKW A;  3MSE B;  1Z4H A;  3VGO A;  2FOT A;  1CFP A;  5I94 A;  3WXA A;  1MF8 B;  1DTL A;  2QDI A;  1AJ5 A;  1C7V A;  1K9U A;  2PVB A;  5D3O A;  4ORA B;  1CDP A;  3I5G B;  3LLE A;  2CXJ A;  3F45 A;  4XJK A;  1SY9 A;  4ORB B;  2DOQ A;  4PAL A;  4GGF A;  1BF5 A;  2KI6 D;  3O6B A;  1X02 A;  2F33 A;  3OHM B;  2IS9 A;  1QIV A;  3PJI A;  2KLE A;  1CDM A;  1CLL A;  1QIW A;  3PFV A;  4GNK B;  3CDN A; 
#chains in the Genus database with same CATH homology
 2NXQ A;  2F3Z A;  1S5G Y;  1KFX S;  4XJK B;  5CSJ A;  1AVS A;  2BE6 A;  2KAV A;  2L98 A;  4TNC A;  2JWW A;  1R2U A;  2KFF A;  1TNP A;  2L4I A;  2Y4Q A;  1J1E A;  3IQO A;  3LK1 A;  3CR5 X;  4MZL A;  1K93 D;  2LUC A;  1M46 A;  3KF9 A;  1H8B A;  2Y5I A;  4IL1 A;  1GQM A;  2A4J A;  4F0Z B;  1CMF A;  1QS7 A;  1XVJ A;  2AMI A;  5JOL A;  1ZFS A;  1NX3 A;  1MR8 A;  2KQ6 A;  4CID A;  3BUN B;  1TNW A;  1Q80 A;  1WRL A;  4YGE B;  1JWD A;  2CBL A;  5J3X A;  3AAK A;  3KPX A;  3PLF B;  4DS7 A;  2M97 A;  2EGD A;  3EK7 A;  1TN4 A;  3VRR A;  1RWY A;  1SL8 A;  1PAL A;  3KHE A;  3DVM A;  2M1U A;  2LAN A;  4M2Q A;  3TUY B;  4MBE A;  5AFP A;  2BKH B;  2LVK A;  2LLU A;  1SCV A;  3O4Y A;  2BL0 B;  1N2D A;  2RGI A;  2JRF A;  5DKN A;  1L2O C;  2CNP A;  3SG4 A;  1CKK A;  2WOR A;  1DJZ A;  1M39 A;  1UHI A;  2GV5 A;  4FTG A;  4OKH A;  4C0K A;  1XFZ O;  2L0P A;  1BLQ A;  2EC6 B;  3CLN A;  3I5H C;  3FWC A;  2COL B;  1QX2 A;  1WY9 A;  4MRY A;  4Q04 A;  1RJV A;  1KQM C;  1GGZ A;  4GUK A;  4MEW A;  1IJ5 A;  4I5J A;  3KEV A;  3TZ1 A;  1OMR A;  3OB1 B;  1DMO A;  2ZKM X;  2KFG A;  2GGZ A;  3RLZ A;  1TNX A;  2LVJ A;  2I2R E;  3I5I B;  1MHO A;  1CDN A;  1SR6 C;  1S6C A;  5CSI A;  3SG7 A;  1C07 A;  5FYX A;  2KAX A;  3LL8 B;  2JTT A;  2ZN9 A;  2G9B A;  2MAZ A;  1DJG A;  3BUX B;  3SJS A;  5HKY A;  1OOJ A;  1FPW A;  2LCP A;  1DT7 B;  2ZRT A;  1IJ6 A;  2ZRS A;  1FF1 A;  1NP8 A;  3LCP C;  1EXR A;  1C7W A;  3DVK A;  4C0L A;  3BUM B;  1AUI B;  1B47 A;  2Q4U A;  1JF2 A;  1MXL C;  4N1F A;  1QX7 A;  5I2Q A;  1S6I A;  2O60 A;  4QJ5 B;  1W7J B;  4AQI A;  1SYM A;  5HYD A;  1LA3 A;  2ISD A;  1A4P A;  2SAS A;  3NXA A;  4WRI A;  2TN4 A;  1NCY A;  1NCZ A;  1RTP 1;  2LHI A;  2WCE A;  1PSB A;  1KSO A;  1YUR A;  1ZOT B;  2MLF C;  1CFD A;  3WHT B;  1NX1 A;  1UHH A;  3O2P A;  4YBH B;  1AHR A;  2LE9 B;  4HSZ A;  5DKR A;  3TDU A;  2OS8 C;  4MZK A;  4CPV A;  2M0R A;  3PAT A;  1A29 A;  2JT3 A;  2E30 A;  1NX0 A;  2KI4 C;  1KK7 Z;  1SW8 A;  3BXK A;  2NCO A;  4ZCU A;  1XFU O;  3VRQ A;  1MXE A;  1JF0 A;  4GGN A;  1DJW A;  4M2P A;  3BOW A;  1CLM A;  4MRX A;  3WHU B;  5AER A;  5HLO A;  1J55 A;  1A2X A;  1IRJ A;  1LXF C;  1XK4 A;  2JXL A;  2P6B B;  3NSL A;  4I5L B;  2MHH A;  1F8H A;  1KWO C;  2K61 A;  1NYA A;  2PRU A;  1DF0 A;  2M7L A;  2LP3 A;  1SBJ A;  3FS7 A;  2Y1M A;  1XFY O;  1QTX A;  1ALW A;  1CFC A;  1EH2 A;  2KOT A;  1XA5 A;  1Y1A A;  2JTZ A;  4MN0 A;  4PCW A;  1EL4 A;  1QLK A;  1V1F A;  4DIR A;  1YTZ C;  3BOW B;  1ZUZ A;  1XO5 A;  3BYA A;  4USL A;  4PE0 A;  1SK6 D;  1FBV A;  2FJU B;  2M9G A;  4WQ3 A;  1WDC B;  4UPG A;  2L4H A;  1JC2 A;  1REC A;  1DF0 B;  1F71 A;  2ZN8 A;  4ETO A;  4ZCV A;  1MQ1 A;  4N1G A;  1NCX A;  3AKB A;  3WNX B;  3CGA A;  2M8U A;  1DJH A;  1BOD A;  1UHN A;  1J7O A;  3BUW B;  4MVF A;  1H4B A;  4BY5 A;  1N65 A;  3VRP A;  1KK7 Y;  1Y1U A;  2I18 A;  1QJT A;  2EHB A;  4CFR A;  2GGM A;  2L50 A;  1DJI A;  4CFQ A;  2QAC A;  2F2P A;  2LMT A;  5KSZ A;  4NDB A;  1IWQ A;  4GBA A;  2KDH A;  4L9M A;  5I2O A;  2KI6 C;  2K7D A;  1IQ5 A;  4AQJ A;  1MUX A;  5CSF A;  3SG2 A;  4YGC B;  3TS5 B;  2PAS A;  4JPZ B;  4PHN A;  1GGW A;  1J7P A;  3FIA A;  2BBM A;  2K2A A;  3D10 A;  1KSM A;  2Y1N A;  4PHK A;  1KFU L;  1G4Y R;  3I5F B;  4JWQ A;  2L51 A;  2Q91 A;  1YX7 A;  4ICB A;  1CDL A;  5HKZ A;  3SIB A;  3HX4 A;  2JXC A;  3I5G C;  1KQV A;  1YR5 A;  1G8I A;  3LK0 A;  4PDZ A;  1F55 A;  1PUL A;  1B8R A;  5KTY A;  1A03 A;  1IKU A;  1BT6 A;  4PHJ A;  1KK8 B;  1S3P A;  2MJW B;  4I5N B;  4PE1 A;  1D1O A;  2JPT A;  2NZ0 A;  5D69 A;  2KGR A;  3EKH A;  1XK4 C;  3SG6 A;  2KYF A;  1ODB A;  3JVT B;  1DJX A;  2KGB C;  5HLV A;  2K7O A;  1WRZ A;  4MZJ A;  1YX8 A;  2LP2 A;  2LV7 A;  1K8U A;  3FWB A;  1TOP A;  4I5K A;  3NSO A;  4GGF C;  1FI5 A;  1RFJ A;  1BR4 B;  2V53 A;  4A4B A;  2JNF A;  1SPY A;  5CPV A;  2H61 A;  1HQV A;  1CTR A;  2OTG B;  4P2Y B;  2JOJ A;  1B7T Z;  4YGB B;  1YUU A;  2E6W A;  2KBI A;  2MA2 A;  4U8D A;  1BU3 A;  1B4C A;  1AJ4 A;  1DJY A;  5KU1 A;  1PVA A;  2F2O A;  1M45 A;  5PAL A;  4XYN A;  2M29 A;  3RM1 A;  1OQP A;  1F4O A;  5ER4 X;  1RRO A;  2K0J A;  2JT8 A;  1A75 B;  1OMD A;  2FCE A;  3TUY C;  2MRD A;  3KO0 A;  2HET A;  1S26 D;  1XYD A;  3I5F C;  3EKJ A;  1QV1 A;  2LNK A;  2BL0 C;  2LVI A;  3GOF A;  4BY4 A;  2M3W A;  2CT9 A;  4M2O A;  2HQW A;  3VRN A;  2KSP A;  3GK1 A;  2HQ8 A;  5I2L A;  1Y1X A;  2F3Y A;  2JU0 A;  2KQY A;  1CFF A;  4HRH A;  2BKI B;  2MLE C;  1YVH A;  1B7T Y;  3VRO A;  1SL7 A;  1LIN A;  2EC6 C;  2KHN A;  1NIW A;  5JJG A;  3EVU A;  5G08 A;  2WCF A;  1JBA A;  1OZS A;  1V1G A;  2LM5 A;  2LVV A;  3ICB A;  1VRK A;  4GAO A;  2LC5 A;  1QAS A;  1XFX O;  4MLW A;  4NQG A;  1UWO A;  4P5O E;  3D0Y A;  1W7I B;  2QPT A;  1K9K A;  2JZI A;  4YI8 A;  1PRW A;  1M63 B;  1NUB A;  2B1U A;  1EG4 A;  2JQ6 A;  1U5I A;  1B9A A;  3GK4 X;  3I5I C;  4JQ0 D;  1JSA A;  1LKJ A;  1NX2 A;  1WLZ A;  2G2B A;  1JFJ A;  4PE4 A;  4GFT A;  1SNL A;  2MBX A;  2H2K A;  1SCM B;  3NSK A;  1ALV A;  3CR2 A;  3DF0 B;  3K21 A;  1CMG A;  3D0Y B;  2I94 A;  5DKQ A;  1K90 D;  1OZO A;  4PE7 A;  3OB2 B;  2BCB A;  4QJ4 B;  1FI6 A;  1U5I B;  1YUT A;  5K89 A;  1J1D A;  1N0Y A;  3ZWH A;  4AOM A;  2ZFD A;  1BG1 A;  3DD4 A;  2H61 C;  3CTN A;  1UHJ A;  2LMU A;  3SG5 A;  1L2O B;  1NSH A;  1NPQ A;  1DVI A;  1KFX L;  2HF5 A;  1OSA A;  2WND A;  5ER5 A;  3PN7 B;  2WOS A;  1B8L A;  1K9P A;  1CM1 A;  1PSR A;  1FW4 A;  2ZND A;  3DVE A;  3A4U B;  3TDZ A;  4C0J A;  3H4S E;  1ZMZ A;  3I5H B;  1AP4 A;  3PAL A;  5B8I B;  4NDD A;  1LA0 A;  4OR9 B;  3JTD B;  1F70 A;  4HRE E;  1K95 A;  2BBN A;  2LLS A;  1KQM B;  1BJF A;  1OMV A;  2CTN A;  3EVV A;  1E8A A;  1ZAC A;  2JNX A;  4WQ2 A;  1B1G A;  5AAN A;  5GQQ C;  3HCM A;  2LAP A;  1DGV A;  1TCF A;  1XFW O;  2L2E A;  3CR4 X;  3O78 A;  4FQO A;  1S1E A;  1WRK A;  1J7R A;  1SKT A;  1SR6 B;  1M31 A;  1OE9 B;  2PMY A;  3BQ3 A;  4HRG A;  1G33 A;  1K2H A;  1XFV O;  4OVN F;  1K96 A;  1S6J A;  2K7B A;  3C1V A;  1SL9 A;  2K8M B;  3IF7 A;  4DUQ A;  3CZT X;  2BEC A;  1TIZ A;  1UUR A;  1YVL A;  2AAO A;  2KAY A;  2NLN A;  2F8P A;  1SCM C;  1TCO B;  5TNC A;  3AAJ A;  1QX5 B;  1F54 A;  1CLB A;  2WCB A;  1KFU S;  2LLT A;  2KFH A;  2K2F A;  1IG5 A;  2ZNE A;  4QJ3 B;  1WDC C;  4PHM A;  3M0W A;  2KBM A;  3EK8 A;  3TDI A;  1J7Q A;  1SRA A;  1L7Z A;  1F4Q A;  2D8N A;  1JFK A;  1UHK A;  4A4C A;  1YRU B;  1SMG A;  3PN7 C;  2M7N A;  1BMO A;  2BCA A;  2KNE A;  3GK2 A;  2O5G A;  3DVJ A;  2OS8 B;  4OV2 A;  5IBW A;  4YGD B;  1A75 A;  1LVC D;  2KI4 B;  3OX5 A;  1MWN A;  1QAT A;  1BOC A;  2SCP A;  3JTD C;  1YRT B;  1Y0V H;  4OCI A;  3IQQ A;  2R2I A;  1R6P A;  1NWD A;  3NSI A;  1QLS A;  1S36 A;  1QVI Z;  3EK4 A;  1HT9 A;  2AUC A;  5AXI A;  3TS5 C;  3OP0 A;  2BCX A;  2KYC A;  3AKA A;  1KWO B;  3ZNI A;  2JUL A;  3CS1 A;  4MSP A;  1DGU A;  2JC2 A;  2LHL A;  5CSN A;  4DCK A;  3A8R A;  4YGA A;  4E68 A;  1BR1 B;  1UUS A;  1UP5 A;  2HPS A;  1IGV A;  2PSR A;  1RK9 A;  1PVB A;  1TTX A;  2I7A A;  2M1K B;  4R1E A;  1AK8 A;  1K94 A;  2VRG A;  3PM8 A;  1EG3 A;  1TNQ A;  2CCM A;  2LUX A;  4D1E A;  4YRU A;  5I8N A;  3QRX A;  1CNP A;  1KK8 C;  3SG3 A;  1IH0 A;  1YUS A;  3PSR A;  1CB1 A;  5AEQ A;  1B8C A;  2BE4 A;  1TRF A;  4N5X A;  3JVT C;  3CWG A;  4NDC A;  1WLM A;  5D7F A;  2FCD A;  2OPO A;  2M49 B;  3OX6 A;  3DF0 A;  2WC8 A;  1QVI Y;  1CM4 A;  1PK0 D;  2K7C A;  1QXP A;  4ORC B;  4GPL B;  3EVR A;  2L5X B;  1S5G Z;  2LMV A;  2PAL A;  5F6T A;  2OTG C;  3SIA A;  1GJY A;  4CLN A;  1EJ3 A;  4DRW A;  1IQ3 A;  5BPJ A;  1KCY A;  3E3R A;  4YI9 A;  2JT0 A;  1JUO A;  1Y6W A;  1QV0 A;  2NCP A;  3BUO B;  5HKW A;  3MSE B;  3VGO A;  2FOT A;  1CFP A;  3WXA A;  1MF8 B;  1DTL A;  1AJ5 A;  1C7V A;  1K9U A;  2PVB A;  4ORA B;  1CDP A;  3I5G B;  3LLE A;  2CXJ A;  3F45 A;  4XJK A;  1SY9 A;  4ORB B;  2DOQ A;  4PAL A;  4GGF A;  1BF5 A;  2KI6 D;  3O6B A;  1X02 A;  2F33 A;  3OHM B;  2IS9 A;  1QIV A;  1CDM A;  1CLL A;  1QIW A;  3PFV A;  4GNK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...