1WRKA

Crystal structure of the n-terminal domain of human cardiac troponin c in complex with trifluoperazine (orthrombic crystal form)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
82
structure length
82
Chain Sequence
IYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGSISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRSM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Troponin C, slow skeletal and cardiac muscles
publication title Crystal structure of the N-terminal domain of human cardiac troponin C in complex with trifluoperazine
rcsb
source organism Homo sapiens
molecule tags Contractile protein
total genus 31
structure length 82
sequence length 82
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1wrkA00
1JF0A 1UURA 3TDUA 2WORA 1BLQA 2KNEA 3BUXB 4R1EA 2I7AA 3MSEB 3LCPC 2QPTA 1XA5A 2HPSA 3EVRA 4MRYA 2BECA 4OKHA 1Y1UA 2L4IA 3PN7B 4P5OE 1M45A 1NUBA 1AK8A 5CPVA 2R2IA 2LVIA 1ZMZA 5PALA 2CTNA 2JNXA 1JFKA 1EJ3A 1HQVA 2BL0C 4PHJA 1UHNA 1LA0A 1KSOA 2LMUA 1OMVA 2K8MB 2KGBC 3CLNA 1B1GA 3WHUB 4E68A 1TNXA 4A4CA 3E3RA 5G08A 2K2FA 1SL8A 1B8RA 2LVVA 1K94A 3KO0A 1OZSA 1KFUS 1KWOC 3I5IB 1A4PA 1DJZA 1NX2A 2F33A 3EK8A 3PM8A 5HKWA 3SG3A 2BBMA 3A8RA 1DF0A 1QV0A 2BE6A 1Y0VH 4MZLA 4CPVA 3VGOA 4CFRA 1A75B 1XVJA 1G33A 2OS8C 1YVLA 2KOTA 3BUOB 3DD4A 1C7WA 1S5GZ 1K90D 3JTDB 2F3ZA 2H61C 2OPOA 1N0YA 4FTGA 1NCZA 4Q04A 5I8NA 1NX3A 1QIWA 1TIZA 3LK0A 4PHKA 2WCFA 1Q80A 2KFGA 1GGWA 3VRNA 3I5GC 3CWGA 1RJVA 4YGEB 2KAYA 2HF5A 3OHMB 1CMGA 3CTNA 1M31A 1SL9A 1KFXL 2LVKA 2Y1NA 4I5KA 1IWQA 1W7IB 3I5HC 1DVIA 1L7ZA 3LL8B 5KTYA 1S5GY 3FWBA 1FF1A 4XYNA 1CLMA 1C07A 1EXRA 1KWOB 5I2QA 1DT7B 1Y1XA 1A75A 1K9PA 1RFJA 2O60A 2Q4UA 4WQ2A 2LLSA 1CM4A 2K61A 5J3XA 1J55A 2AAOA 2BBNA 1XO5A 4AQJA 5I2OA 2EC6C 2OTGB 1SY9A 4GUKA 2KGRA 3EK4A 2L0PA 1FW4A 2BCXA 1RK9A 3DVKA 5CSIA 1PSBA 3A4UB 2TN4A 5HLOA 1TCOB 5JJGA 3NSOA 4GGNA 1L2OC 3M0WA 1K95A 2KAVA 2JXLA 5AANA 1BODA 1QS7A 1XK4A 1AP4A 4ORCB 1J7PA 3I5GB 1YTZC 4ZCVA 1J7OA 4MLWA 3OB2B 4PE7A 4ICBA 3CR2A 3FS7A 3KPXA 5CSJA 1KFXS 2K7BA 4JWQA 1ODBA 1IQ3A 1LVCD 1V1GA 2RGIA 2M97A 3SG7A 5D69A 2KI6C 4CFQA 4MVFA 4PHNA 2LMVA 2Q91A 4D1EA 1NP8A 4ORBB 5ER4X 2ZKMX 2JT8A 3EKJA 2ISDA 1CB1A 3VRQA 1SYMA 4ZCUA 2LM5A 5DKNA 1ALWA 2CT9A 1U5IA 2EC6B 1DF0B 1NX0A 2V53A 1QLKA 1H4BA 2M1UA 4DRWA 1DJIA 2GGMA 2KI4C 4BY4A 4ORAB 4M2OA 2I18A 1EG3A 1L2OB 1SPYA 3NSLA 4GBAA 4YI9A 5KSZA 2JTTA 3FWCA 2CBLA 1YRUB 2LE9B 2BKIB 1QJTA 1IJ6A 3TS5C 3VRRA 1WDCC 1XK4C 3ZNIA 4YI8A 2JPTA 1B47A 2BKHB 1YUUA 2M29A 1J7QA 2F3YA 1KQMC 1TNWA 1G8IA 2G9BA 2KFFA 1XFUO 1KK8C 4GNKB 2G2BA 4HRHA 2M1KB 4WRIA 1YUTA 1AJ4A 1CM1A 4A4BA 1HT9A 4GGFA 4M2PA 1F70A 3PFVA 2AUCA 2LCPA 4OCIA 5F6TA 3WHTB 2F2OA 2KI6D 2M8UA 1MXLC 3FIAA 3O2PA 2FJUB 1CDMA 2JZIA 2L51A 1KSMA 1WRLA 2EHBA 1QASA 4HREE 1JC2A 1E8AA 1IJ5A 2ZN8A 2BE4A 3O78A 1SCVA 1GQMA 2COLB 1SMGA 2H2KA 3CZTX 1MQ1A 4DCKA 1B9AA 4N5XA 1WRKA 1PVAA 2I2RE 1IH0A 1X02A 1DTLA 2K0JA 5DKRA 2NLNA 2PRUA 3EVUA 1JFJA 2L50A 3KEVA 2KAXA 3BYAA 3KF9A 1ZFSA 1OE9B 3F45A 1DJWA 1YX7A 4WQ3A 4MZJA 3LK1A 2KYFA 4F0ZB 3TS5B 1Y1AA 4MN0A 4BY5A 4YGCB 1WDCB 3PALA 1LXFC 1RECA 2NXQA 2PSRA 3IQQA 4C0LA 1MR8A 1DGVA 3TUYC 2NCPA 1KQMB 1B8LA 1SBJA 2BL0B 3JVTC 4DIRA 5HLVA 2JQ6A 2MLFC 1KK8B 1MWNA 5HYDA 1M46A 1CDLA 3PATA 1S3PA 1SK6D 3AAJA 4MEWA 5AFPA 1G4YR 1B7TZ 1J1EA 2WCEA 1FI6A 4I5LB 2KSPA 2VRGA 2EGDA 1M39A 2MHHA 1B8CA 1CDPA 1M63B 3GK2A 2DOQA 4GGFC 4NDCA 3AAKA 3AKAA 3SJSA 2LC5A 1AHRA 1OZOA 1NSHA 2BCAA 1QLSA 1CLLA 3ZWHA 1DJXA 2OS8B 1QX7A 3D10A 2LMTA 3SIBA 1TOPA 1CNPA 1A29A 1JUOA 4YGAA 3RLZA 2Y4QA 3DVEA 3TZ1A 1U5IB 3VRPA 1YR5A 2FOTA 2P6BB 3CR5X 3SIAA 4FQOA 2K7DA 2LUXA 4AOMA 5GQQC 1JBAA 2ZFDA 1DJYA 3AKBA 1JWDA 1GGZA 2JT0A 4PALA 4PE0A 2WC8A 4PE1A 1B7TY 1KQVA 2B1UA 2KQYA 4I5NB 1SR6C 3CGAA 1YURA 4YRUA 1R2UA 1FPWA 2ZN9A 2Y5IA 3H4SE 1QV1A 4MZKA 3TUYB 4GFTA 1NIWA 1YX8A 2JNFA 3JVTB 1TRFA 1MHOA 4NDDA 5B8IB 1SKTA 3I5HB 2WOSA 3BUWB 2KHNA 3CS1A 1F71A 1PK0D 5CSFA 2A4JA 1OSAA 1QATA 5D7FA 1MUXA 5I2LA 2PASA 1GJYA 4JPZB 2JOJA 1CDNA 1CKKA 2MRDA 1F8HA 5TNCA 1QX5B 4CLNA 1NCYA 1WY9A 4C0KA 2LVJA 3ICBA 4OR9B 4HRGA 1UHJA 2PVBA 1BR1B 4QJ3B 5HKYA 2NCOA 1EH2A 4CIDA 1H8BA 4NQGA 1XFXO 3OX6A 1WLMA 3D0YA 1EL4A 2LLUA 1F54A 1A2XA 2LHLA 4N1GA 4OV2A 2ZNEA 4L9MA 1IQ5A 1K96A 3KHEA 1CFCA 1C7VA 3NSIA 1DGUA 2LANA 1UP5A 4HSZA 1JSAA 4PDZA 1D1OA 1BT6A 3BUMB 3O4YA 2CNPA 4ETOA 3EVVA 2ZRSA 3TDIA 1BF5A 1UUSA 2JTZA 2LHIA 1CTRA 4GAOA 1NX1A 1K93D 4XJKA 1OMDA 3O6BA 4AQIA 3I5FC 1K9KA 1QX2A 5K89A 2M0RA 5JOLA 4DS7A 4MBEA 1V1FA 1PULA 1OOJA 3DVJA 4TNCA 3VROA 3EK7A 1NWDA 2M3WA 3DVMA 2JULA 3CR4X 2K2AA 1XFYO 3WNXB 5AXIA 2M9GA 1W7JB 2KYCA 2L2EA 3IQOA 3OP0A 3DF0A 1FBVA 3TDZA 4DUQA 1BG1A 2KFHA 2E6WA 3HCMA 1AVSA 1OMRA 2KI4B 2MAZA 2O5GA 1SCMC 5AERA 4NDBA 1RWYA 1CFFA 2E30A 1F4QA 5BPJA 2MLEC 4PE4A 1K9UA 2KBIA 2JXCA 2Y1MA 2L5XB 1QVIZ 1RTP1 2FCEA 2I94A 1BR4B 1BU3A 2NZ0A 4M2QA 3BOWA 3OX5A 1IGVA 1A03A 2WNDA 1VRKA 2F8PA 2JWWA 3SG4A 1QXPA 1KK7Z 2HQ8A 1CMFA 2GV5A 2OTGC 3C1VA 1MXEA 1N65A 3RM1A 2JT3A 1CLBA 1UHKA 4USLA 5IBWA 2MA2A 2PMYA 2ZRTA 3I5FB 1WLZA 1LKJA 1PRWA 1N2DA 1S6JA 2SASA 3SG5A 2KDHA 1S6CA 2HQWA 1JF2A 4QJ4B 4I5JA 1IG5A 2KBMA 3WXAA 1NPQA 1K8UA 2D8NA 1IKUA 3NSKA 5CSNA 1WRZA 1QVIY 4P2YB 2GGZA 5FYXA 1TTXA 1J1DA 2K7OA 2QACA 4U8DA 1CFDA 1K2HA 3NXAA 1S6IA 3BXKA 3GK4X 1KK7Y 1FI5A 1SCMB 1F55A 1SW8A 5AEQA 2L98A 3PSRA 4PCWA 1AJ5A 2M49B 3GOFA 5DKQA 1EG4A 1KCYA 1ZACA 3D0YB 1XFWO 4YGBB 5ER5A 1PVBA 1QTXA 1UHIA 2MBXA 5KU1A 1XYDA 2M7NA 3IF7A 2LUCA 1TNQA 1B4CA 3HX4A 1YUSA 1LINA 1R6PA 3SG2A 2SCPA 2L4HA 4YBHB 4MRXA 2LP3A 1LA3A 1F4OA 4YGDB 2IS9A 3SG6A 1TN4A 2JC2A 4XJKB 1S36A 2LV7A 2PALA 2M7LA 1DJGA 1NCXA 1S1EA 1YRTB 1ZOTB 3BUNB 2WCBA 4OVNF 1S26D 2LLTA 2FCDA 2CXJA 1Y6WA 3PN7C 1XFZO 1BOCA 1SL7A 4PHMA 1DMOA 1TCFA 1BMOA 3EKHA 4IL1A 1ALVA 1YVHA 2LP2A 2CCMA 2AMIA 3OB1B 2K7CA 1BJFA 2HETA 4UPGA 1CFPA 1NYAA 4N1FA 1SRAA 3DF0B 1PALA 1UHHA 2KQ6A 2LAPA 2JRFA 1PSRA 3GK1A 1DJHA 2LNKA 1IRJA 1KFUL 3I5IC 1OQPA 1TNPA 1SR6B 1ZUZA 4JQ0D 2ZNDA 3K21A 3QRXA 3PLFB 5HKZA 2JU0A 2BCBA 1AUIB 1QIVA 1MF8B 4MSPA 4C0JA 2H61A 3LLEA 1XFVO 3BOWB 3BQ3A 1J7RA 1RROA 4QJ5B 2MJWB 1SNLA 3JTDC 1UWOA 4GPLB 2F2PA
chains in the Genus database with same CATH superfamily
1JF0A 5EL2A 1DC1A 3R1PA 1UURA 3TDUA 2WORA 1BLQA 2KNEA 3BUXB 4R1EA 2I7AA 3MSEB 3LCPC 2QPTA 2KPHA 1XA5A 2HPSA 3EVRA 4MRYA 2BECA 4OKHA 1Y1UA 2L4IA 3PN7B 4P5OE 1Z4HA 3S0EA 1M45A 1NUBA 1AK8A 5CPVA 2R2IA 4IJ7A 3BFAA 2LVIA 1ZMZA 3R1OA 5PALA 2CTNA 2JNXA 3SS4A 1JFKA 1EJ3A 1HQVA 2BL0C 4PHJA 5I94A 1UHNA 1LA0A 1KSOA 2LMUA 1OMVA 2K8MB 2KGBC 3CLNA 1B1GA 4JD9A 2WCMA 3WHUB 4E68A 1TNXA 4A4CA 3E3RA 5G08A 2K2FA 1SL8A 1B8RA 2LVVA 1K94A 3KO0A 2PYQA 3DYEA 1OZSA 1KFUS 1KWOC 3I5IB 2L2CA 1A4PA 1DJZA 1NX2A 2F33A 3EK8A 3PM8A 5HKWA 2P71A 3SG3A 2BBMA 3A8RA 1DF0A 1QV0A 2BE6A 1Y0VH 4MZLA 4CPVA 3VGOA 4CFRA 1A75B 1XVJA 1G33A 3B87A 3CZ2A 3D73A 2OS8C 1YVLA 3SS3A 5D3OA 2KOTA 3BUOB 3DD4A 1C7WA 1S5GZ 1K90D 3JTDB 2F3ZA 2H61C 2OPOA 1N0YA 4FTGA 1NCZA 2JPOA 4Q04A 5I8NA 1NX3A 1QIWA 1TIZA 3LK0A 2GTEA 4PHKA 2WCFA 1Q80A 2KFGA 3CYZA 1GGWA 2WCHA 3VRNA 3I5GC 3CWGA 1RJVA 4YGEB 2KAYA 2HF5A 3OHMB 1CMGA 3CTNA 1M31A 1SL9A 1KFXL 2LVKA 2Y1NA 3S0FA 4I5KA 1IWQA 3FE9A 1W7IB 3I5HC 1DVIA 1L7ZA 3FE8A 3LL8B 5KTYA 1LS8A 1S5GY 4FQTA 3FWBA 1FF1A 4XYNA 1CLMA 4F7FA 1C07A 1EXRA 1KWOB 5I2QA 1DT7B 1Y1XA 1A75A 1K9PA 1RFJA 2O60A 2Q4UA 4WQ2A 2LLSA 1CM4A 2K61A 5J3XA 1DEKA 1J55A 2AAOA 2BBNA 1XO5A 4AQJA 5I2OA 2EC6C 2OTGB 1SY9A 4GUKA 2KLEA 3DXLA 2KGRA 3EK4A 2L0PA 1FW4A 2BCXA 1RK9A 3DVKA 5CSIA 1PSBA 3A4UB 1OOIX 2TN4A 5HLOA 1TCOB 5JJGA 3NSOA 4GGNA 1L2OC 3M0WA 1K95A 2KAVA 3DY9A 2JXLA 5AANA 1BODA 4KYNA 1QS7A 1XK4A 1AP4A 4ORCB 1J7PA 3I5GB 1YTZC 3S0AA 4ZCVA 1J7OA 4MLWA 3OB2B 4PE7A 2QEHA 4ICBA 3V2LA 3CR2A 3FS7A 3KPXA 5CSJA 1KFXS 2K7BA 4JWQA 1ODBA 2WC6A 1IQ3A 1LVCD 1V1GA 2RGIA 2M97A 3SG7A 5D69A 2KI6C 4CFQA 3OBVA 4MVFA 4PHNA 2LMVA 2Q91A 4D1EA 1NP8A 3CZ1A 4ORBB 5ER4X 2ZKMX 3D77A 2JT8A 3EKJA 2ISDA 1CB1A 3VRQA 2YGUA 1SYMA 4ZCUA 2LM5A 3B7AA 5DKNA 3RZSA 1ALWA 2CT9A 1U5IA 2EC6B 1DF0B 1NX0A 2V53A 3UO9A 1QLKA 1H4BA 2M1UA 4DRWA 1DJIA 2GGMA 2KI4C 4BY4A 4ORAB 4M2OA 2I18A 1EG3A 1L2OB 4INWA 1SPYA 3NSLA 4GBAA 4YI9A 5KSZA 2JTTA 3FWCA 2CBLA 1YRUB 2LE9B 2BKIB 1QJTA 1IJ6A 3TS5C 3CABA 3VRRA 1WDCC 1XK4C 1XFRA 3ZNIA 4YI8A 2JPTA 1B47A 3UNWA 1T14A 2BKHB 1YUUA 2M29A 1J7QA 2F3YA 1KQMC 2P70A 1TNWA 1G8IA 2G9BA 2KFFA 1XFUO 1KK8C 4GNKB 2G2BA 4HRHA 1P28A 2M1KB 4WRIA 1YUTA 1AJ4A 1CM1A 4A4BA 1HT9A 4GGFA 4M2PA 3NHIA 1F70A 3PFVA 2AUCA 2LCPA 4OCIA 5F6TA 3WHTB 2F2OA 2KI6D 2M8UA 1MXLC 3FIAA 3O2PA 2FJUB 1CDMA 3CDNA 2JZIA 2L51A 1TUZA 1KSMA 1WRLA 2EHBA 1QASA 3CZ0A 3B6XA 4HREE 1JC2A 1E8AA 1IJ5A 2ZN8A 2BE4A 3O78A 1SCVA 1GQMA 2COLB 1SMGA 2H2KA 1C3ZA 3CZTX 1MQ1A 4DCKA 1B9AA 4N5XA 1WRKA 1PVAA 2I2RE 1IH0A 1X02A 2H8VA 1DTLA 2K0JA 5DKRA 2NLNA 2PRUA 3EVUA 1JFJA 2L50A 3KEVA 2KAXA 3BYAA 3KF9A 1ZFSA 2WCLA 1W9ZA 1OE9B 3F45A 1DJWA 1YX7A 2QEVA 4WQ3A 4MZJA 3LK1A 2KYFA 3EG5B 4F0ZB 3TS5B 1Y1AA 4MN0A 4BY5A 4YGCB 1WDCB 3PALA 1LXFC 1RECA 2NXQA 2PSRA 3IQQA 4C0LA 1MR8A 1DGVA 3TUYC 2NCPA 1KQMB 1B8LA 1SBJA 2BL0B 3JVTC 4DIRA 5HLVA 2JQ6A 2MLFC 1KK8B 1MWNA 5HYDA 1M46A 1CDLA 3PATA 1S3PA 1SK6D 3AAJA 3L4AA 4MEWA 5AFPA 1G4YR 1B7TZ 1J1EA 2WCEA 1FI6A 4I5LB 2KSPA 2VRGA 2EGDA 1M39A 2MHHA 1B8CA 1CDPA 1M63B 3FE6A 2DOQA 3GK2A 4GGFC 3AAKA 3AKAA 4NDCA 3S0DA 3QMEA 3SJSA 2LC5A 1AHRA 1OZOA 1NSHA 3B86A 2BCAA 1QLSA 1CLLA 2WCKA 3ZWHA 1DJXA 2OS8B 1QX7A 3D10A 2KLDA 2LMTA 3SIBA 1TOPA 1CNPA 1A29A 1JUOA 4YGAA 3RLZA 3S0GA 3SS5A 2Y4QA 3DVEA 3TZ1A 1U5IB 3VRPA 1YR5A 2FOTA 2P6BB 3CR5X 3SIAA 4FQOA 2K7DA 2LUXA 4AOMA 5GQQC 1JBAA 2ZFDA 1DJYA 3AKBA 1JWDA 1GGZA 2JT0A 3O4XA 4PALA 4PE0A 2WC8A 4PE1A 1B7TY 1KQVA 2B1UA 2KQYA 4I5NB 1SR6C 3CGAA 1OOFA 1YURA 4YRUA 1R2UA 1FPWA 2ZN9A 2Y5IA 3H4SE 5DICA 2WCJA 1QV1A 1TUJA 4MZKA 3TUYB 1OW4A 4GFTA 1NIWA 1YX8A 2JNFA 3JVTB 1TRFA 1MHOA 4NDDA 5B8IB 1SKTA 3I5HB 3S0BA 2WOSA 3BUWB 2KHNA 3CS1A 4PT1A 1F71A 1PK0D 5CSFA 2A4JA 1OSAA 3OGNA 1QATA 5D7FA 1MUXA 5I2LA 3D76A 2PASA 1GJYA 3D75A 4JPZB 2JOJA 1SSEB 1CDNA 1CKKA 3IVTA 2MRDA 1F8HA 3B88A 5TNCA 1QX5B 4CLNA 1NCYA 1WY9A 3K1EA 4C0KA 2LVJA 3ICBA 4OR9B 4HRGA 1UHJA 2PVBA 1IIOA 3R72A 1BR1B 4QJ3B 5HKYA 2NCOA 2L5YA 3VB1A 3L4LA 1EH2A 4CIDA 1H8BA 4NQGA 1XFXO 1TWOA 3OX6A 1WLMA 3D0YA 1EL4A 5HL1A 2LLUA 3BJHA 1F54A 1A2XA 2LHLA 4N1GA 4OV2A 2ZNEA 4L9MA 1IQ5A 1K96A 3KHEA 1CFCA 1C7VA 3NSIA 1DGUA 2LANA 1UP5A 4HSZA 1JSAA 4PDZA 1D1OA 1BT6A 3BUMB 3O4YA 2CNPA 4ETOA 3EVVA 2ZRSA 3TDIA 1BF5A 1UUSA 2JTZA 1ORGA 2LHIA 1CTRA 4GAOA 1NX1A 1K93D 2ERBA 3NGVA 5FI2A 4XJKA 1OMDA 3O6BA 4AQIA 3I5FC 1K9KA 1QX2A 5K89A 2M0RA 5JOLA 4DS7A 4MBEA 1V1FA 1PULA 1OOJA 3DVJA 4TNCA 3VROA 3EK7A 1NWDA 2M3WA 1QWVA 3DVMA 2JULA 3CR4X 2K2AA 1XFYO 3WNXB 3PM2A 5AXIA 2M9GA 1OOGA 1W7JB 2KYCA 2L2EA 3IQOA 3OP0A 3DF0A 1FBVA 3TDZA 4DUQA 1BG1A 3BFBA 2KFHA 2E6WA 3Q8IA 3HCMA 1AVSA 1OMRA 2KI4B 2MAZA 2O5GA 1SCMC 5AERA 4NDBA 1RWYA 1CFFA 2E30A 1Z2CB 1F4QA 5BPJA 2MLEC 4PE4A 1K9UA 2KBIA 2JXCA 2Y1MA 2L5XB 1QVIZ 1RTP1 2FCEA 2I94A 1BR4B 1BU3A 2NZ0A 4M2QA 3BOWA 3OX5A 1IGVA 1A03A 2WNDA 1VRKA 2F8PA 2JWWA 3SG4A 1QXPA 1KK7Z 2HQ8A 1CMFA 2GV5A 2OTGC 3C1VA 4JKTA 1MXEA 1N65A 3RM1A 2JT3A 1CLBA 1UHKA 3D78A 4USLA 5IBWA 2MA2A 2PMYA 2ZRTA 3I5FB 1WLZA 1LKJA 1PRWA 1N2DA 1S6JA 2SASA 3SG5A 2KDHA 1S6CA 2HQWA 1JF2A 4QJ4B 2BAPA 4I5JA 1IG5A 2KBMA 3WXAA 1NPQA 1K8UA 2D8NA 1IKUA 3NSKA 5CSNA 3PJIA 1WRZA 1QVIY 4P2YB 2GGZA 5FYXA 1TTXA 1J1DA 2K7OA 2QACA 4U8DA 1CFDA 1K2HA 3NXAA 1S6IA 3BXKA 3GK4X 3R1VA 1KK7Y 1FI5A 1SCMB 1F55A 1SW8A 4OZDA 5AEQA 2L98A 3PSRA 4PCWA 1AJ5A 2M49B 3GOFA 5DKQA 1GM0A 1EG4A 1KCYA 1ZACA 3D0YB 1XFWO 3BFHA 4YGBB 5ER5A 1PVBA 1QTXA 1UHIA 2MBXA 5KU1A 1OOHA 1XYDA 2M7NA 3IF7A 2LUCA 1TNQA 1B4CA 3HX4A 1YUSA 2WC5A 1LINA 3N7HA 1R6PA 3SG2A 2SCPA 2L4HA 2FJYA 4YBHB 4MRXA 2LP3A 1LA3A 1F4OA 4YGDB 2IS9A 3SG6A 1TN4A 2JC2A 4XJKB 1S36A 2LV7A 2PALA 2BNXA 2M7LA 1DJGA 2QEBA 1NCXA 1S1EA 1YRTB 1ZOTB 1DELA 2WCBA 3BUNB 1S26D 4OVNF 1C3YA 2LLTA 2FCDA 2CXJA 1Y6WA 3PN7C 1XFZO 1BOCA 1DQEA 1SL7A 4PHMA 1DMOA 1TCFA 1BMOA 3EKHA 4IL1A 1ALVA 1YVHA 2LP2A 2CCMA 2AMIA 3OB1B 2K7CA 1BJFA 2HETA 4UPGA 4INXA 1CFPA 2K60A 1NYAA 4N1FA 1SRAA 3DF0B 2PQLA 5FI6A 1PALA 1UHHA 2KQ6A 2QDIA 3NHTA 2LAPA 5FI7A 3L47A 2JRFA 1PSRA 3GK1A 1DJHA 2LNKA 1IRJA 1KFUL 3I5IC 1OQPA 1TNPA 1SR6B 1ZUZA 3DZTA 2ZNDA 4JQ0D 2QEOA 3K21A 3QRXA 3PLFB 5HKZA 2JU0A 2BCBA 1AUIB 1QIVA 1MF8B 4MSPA 4C0JA 2H61A 3LLEA 1XFVO 3D74A 3BOWB 3BQ3A 1J7RA 1RROA 4QJ5B 2MJWB 1SNLA 3JTDC 1UWOA 4GPLB 2F2PA
chains in the Genus database with same CATH topology
1JF0A 1UURA 3TDUA 2WORA 1BLQA 2KNEA 3BUXB 4R1EA 2I7AA 3MSEB 3LCPC 2QPTA 1XA5A 2HPSA 3EVRA 4MRYA 2BECA 4OKHA 1Y1UA 2L4IA 3PN7B 4P5OE 1M45A 1NUBA 1AK8A 5CPVA 2R2IA 2LVIA 1ZMZA 5PALA 2CTNA 2JNXA 1JFKA 1EJ3A 1HQVA 2BL0C 4PHJA 1UHNA 1LA0A 1KSOA 2LMUA 1OMVA 2K8MB 2KGBC 3CLNA 1B1GA 3WHUB 4E68A 1TNXA 4A4CA 3E3RA 5G08A 2K2FA 1SL8A 1B8RA 2LVVA 1K94A 3KO0A 1OZSA 1KFUS 1KWOC 3I5IB 1A4PA 1DJZA 1NX2A 2F33A 3EK8A 3PM8A 5HKWA 3SG3A 2BBMA 3A8RA 1DF0A 1QV0A 2BE6A 1Y0VH 4MZLA 4CPVA 3VGOA 4CFRA 1A75B 1XVJA 1G33A 2OS8C 1YVLA 2KOTA 3BUOB 3DD4A 1C7WA 1S5GZ 1K90D 3JTDB 2F3ZA 2H61C 2OPOA 1N0YA 4FTGA 1NCZA 4Q04A 5I8NA 1NX3A 1QIWA 1TIZA 3LK0A 4PHKA 2WCFA 1Q80A 2KFGA 1GGWA 3VRNA 3I5GC 3CWGA 1RJVA 4YGEB 2KAYA 2HF5A 3OHMB 1CMGA 3CTNA 1M31A 1SL9A 1KFXL 2LVKA 2Y1NA 4I5KA 1IWQA 1W7IB 3I5HC 1DVIA 1L7ZA 3LL8B 5KTYA 1S5GY 3FWBA 1FF1A 4XYNA 1CLMA 1C07A 1EXRA 1KWOB 5I2QA 1DT7B 1Y1XA 1A75A 1K9PA 1RFJA 2O60A 2Q4UA 4WQ2A 2LLSA 1CM4A 2K61A 5J3XA 1J55A 2AAOA 2BBNA 1XO5A 4AQJA 5I2OA 2EC6C 2OTGB 1SY9A 4GUKA 2KGRA 3EK4A 2L0PA 1FW4A 2BCXA 1RK9A 3DVKA 5CSIA 1PSBA 3A4UB 2TN4A 5HLOA 1TCOB 5JJGA 3NSOA 4GGNA 1L2OC 3M0WA 1K95A 2KAVA 2JXLA 5AANA 1BODA 1QS7A 1XK4A 1AP4A 4ORCB 1J7PA 3I5GB 1YTZC 4ZCVA 1J7OA 4MLWA 3OB2B 4PE7A 4ICBA 3CR2A 3FS7A 3KPXA 5CSJA 1KFXS 2K7BA 4JWQA 1ODBA 1IQ3A 1LVCD 1V1GA 2RGIA 2M97A 3SG7A 5D69A 2KI6C 4CFQA 4MVFA 4PHNA 2LMVA 2Q91A 4D1EA 1NP8A 4ORBB 5ER4X 2ZKMX 2JT8A 3EKJA 2ISDA 1CB1A 3VRQA 1SYMA 4ZCUA 2LM5A 5DKNA 1ALWA 2CT9A 1U5IA 2EC6B 1DF0B 1NX0A 2V53A 1QLKA 1H4BA 2M1UA 4DRWA 1DJIA 2GGMA 2KI4C 4BY4A 4ORAB 4M2OA 2I18A 1EG3A 1L2OB 1SPYA 3NSLA 4GBAA 4YI9A 5KSZA 2JTTA 3FWCA 2CBLA 1YRUB 2LE9B 2BKIB 1QJTA 1IJ6A 3TS5C 3VRRA 1WDCC 1XK4C 3ZNIA 4YI8A 2JPTA 1B47A 2BKHB 1YUUA 2M29A 1J7QA 2F3YA 1KQMC 1TNWA 1G8IA 2G9BA 2KFFA 1XFUO 1KK8C 4GNKB 2G2BA 4HRHA 2M1KB 4WRIA 1YUTA 1AJ4A 1CM1A 4A4BA 1HT9A 4GGFA 4M2PA 1F70A 3PFVA 2AUCA 2LCPA 4OCIA 5F6TA 3WHTB 2F2OA 2KI6D 2M8UA 1MXLC 3FIAA 3O2PA 2FJUB 1CDMA 2JZIA 2L51A 1KSMA 1WRLA 2EHBA 1QASA 4HREE 1JC2A 1E8AA 1IJ5A 2ZN8A 2BE4A 3O78A 1SCVA 1GQMA 2COLB 1SMGA 2H2KA 3CZTX 1MQ1A 4DCKA 1B9AA 4N5XA 1WRKA 1PVAA 2I2RE 1IH0A 1X02A 1DTLA 2K0JA 5DKRA 2NLNA 2PRUA 3EVUA 1JFJA 2L50A 3KEVA 2KAXA 3BYAA 3KF9A 1ZFSA 1OE9B 3F45A 1DJWA 1YX7A 4WQ3A 4MZJA 3LK1A 2KYFA 4F0ZB 3TS5B 1Y1AA 4MN0A 4BY5A 4YGCB 1WDCB 3PALA 1LXFC 1RECA 2NXQA 2PSRA 3IQQA 4C0LA 1MR8A 1DGVA 3TUYC 2NCPA 1KQMB 1B8LA 1SBJA 2BL0B 3JVTC 4DIRA 5HLVA 2JQ6A 2MLFC 1KK8B 1MWNA 5HYDA 1M46A 1CDLA 3PATA 1S3PA 1SK6D 3AAJA 4MEWA 5AFPA 1G4YR 1B7TZ 1J1EA 2WCEA 1FI6A 4I5LB 2KSPA 2VRGA 2EGDA 1M39A 2MHHA 1B8CA 1CDPA 1M63B 3GK2A 2DOQA 4GGFC 4NDCA 3AAKA 3AKAA 3SJSA 2LC5A 1AHRA 1OZOA 1NSHA 2BCAA 1QLSA 1CLLA 3ZWHA 1DJXA 2OS8B 1QX7A 3D10A 2LMTA 3SIBA 1TOPA 1CNPA 1A29A 1JUOA 4YGAA 3RLZA 2Y4QA 3DVEA 3TZ1A 1U5IB 3VRPA 1YR5A 2FOTA 2P6BB 3CR5X 3SIAA 4FQOA 2K7DA 2LUXA 4AOMA 5GQQC 1JBAA 2ZFDA 1DJYA 3AKBA 1JWDA 1GGZA 2JT0A 4PALA 4PE0A 2WC8A 4PE1A 1B7TY 1KQVA 2B1UA 2KQYA 4I5NB 1SR6C 3CGAA 1YURA 4YRUA 1R2UA 1FPWA 2ZN9A 2Y5IA 3H4SE 1QV1A 4MZKA 3TUYB 4GFTA 1NIWA 1YX8A 2JNFA 3JVTB 1TRFA 1MHOA 4NDDA 5B8IB 1SKTA 3I5HB 2WOSA 3BUWB 2KHNA 3CS1A 1F71A 1PK0D 5CSFA 2A4JA 1OSAA 1QATA 5D7FA 1MUXA 5I2LA 2PASA 1GJYA 4JPZB 2JOJA 1CDNA 1CKKA 2MRDA 1F8HA 5TNCA 1QX5B 4CLNA 1NCYA 1WY9A 4C0KA 2LVJA 3ICBA 4OR9B 4HRGA 1UHJA 2PVBA 1BR1B 4QJ3B 5HKYA 2NCOA 1EH2A 4CIDA 1H8BA 4NQGA 1XFXO 3OX6A 1WLMA 3D0YA 1EL4A 2LLUA 1F54A 1A2XA 2LHLA 4N1GA 4OV2A 2ZNEA 4L9MA 1IQ5A 1K96A 3KHEA 1CFCA 1C7VA 3NSIA 1DGUA 2LANA 1UP5A 4HSZA 1JSAA 4PDZA 1D1OA 1BT6A 3BUMB 3O4YA 2CNPA 4ETOA 3EVVA 2ZRSA 3TDIA 1BF5A 1UUSA 2JTZA 2LHIA 1CTRA 4GAOA 1NX1A 1K93D 4XJKA 1OMDA 3O6BA 4AQIA 3I5FC 1K9KA 1QX2A 5K89A 2M0RA 5JOLA 4DS7A 4MBEA 1V1FA 1PULA 1OOJA 3DVJA 4TNCA 3VROA 3EK7A 1NWDA 2M3WA 3DVMA 2JULA 3CR4X 2K2AA 1XFYO 3WNXB 5AXIA 2M9GA 1W7JB 2KYCA 2L2EA 3IQOA 3OP0A 3DF0A 1FBVA 3TDZA 4DUQA 1BG1A 2KFHA 2E6WA 3HCMA 1AVSA 1OMRA 2KI4B 2MAZA 2O5GA 1SCMC 5AERA 4NDBA 1RWYA 1CFFA 2E30A 1F4QA 5BPJA 2MLEC 4PE4A 1K9UA 2KBIA 2JXCA 2Y1MA 2L5XB 1QVIZ 1RTP1 2FCEA 2I94A 1BR4B 1BU3A 2NZ0A 4M2QA 3BOWA 3OX5A 1IGVA 1A03A 2WNDA 1VRKA 2F8PA 2JWWA 3SG4A 1QXPA 1KK7Z 2HQ8A 1CMFA 2GV5A 2OTGC 3C1VA 1MXEA 1N65A 3RM1A 2JT3A 1CLBA 1UHKA 4USLA 5IBWA 2MA2A 2PMYA 2ZRTA 3I5FB 1WLZA 1LKJA 1PRWA 1N2DA 1S6JA 2SASA 3SG5A 2KDHA 1S6CA 2HQWA 1JF2A 4QJ4B 4I5JA 1IG5A 2KBMA 3WXAA 1NPQA 1K8UA 2D8NA 1IKUA 3NSKA 5CSNA 1WRZA 1QVIY 4P2YB 2GGZA 5FYXA 1TTXA 1J1DA 2K7OA 2QACA 4U8DA 1CFDA 1K2HA 3NXAA 1S6IA 3BXKA 3GK4X 1KK7Y 1FI5A 1SCMB 1F55A 1SW8A 5AEQA 2L98A 3PSRA 4PCWA 1AJ5A 2M49B 3GOFA 5DKQA 1EG4A 1KCYA 1ZACA 3D0YB 1XFWO 4YGBB 5ER5A 1PVBA 1QTXA 1UHIA 2MBXA 5KU1A 1XYDA 2M7NA 3IF7A 2LUCA 1TNQA 1B4CA 3HX4A 1YUSA 1LINA 1R6PA 3SG2A 2SCPA 2L4HA 4YBHB 4MRXA 2LP3A 1LA3A 1F4OA 4YGDB 2IS9A 3SG6A 1TN4A 2JC2A 4XJKB 1S36A 2LV7A 2PALA 2M7LA 1DJGA 1NCXA 1S1EA 1YRTB 1ZOTB 3BUNB 2WCBA 4OVNF 1S26D 2LLTA 2FCDA 2CXJA 1Y6WA 3PN7C 1XFZO 1BOCA 1SL7A 4PHMA 1DMOA 1TCFA 1BMOA 3EKHA 4IL1A 1ALVA 1YVHA 2LP2A 2CCMA 2AMIA 3OB1B 2K7CA 1BJFA 2HETA 4UPGA 1CFPA 1NYAA 4N1FA 1SRAA 3DF0B 1PALA 1UHHA 2KQ6A 2LAPA 2JRFA 1PSRA 3GK1A 1DJHA 2LNKA 1IRJA 1KFUL 3I5IC 1OQPA 1TNPA 1SR6B 1ZUZA 4JQ0D 2ZNDA 3K21A 3QRXA 3PLFB 5HKZA 2JU0A 2BCBA 1AUIB 1QIVA 1MF8B 4MSPA 4C0JA 2H61A 3LLEA 1XFVO 3BOWB 3BQ3A 1J7RA 1RROA 4QJ5B 2MJWB 1SNLA 3JTDC 1UWOA 4GPLB 2F2PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JF0 A;  1UUR A;  3TDU A;  2WOR A;  1BLQ A;  2KNE A;  3BUX B;  4R1E A;  2I7A A;  3MSE B;  3LCP C;  2QPT A;  1XA5 A;  2HPS A;  3EVR A;  4MRY A;  2BEC A;  4OKH A;  1Y1U A;  2L4I A;  3PN7 B;  4P5O E;  1M45 A;  1NUB A;  1AK8 A;  5CPV A;  2R2I A;  2LVI A;  1ZMZ A;  5PAL A;  2CTN A;  2JNX A;  1JFK A;  1EJ3 A;  1HQV A;  2BL0 C;  4PHJ A;  1UHN A;  1LA0 A;  1KSO A;  2LMU A;  1OMV A;  2K8M B;  2KGB C;  3CLN A;  1B1G A;  3WHU B;  4E68 A;  1TNX A;  4A4C A;  3E3R A;  5G08 A;  2K2F A;  1SL8 A;  1B8R A;  2LVV A;  1K94 A;  3KO0 A;  1OZS A;  1KFU S;  1KWO C;  3I5I B;  1A4P A;  1DJZ A;  1NX2 A;  2F33 A;  3EK8 A;  3PM8 A;  5HKW A;  3SG3 A;  2BBM A;  3A8R A;  1DF0 A;  1QV0 A;  2BE6 A;  1Y0V H;  4MZL A;  4CPV A;  3VGO A;  4CFR A;  1A75 B;  1XVJ A;  1G33 A;  2OS8 C;  1YVL A;  2KOT A;  3BUO B;  3DD4 A;  1C7W A;  1S5G Z;  1K90 D;  3JTD B;  2F3Z A;  2H61 C;  2OPO A;  1N0Y A;  4FTG A;  1NCZ A;  4Q04 A;  5I8N A;  1NX3 A;  1QIW A;  1TIZ A;  3LK0 A;  4PHK A;  2WCF A;  1Q80 A;  2KFG A;  1GGW A;  3VRN A;  3I5G C;  3CWG A;  1RJV A;  4YGE B;  2KAY A;  2HF5 A;  3OHM B;  1CMG A;  3CTN A;  1M31 A;  1SL9 A;  1KFX L;  2LVK A;  2Y1N A;  4I5K A;  1IWQ A;  1W7I B;  3I5H C;  1DVI A;  1L7Z A;  3LL8 B;  5KTY A;  1S5G Y;  3FWB A;  1FF1 A;  4XYN A;  1CLM A;  1C07 A;  1EXR A;  1KWO B;  5I2Q A;  1DT7 B;  1Y1X A;  1A75 A;  1K9P A;  1RFJ A;  2O60 A;  2Q4U A;  4WQ2 A;  2LLS A;  1CM4 A;  2K61 A;  5J3X A;  1J55 A;  2AAO A;  2BBN A;  1XO5 A;  4AQJ A;  5I2O A;  2EC6 C;  2OTG B;  1SY9 A;  4GUK A;  2KGR A;  3EK4 A;  2L0P A;  1FW4 A;  2BCX A;  1RK9 A;  3DVK A;  5CSI A;  1PSB A;  3A4U B;  2TN4 A;  5HLO A;  1TCO B;  5JJG A;  3NSO A;  4GGN A;  1L2O C;  3M0W A;  1K95 A;  2KAV A;  2JXL A;  5AAN A;  1BOD A;  1QS7 A;  1XK4 A;  1AP4 A;  4ORC B;  1J7P A;  3I5G B;  1YTZ C;  4ZCV A;  1J7O A;  4MLW A;  3OB2 B;  4PE7 A;  4ICB A;  3CR2 A;  3FS7 A;  3KPX A;  5CSJ A;  1KFX S;  2K7B A;  4JWQ A;  1ODB A;  1IQ3 A;  1LVC D;  1V1G A;  2RGI A;  2M97 A;  3SG7 A;  5D69 A;  2KI6 C;  4CFQ A;  4MVF A;  4PHN A;  2LMV A;  2Q91 A;  4D1E A;  1NP8 A;  4ORB B;  5ER4 X;  2ZKM X;  2JT8 A;  3EKJ A;  2ISD A;  1CB1 A;  3VRQ A;  1SYM A;  4ZCU A;  2LM5 A;  5DKN A;  1ALW A;  2CT9 A;  1U5I A;  2EC6 B;  1DF0 B;  1NX0 A;  2V53 A;  1QLK A;  1H4B A;  2M1U A;  4DRW A;  1DJI A;  2GGM A;  2KI4 C;  4BY4 A;  4ORA B;  4M2O A;  2I18 A;  1EG3 A;  1L2O B;  1SPY A;  3NSL A;  4GBA A;  4YI9 A;  5KSZ A;  2JTT A;  3FWC A;  2CBL A;  1YRU B;  2LE9 B;  2BKI B;  1QJT A;  1IJ6 A;  3TS5 C;  3VRR A;  1WDC C;  1XK4 C;  3ZNI A;  4YI8 A;  2JPT A;  1B47 A;  2BKH B;  1YUU A;  2M29 A;  1J7Q A;  2F3Y A;  1KQM C;  1TNW A;  1G8I A;  2G9B A;  2KFF A;  1XFU O;  1KK8 C;  4GNK B;  2G2B A;  4HRH A;  2M1K B;  4WRI A;  1YUT A;  1AJ4 A;  1CM1 A;  4A4B A;  1HT9 A;  4GGF A;  4M2P A;  1F70 A;  3PFV A;  2AUC A;  2LCP A;  4OCI A;  5F6T A;  3WHT B;  2F2O A;  2KI6 D;  2M8U A;  1MXL C;  3FIA A;  3O2P A;  2FJU B;  1CDM A;  2JZI A;  2L51 A;  1KSM A;  1WRL A;  2EHB A;  1QAS A;  4HRE E;  1JC2 A;  1E8A A;  1IJ5 A;  2ZN8 A;  2BE4 A;  3O78 A;  1SCV A;  1GQM A;  2COL B;  1SMG A;  2H2K A;  3CZT X;  1MQ1 A;  4DCK A;  1B9A A;  4N5X A;  1WRK A;  1PVA A;  2I2R E;  1IH0 A;  1X02 A;  1DTL A;  2K0J A;  5DKR A;  2NLN A;  2PRU A;  3EVU A;  1JFJ A;  2L50 A;  3KEV A;  2KAX A;  3BYA A;  3KF9 A;  1ZFS A;  1OE9 B;  3F45 A;  1DJW A;  1YX7 A;  4WQ3 A;  4MZJ A;  3LK1 A;  2KYF A;  4F0Z B;  3TS5 B;  1Y1A A;  4MN0 A;  4BY5 A;  4YGC B;  1WDC B;  3PAL A;  1LXF C;  1REC A;  2NXQ A;  2PSR A;  3IQQ A;  4C0L A;  1MR8 A;  1DGV A;  3TUY C;  2NCP A;  1KQM B;  1B8L A;  1SBJ A;  2BL0 B;  3JVT C;  4DIR A;  5HLV A;  2JQ6 A;  2MLF C;  1KK8 B;  1MWN A;  5HYD A;  1M46 A;  1CDL A;  3PAT A;  1S3P A;  1SK6 D;  3AAJ A;  4MEW A;  5AFP A;  1G4Y R;  1B7T Z;  1J1E A;  2WCE A;  1FI6 A;  4I5L B;  2KSP A;  2VRG A;  2EGD A;  1M39 A;  2MHH A;  1B8C A;  1CDP A;  1M63 B;  3GK2 A;  2DOQ A;  4GGF C;  4NDC A;  3AAK A;  3AKA A;  3SJS A;  2LC5 A;  1AHR A;  1OZO A;  1NSH A;  2BCA A;  1QLS A;  1CLL A;  3ZWH A;  1DJX A;  2OS8 B;  1QX7 A;  3D10 A;  2LMT A;  3SIB A;  1TOP A;  1CNP A;  1A29 A;  1JUO A;  4YGA A;  3RLZ A;  2Y4Q A;  3DVE A;  3TZ1 A;  1U5I B;  3VRP A;  1YR5 A;  2FOT A;  2P6B B;  3CR5 X;  3SIA A;  4FQO A;  2K7D A;  2LUX A;  4AOM A;  5GQQ C;  1JBA A;  2ZFD A;  1DJY A;  3AKB A;  1JWD A;  1GGZ A;  2JT0 A;  4PAL A;  4PE0 A;  2WC8 A;  4PE1 A;  1B7T Y;  1KQV A;  2B1U A;  2KQY A;  4I5N B;  1SR6 C;  3CGA A;  1YUR A;  4YRU A;  1R2U A;  1FPW A;  2ZN9 A;  2Y5I A;  3H4S E;  1QV1 A;  4MZK A;  3TUY B;  4GFT A;  1NIW A;  1YX8 A;  2JNF A;  3JVT B;  1TRF A;  1MHO A;  4NDD A;  5B8I B;  1SKT A;  3I5H B;  2WOS A;  3BUW B;  2KHN A;  3CS1 A;  1F71 A;  1PK0 D;  5CSF A;  2A4J A;  1OSA A;  1QAT A;  5D7F A;  1MUX A;  5I2L A;  2PAS A;  1GJY A;  4JPZ B;  2JOJ A;  1CDN A;  1CKK A;  2MRD A;  1F8H A;  5TNC A;  1QX5 B;  4CLN A;  1NCY A;  1WY9 A;  4C0K A;  2LVJ A;  3ICB A;  4OR9 B;  4HRG A;  1UHJ A;  2PVB A;  1BR1 B;  4QJ3 B;  5HKY A;  2NCO A;  1EH2 A;  4CID A;  1H8B A;  4NQG A;  1XFX O;  3OX6 A;  1WLM A;  3D0Y A;  1EL4 A;  2LLU A;  1F54 A;  1A2X A;  2LHL A;  4N1G A;  4OV2 A;  2ZNE A;  4L9M A;  1IQ5 A;  1K96 A;  3KHE A;  1CFC A;  1C7V A;  3NSI A;  1DGU A;  2LAN A;  1UP5 A;  4HSZ A;  1JSA A;  4PDZ A;  1D1O A;  1BT6 A;  3BUM B;  3O4Y A;  2CNP A;  4ETO A;  3EVV A;  2ZRS A;  3TDI A;  1BF5 A;  1UUS A;  2JTZ A;  2LHI A;  1CTR A;  4GAO A;  1NX1 A;  1K93 D;  4XJK A;  1OMD A;  3O6B A;  4AQI A;  3I5F C;  1K9K A;  1QX2 A;  5K89 A;  2M0R A;  5JOL A;  4DS7 A;  4MBE A;  1V1F A;  1PUL A;  1OOJ A;  3DVJ A;  4TNC A;  3VRO A;  3EK7 A;  1NWD A;  2M3W A;  3DVM A;  2JUL A;  3CR4 X;  2K2A A;  1XFY O;  3WNX B;  5AXI A;  2M9G A;  1W7J B;  2KYC A;  2L2E A;  3IQO A;  3OP0 A;  3DF0 A;  1FBV A;  3TDZ A;  4DUQ A;  1BG1 A;  2KFH A;  2E6W A;  3HCM A;  1AVS A;  1OMR A;  2KI4 B;  2MAZ A;  2O5G A;  1SCM C;  5AER A;  4NDB A;  1RWY A;  1CFF A;  2E30 A;  1F4Q A;  5BPJ A;  2MLE C;  4PE4 A;  1K9U A;  2KBI A;  2JXC A;  2Y1M A;  2L5X B;  1QVI Z;  1RTP 1;  2FCE A;  2I94 A;  1BR4 B;  1BU3 A;  2NZ0 A;  4M2Q A;  3BOW A;  3OX5 A;  1IGV A;  1A03 A;  2WND A;  1VRK A;  2F8P A;  2JWW A;  3SG4 A;  1QXP A;  1KK7 Z;  2HQ8 A;  1CMF A;  2GV5 A;  2OTG C;  3C1V A;  1MXE A;  1N65 A;  3RM1 A;  2JT3 A;  1CLB A;  1UHK A;  4USL A;  5IBW A;  2MA2 A;  2PMY A;  2ZRT A;  3I5F B;  1WLZ A;  1LKJ A;  1PRW A;  1N2D A;  1S6J A;  2SAS A;  3SG5 A;  2KDH A;  1S6C A;  2HQW A;  1JF2 A;  4QJ4 B;  4I5J A;  1IG5 A;  2KBM A;  3WXA A;  1NPQ A;  1K8U A;  2D8N A;  1IKU A;  3NSK A;  5CSN A;  1WRZ A;  1QVI Y;  4P2Y B;  2GGZ A;  5FYX A;  1TTX A;  1J1D A;  2K7O A;  2QAC A;  4U8D A;  1CFD A;  1K2H A;  3NXA A;  1S6I A;  3BXK A;  3GK4 X;  1KK7 Y;  1FI5 A;  1SCM B;  1F55 A;  1SW8 A;  5AEQ A;  2L98 A;  3PSR A;  4PCW A;  1AJ5 A;  2M49 B;  3GOF A;  5DKQ A;  1EG4 A;  1KCY A;  1ZAC A;  3D0Y B;  1XFW O;  4YGB B;  5ER5 A;  1PVB A;  1QTX A;  1UHI A;  2MBX A;  5KU1 A;  1XYD A;  2M7N A;  3IF7 A;  2LUC A;  1TNQ A;  1B4C A;  3HX4 A;  1YUS A;  1LIN A;  1R6P A;  3SG2 A;  2SCP A;  2L4H A;  4YBH B;  4MRX A;  2LP3 A;  1LA3 A;  1F4O A;  4YGD B;  2IS9 A;  3SG6 A;  1TN4 A;  2JC2 A;  4XJK B;  1S36 A;  2LV7 A;  2PAL A;  2M7L A;  1DJG A;  1NCX A;  1S1E A;  1YRT B;  1ZOT B;  3BUN B;  2WCB A;  4OVN F;  1S26 D;  2LLT A;  2FCD A;  2CXJ A;  1Y6W A;  3PN7 C;  1XFZ O;  1BOC A;  1SL7 A;  4PHM A;  1DMO A;  1TCF A;  1BMO A;  3EKH A;  4IL1 A;  1ALV A;  1YVH A;  2LP2 A;  2CCM A;  2AMI A;  3OB1 B;  2K7C A;  1BJF A;  2HET A;  4UPG A;  1CFP A;  1NYA A;  4N1F A;  1SRA A;  3DF0 B;  1PAL A;  1UHH A;  2KQ6 A;  2LAP A;  2JRF A;  1PSR A;  3GK1 A;  1DJH A;  2LNK A;  1IRJ A;  1KFU L;  3I5I C;  1OQP A;  1TNP A;  1SR6 B;  1ZUZ A;  4JQ0 D;  2ZND A;  3K21 A;  3QRX A;  3PLF B;  5HKZ A;  2JU0 A;  2BCB A;  1AUI B;  1QIV A;  1MF8 B;  4MSP A;  4C0J A;  2H61 A;  3LLE A;  1XFV O;  3BOW B;  3BQ3 A;  1J7R A;  1RRO A;  4QJ5 B;  2MJW B;  1SNL A;  3JTD C;  1UWO A;  4GPL B;  2F2P A; 
#chains in the Genus database with same CATH topology
 1JF0 A;  5EL2 A;  1DC1 A;  3R1P A;  1UUR A;  3TDU A;  2WOR A;  1BLQ A;  2KNE A;  3BUX B;  4R1E A;  2I7A A;  3MSE B;  3LCP C;  2QPT A;  2KPH A;  1XA5 A;  2HPS A;  3EVR A;  4MRY A;  2BEC A;  4OKH A;  1Y1U A;  2L4I A;  3PN7 B;  4P5O E;  1Z4H A;  3S0E A;  1M45 A;  1NUB A;  1AK8 A;  5CPV A;  2R2I A;  4IJ7 A;  3BFA A;  2LVI A;  1ZMZ A;  3R1O A;  5PAL A;  2CTN A;  2JNX A;  3SS4 A;  1JFK A;  1EJ3 A;  1HQV A;  2BL0 C;  4PHJ A;  5I94 A;  1UHN A;  1LA0 A;  1KSO A;  2LMU A;  1OMV A;  2K8M B;  2KGB C;  3CLN A;  1B1G A;  4JD9 A;  2WCM A;  3WHU B;  4E68 A;  1TNX A;  4A4C A;  3E3R A;  5G08 A;  2K2F A;  1SL8 A;  1B8R A;  2LVV A;  1K94 A;  3KO0 A;  2PYQ A;  3DYE A;  1OZS A;  1KFU S;  1KWO C;  3I5I B;  2L2C A;  1A4P A;  1DJZ A;  1NX2 A;  2F33 A;  3EK8 A;  3PM8 A;  5HKW A;  2P71 A;  3SG3 A;  2BBM A;  3A8R A;  1DF0 A;  1QV0 A;  2BE6 A;  1Y0V H;  4MZL A;  4CPV A;  3VGO A;  4CFR A;  1A75 B;  1XVJ A;  1G33 A;  3B87 A;  3CZ2 A;  3D73 A;  2OS8 C;  1YVL A;  3SS3 A;  5D3O A;  2KOT A;  3BUO B;  3DD4 A;  1C7W A;  1S5G Z;  1K90 D;  3JTD B;  2F3Z A;  2H61 C;  2OPO A;  1N0Y A;  4FTG A;  1NCZ A;  2JPO A;  4Q04 A;  5I8N A;  1NX3 A;  1QIW A;  1TIZ A;  3LK0 A;  2GTE A;  4PHK A;  2WCF A;  1Q80 A;  2KFG A;  3CYZ A;  1GGW A;  2WCH A;  3VRN A;  3I5G C;  3CWG A;  1RJV A;  4YGE B;  2KAY A;  2HF5 A;  3OHM B;  1CMG A;  3CTN A;  1M31 A;  1SL9 A;  1KFX L;  2LVK A;  2Y1N A;  3S0F A;  4I5K A;  1IWQ A;  3FE9 A;  1W7I B;  3I5H C;  1DVI A;  1L7Z A;  3FE8 A;  3LL8 B;  5KTY A;  1LS8 A;  1S5G Y;  4FQT A;  3FWB A;  1FF1 A;  4XYN A;  1CLM A;  4F7F A;  1C07 A;  1EXR A;  1KWO B;  5I2Q A;  1DT7 B;  1Y1X A;  1A75 A;  1K9P A;  1RFJ A;  2O60 A;  2Q4U A;  4WQ2 A;  2LLS A;  1CM4 A;  2K61 A;  5J3X A;  1DEK A;  1J55 A;  2AAO A;  2BBN A;  1XO5 A;  4AQJ A;  5I2O A;  2EC6 C;  2OTG B;  1SY9 A;  4GUK A;  2KLE A;  3DXL A;  2KGR A;  3EK4 A;  2L0P A;  1FW4 A;  2BCX A;  1RK9 A;  3DVK A;  5CSI A;  1PSB A;  3A4U B;  1OOI X;  2TN4 A;  5HLO A;  1TCO B;  5JJG A;  3NSO A;  4GGN A;  1L2O C;  3M0W A;  1K95 A;  2KAV A;  3DY9 A;  2JXL A;  5AAN A;  1BOD A;  4KYN A;  1QS7 A;  1XK4 A;  1AP4 A;  4ORC B;  1J7P A;  3I5G B;  1YTZ C;  3S0A A;  4ZCV A;  1J7O A;  4MLW A;  3OB2 B;  4PE7 A;  2QEH A;  4ICB A;  3V2L A;  3CR2 A;  3FS7 A;  3KPX A;  5CSJ A;  1KFX S;  2K7B A;  4JWQ A;  1ODB A;  2WC6 A;  1IQ3 A;  1LVC D;  1V1G A;  2RGI A;  2M97 A;  3SG7 A;  5D69 A;  2KI6 C;  4CFQ A;  3OBV A;  4MVF A;  4PHN A;  2LMV A;  2Q91 A;  4D1E A;  1NP8 A;  3CZ1 A;  4ORB B;  5ER4 X;  2ZKM X;  3D77 A;  2JT8 A;  3EKJ A;  2ISD A;  1CB1 A;  3VRQ A;  2YGU A;  1SYM A;  4ZCU A;  2LM5 A;  3B7A A;  5DKN A;  3RZS A;  1ALW A;  2CT9 A;  1U5I A;  2EC6 B;  1DF0 B;  1NX0 A;  2V53 A;  3UO9 A;  1QLK A;  1H4B A;  2M1U A;  4DRW A;  1DJI A;  2GGM A;  2KI4 C;  4BY4 A;  4ORA B;  4M2O A;  2I18 A;  1EG3 A;  1L2O B;  4INW A;  1SPY A;  3NSL A;  4GBA A;  4YI9 A;  5KSZ A;  2JTT A;  3FWC A;  2CBL A;  1YRU B;  2LE9 B;  2BKI B;  1QJT A;  1IJ6 A;  3TS5 C;  3CAB A;  3VRR A;  1WDC C;  1XK4 C;  1XFR A;  3ZNI A;  4YI8 A;  2JPT A;  1B47 A;  3UNW A;  1T14 A;  2BKH B;  1YUU A;  2M29 A;  1J7Q A;  2F3Y A;  1KQM C;  2P70 A;  1TNW A;  1G8I A;  2G9B A;  2KFF A;  1XFU O;  1KK8 C;  4GNK B;  2G2B A;  4HRH A;  1P28 A;  2M1K B;  4WRI A;  1YUT A;  1AJ4 A;  1CM1 A;  4A4B A;  1HT9 A;  4GGF A;  4M2P A;  3NHI A;  1F70 A;  3PFV A;  2AUC A;  2LCP A;  4OCI A;  5F6T A;  3WHT B;  2F2O A;  2KI6 D;  2M8U A;  1MXL C;  3FIA A;  3O2P A;  2FJU B;  1CDM A;  3CDN A;  2JZI A;  2L51 A;  1TUZ A;  1KSM A;  1WRL A;  2EHB A;  1QAS A;  3CZ0 A;  3B6X A;  4HRE E;  1JC2 A;  1E8A A;  1IJ5 A;  2ZN8 A;  2BE4 A;  3O78 A;  1SCV A;  1GQM A;  2COL B;  1SMG A;  2H2K A;  1C3Z A;  3CZT X;  1MQ1 A;  4DCK A;  1B9A A;  4N5X A;  1WRK A;  1PVA A;  2I2R E;  1IH0 A;  1X02 A;  2H8V A;  1DTL A;  2K0J A;  5DKR A;  2NLN A;  2PRU A;  3EVU A;  1JFJ A;  2L50 A;  3KEV A;  2KAX A;  3BYA A;  3KF9 A;  1ZFS A;  2WCL A;  1W9Z A;  1OE9 B;  3F45 A;  1DJW A;  1YX7 A;  2QEV A;  4WQ3 A;  4MZJ A;  3LK1 A;  2KYF A;  3EG5 B;  4F0Z B;  3TS5 B;  1Y1A A;  4MN0 A;  4BY5 A;  4YGC B;  1WDC B;  3PAL A;  1LXF C;  1REC A;  2NXQ A;  2PSR A;  3IQQ A;  4C0L A;  1MR8 A;  1DGV A;  3TUY C;  2NCP A;  1KQM B;  1B8L A;  1SBJ A;  2BL0 B;  3JVT C;  4DIR A;  5HLV A;  2JQ6 A;  2MLF C;  1KK8 B;  1MWN A;  5HYD A;  1M46 A;  1CDL A;  3PAT A;  1S3P A;  1SK6 D;  3AAJ A;  3L4A A;  4MEW A;  5AFP A;  1G4Y R;  1B7T Z;  1J1E A;  2WCE A;  1FI6 A;  4I5L B;  2KSP A;  2VRG A;  2EGD A;  1M39 A;  2MHH A;  1B8C A;  1CDP A;  1M63 B;  3FE6 A;  2DOQ A;  3GK2 A;  4GGF C;  3AAK A;  3AKA A;  4NDC A;  3S0D A;  3QME A;  3SJS A;  2LC5 A;  1AHR A;  1OZO A;  1NSH A;  3B86 A;  2BCA A;  1QLS A;  1CLL A;  2WCK A;  3ZWH A;  1DJX A;  2OS8 B;  1QX7 A;  3D10 A;  2KLD A;  2LMT A;  3SIB A;  1TOP A;  1CNP A;  1A29 A;  1JUO A;  4YGA A;  3RLZ A;  3S0G A;  3SS5 A;  2Y4Q A;  3DVE A;  3TZ1 A;  1U5I B;  3VRP A;  1YR5 A;  2FOT A;  2P6B B;  3CR5 X;  3SIA A;  4FQO A;  2K7D A;  2LUX A;  4AOM A;  5GQQ C;  1JBA A;  2ZFD A;  1DJY A;  3AKB A;  1JWD A;  1GGZ A;  2JT0 A;  3O4X A;  4PAL A;  4PE0 A;  2WC8 A;  4PE1 A;  1B7T Y;  1KQV A;  2B1U A;  2KQY A;  4I5N B;  1SR6 C;  3CGA A;  1OOF A;  1YUR A;  4YRU A;  1R2U A;  1FPW A;  2ZN9 A;  2Y5I A;  3H4S E;  5DIC A;  2WCJ A;  1QV1 A;  1TUJ A;  4MZK A;  3TUY B;  1OW4 A;  4GFT A;  1NIW A;  1YX8 A;  2JNF A;  3JVT B;  1TRF A;  1MHO A;  4NDD A;  5B8I B;  1SKT A;  3I5H B;  3S0B A;  2WOS A;  3BUW B;  2KHN A;  3CS1 A;  4PT1 A;  1F71 A;  1PK0 D;  5CSF A;  2A4J A;  1OSA A;  3OGN A;  1QAT A;  5D7F A;  1MUX A;  5I2L A;  3D76 A;  2PAS A;  1GJY A;  3D75 A;  4JPZ B;  2JOJ A;  1SSE B;  1CDN A;  1CKK A;  3IVT A;  2MRD A;  1F8H A;  3B88 A;  5TNC A;  1QX5 B;  4CLN A;  1NCY A;  1WY9 A;  3K1E A;  4C0K A;  2LVJ A;  3ICB A;  4OR9 B;  4HRG A;  1UHJ A;  2PVB A;  1IIO A;  3R72 A;  1BR1 B;  4QJ3 B;  5HKY A;  2NCO A;  2L5Y A;  3VB1 A;  3L4L A;  1EH2 A;  4CID A;  1H8B A;  4NQG A;  1XFX O;  1TWO A;  3OX6 A;  1WLM A;  3D0Y A;  1EL4 A;  5HL1 A;  2LLU A;  3BJH A;  1F54 A;  1A2X A;  2LHL A;  4N1G A;  4OV2 A;  2ZNE A;  4L9M A;  1IQ5 A;  1K96 A;  3KHE A;  1CFC A;  1C7V A;  3NSI A;  1DGU A;  2LAN A;  1UP5 A;  4HSZ A;  1JSA A;  4PDZ A;  1D1O A;  1BT6 A;  3BUM B;  3O4Y A;  2CNP A;  4ETO A;  3EVV A;  2ZRS A;  3TDI A;  1BF5 A;  1UUS A;  2JTZ A;  1ORG A;  2LHI A;  1CTR A;  4GAO A;  1NX1 A;  1K93 D;  2ERB A;  3NGV A;  5FI2 A;  4XJK A;  1OMD A;  3O6B A;  4AQI A;  3I5F C;  1K9K A;  1QX2 A;  5K89 A;  2M0R A;  5JOL A;  4DS7 A;  4MBE A;  1V1F A;  1PUL A;  1OOJ A;  3DVJ A;  4TNC A;  3VRO A;  3EK7 A;  1NWD A;  2M3W A;  1QWV A;  3DVM A;  2JUL A;  3CR4 X;  2K2A A;  1XFY O;  3WNX B;  3PM2 A;  5AXI A;  2M9G A;  1OOG A;  1W7J B;  2KYC A;  2L2E A;  3IQO A;  3OP0 A;  3DF0 A;  1FBV A;  3TDZ A;  4DUQ A;  1BG1 A;  3BFB A;  2KFH A;  2E6W A;  3Q8I A;  3HCM A;  1AVS A;  1OMR A;  2KI4 B;  2MAZ A;  2O5G A;  1SCM C;  5AER A;  4NDB A;  1RWY A;  1CFF A;  2E30 A;  1Z2C B;  1F4Q A;  5BPJ A;  2MLE C;  4PE4 A;  1K9U A;  2KBI A;  2JXC A;  2Y1M A;  2L5X B;  1QVI Z;  1RTP 1;  2FCE A;  2I94 A;  1BR4 B;  1BU3 A;  2NZ0 A;  4M2Q A;  3BOW A;  3OX5 A;  1IGV A;  1A03 A;  2WND A;  1VRK A;  2F8P A;  2JWW A;  3SG4 A;  1QXP A;  1KK7 Z;  2HQ8 A;  1CMF A;  2GV5 A;  2OTG C;  3C1V A;  4JKT A;  1MXE A;  1N65 A;  3RM1 A;  2JT3 A;  1CLB A;  1UHK A;  3D78 A;  4USL A;  5IBW A;  2MA2 A;  2PMY A;  2ZRT A;  3I5F B;  1WLZ A;  1LKJ A;  1PRW A;  1N2D A;  1S6J A;  2SAS A;  3SG5 A;  2KDH A;  1S6C A;  2HQW A;  1JF2 A;  4QJ4 B;  2BAP A;  4I5J A;  1IG5 A;  2KBM A;  3WXA A;  1NPQ A;  1K8U A;  2D8N A;  1IKU A;  3NSK A;  5CSN A;  3PJI A;  1WRZ A;  1QVI Y;  4P2Y B;  2GGZ A;  5FYX A;  1TTX A;  1J1D A;  2K7O A;  2QAC A;  4U8D A;  1CFD A;  1K2H A;  3NXA A;  1S6I A;  3BXK A;  3GK4 X;  3R1V A;  1KK7 Y;  1FI5 A;  1SCM B;  1F55 A;  1SW8 A;  4OZD A;  5AEQ A;  2L98 A;  3PSR A;  4PCW A;  1AJ5 A;  2M49 B;  3GOF A;  5DKQ A;  1GM0 A;  1EG4 A;  1KCY A;  1ZAC A;  3D0Y B;  1XFW O;  3BFH A;  4YGB B;  5ER5 A;  1PVB A;  1QTX A;  1UHI A;  2MBX A;  5KU1 A;  1OOH A;  1XYD A;  2M7N A;  3IF7 A;  2LUC A;  1TNQ A;  1B4C A;  3HX4 A;  1YUS A;  2WC5 A;  1LIN A;  3N7H A;  1R6P A;  3SG2 A;  2SCP A;  2L4H A;  2FJY A;  4YBH B;  4MRX A;  2LP3 A;  1LA3 A;  1F4O A;  4YGD B;  2IS9 A;  3SG6 A;  1TN4 A;  2JC2 A;  4XJK B;  1S36 A;  2LV7 A;  2PAL A;  2BNX A;  2M7L A;  1DJG A;  2QEB A;  1NCX A;  1S1E A;  1YRT B;  1ZOT B;  1DEL A;  2WCB A;  3BUN B;  1S26 D;  4OVN F;  1C3Y A;  2LLT A;  2FCD A;  2CXJ A;  1Y6W A;  3PN7 C;  1XFZ O;  1BOC A;  1DQE A;  1SL7 A;  4PHM A;  1DMO A;  1TCF A;  1BMO A;  3EKH A;  4IL1 A;  1ALV A;  1YVH A;  2LP2 A;  2CCM A;  2AMI A;  3OB1 B;  2K7C A;  1BJF A;  2HET A;  4UPG A;  4INX A;  1CFP A;  2K60 A;  1NYA A;  4N1F A;  1SRA A;  3DF0 B;  2PQL A;  5FI6 A;  1PAL A;  1UHH A;  2KQ6 A;  2QDI A;  3NHT A;  2LAP A;  5FI7 A;  3L47 A;  2JRF A;  1PSR A;  3GK1 A;  1DJH A;  2LNK A;  1IRJ A;  1KFU L;  3I5I C;  1OQP A;  1TNP A;  1SR6 B;  1ZUZ A;  3DZT A;  2ZND A;  4JQ0 D;  2QEO A;  3K21 A;  3QRX A;  3PLF B;  5HKZ A;  2JU0 A;  2BCB A;  1AUI B;  1QIV A;  1MF8 B;  4MSP A;  4C0J A;  2H61 A;  3LLE A;  1XFV O;  3D74 A;  3BOW B;  3BQ3 A;  1J7R A;  1RRO A;  4QJ5 B;  2MJW B;  1SNL A;  3JTD C;  1UWO A;  4GPL B;  2F2P A; 
#chains in the Genus database with same CATH homology
 1JF0 A;  1UUR A;  3TDU A;  2WOR A;  1BLQ A;  2KNE A;  3BUX B;  4R1E A;  2I7A A;  3MSE B;  3LCP C;  2QPT A;  1XA5 A;  2HPS A;  3EVR A;  4MRY A;  2BEC A;  4OKH A;  1Y1U A;  2L4I A;  3PN7 B;  4P5O E;  1M45 A;  1NUB A;  1AK8 A;  5CPV A;  2R2I A;  2LVI A;  1ZMZ A;  5PAL A;  2CTN A;  2JNX A;  1JFK A;  1EJ3 A;  1HQV A;  2BL0 C;  4PHJ A;  1UHN A;  1LA0 A;  1KSO A;  2LMU A;  1OMV A;  2K8M B;  2KGB C;  3CLN A;  1B1G A;  3WHU B;  4E68 A;  1TNX A;  4A4C A;  3E3R A;  5G08 A;  2K2F A;  1SL8 A;  1B8R A;  2LVV A;  1K94 A;  3KO0 A;  1OZS A;  1KFU S;  1KWO C;  3I5I B;  1A4P A;  1DJZ A;  1NX2 A;  2F33 A;  3EK8 A;  3PM8 A;  5HKW A;  3SG3 A;  2BBM A;  3A8R A;  1DF0 A;  1QV0 A;  2BE6 A;  1Y0V H;  4MZL A;  4CPV A;  3VGO A;  4CFR A;  1A75 B;  1XVJ A;  1G33 A;  2OS8 C;  1YVL A;  2KOT A;  3BUO B;  3DD4 A;  1C7W A;  1S5G Z;  1K90 D;  3JTD B;  2F3Z A;  2H61 C;  2OPO A;  1N0Y A;  4FTG A;  1NCZ A;  4Q04 A;  5I8N A;  1NX3 A;  1QIW A;  1TIZ A;  3LK0 A;  4PHK A;  2WCF A;  1Q80 A;  2KFG A;  1GGW A;  3VRN A;  3I5G C;  3CWG A;  1RJV A;  4YGE B;  2KAY A;  2HF5 A;  3OHM B;  1CMG A;  3CTN A;  1M31 A;  1SL9 A;  1KFX L;  2LVK A;  2Y1N A;  4I5K A;  1IWQ A;  1W7I B;  3I5H C;  1DVI A;  1L7Z A;  3LL8 B;  5KTY A;  1S5G Y;  3FWB A;  1FF1 A;  4XYN A;  1CLM A;  1C07 A;  1EXR A;  1KWO B;  5I2Q A;  1DT7 B;  1Y1X A;  1A75 A;  1K9P A;  1RFJ A;  2O60 A;  2Q4U A;  4WQ2 A;  2LLS A;  1CM4 A;  2K61 A;  5J3X A;  1J55 A;  2AAO A;  2BBN A;  1XO5 A;  4AQJ A;  5I2O A;  2EC6 C;  2OTG B;  1SY9 A;  4GUK A;  2KGR A;  3EK4 A;  2L0P A;  1FW4 A;  2BCX A;  1RK9 A;  3DVK A;  5CSI A;  1PSB A;  3A4U B;  2TN4 A;  5HLO A;  1TCO B;  5JJG A;  3NSO A;  4GGN A;  1L2O C;  3M0W A;  1K95 A;  2KAV A;  2JXL A;  5AAN A;  1BOD A;  1QS7 A;  1XK4 A;  1AP4 A;  4ORC B;  1J7P A;  3I5G B;  1YTZ C;  4ZCV A;  1J7O A;  4MLW A;  3OB2 B;  4PE7 A;  4ICB A;  3CR2 A;  3FS7 A;  3KPX A;  5CSJ A;  1KFX S;  2K7B A;  4JWQ A;  1ODB A;  1IQ3 A;  1LVC D;  1V1G A;  2RGI A;  2M97 A;  3SG7 A;  5D69 A;  2KI6 C;  4CFQ A;  4MVF A;  4PHN A;  2LMV A;  2Q91 A;  4D1E A;  1NP8 A;  4ORB B;  5ER4 X;  2ZKM X;  2JT8 A;  3EKJ A;  2ISD A;  1CB1 A;  3VRQ A;  1SYM A;  4ZCU A;  2LM5 A;  5DKN A;  1ALW A;  2CT9 A;  1U5I A;  2EC6 B;  1DF0 B;  1NX0 A;  2V53 A;  1QLK A;  1H4B A;  2M1U A;  4DRW A;  1DJI A;  2GGM A;  2KI4 C;  4BY4 A;  4ORA B;  4M2O A;  2I18 A;  1EG3 A;  1L2O B;  1SPY A;  3NSL A;  4GBA A;  4YI9 A;  5KSZ A;  2JTT A;  3FWC A;  2CBL A;  1YRU B;  2LE9 B;  2BKI B;  1QJT A;  1IJ6 A;  3TS5 C;  3VRR A;  1WDC C;  1XK4 C;  3ZNI A;  4YI8 A;  2JPT A;  1B47 A;  2BKH B;  1YUU A;  2M29 A;  1J7Q A;  2F3Y A;  1KQM C;  1TNW A;  1G8I A;  2G9B A;  2KFF A;  1XFU O;  1KK8 C;  4GNK B;  2G2B A;  4HRH A;  2M1K B;  4WRI A;  1YUT A;  1AJ4 A;  1CM1 A;  4A4B A;  1HT9 A;  4GGF A;  4M2P A;  1F70 A;  3PFV A;  2AUC A;  2LCP A;  4OCI A;  5F6T A;  3WHT B;  2F2O A;  2KI6 D;  2M8U A;  1MXL C;  3FIA A;  3O2P A;  2FJU B;  1CDM A;  2JZI A;  2L51 A;  1KSM A;  1WRL A;  2EHB A;  1QAS A;  4HRE E;  1JC2 A;  1E8A A;  1IJ5 A;  2ZN8 A;  2BE4 A;  3O78 A;  1SCV A;  1GQM A;  2COL B;  1SMG A;  2H2K A;  3CZT X;  1MQ1 A;  4DCK A;  1B9A A;  4N5X A;  1WRK A;  1PVA A;  2I2R E;  1IH0 A;  1X02 A;  1DTL A;  2K0J A;  5DKR A;  2NLN A;  2PRU A;  3EVU A;  1JFJ A;  2L50 A;  3KEV A;  2KAX A;  3BYA A;  3KF9 A;  1ZFS A;  1OE9 B;  3F45 A;  1DJW A;  1YX7 A;  4WQ3 A;  4MZJ A;  3LK1 A;  2KYF A;  4F0Z B;  3TS5 B;  1Y1A A;  4MN0 A;  4BY5 A;  4YGC B;  1WDC B;  3PAL A;  1LXF C;  1REC A;  2NXQ A;  2PSR A;  3IQQ A;  4C0L A;  1MR8 A;  1DGV A;  3TUY C;  2NCP A;  1KQM B;  1B8L A;  1SBJ A;  2BL0 B;  3JVT C;  4DIR A;  5HLV A;  2JQ6 A;  2MLF C;  1KK8 B;  1MWN A;  5HYD A;  1M46 A;  1CDL A;  3PAT A;  1S3P A;  1SK6 D;  3AAJ A;  4MEW A;  5AFP A;  1G4Y R;  1B7T Z;  1J1E A;  2WCE A;  1FI6 A;  4I5L B;  2KSP A;  2VRG A;  2EGD A;  1M39 A;  2MHH A;  1B8C A;  1CDP A;  1M63 B;  3GK2 A;  2DOQ A;  4GGF C;  4NDC A;  3AAK A;  3AKA A;  3SJS A;  2LC5 A;  1AHR A;  1OZO A;  1NSH A;  2BCA A;  1QLS A;  1CLL A;  3ZWH A;  1DJX A;  2OS8 B;  1QX7 A;  3D10 A;  2LMT A;  3SIB A;  1TOP A;  1CNP A;  1A29 A;  1JUO A;  4YGA A;  3RLZ A;  2Y4Q A;  3DVE A;  3TZ1 A;  1U5I B;  3VRP A;  1YR5 A;  2FOT A;  2P6B B;  3CR5 X;  3SIA A;  4FQO A;  2K7D A;  2LUX A;  4AOM A;  5GQQ C;  1JBA A;  2ZFD A;  1DJY A;  3AKB A;  1JWD A;  1GGZ A;  2JT0 A;  4PAL A;  4PE0 A;  2WC8 A;  4PE1 A;  1B7T Y;  1KQV A;  2B1U A;  2KQY A;  4I5N B;  1SR6 C;  3CGA A;  1YUR A;  4YRU A;  1R2U A;  1FPW A;  2ZN9 A;  2Y5I A;  3H4S E;  1QV1 A;  4MZK A;  3TUY B;  4GFT A;  1NIW A;  1YX8 A;  2JNF A;  3JVT B;  1TRF A;  1MHO A;  4NDD A;  5B8I B;  1SKT A;  3I5H B;  2WOS A;  3BUW B;  2KHN A;  3CS1 A;  1F71 A;  1PK0 D;  5CSF A;  2A4J A;  1OSA A;  1QAT A;  5D7F A;  1MUX A;  5I2L A;  2PAS A;  1GJY A;  4JPZ B;  2JOJ A;  1CDN A;  1CKK A;  2MRD A;  1F8H A;  5TNC A;  1QX5 B;  4CLN A;  1NCY A;  1WY9 A;  4C0K A;  2LVJ A;  3ICB A;  4OR9 B;  4HRG A;  1UHJ A;  2PVB A;  1BR1 B;  4QJ3 B;  5HKY A;  2NCO A;  1EH2 A;  4CID A;  1H8B A;  4NQG A;  1XFX O;  3OX6 A;  1WLM A;  3D0Y A;  1EL4 A;  2LLU A;  1F54 A;  1A2X A;  2LHL A;  4N1G A;  4OV2 A;  2ZNE A;  4L9M A;  1IQ5 A;  1K96 A;  3KHE A;  1CFC A;  1C7V A;  3NSI A;  1DGU A;  2LAN A;  1UP5 A;  4HSZ A;  1JSA A;  4PDZ A;  1D1O A;  1BT6 A;  3BUM B;  3O4Y A;  2CNP A;  4ETO A;  3EVV A;  2ZRS A;  3TDI A;  1BF5 A;  1UUS A;  2JTZ A;  2LHI A;  1CTR A;  4GAO A;  1NX1 A;  1K93 D;  4XJK A;  1OMD A;  3O6B A;  4AQI A;  3I5F C;  1K9K A;  1QX2 A;  5K89 A;  2M0R A;  5JOL A;  4DS7 A;  4MBE A;  1V1F A;  1PUL A;  1OOJ A;  3DVJ A;  4TNC A;  3VRO A;  3EK7 A;  1NWD A;  2M3W A;  3DVM A;  2JUL A;  3CR4 X;  2K2A A;  1XFY O;  3WNX B;  5AXI A;  2M9G A;  1W7J B;  2KYC A;  2L2E A;  3IQO A;  3OP0 A;  3DF0 A;  1FBV A;  3TDZ A;  4DUQ A;  1BG1 A;  2KFH A;  2E6W A;  3HCM A;  1AVS A;  1OMR A;  2KI4 B;  2MAZ A;  2O5G A;  1SCM C;  5AER A;  4NDB A;  1RWY A;  1CFF A;  2E30 A;  1F4Q A;  5BPJ A;  2MLE C;  4PE4 A;  1K9U A;  2KBI A;  2JXC A;  2Y1M A;  2L5X B;  1QVI Z;  1RTP 1;  2FCE A;  2I94 A;  1BR4 B;  1BU3 A;  2NZ0 A;  4M2Q A;  3BOW A;  3OX5 A;  1IGV A;  1A03 A;  2WND A;  1VRK A;  2F8P A;  2JWW A;  3SG4 A;  1QXP A;  1KK7 Z;  2HQ8 A;  1CMF A;  2GV5 A;  2OTG C;  3C1V A;  1MXE A;  1N65 A;  3RM1 A;  2JT3 A;  1CLB A;  1UHK A;  4USL A;  5IBW A;  2MA2 A;  2PMY A;  2ZRT A;  3I5F B;  1WLZ A;  1LKJ A;  1PRW A;  1N2D A;  1S6J A;  2SAS A;  3SG5 A;  2KDH A;  1S6C A;  2HQW A;  1JF2 A;  4QJ4 B;  4I5J A;  1IG5 A;  2KBM A;  3WXA A;  1NPQ A;  1K8U A;  2D8N A;  1IKU A;  3NSK A;  5CSN A;  1WRZ A;  1QVI Y;  4P2Y B;  2GGZ A;  5FYX A;  1TTX A;  1J1D A;  2K7O A;  2QAC A;  4U8D A;  1CFD A;  1K2H A;  3NXA A;  1S6I A;  3BXK A;  3GK4 X;  1KK7 Y;  1FI5 A;  1SCM B;  1F55 A;  1SW8 A;  5AEQ A;  2L98 A;  3PSR A;  4PCW A;  1AJ5 A;  2M49 B;  3GOF A;  5DKQ A;  1EG4 A;  1KCY A;  1ZAC A;  3D0Y B;  1XFW O;  4YGB B;  5ER5 A;  1PVB A;  1QTX A;  1UHI A;  2MBX A;  5KU1 A;  1XYD A;  2M7N A;  3IF7 A;  2LUC A;  1TNQ A;  1B4C A;  3HX4 A;  1YUS A;  1LIN A;  1R6P A;  3SG2 A;  2SCP A;  2L4H A;  4YBH B;  4MRX A;  2LP3 A;  1LA3 A;  1F4O A;  4YGD B;  2IS9 A;  3SG6 A;  1TN4 A;  2JC2 A;  4XJK B;  1S36 A;  2LV7 A;  2PAL A;  2M7L A;  1DJG A;  1NCX A;  1S1E A;  1YRT B;  1ZOT B;  3BUN B;  2WCB A;  4OVN F;  1S26 D;  2LLT A;  2FCD A;  2CXJ A;  1Y6W A;  3PN7 C;  1XFZ O;  1BOC A;  1SL7 A;  4PHM A;  1DMO A;  1TCF A;  1BMO A;  3EKH A;  4IL1 A;  1ALV A;  1YVH A;  2LP2 A;  2CCM A;  2AMI A;  3OB1 B;  2K7C A;  1BJF A;  2HET A;  4UPG A;  1CFP A;  1NYA A;  4N1F A;  1SRA A;  3DF0 B;  1PAL A;  1UHH A;  2KQ6 A;  2LAP A;  2JRF A;  1PSR A;  3GK1 A;  1DJH A;  2LNK A;  1IRJ A;  1KFU L;  3I5I C;  1OQP A;  1TNP A;  1SR6 B;  1ZUZ A;  4JQ0 D;  2ZND A;  3K21 A;  3QRX A;  3PLF B;  5HKZ A;  2JU0 A;  2BCB A;  1AUI B;  1QIV A;  1MF8 B;  4MSP A;  4C0J A;  2H61 A;  3LLE A;  1XFV O;  3BOW B;  3BQ3 A;  1J7R A;  1RRO A;  4QJ5 B;  2MJW B;  1SNL A;  3JTD C;  1UWO A;  4GPL B;  2F2P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...