2K7BA

Nmr structure of mg2+-bound cabp1 n-domain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
76
structure length
76
Chain Sequence
DRSLRPEEIEELREAFREFDKDKDGYINCRDLGNCMRTMGYMPTEMELIELSQQINMNLGGHVDFDDFVELMGPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Calcium-binding protein 1
publication title NMR structure of Mg2+-bound CaBP1 N-domain
rcsb
source organism Homo sapiens
total genus 14
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2008-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2k7bA00
5GQQC 1BOCA 2DOQA 2LVIA 1ZUZA 2SCPA 2JT3A 3AAJA 1RTP1 2Y5IA 4M2QA 1NCYA 2R2IA 1KSMA 2LVVA 3DD4A 3SJSA 1K2HA 5BPJA 3KPXA 3AKAA 1KQVA 1UHJA 1AJ5A 1DTLA 4E68A 1CNPA 1K94A 1YVHA 1OMRA 3M0WA 4MBEA 1EXRA 2KDHA 3CR5X 2KQYA 5IBWA 2LAPA 1XK4C 1KK7Y 1K96A 1C7WA 1N65A 2Y4QA 3BXKA 1ZOTB 2CXJA 2L4IA 3I5FB 4USLA 1DJYA 1IRJA 4BY4A 3SG5A 4JQ0D 2M29A 1J7RA 4WQ2A 1F71A 2LUCA 1RFJA 2SASA 1CFFA 3O2PA 3WNXB 1WDCC 3F45A 5I2QA 1NX0A 1V1FA 2M7NA 4GGFA 2F8PA 4YGEB 1SNLA 3SG6A 1M45A 2M97A 3CR2A 3KO0A 2JTTA 4MN0A 5AERA 2HETA 2JC2A 1Y6WA 5K89A 2BCAA 1YR5A 1FPWA 1UHIA 4BY5A 2MBXA 2JU0A 1FI6A 2I2RE 1H4BA 1CLBA 2JXCA 1S6CA 2BBNA 3BOWB 3SG2A 3VRRA 1TTXA 1J1DA 4XJKB 1KCYA 2O5GA 1IQ3A 4ORAB 1XVJA 2F3YA 1KQMC 1M46A 1U5IA 4MZLA 3I5HC 2PMYA 2BECA 2K2FA 4OVNF 3SG4A 3LCPC 4XYNA 1WRLA 1F54A 1JUOA 4TNCA 1SR6B 3LK0A 5G08A 1A4PA 1UHKA 2M49B 2H61C 1CM1A 3RM1A 4PHNA 2KAXA 2TN4A 1K8UA 1OZOA 5CSIA 2O60A 2WORA 3CTNA 1PVBA 3MSEB 4HREE 2CBLA 3QRXA 2BKHB 2KFGA 3LLEA 1R6PA 1J7PA 1UHNA 1B8RA 1AHRA 1B8CA 1QVIZ 2LE9B 4C0LA 1MQ1A 1VRKA 3DF0A 4OCIA 4A4CA 1BR1B 1OZSA 1QX5B 1CFCA 1S1EA 1CDMA 1DJXA 1RECA 1SYMA 4DIRA 1YRUB 1L7ZA 1NIWA 3EVRA 2M1UA 5JJGA 3HCMA 1B47A 1QIVA 3SIBA 1CDPA 2Y1NA 3EVUA 3PN7B 2KHNA 2L2EA 2KFFA 5CSJA 3VROA 1F55A 1XFYO 2ZN8A 3ZWHA 4C0KA 2EC6C 2LANA 3HX4A 2F33A 5CPVA 2VRGA 1K90D 1B9AA 2MRDA 3DVJA 4ORCB 1KK8B 1WY9A 1XO5A 2K7OA 4YGCB 1YVLA 5HYDA 1CTRA 1NWDA 2LVKA 1S26D 2KSPA 4ICBA 5HKWA 1ZMZA 2LNKA 1QATA 1K9PA 1SL8A 2KGRA 4AQIA 2BL0B 4ZCVA 2ZNDA 4UPGA 3TDZA 2WC8A 3C1VA 1UP5A 1A2XA 1DJWA 2M3WA 1BODA 1S6IA 1CDLA 4I5LB 1PULA 4AOMA 1U5IB 1YTZC 4OR9B 1TIZA 3A8RA 4PCWA 5JOLA 5D69A 1LKJA 1QS7A 1OMVA 2BBMA 1R2UA 2KI6C 1XK4A 4Q04A 3TDIA 1B7TY 3KEVA 2E6WA 1B4CA 2BE4A 5HLVA 2JXLA 4HRGA 2MA2A 1J7OA 2KI4C 2M7LA 1BF5A 3TS5C 3D10A 2CT9A 2L0PA 2JOJA 1RWYA 2KI6D 2E30A 3BQ3A 1KWOC 1SPYA 4YRUA 1Y1AA 2LCPA 3DF0B 1IQ5A 3IQOA 3NSOA 1CLLA 3I5GC 4I5NB 3FIAA 3NSLA 1NCZA 3LL8B 2JNXA 1XA5A 1BG1A 4WQ3A 1CDNA 1S5GZ 4IL1A 1E8AA 1LVCD 3OX6A 4DRWA 3OB2B 1DF0A 2FCDA 1ZACA 2OS8C 2NLNA 1DT7B 3I5FC 1OE9B 3BUWB 3H4SE 1NP8A 4GBAA 1AUIB 3OHMB 1HQVA 2JZIA 1G33A 1F8HA 4P5OE 1MWNA 1QVIY 2JNFA 3GK2A 1GGZA 3E3RA 3NXAA 4R1EA 2KQ6A 1K9UA 4PALA 1LXFC 4A4BA 3PLFB 1MF8B 1NSHA 2BCBA 2H61A 2MHHA 1UURA 1SCVA 4PE7A 1GQMA 2PVBA 2OPOA 5CSNA 4CIDA 1MHOA 5D7FA 2QPTA 4PDZA 2HF5A 1PRWA 2HQ8A 4F0ZB 1M63B 5PALA 2LMTA 1IJ5A 2KBMA 1SCMC 1SK6D 2Y1MA 4M2OA 2WCBA 1JF2A 1BR4B 4ORBB 2K7BA 1V1GA 3BUNB 1M31A 1AK8A 3TUYC 1YUSA 4MEWA 1FW4A 2V53A 2OTGC 4N1FA 1CB1A 1MR8A 2FCEA 3DVEA 3BYAA 5HKZA 1QV0A 4MRYA 1EG4A 2CNPA 1XFXO 1WDCB 1QIWA 1RJVA 1SW8A 4MLWA 3CGAA 1NPQA 4YGDB 5AFPA 2EGDA 1TOPA 5FYXA 1OQPA 4MZJA 2ZRTA 1DF0B 2IS9A 2JPTA 3EK7A 2KYCA 3I5IC 2JWWA 1EH2A 2ZFDA 1XFZO 4PHMA 2BKIB 2MJWB 4OKHA 1JF0A 2I7AA 1DJHA 3O6BA 2QACA 4CPVA 2M9GA 1S3PA 2ZRSA 1CFDA 2NCOA 1DMOA 1KFXL 1KQMB 2LP3A 2JT8A 2Q4UA 2LV7A 3I5HB 4MSPA 1C07A 2LC5A 2KBIA 3AAKA 4L9MA 4P2YB 4DUQA 1SY9A 1L2OC 2KNEA 1X02A 2F3ZA 1NYAA 2LLSA 1S5GY 1PSBA 1KK7Z 1Y1UA 3TZ1A 2WCFA 1JWDA 4YI9A 5AEQA 5AANA 5KU1A 5AXIA 1DJGA 3AKBA 1SRAA 3FS7A 1BT6A 3GK1A 4NQGA 3CLNA 1QV1A 4GFTA 2WOSA 4PHKA 3VRQA 3ZNIA 2GGZA 1D1OA 3ICBA 3PALA 2G2BA 4YGAA 1GGWA 2BE6A 3WXAA 2AAOA 1YX8A 1CM4A 2PSRA 3BUMB 3LK1A 4JPZB 1K95A 5KSZA 2HQWA 2KAVA 3EVVA 3JTDC 1NX3A 2WCEA 1NX1A 1FI5A 2KOTA 3VGOA 4GNKB 2RGIA 1FF1A 1XYDA 1BU3A 3PATA 3FWCA 1WLZA 2EC6B 5KTYA 1TRFA 2L4HA 5DKNA 3DVMA 4PE1A 1G8IA 1HT9A 1PSRA 1TNWA 3JVTC 5HLOA 1EJ3A 1UHHA 1BLQA 1ALVA 2L51A 1DVIA 1S6JA 5TNCA 1RK9A 1IH0A 1TNPA 1XFUO 3D0YA 1WLMA 4PE4A 2B1UA 2PRUA 1FBVA 3OP0A 1QLSA 3CWGA 2H2KA 2JULA 4FTGA 2ZN9A 2KFHA 4C0JA 1SMGA 1N0YA 5F6TA 4NDBA 1QXPA 3BUXB 1JC2A 5ER5A 5DKRA 3NSIA 2MLFC 2CTNA 1A03A 1ODBA 2K8MB 2LLUA 1CMFA 1WRZA 1KFUS 2HPSA 1G4YR 3FWBA 4YBHB 2KI4B 4GPLB 2EHBA 2LP2A 3TS5B 4M2PA 1YUUA 1YURA 2KAYA 1IKUA 2K61A 4DCKA 1KWOB 1XFWO 2K7CA 4YGBB 3TDUA 5I2OA 1EL4A 3PSRA 3PM8A 3I5GB 1GJYA 3RLZA 3BUOB 5DKQA 1F70A 2CCMA 2JT0A 2GV5A 3PFVA 1OSAA 3VRPA 2LHLA 3A4UB 1KFUL 1LINA 1J1EA 1C7VA 2OS8B 1CFPA 3OX5A 4U8DA 1CMGA 1A75A 3OB1B 1DJIA 1Q80A 1KSOA 4PHJA 4PE0A 5CSFA 2COLB 3WHTB 2FOTA 2BCXA 1DGUA 4CFRA 1SR6C 2L5XB 4OV2A 1B8LA 3CS1A 3CZTX 2KYFA 2ISDA 3D0YB 4JWQA 1TNXA 4CLNA 1IGVA 5J3XA 1A29A 2AUCA 1AP4A 1QJTA 3EK4A 2AMIA 4QJ4B 1B7TZ 1LA0A 1KFXS 3O4YA 2G9BA 2K7DA 2LMUA 2A4JA 4HSZA 2ZKMX 5ER4X 2NCPA 4N5XA 2NXQA 2L98A 2NZ0A 4WRIA 2JRFA 1ALWA 3IF7A 1QTXA 1YRTB 3NSKA 1DGVA 1CKKA 1LA3A 3EKHA 1IG5A 1SCMB 1QX2A 3GOFA 5HKYA 4YI8A 1QX7A 3PN7C 1IWQA 3TUYB 4D1EA 2JQ6A 1W7IB 2K0JA 1CLMA 2OTGB 1TN4A 2LLTA 4NDDA 2M0RA 1MUXA 1S36A 2I18A 2M1KB 3SG7A 5B8IB 4FQOA 4GGFC 1KK8C 4MVFA 3GK4X 1B1GA 2M8UA 1ZFSA 1WRKA 3EK8A 2LHIA 1EG3A 2LUXA 1TNQA 2F2PA 1MXEA 4MRXA 1M39A 2BL0C 2ZNEA 4N1GA 4GUKA 1BJFA 4I5JA 1SKTA 1PK0D 4ETOA 3I5IB 1A75B 3KHEA 2L50A 1OOJA 1W7JB 2PASA 1JFKA 2GGMA 3EKJA 1AVSA 2JTZA 2K2AA 1XFVO 1JBAA 2F2OA 4DS7A 2LM5A 5I2LA 1N2DA 1NX2A 2I94A 1L2OB 2LMVA 3KF9A 2LVJA 3SG3A 1PALA 4QJ3B 1QLKA 1Y1XA 1YX7A 1NCXA 1OMDA 1K9KA 1F4OA 1SL9A 4GAOA 1K93D 1PVAA 4MZKA 3VRNA 1IJ6A 1SL7A 1SBJA 1TCOB 3CR4X 4NDCA 3WHUB 1MXLC 1BMOA 3O78A 2FJUB 4ZCUA 1JFJA 2MAZA 1YUTA 1NUBA 2D8NA 1Y0VH 4AQJA 1J7QA 2KGBC 2MLEC 4CFQA 3IQQA 1JSAA 4I5KA 3K21A 3DVKA 1DJZA 1UWOA 3JTDB 1H8BA 3SIAA 1J55A 4HRHA 1RROA 3BOWA 1TCFA 2PALA 4XJKA 2P6BB 2WNDA 1F4QA 1AJ4A 5I8NA 4QJ5B 1QASA 2Q91A 4GGNA 1UUSA 3JVTB
chains in the Genus database with same CATH superfamily
5GQQC 1BOCA 2DOQA 2P71A 1ORGA 3UNWA 2LVIA 1ZUZA 2SCPA 2JT3A 3AAJA 1RTP1 2Y5IA 4M2QA 1NCYA 2R2IA 1KSMA 2GTEA 2LVVA 3DD4A 3SJSA 1K2HA 5BPJA 3KPXA 3AKAA 3L4LA 1KQVA 1UHJA 1AJ5A 1DTLA 4E68A 1CNPA 1OOFA 1K94A 1YVHA 1OMRA 3M0WA 4MBEA 1EXRA 2KDHA 3CR5X 2KQYA 5IBWA 2LAPA 1XK4C 1KK7Y 1K96A 1C7WA 1N65A 2Y4QA 3BXKA 1ZOTB 2CXJA 2H8VA 2L4IA 3I5FB 4USLA 1DJYA 1IRJA 4BY4A 3SG5A 2WCLA 4JQ0D 2M29A 1J7RA 4WQ2A 1F71A 2LUCA 1RFJA 2SASA 1CFFA 3O2PA 3WNXB 1WDCC 3R1OA 3F45A 5I2QA 1NX0A 1V1FA 2WCKA 2M7NA 3QMEA 4GGFA 2F8PA 4YGEB 1SNLA 3SG6A 1M45A 2M97A 3CR2A 3KO0A 2JTTA 4MN0A 5AERA 2HETA 2JC2A 1Y6WA 5K89A 2BCAA 2WCHA 1YR5A 1FPWA 1UHIA 4BY5A 2MBXA 3UO9A 2JU0A 1FI6A 3V2LA 2I2RE 3OGNA 3Q8IA 3IVTA 1H4BA 1CLBA 2JXCA 1S6CA 2BBNA 3BOWB 1OW4A 3SG2A 1TTXA 3VRRA 1J1DA 4XJKB 2L2CA 1KCYA 2O5GA 1IQ3A 4ORAB 1XVJA 2F3YA 1KQMC 1M46A 1U5IA 4MZLA 3I5HC 2PMYA 2BECA 2K2FA 4OVNF 3SG4A 3LCPC 4XYNA 1WRLA 1F54A 1JUOA 4TNCA 1SR6B 3LK0A 5G08A 1A4PA 1UHKA 5D3OA 2M49B 2H61C 1CM1A 5FI2A 3RM1A 4PHNA 2KAXA 2TN4A 1K8UA 1OZOA 5CSIA 2O60A 2WORA 3CTNA 1PVBA 3MSEB 4HREE 2ERBA 2CBLA 3QRXA 2BKHB 2KFGA 3LLEA 1R6PA 1J7PA 1UHNA 1W9ZA 2WC6A 1B8RA 1C3ZA 1AHRA 1B8CA 1QVIZ 2LE9B 3BFHA 3BFAA 4C0LA 1MQ1A 1VRKA 3DF0A 4OCIA 4A4CA 1BR1B 1OZSA 1QX5B 1CFCA 1S1EA 1CDMA 1DJXA 1RECA 1SYMA 4DIRA 1YRUB 1L7ZA 1NIWA 3EVRA 2M1UA 5JJGA 3HCMA 3R1VA 1B47A 1QIVA 3SIBA 1CDPA 2Y1NA 3EVUA 3PN7B 2KHNA 2L2EA 1DQEA 2KFFA 5CSJA 3VROA 1F55A 1XFYO 2ZN8A 3ZWHA 4C0KA 2EC6C 2LANA 3HX4A 2F33A 5CPVA 2VRGA 1K90D 1B9AA 2MRDA 3DVJA 4ORCB 1KK8B 1WY9A 1XO5A 2K7OA 3B6XA 1YVLA 3D74A 1CTRA 1NWDA 4YGCB 5HYDA 2LVKA 1S26D 1Z4HA 2BAPA 2KSPA 4ICBA 5HKWA 1ZMZA 2LNKA 1QATA 1QWVA 2L5YA 1K9PA 3BJHA 1SL8A 2KGRA 4AQIA 2BL0B 4ZCVA 2ZNDA 4UPGA 3TDZA 2WC8A 3C1VA 3DYEA 1UP5A 1A2XA 1DJWA 2M3WA 1BODA 1S6IA 1CDLA 1LS8A 2K60A 4I5LB 1PULA 4AOMA 1U5IB 1YTZC 4OR9B 1TIZA 3NHTA 3A8RA 4PCWA 5JOLA 5D69A 1LKJA 1QS7A 1OMVA 2BBMA 1R2UA 2KI6C 1XK4A 3D77A 4Q04A 1B7TY 3KEVA 2E6WA 4JD9A 1B4CA 2BE4A 5HLVA 2JXLA 2QEVA 4HRGA 2MA2A 1J7OA 2KI4C 2M7LA 1BF5A 3TS5C 3D10A 1DC1A 2CT9A 2L0PA 2JOJA 1RWYA 2KI6D 2E30A 3BQ3A 1KWOC 1SPYA 4YRUA 1Y1AA 2LCPA 3DF0B 1IQ5A 3IQOA 3NSOA 3D76A 1CLLA 3I5GC 4I5NB 3FIAA 3NSLA 1NCZA 3LL8B 2JNXA 1XA5A 2JPOA 1BG1A 4WQ3A 1CDNA 1S5GZ 4IL1A 1E8AA 1LVCD 3OX6A 4DRWA 3OB2B 1DF0A 2FCDA 1ZACA 2OS8C 2NLNA 1DT7B 3I5FC 1OE9B 3BUWB 3H4SE 1NP8A 3DXLA 4JKTA 2BNXA 4GBAA 1AUIB 3OHMB 1HQVA 2JZIA 1G33A 3CZ0A 4PT1A 1F8HA 4P5OE 1MWNA 1QVIY 4INWA 4OZDA 2JNFA 3GK2A 1GGZA 3E3RA 3NXAA 4R1EA 2KQ6A 1K9UA 4PALA 1LXFC 2PYQA 4A4BA 3PLFB 1MF8B 1NSHA 2BCBA 2H61A 3TDIA 2MHHA 1UURA 1SCVA 2PQLA 3DY9A 3FE9A 1GQMA 2PVBA 2OPOA 4PE7A 5CSNA 1MHOA 4CIDA 5D7FA 3S0AA 2QPTA 4PDZA 2HF5A 1PRWA 2HQ8A 2KLDA 4F0ZB 1M63B 5PALA 2LMTA 1IJ5A 2KBMA 1SCMC 1SK6D 2Y1MA 4M2OA 2WCBA 1JF2A 1BR4B 4ORBB 2K7BA 1V1GA 3BUNB 1M31A 1AK8A 3TUYC 1YUSA 4MEWA 1FW4A 2V53A 2OTGC 4N1FA 1CB1A 1MR8A 3R1PA 2FCEA 3DVEA 3BYAA 5HKZA 1QV0A 4MRYA 1EG4A 1TUJA 2CNPA 1XFXO 1WDCB 3K1EA 1QIWA 1RJVA 3NGVA 1SW8A 2QEHA 4MLWA 3CGAA 1NPQA 4YGDB 5AFPA 3PM2A 2EGDA 1TOPA 5FYXA 1OQPA 4MZJA 2ZRTA 1DF0B 2IS9A 2JPTA 3EK7A 2KYCA 3I5IC 2JWWA 1EH2A 2ZFDA 1XFZO 4PHMA 2BKIB 2MJWB 4OKHA 3SS5A 1JF0A 2I7AA 1DJHA 3S0DA 3O6BA 2QACA 2FJYA 3L4AA 2M9GA 1S3PA 2ZRSA 2QEOA 4CPVA 1CFDA 2NCOA 5I94A 1DMOA 1KFXL 1KQMB 3EG5B 2LP3A 2JT8A 2Q4UA 2LV7A 3I5HB 4MSPA 1C07A 2LC5A 3SS3A 2KBIA 3AAKA 4L9MA 4IJ7A 4P2YB 4DUQA 1SY9A 1L2OC 3RZSA 2KNEA 1X02A 2F3ZA 1NYAA 2KPHA 2LLSA 1S5GY 1PSBA 3PJIA 1KK7Z 3CYZA 1Y1UA 3TZ1A 2WCFA 1JWDA 4YI9A 5AEQA 5AANA 5KU1A 5AXIA 1DJGA 3AKBA 1SRAA 3FS7A 1BT6A 3GK1A 4NQGA 3CLNA 1QV1A 4GFTA 2WOSA 4PHKA 1T14A 3VRQA 3ZNIA 2GGZA 1D1OA 3ICBA 3PALA 2G2BA 4YGAA 1GGWA 1DEKA 2BE6A 3WXAA 2AAOA 1YX8A 1CM4A 2PSRA 3BUMB 3LK1A 4JPZB 1K95A 5KSZA 2HQWA 2KAVA 3EVVA 3JTDC 1NX3A 2WCEA 1NX1A 1FI5A 2KOTA 3VGOA 3S0BA 4GNKB 2RGIA 1FF1A 1XYDA 1BU3A 3PATA 2YGUA 3FWCA 1WLZA 2EC6B 5KTYA 1TRFA 2L4HA 5DKNA 5EL2A 3DVMA 4PE1A 1G8IA 1HT9A 1PSRA 1TNWA 3S0FA 3JVTC 5HLOA 1EJ3A 1UHHA 1BLQA 1ALVA 2L51A 1DVIA 1S6JA 5TNCA 1RK9A 1IH0A 1TNPA 2P70A 1XFUO 3D0YA 1WLMA 1C3YA 1GM0A 4PE4A 2B1UA 2PRUA 3D78A 1FBVA 3OP0A 1QLSA 3CWGA 3L47A 3BFBA 2H2KA 2JULA 4FTGA 2ZN9A 2KFHA 4C0JA 1SMGA 1N0YA 5F6TA 4NDBA 1QXPA 3BUXB 3O4XA 1JC2A 1TUZA 5ER5A 5DKRA 3NSIA 2MLFC 2CTNA 1A03A 2WC5A 1ODBA 2K8MB 3NHIA 2LLUA 1CMFA 1WRZA 2QEBA 1KFUS 2HPSA 1G4YR 3FWBA 4YBHB 2KI4B 4GPLB 1OOIX 2EHBA 2LP2A 3TS5B 4M2PA 4F7FA 1YUUA 3D75A 1YURA 2KAYA 1IKUA 2K61A 2WCJA 4DCKA 1KWOB 1XFWO 2K7CA 4YGBB 3TDUA 5I2OA 1EL4A 3PSRA 3VB1A 3PM8A 3I5GB 1GJYA 3CDNA 3RLZA 3BUOB 5DKQA 1F70A 2CCMA 2JT0A 2GV5A 3PFVA 1OSAA 3VRPA 2LHLA 3A4UB 1KFUL 1LINA 3SS4A 1XFRA 1J1EA 1C7VA 2OS8B 1CFPA 1IIOA 3OX5A 4U8DA 1CMGA 1A75A 3OB1B 1DJIA 1Q80A 1KSOA 4PHJA 4PE0A 5CSFA 2COLB 3WHTB 2FOTA 1OOHA 2BCXA 3CZ2A 1DGUA 3CABA 5DICA 4CFRA 1SR6C 2L5XB 4OV2A 1B8LA 3CS1A 3CZTX 2KYFA 3R72A 2ISDA 3D0YB 4JWQA 3B86A 1TNXA 3B87A 1IGVA 5J3XA 1A29A 4CLNA 2AUCA 2QDIA 1QJTA 3B88A 3EK4A 1AP4A 2AMIA 4QJ4B 1B7TZ 1LA0A 1KFXS 3O4YA 2G9BA 2K7DA 2KLEA 2LMUA 3FE6A 2A4JA 4HSZA 2ZKMX 5ER4X 2NCPA 3DZTA 2NXQA 4N5XA 2L98A 2NZ0A 4WRIA 2JRFA 1ALWA 1SSEB 3IF7A 1QTXA 1YRTB 1Z2CB 1DGVA 3NSKA 1LA3A 3EKHA 3S0EA 1CKKA 1IG5A 1SCMB 1QX2A 3GOFA 5HKYA 4YI8A 1QX7A 3PN7C 1IWQA 3TUYB 4D1EA 2JQ6A 4INXA 1W7IB 2K0JA 1CLMA 2OTGB 1OOGA 1TN4A 2LLTA 4NDDA 2M0RA 1MUXA 1S36A 2I18A 2M1KB 3SG7A 5B8IB 4FQOA 2WCMA 1KK8C 4GGFC 3GK4X 4MVFA 1B1GA 2M8UA 1ZFSA 1WRKA 3S0GA 3EK8A 2LHIA 1EG3A 2LUXA 1TNQA 2F2PA 1MXEA 4MRXA 1M39A 2BL0C 2ZNEA 4N1GA 4GUKA 1BJFA 4I5JA 1SKTA 1PK0D 4ETOA 3I5IB 1A75B 3KHEA 2L50A 1OOJA 1W7JB 2PASA 1JFKA 2GGMA 3EKJA 1AVSA 2JTZA 2K2AA 1XFVO 1JBAA 2F2OA 4DS7A 2LM5A 3B7AA 5I2LA 1N2DA 4KYNA 5FI7A 3N7HA 1NX2A 4FQTA 2I94A 1L2OB 2LMVA 3KF9A 2LVJA 3SG3A 1PALA 4QJ3B 1QLKA 1Y1XA 1YX7A 1NCXA 1OMDA 1K9KA 1F4OA 1SL9A 3FE8A 4GAOA 1K93D 1PVAA 4MZKA 3VRNA 5HL1A 3OBVA 1IJ6A 1SL7A 1SBJA 1TCOB 3CR4X 4NDCA 3WHUB 1MXLC 1BMOA 3O78A 2FJUB 4ZCUA 1JFJA 2MAZA 1DELA 1YUTA 1NUBA 2D8NA 1Y0VH 4AQJA 1J7QA 2KGBC 2MLEC 3CZ1A 5FI6A 3IQQA 4CFQA 1JSAA 4I5KA 3K21A 3DVKA 1DJZA 1UWOA 3JTDB 1H8BA 3SIAA 1J55A 4HRHA 1RROA 3BOWA 1TCFA 2PALA 4XJKA 2P6BB 2WNDA 1F4QA 1TWOA 1AJ4A 3D73A 5I8NA 4QJ5B 1QASA 2Q91A 4GGNA 1P28A 1UUSA 3JVTB
chains in the Genus database with same CATH topology
5GQQC 1BOCA 2DOQA 2LVIA 1ZUZA 2SCPA 2JT3A 3AAJA 1RTP1 2Y5IA 4M2QA 1NCYA 2R2IA 1KSMA 2LVVA 3DD4A 3SJSA 1K2HA 5BPJA 3KPXA 3AKAA 1KQVA 1UHJA 1AJ5A 1DTLA 4E68A 1CNPA 1K94A 1YVHA 1OMRA 3M0WA 4MBEA 1EXRA 2KDHA 3CR5X 2KQYA 5IBWA 2LAPA 1XK4C 1KK7Y 1K96A 1C7WA 1N65A 2Y4QA 3BXKA 1ZOTB 2CXJA 2L4IA 3I5FB 4USLA 1DJYA 1IRJA 4BY4A 3SG5A 4JQ0D 2M29A 1J7RA 4WQ2A 1F71A 2LUCA 1RFJA 2SASA 1CFFA 3O2PA 3WNXB 1WDCC 3F45A 5I2QA 1NX0A 1V1FA 2M7NA 4GGFA 2F8PA 4YGEB 1SNLA 3SG6A 1M45A 2M97A 3CR2A 3KO0A 2JTTA 4MN0A 5AERA 2HETA 2JC2A 1Y6WA 5K89A 2BCAA 1YR5A 1FPWA 1UHIA 4BY5A 2MBXA 2JU0A 1FI6A 2I2RE 1H4BA 1CLBA 2JXCA 1S6CA 2BBNA 3BOWB 3SG2A 3VRRA 1TTXA 1J1DA 4XJKB 1KCYA 2O5GA 1IQ3A 4ORAB 1XVJA 2F3YA 1KQMC 1M46A 1U5IA 4MZLA 3I5HC 2PMYA 2BECA 2K2FA 4OVNF 3SG4A 3LCPC 4XYNA 1WRLA 1F54A 1JUOA 4TNCA 1SR6B 3LK0A 5G08A 1A4PA 1UHKA 2M49B 2H61C 1CM1A 3RM1A 4PHNA 2KAXA 2TN4A 1K8UA 1OZOA 5CSIA 2O60A 2WORA 3CTNA 1PVBA 3MSEB 4HREE 2CBLA 3QRXA 2BKHB 2KFGA 3LLEA 1R6PA 1J7PA 1UHNA 1B8RA 1AHRA 1B8CA 1QVIZ 2LE9B 4C0LA 1MQ1A 1VRKA 3DF0A 4OCIA 4A4CA 1BR1B 1OZSA 1QX5B 1CFCA 1S1EA 1CDMA 1DJXA 1RECA 1SYMA 4DIRA 1YRUB 1L7ZA 1NIWA 3EVRA 2M1UA 5JJGA 3HCMA 1B47A 1QIVA 3SIBA 1CDPA 2Y1NA 3EVUA 3PN7B 2KHNA 2L2EA 2KFFA 5CSJA 3VROA 1F55A 1XFYO 2ZN8A 3ZWHA 4C0KA 2EC6C 2LANA 3HX4A 2F33A 5CPVA 2VRGA 1K90D 1B9AA 2MRDA 3DVJA 4ORCB 1KK8B 1WY9A 1XO5A 2K7OA 4YGCB 1YVLA 5HYDA 1CTRA 1NWDA 2LVKA 1S26D 2KSPA 4ICBA 5HKWA 1ZMZA 2LNKA 1QATA 1K9PA 1SL8A 2KGRA 4AQIA 2BL0B 4ZCVA 2ZNDA 4UPGA 3TDZA 2WC8A 3C1VA 1UP5A 1A2XA 1DJWA 2M3WA 1BODA 1S6IA 1CDLA 4I5LB 1PULA 4AOMA 1U5IB 1YTZC 4OR9B 1TIZA 3A8RA 4PCWA 5JOLA 5D69A 1LKJA 1QS7A 1OMVA 2BBMA 1R2UA 2KI6C 1XK4A 4Q04A 3TDIA 1B7TY 3KEVA 2E6WA 1B4CA 2BE4A 5HLVA 2JXLA 4HRGA 2MA2A 1J7OA 2KI4C 2M7LA 1BF5A 3TS5C 3D10A 2CT9A 2L0PA 2JOJA 1RWYA 2KI6D 2E30A 3BQ3A 1KWOC 1SPYA 4YRUA 1Y1AA 2LCPA 3DF0B 1IQ5A 3IQOA 3NSOA 1CLLA 3I5GC 4I5NB 3FIAA 3NSLA 1NCZA 3LL8B 2JNXA 1XA5A 1BG1A 4WQ3A 1CDNA 1S5GZ 4IL1A 1E8AA 1LVCD 3OX6A 4DRWA 3OB2B 1DF0A 2FCDA 1ZACA 2OS8C 2NLNA 1DT7B 3I5FC 1OE9B 3BUWB 3H4SE 1NP8A 4GBAA 1AUIB 3OHMB 1HQVA 2JZIA 1G33A 1F8HA 4P5OE 1MWNA 1QVIY 2JNFA 3GK2A 1GGZA 3E3RA 3NXAA 4R1EA 2KQ6A 1K9UA 4PALA 1LXFC 4A4BA 3PLFB 1MF8B 1NSHA 2BCBA 2H61A 2MHHA 1UURA 1SCVA 4PE7A 1GQMA 2PVBA 2OPOA 5CSNA 4CIDA 1MHOA 5D7FA 2QPTA 4PDZA 2HF5A 1PRWA 2HQ8A 4F0ZB 1M63B 5PALA 2LMTA 1IJ5A 2KBMA 1SCMC 1SK6D 2Y1MA 4M2OA 2WCBA 1JF2A 1BR4B 4ORBB 2K7BA 1V1GA 3BUNB 1M31A 1AK8A 3TUYC 1YUSA 4MEWA 1FW4A 2V53A 2OTGC 4N1FA 1CB1A 1MR8A 2FCEA 3DVEA 3BYAA 5HKZA 1QV0A 4MRYA 1EG4A 2CNPA 1XFXO 1WDCB 1QIWA 1RJVA 1SW8A 4MLWA 3CGAA 1NPQA 4YGDB 5AFPA 2EGDA 1TOPA 5FYXA 1OQPA 4MZJA 2ZRTA 1DF0B 2IS9A 2JPTA 3EK7A 2KYCA 3I5IC 2JWWA 1EH2A 2ZFDA 1XFZO 4PHMA 2BKIB 2MJWB 4OKHA 1JF0A 2I7AA 1DJHA 3O6BA 2QACA 4CPVA 2M9GA 1S3PA 2ZRSA 1CFDA 2NCOA 1DMOA 1KFXL 1KQMB 2LP3A 2JT8A 2Q4UA 2LV7A 3I5HB 4MSPA 1C07A 2LC5A 2KBIA 3AAKA 4L9MA 4P2YB 4DUQA 1SY9A 1L2OC 2KNEA 1X02A 2F3ZA 1NYAA 2LLSA 1S5GY 1PSBA 1KK7Z 1Y1UA 3TZ1A 2WCFA 1JWDA 4YI9A 5AEQA 5AANA 5KU1A 5AXIA 1DJGA 3AKBA 1SRAA 3FS7A 1BT6A 3GK1A 4NQGA 3CLNA 1QV1A 4GFTA 2WOSA 4PHKA 3VRQA 3ZNIA 2GGZA 1D1OA 3ICBA 3PALA 2G2BA 4YGAA 1GGWA 2BE6A 3WXAA 2AAOA 1YX8A 1CM4A 2PSRA 3BUMB 3LK1A 4JPZB 1K95A 5KSZA 2HQWA 2KAVA 3EVVA 3JTDC 1NX3A 2WCEA 1NX1A 1FI5A 2KOTA 3VGOA 4GNKB 2RGIA 1FF1A 1XYDA 1BU3A 3PATA 3FWCA 1WLZA 2EC6B 5KTYA 1TRFA 2L4HA 5DKNA 3DVMA 4PE1A 1G8IA 1HT9A 1PSRA 1TNWA 3JVTC 5HLOA 1EJ3A 1UHHA 1BLQA 1ALVA 2L51A 1DVIA 1S6JA 5TNCA 1RK9A 1IH0A 1TNPA 1XFUO 3D0YA 1WLMA 4PE4A 2B1UA 2PRUA 1FBVA 3OP0A 1QLSA 3CWGA 2H2KA 2JULA 4FTGA 2ZN9A 2KFHA 4C0JA 1SMGA 1N0YA 5F6TA 4NDBA 1QXPA 3BUXB 1JC2A 5ER5A 5DKRA 3NSIA 2MLFC 2CTNA 1A03A 1ODBA 2K8MB 2LLUA 1CMFA 1WRZA 1KFUS 2HPSA 1G4YR 3FWBA 4YBHB 2KI4B 4GPLB 2EHBA 2LP2A 3TS5B 4M2PA 1YUUA 1YURA 2KAYA 1IKUA 2K61A 4DCKA 1KWOB 1XFWO 2K7CA 4YGBB 3TDUA 5I2OA 1EL4A 3PSRA 3PM8A 3I5GB 1GJYA 3RLZA 3BUOB 5DKQA 1F70A 2CCMA 2JT0A 2GV5A 3PFVA 1OSAA 3VRPA 2LHLA 3A4UB 1KFUL 1LINA 1J1EA 1C7VA 2OS8B 1CFPA 3OX5A 4U8DA 1CMGA 1A75A 3OB1B 1DJIA 1Q80A 1KSOA 4PHJA 4PE0A 5CSFA 2COLB 3WHTB 2FOTA 2BCXA 1DGUA 4CFRA 1SR6C 2L5XB 4OV2A 1B8LA 3CS1A 3CZTX 2KYFA 2ISDA 3D0YB 4JWQA 1TNXA 4CLNA 1IGVA 5J3XA 1A29A 2AUCA 1AP4A 1QJTA 3EK4A 2AMIA 4QJ4B 1B7TZ 1LA0A 1KFXS 3O4YA 2G9BA 2K7DA 2LMUA 2A4JA 4HSZA 2ZKMX 5ER4X 2NCPA 4N5XA 2NXQA 2L98A 2NZ0A 4WRIA 2JRFA 1ALWA 3IF7A 1QTXA 1YRTB 3NSKA 1DGVA 1CKKA 1LA3A 3EKHA 1IG5A 1SCMB 1QX2A 3GOFA 5HKYA 4YI8A 1QX7A 3PN7C 1IWQA 3TUYB 4D1EA 2JQ6A 1W7IB 2K0JA 1CLMA 2OTGB 1TN4A 2LLTA 4NDDA 2M0RA 1MUXA 1S36A 2I18A 2M1KB 3SG7A 5B8IB 4FQOA 4GGFC 1KK8C 4MVFA 3GK4X 1B1GA 2M8UA 1ZFSA 1WRKA 3EK8A 2LHIA 1EG3A 2LUXA 1TNQA 2F2PA 1MXEA 4MRXA 1M39A 2BL0C 2ZNEA 4N1GA 4GUKA 1BJFA 4I5JA 1SKTA 1PK0D 4ETOA 3I5IB 1A75B 3KHEA 2L50A 1OOJA 1W7JB 2PASA 1JFKA 2GGMA 3EKJA 1AVSA 2JTZA 2K2AA 1XFVO 1JBAA 2F2OA 4DS7A 2LM5A 5I2LA 1N2DA 1NX2A 2I94A 1L2OB 2LMVA 3KF9A 2LVJA 3SG3A 1PALA 4QJ3B 1QLKA 1Y1XA 1YX7A 1NCXA 1OMDA 1K9KA 1F4OA 1SL9A 4GAOA 1K93D 1PVAA 4MZKA 3VRNA 1IJ6A 1SL7A 1SBJA 1TCOB 3CR4X 4NDCA 3WHUB 1MXLC 1BMOA 3O78A 2FJUB 4ZCUA 1JFJA 2MAZA 1YUTA 1NUBA 2D8NA 1Y0VH 4AQJA 1J7QA 2KGBC 2MLEC 4CFQA 3IQQA 1JSAA 4I5KA 3K21A 3DVKA 1DJZA 1UWOA 3JTDB 1H8BA 3SIAA 1J55A 4HRHA 1RROA 3BOWA 1TCFA 2PALA 4XJKA 2P6BB 2WNDA 1F4QA 1AJ4A 5I8NA 4QJ5B 1QASA 2Q91A 4GGNA 1UUSA 3JVTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GQQ C;  1BOC A;  2DOQ A;  2LVI A;  1ZUZ A;  2SCP A;  2JT3 A;  3AAJ A;  1RTP 1;  2Y5I A;  4M2Q A;  1NCY A;  2R2I A;  1KSM A;  2LVV A;  3DD4 A;  3SJS A;  1K2H A;  5BPJ A;  3KPX A;  3AKA A;  1KQV A;  1UHJ A;  1AJ5 A;  1DTL A;  4E68 A;  1CNP A;  1K94 A;  1YVH A;  1OMR A;  3M0W A;  4MBE A;  1EXR A;  2KDH A;  3CR5 X;  2KQY A;  5IBW A;  2LAP A;  1XK4 C;  1KK7 Y;  1K96 A;  1C7W A;  1N65 A;  2Y4Q A;  3BXK A;  1ZOT B;  2CXJ A;  2L4I A;  3I5F B;  4USL A;  1DJY A;  1IRJ A;  4BY4 A;  3SG5 A;  4JQ0 D;  2M29 A;  1J7R A;  4WQ2 A;  1F71 A;  2LUC A;  1RFJ A;  2SAS A;  1CFF A;  3O2P A;  3WNX B;  1WDC C;  3F45 A;  5I2Q A;  1NX0 A;  1V1F A;  2M7N A;  4GGF A;  2F8P A;  4YGE B;  1SNL A;  3SG6 A;  1M45 A;  2M97 A;  3CR2 A;  3KO0 A;  2JTT A;  4MN0 A;  5AER A;  2HET A;  2JC2 A;  1Y6W A;  5K89 A;  2BCA A;  1YR5 A;  1FPW A;  1UHI A;  4BY5 A;  2MBX A;  2JU0 A;  1FI6 A;  2I2R E;  1H4B A;  1CLB A;  2JXC A;  1S6C A;  2BBN A;  3BOW B;  3SG2 A;  3VRR A;  1TTX A;  1J1D A;  4XJK B;  1KCY A;  2O5G A;  1IQ3 A;  4ORA B;  1XVJ A;  2F3Y A;  1KQM C;  1M46 A;  1U5I A;  4MZL A;  3I5H C;  2PMY A;  2BEC A;  2K2F A;  4OVN F;  3SG4 A;  3LCP C;  4XYN A;  1WRL A;  1F54 A;  1JUO A;  4TNC A;  1SR6 B;  3LK0 A;  5G08 A;  1A4P A;  1UHK A;  2M49 B;  2H61 C;  1CM1 A;  3RM1 A;  4PHN A;  2KAX A;  2TN4 A;  1K8U A;  1OZO A;  5CSI A;  2O60 A;  2WOR A;  3CTN A;  1PVB A;  3MSE B;  4HRE E;  2CBL A;  3QRX A;  2BKH B;  2KFG A;  3LLE A;  1R6P A;  1J7P A;  1UHN A;  1B8R A;  1AHR A;  1B8C A;  1QVI Z;  2LE9 B;  4C0L A;  1MQ1 A;  1VRK A;  3DF0 A;  4OCI A;  4A4C A;  1BR1 B;  1OZS A;  1QX5 B;  1CFC A;  1S1E A;  1CDM A;  1DJX A;  1REC A;  1SYM A;  4DIR A;  1YRU B;  1L7Z A;  1NIW A;  3EVR A;  2M1U A;  5JJG A;  3HCM A;  1B47 A;  1QIV A;  3SIB A;  1CDP A;  2Y1N A;  3EVU A;  3PN7 B;  2KHN A;  2L2E A;  2KFF A;  5CSJ A;  3VRO A;  1F55 A;  1XFY O;  2ZN8 A;  3ZWH A;  4C0K A;  2EC6 C;  2LAN A;  3HX4 A;  2F33 A;  5CPV A;  2VRG A;  1K90 D;  1B9A A;  2MRD A;  3DVJ A;  4ORC B;  1KK8 B;  1WY9 A;  1XO5 A;  2K7O A;  4YGC B;  1YVL A;  5HYD A;  1CTR A;  1NWD A;  2LVK A;  1S26 D;  2KSP A;  4ICB A;  5HKW A;  1ZMZ A;  2LNK A;  1QAT A;  1K9P A;  1SL8 A;  2KGR A;  4AQI A;  2BL0 B;  4ZCV A;  2ZND A;  4UPG A;  3TDZ A;  2WC8 A;  3C1V A;  1UP5 A;  1A2X A;  1DJW A;  2M3W A;  1BOD A;  1S6I A;  1CDL A;  4I5L B;  1PUL A;  4AOM A;  1U5I B;  1YTZ C;  4OR9 B;  1TIZ A;  3A8R A;  4PCW A;  5JOL A;  5D69 A;  1LKJ A;  1QS7 A;  1OMV A;  2BBM A;  1R2U A;  2KI6 C;  1XK4 A;  4Q04 A;  3TDI A;  1B7T Y;  3KEV A;  2E6W A;  1B4C A;  2BE4 A;  5HLV A;  2JXL A;  4HRG A;  2MA2 A;  1J7O A;  2KI4 C;  2M7L A;  1BF5 A;  3TS5 C;  3D10 A;  2CT9 A;  2L0P A;  2JOJ A;  1RWY A;  2KI6 D;  2E30 A;  3BQ3 A;  1KWO C;  1SPY A;  4YRU A;  1Y1A A;  2LCP A;  3DF0 B;  1IQ5 A;  3IQO A;  3NSO A;  1CLL A;  3I5G C;  4I5N B;  3FIA A;  3NSL A;  1NCZ A;  3LL8 B;  2JNX A;  1XA5 A;  1BG1 A;  4WQ3 A;  1CDN A;  1S5G Z;  4IL1 A;  1E8A A;  1LVC D;  3OX6 A;  4DRW A;  3OB2 B;  1DF0 A;  2FCD A;  1ZAC A;  2OS8 C;  2NLN A;  1DT7 B;  3I5F C;  1OE9 B;  3BUW B;  3H4S E;  1NP8 A;  4GBA A;  1AUI B;  3OHM B;  1HQV A;  2JZI A;  1G33 A;  1F8H A;  4P5O E;  1MWN A;  1QVI Y;  2JNF A;  3GK2 A;  1GGZ A;  3E3R A;  3NXA A;  4R1E A;  2KQ6 A;  1K9U A;  4PAL A;  1LXF C;  4A4B A;  3PLF B;  1MF8 B;  1NSH A;  2BCB A;  2H61 A;  2MHH A;  1UUR A;  1SCV A;  4PE7 A;  1GQM A;  2PVB A;  2OPO A;  5CSN A;  4CID A;  1MHO A;  5D7F A;  2QPT A;  4PDZ A;  2HF5 A;  1PRW A;  2HQ8 A;  4F0Z B;  1M63 B;  5PAL A;  2LMT A;  1IJ5 A;  2KBM A;  1SCM C;  1SK6 D;  2Y1M A;  4M2O A;  2WCB A;  1JF2 A;  1BR4 B;  4ORB B;  2K7B A;  1V1G A;  3BUN B;  1M31 A;  1AK8 A;  3TUY C;  1YUS A;  4MEW A;  1FW4 A;  2V53 A;  2OTG C;  4N1F A;  1CB1 A;  1MR8 A;  2FCE A;  3DVE A;  3BYA A;  5HKZ A;  1QV0 A;  4MRY A;  1EG4 A;  2CNP A;  1XFX O;  1WDC B;  1QIW A;  1RJV A;  1SW8 A;  4MLW A;  3CGA A;  1NPQ A;  4YGD B;  5AFP A;  2EGD A;  1TOP A;  5FYX A;  1OQP A;  4MZJ A;  2ZRT A;  1DF0 B;  2IS9 A;  2JPT A;  3EK7 A;  2KYC A;  3I5I C;  2JWW A;  1EH2 A;  2ZFD A;  1XFZ O;  4PHM A;  2BKI B;  2MJW B;  4OKH A;  1JF0 A;  2I7A A;  1DJH A;  3O6B A;  2QAC A;  4CPV A;  2M9G A;  1S3P A;  2ZRS A;  1CFD A;  2NCO A;  1DMO A;  1KFX L;  1KQM B;  2LP3 A;  2JT8 A;  2Q4U A;  2LV7 A;  3I5H B;  4MSP A;  1C07 A;  2LC5 A;  2KBI A;  3AAK A;  4L9M A;  4P2Y B;  4DUQ A;  1SY9 A;  1L2O C;  2KNE A;  1X02 A;  2F3Z A;  1NYA A;  2LLS A;  1S5G Y;  1PSB A;  1KK7 Z;  1Y1U A;  3TZ1 A;  2WCF A;  1JWD A;  4YI9 A;  5AEQ A;  5AAN A;  5KU1 A;  5AXI A;  1DJG A;  3AKB A;  1SRA A;  3FS7 A;  1BT6 A;  3GK1 A;  4NQG A;  3CLN A;  1QV1 A;  4GFT A;  2WOS A;  4PHK A;  3VRQ A;  3ZNI A;  2GGZ A;  1D1O A;  3ICB A;  3PAL A;  2G2B A;  4YGA A;  1GGW A;  2BE6 A;  3WXA A;  2AAO A;  1YX8 A;  1CM4 A;  2PSR A;  3BUM B;  3LK1 A;  4JPZ B;  1K95 A;  5KSZ A;  2HQW A;  2KAV A;  3EVV A;  3JTD C;  1NX3 A;  2WCE A;  1NX1 A;  1FI5 A;  2KOT A;  3VGO A;  4GNK B;  2RGI A;  1FF1 A;  1XYD A;  1BU3 A;  3PAT A;  3FWC A;  1WLZ A;  2EC6 B;  5KTY A;  1TRF A;  2L4H A;  5DKN A;  3DVM A;  4PE1 A;  1G8I A;  1HT9 A;  1PSR A;  1TNW A;  3JVT C;  5HLO A;  1EJ3 A;  1UHH A;  1BLQ A;  1ALV A;  2L51 A;  1DVI A;  1S6J A;  5TNC A;  1RK9 A;  1IH0 A;  1TNP A;  1XFU O;  3D0Y A;  1WLM A;  4PE4 A;  2B1U A;  2PRU A;  1FBV A;  3OP0 A;  1QLS A;  3CWG A;  2H2K A;  2JUL A;  4FTG A;  2ZN9 A;  2KFH A;  4C0J A;  1SMG A;  1N0Y A;  5F6T A;  4NDB A;  1QXP A;  3BUX B;  1JC2 A;  5ER5 A;  5DKR A;  3NSI A;  2MLF C;  2CTN A;  1A03 A;  1ODB A;  2K8M B;  2LLU A;  1CMF A;  1WRZ A;  1KFU S;  2HPS A;  1G4Y R;  3FWB A;  4YBH B;  2KI4 B;  4GPL B;  2EHB A;  2LP2 A;  3TS5 B;  4M2P A;  1YUU A;  1YUR A;  2KAY A;  1IKU A;  2K61 A;  4DCK A;  1KWO B;  1XFW O;  2K7C A;  4YGB B;  3TDU A;  5I2O A;  1EL4 A;  3PSR A;  3PM8 A;  3I5G B;  1GJY A;  3RLZ A;  3BUO B;  5DKQ A;  1F70 A;  2CCM A;  2JT0 A;  2GV5 A;  3PFV A;  1OSA A;  3VRP A;  2LHL A;  3A4U B;  1KFU L;  1LIN A;  1J1E A;  1C7V A;  2OS8 B;  1CFP A;  3OX5 A;  4U8D A;  1CMG A;  1A75 A;  3OB1 B;  1DJI A;  1Q80 A;  1KSO A;  4PHJ A;  4PE0 A;  5CSF A;  2COL B;  3WHT B;  2FOT A;  2BCX A;  1DGU A;  4CFR A;  1SR6 C;  2L5X B;  4OV2 A;  1B8L A;  3CS1 A;  3CZT X;  2KYF A;  2ISD A;  3D0Y B;  4JWQ A;  1TNX A;  4CLN A;  1IGV A;  5J3X A;  1A29 A;  2AUC A;  1AP4 A;  1QJT A;  3EK4 A;  2AMI A;  4QJ4 B;  1B7T Z;  1LA0 A;  1KFX S;  3O4Y A;  2G9B A;  2K7D A;  2LMU A;  2A4J A;  4HSZ A;  2ZKM X;  5ER4 X;  2NCP A;  4N5X A;  2NXQ A;  2L98 A;  2NZ0 A;  4WRI A;  2JRF A;  1ALW A;  3IF7 A;  1QTX A;  1YRT B;  3NSK A;  1DGV A;  1CKK A;  1LA3 A;  3EKH A;  1IG5 A;  1SCM B;  1QX2 A;  3GOF A;  5HKY A;  4YI8 A;  1QX7 A;  3PN7 C;  1IWQ A;  3TUY B;  4D1E A;  2JQ6 A;  1W7I B;  2K0J A;  1CLM A;  2OTG B;  1TN4 A;  2LLT A;  4NDD A;  2M0R A;  1MUX A;  1S36 A;  2I18 A;  2M1K B;  3SG7 A;  5B8I B;  4FQO A;  4GGF C;  1KK8 C;  4MVF A;  3GK4 X;  1B1G A;  2M8U A;  1ZFS A;  1WRK A;  3EK8 A;  2LHI A;  1EG3 A;  2LUX A;  1TNQ A;  2F2P A;  1MXE A;  4MRX A;  1M39 A;  2BL0 C;  2ZNE A;  4N1G A;  4GUK A;  1BJF A;  4I5J A;  1SKT A;  1PK0 D;  4ETO A;  3I5I B;  1A75 B;  3KHE A;  2L50 A;  1OOJ A;  1W7J B;  2PAS A;  1JFK A;  2GGM A;  3EKJ A;  1AVS A;  2JTZ A;  2K2A A;  1XFV O;  1JBA A;  2F2O A;  4DS7 A;  2LM5 A;  5I2L A;  1N2D A;  1NX2 A;  2I94 A;  1L2O B;  2LMV A;  3KF9 A;  2LVJ A;  3SG3 A;  1PAL A;  4QJ3 B;  1QLK A;  1Y1X A;  1YX7 A;  1NCX A;  1OMD A;  1K9K A;  1F4O A;  1SL9 A;  4GAO A;  1K93 D;  1PVA A;  4MZK A;  3VRN A;  1IJ6 A;  1SL7 A;  1SBJ A;  1TCO B;  3CR4 X;  4NDC A;  3WHU B;  1MXL C;  1BMO A;  3O78 A;  2FJU B;  4ZCU A;  1JFJ A;  2MAZ A;  1YUT A;  1NUB A;  2D8N A;  1Y0V H;  4AQJ A;  1J7Q A;  2KGB C;  2MLE C;  4CFQ A;  3IQQ A;  1JSA A;  4I5K A;  3K21 A;  3DVK A;  1DJZ A;  1UWO A;  3JTD B;  1H8B A;  3SIA A;  1J55 A;  4HRH A;  1RRO A;  3BOW A;  1TCF A;  2PAL A;  4XJK A;  2P6B B;  2WND A;  1F4Q A;  1AJ4 A;  5I8N A;  4QJ5 B;  1QAS A;  2Q91 A;  4GGN A;  1UUS A;  3JVT B; 
#chains in the Genus database with same CATH topology
 5GQQ C;  1BOC A;  2DOQ A;  2P71 A;  1ORG A;  3UNW A;  2LVI A;  1ZUZ A;  2SCP A;  2JT3 A;  3AAJ A;  1RTP 1;  2Y5I A;  4M2Q A;  1NCY A;  2R2I A;  1KSM A;  2GTE A;  2LVV A;  3DD4 A;  3SJS A;  1K2H A;  5BPJ A;  3KPX A;  3AKA A;  3L4L A;  1KQV A;  1UHJ A;  1AJ5 A;  1DTL A;  4E68 A;  1CNP A;  1OOF A;  1K94 A;  1YVH A;  1OMR A;  3M0W A;  4MBE A;  1EXR A;  2KDH A;  3CR5 X;  2KQY A;  5IBW A;  2LAP A;  1XK4 C;  1KK7 Y;  1K96 A;  1C7W A;  1N65 A;  2Y4Q A;  3BXK A;  1ZOT B;  2CXJ A;  2H8V A;  2L4I A;  3I5F B;  4USL A;  1DJY A;  1IRJ A;  4BY4 A;  3SG5 A;  2WCL A;  4JQ0 D;  2M29 A;  1J7R A;  4WQ2 A;  1F71 A;  2LUC A;  1RFJ A;  2SAS A;  1CFF A;  3O2P A;  3WNX B;  1WDC C;  3R1O A;  3F45 A;  5I2Q A;  1NX0 A;  1V1F A;  2WCK A;  2M7N A;  3QME A;  4GGF A;  2F8P A;  4YGE B;  1SNL A;  3SG6 A;  1M45 A;  2M97 A;  3CR2 A;  3KO0 A;  2JTT A;  4MN0 A;  5AER A;  2HET A;  2JC2 A;  1Y6W A;  5K89 A;  2BCA A;  2WCH A;  1YR5 A;  1FPW A;  1UHI A;  4BY5 A;  2MBX A;  3UO9 A;  2JU0 A;  1FI6 A;  3V2L A;  2I2R E;  3OGN A;  3Q8I A;  3IVT A;  1H4B A;  1CLB A;  2JXC A;  1S6C A;  2BBN A;  3BOW B;  1OW4 A;  3SG2 A;  1TTX A;  3VRR A;  1J1D A;  4XJK B;  2L2C A;  1KCY A;  2O5G A;  1IQ3 A;  4ORA B;  1XVJ A;  2F3Y A;  1KQM C;  1M46 A;  1U5I A;  4MZL A;  3I5H C;  2PMY A;  2BEC A;  2K2F A;  4OVN F;  3SG4 A;  3LCP C;  4XYN A;  1WRL A;  1F54 A;  1JUO A;  4TNC A;  1SR6 B;  3LK0 A;  5G08 A;  1A4P A;  1UHK A;  5D3O A;  2M49 B;  2H61 C;  1CM1 A;  5FI2 A;  3RM1 A;  4PHN A;  2KAX A;  2TN4 A;  1K8U A;  1OZO A;  5CSI A;  2O60 A;  2WOR A;  3CTN A;  1PVB A;  3MSE B;  4HRE E;  2ERB A;  2CBL A;  3QRX A;  2BKH B;  2KFG A;  3LLE A;  1R6P A;  1J7P A;  1UHN A;  1W9Z A;  2WC6 A;  1B8R A;  1C3Z A;  1AHR A;  1B8C A;  1QVI Z;  2LE9 B;  3BFH A;  3BFA A;  4C0L A;  1MQ1 A;  1VRK A;  3DF0 A;  4OCI A;  4A4C A;  1BR1 B;  1OZS A;  1QX5 B;  1CFC A;  1S1E A;  1CDM A;  1DJX A;  1REC A;  1SYM A;  4DIR A;  1YRU B;  1L7Z A;  1NIW A;  3EVR A;  2M1U A;  5JJG A;  3HCM A;  3R1V A;  1B47 A;  1QIV A;  3SIB A;  1CDP A;  2Y1N A;  3EVU A;  3PN7 B;  2KHN A;  2L2E A;  1DQE A;  2KFF A;  5CSJ A;  3VRO A;  1F55 A;  1XFY O;  2ZN8 A;  3ZWH A;  4C0K A;  2EC6 C;  2LAN A;  3HX4 A;  2F33 A;  5CPV A;  2VRG A;  1K90 D;  1B9A A;  2MRD A;  3DVJ A;  4ORC B;  1KK8 B;  1WY9 A;  1XO5 A;  2K7O A;  3B6X A;  1YVL A;  3D74 A;  1CTR A;  1NWD A;  4YGC B;  5HYD A;  2LVK A;  1S26 D;  1Z4H A;  2BAP A;  2KSP A;  4ICB A;  5HKW A;  1ZMZ A;  2LNK A;  1QAT A;  1QWV A;  2L5Y A;  1K9P A;  3BJH A;  1SL8 A;  2KGR A;  4AQI A;  2BL0 B;  4ZCV A;  2ZND A;  4UPG A;  3TDZ A;  2WC8 A;  3C1V A;  3DYE A;  1UP5 A;  1A2X A;  1DJW A;  2M3W A;  1BOD A;  1S6I A;  1CDL A;  1LS8 A;  2K60 A;  4I5L B;  1PUL A;  4AOM A;  1U5I B;  1YTZ C;  4OR9 B;  1TIZ A;  3NHT A;  3A8R A;  4PCW A;  5JOL A;  5D69 A;  1LKJ A;  1QS7 A;  1OMV A;  2BBM A;  1R2U A;  2KI6 C;  1XK4 A;  3D77 A;  4Q04 A;  1B7T Y;  3KEV A;  2E6W A;  4JD9 A;  1B4C A;  2BE4 A;  5HLV A;  2JXL A;  2QEV A;  4HRG A;  2MA2 A;  1J7O A;  2KI4 C;  2M7L A;  1BF5 A;  3TS5 C;  3D10 A;  1DC1 A;  2CT9 A;  2L0P A;  2JOJ A;  1RWY A;  2KI6 D;  2E30 A;  3BQ3 A;  1KWO C;  1SPY A;  4YRU A;  1Y1A A;  2LCP A;  3DF0 B;  1IQ5 A;  3IQO A;  3NSO A;  3D76 A;  1CLL A;  3I5G C;  4I5N B;  3FIA A;  3NSL A;  1NCZ A;  3LL8 B;  2JNX A;  1XA5 A;  2JPO A;  1BG1 A;  4WQ3 A;  1CDN A;  1S5G Z;  4IL1 A;  1E8A A;  1LVC D;  3OX6 A;  4DRW A;  3OB2 B;  1DF0 A;  2FCD A;  1ZAC A;  2OS8 C;  2NLN A;  1DT7 B;  3I5F C;  1OE9 B;  3BUW B;  3H4S E;  1NP8 A;  3DXL A;  4JKT A;  2BNX A;  4GBA A;  1AUI B;  3OHM B;  1HQV A;  2JZI A;  1G33 A;  3CZ0 A;  4PT1 A;  1F8H A;  4P5O E;  1MWN A;  1QVI Y;  4INW A;  4OZD A;  2JNF A;  3GK2 A;  1GGZ A;  3E3R A;  3NXA A;  4R1E A;  2KQ6 A;  1K9U A;  4PAL A;  1LXF C;  2PYQ A;  4A4B A;  3PLF B;  1MF8 B;  1NSH A;  2BCB A;  2H61 A;  3TDI A;  2MHH A;  1UUR A;  1SCV A;  2PQL A;  3DY9 A;  3FE9 A;  1GQM A;  2PVB A;  2OPO A;  4PE7 A;  5CSN A;  1MHO A;  4CID A;  5D7F A;  3S0A A;  2QPT A;  4PDZ A;  2HF5 A;  1PRW A;  2HQ8 A;  2KLD A;  4F0Z B;  1M63 B;  5PAL A;  2LMT A;  1IJ5 A;  2KBM A;  1SCM C;  1SK6 D;  2Y1M A;  4M2O A;  2WCB A;  1JF2 A;  1BR4 B;  4ORB B;  2K7B A;  1V1G A;  3BUN B;  1M31 A;  1AK8 A;  3TUY C;  1YUS A;  4MEW A;  1FW4 A;  2V53 A;  2OTG C;  4N1F A;  1CB1 A;  1MR8 A;  3R1P A;  2FCE A;  3DVE A;  3BYA A;  5HKZ A;  1QV0 A;  4MRY A;  1EG4 A;  1TUJ A;  2CNP A;  1XFX O;  1WDC B;  3K1E A;  1QIW A;  1RJV A;  3NGV A;  1SW8 A;  2QEH A;  4MLW A;  3CGA A;  1NPQ A;  4YGD B;  5AFP A;  3PM2 A;  2EGD A;  1TOP A;  5FYX A;  1OQP A;  4MZJ A;  2ZRT A;  1DF0 B;  2IS9 A;  2JPT A;  3EK7 A;  2KYC A;  3I5I C;  2JWW A;  1EH2 A;  2ZFD A;  1XFZ O;  4PHM A;  2BKI B;  2MJW B;  4OKH A;  3SS5 A;  1JF0 A;  2I7A A;  1DJH A;  3S0D A;  3O6B A;  2QAC A;  2FJY A;  3L4A A;  2M9G A;  1S3P A;  2ZRS A;  2QEO A;  4CPV A;  1CFD A;  2NCO A;  5I94 A;  1DMO A;  1KFX L;  1KQM B;  3EG5 B;  2LP3 A;  2JT8 A;  2Q4U A;  2LV7 A;  3I5H B;  4MSP A;  1C07 A;  2LC5 A;  3SS3 A;  2KBI A;  3AAK A;  4L9M A;  4IJ7 A;  4P2Y B;  4DUQ A;  1SY9 A;  1L2O C;  3RZS A;  2KNE A;  1X02 A;  2F3Z A;  1NYA A;  2KPH A;  2LLS A;  1S5G Y;  1PSB A;  3PJI A;  1KK7 Z;  3CYZ A;  1Y1U A;  3TZ1 A;  2WCF A;  1JWD A;  4YI9 A;  5AEQ A;  5AAN A;  5KU1 A;  5AXI A;  1DJG A;  3AKB A;  1SRA A;  3FS7 A;  1BT6 A;  3GK1 A;  4NQG A;  3CLN A;  1QV1 A;  4GFT A;  2WOS A;  4PHK A;  1T14 A;  3VRQ A;  3ZNI A;  2GGZ A;  1D1O A;  3ICB A;  3PAL A;  2G2B A;  4YGA A;  1GGW A;  1DEK A;  2BE6 A;  3WXA A;  2AAO A;  1YX8 A;  1CM4 A;  2PSR A;  3BUM B;  3LK1 A;  4JPZ B;  1K95 A;  5KSZ A;  2HQW A;  2KAV A;  3EVV A;  3JTD C;  1NX3 A;  2WCE A;  1NX1 A;  1FI5 A;  2KOT A;  3VGO A;  3S0B A;  4GNK B;  2RGI A;  1FF1 A;  1XYD A;  1BU3 A;  3PAT A;  2YGU A;  3FWC A;  1WLZ A;  2EC6 B;  5KTY A;  1TRF A;  2L4H A;  5DKN A;  5EL2 A;  3DVM A;  4PE1 A;  1G8I A;  1HT9 A;  1PSR A;  1TNW A;  3S0F A;  3JVT C;  5HLO A;  1EJ3 A;  1UHH A;  1BLQ A;  1ALV A;  2L51 A;  1DVI A;  1S6J A;  5TNC A;  1RK9 A;  1IH0 A;  1TNP A;  2P70 A;  1XFU O;  3D0Y A;  1WLM A;  1C3Y A;  1GM0 A;  4PE4 A;  2B1U A;  2PRU A;  3D78 A;  1FBV A;  3OP0 A;  1QLS A;  3CWG A;  3L47 A;  3BFB A;  2H2K A;  2JUL A;  4FTG A;  2ZN9 A;  2KFH A;  4C0J A;  1SMG A;  1N0Y A;  5F6T A;  4NDB A;  1QXP A;  3BUX B;  3O4X A;  1JC2 A;  1TUZ A;  5ER5 A;  5DKR A;  3NSI A;  2MLF C;  2CTN A;  1A03 A;  2WC5 A;  1ODB A;  2K8M B;  3NHI A;  2LLU A;  1CMF A;  1WRZ A;  2QEB A;  1KFU S;  2HPS A;  1G4Y R;  3FWB A;  4YBH B;  2KI4 B;  4GPL B;  1OOI X;  2EHB A;  2LP2 A;  3TS5 B;  4M2P A;  4F7F A;  1YUU A;  3D75 A;  1YUR A;  2KAY A;  1IKU A;  2K61 A;  2WCJ A;  4DCK A;  1KWO B;  1XFW O;  2K7C A;  4YGB B;  3TDU A;  5I2O A;  1EL4 A;  3PSR A;  3VB1 A;  3PM8 A;  3I5G B;  1GJY A;  3CDN A;  3RLZ A;  3BUO B;  5DKQ A;  1F70 A;  2CCM A;  2JT0 A;  2GV5 A;  3PFV A;  1OSA A;  3VRP A;  2LHL A;  3A4U B;  1KFU L;  1LIN A;  3SS4 A;  1XFR A;  1J1E A;  1C7V A;  2OS8 B;  1CFP A;  1IIO A;  3OX5 A;  4U8D A;  1CMG A;  1A75 A;  3OB1 B;  1DJI A;  1Q80 A;  1KSO A;  4PHJ A;  4PE0 A;  5CSF A;  2COL B;  3WHT B;  2FOT A;  1OOH A;  2BCX A;  3CZ2 A;  1DGU A;  3CAB A;  5DIC A;  4CFR A;  1SR6 C;  2L5X B;  4OV2 A;  1B8L A;  3CS1 A;  3CZT X;  2KYF A;  3R72 A;  2ISD A;  3D0Y B;  4JWQ A;  3B86 A;  1TNX A;  3B87 A;  1IGV A;  5J3X A;  1A29 A;  4CLN A;  2AUC A;  2QDI A;  1QJT A;  3B88 A;  3EK4 A;  1AP4 A;  2AMI A;  4QJ4 B;  1B7T Z;  1LA0 A;  1KFX S;  3O4Y A;  2G9B A;  2K7D A;  2KLE A;  2LMU A;  3FE6 A;  2A4J A;  4HSZ A;  2ZKM X;  5ER4 X;  2NCP A;  3DZT A;  2NXQ A;  4N5X A;  2L98 A;  2NZ0 A;  4WRI A;  2JRF A;  1ALW A;  1SSE B;  3IF7 A;  1QTX A;  1YRT B;  1Z2C B;  1DGV A;  3NSK A;  1LA3 A;  3EKH A;  3S0E A;  1CKK A;  1IG5 A;  1SCM B;  1QX2 A;  3GOF A;  5HKY A;  4YI8 A;  1QX7 A;  3PN7 C;  1IWQ A;  3TUY B;  4D1E A;  2JQ6 A;  4INX A;  1W7I B;  2K0J A;  1CLM A;  2OTG B;  1OOG A;  1TN4 A;  2LLT A;  4NDD A;  2M0R A;  1MUX A;  1S36 A;  2I18 A;  2M1K B;  3SG7 A;  5B8I B;  4FQO A;  2WCM A;  1KK8 C;  4GGF C;  3GK4 X;  4MVF A;  1B1G A;  2M8U A;  1ZFS A;  1WRK A;  3S0G A;  3EK8 A;  2LHI A;  1EG3 A;  2LUX A;  1TNQ A;  2F2P A;  1MXE A;  4MRX A;  1M39 A;  2BL0 C;  2ZNE A;  4N1G A;  4GUK A;  1BJF A;  4I5J A;  1SKT A;  1PK0 D;  4ETO A;  3I5I B;  1A75 B;  3KHE A;  2L50 A;  1OOJ A;  1W7J B;  2PAS A;  1JFK A;  2GGM A;  3EKJ A;  1AVS A;  2JTZ A;  2K2A A;  1XFV O;  1JBA A;  2F2O A;  4DS7 A;  2LM5 A;  3B7A A;  5I2L A;  1N2D A;  4KYN A;  5FI7 A;  3N7H A;  1NX2 A;  4FQT A;  2I94 A;  1L2O B;  2LMV A;  3KF9 A;  2LVJ A;  3SG3 A;  1PAL A;  4QJ3 B;  1QLK A;  1Y1X A;  1YX7 A;  1NCX A;  1OMD A;  1K9K A;  1F4O A;  1SL9 A;  3FE8 A;  4GAO A;  1K93 D;  1PVA A;  4MZK A;  3VRN A;  5HL1 A;  3OBV A;  1IJ6 A;  1SL7 A;  1SBJ A;  1TCO B;  3CR4 X;  4NDC A;  3WHU B;  1MXL C;  1BMO A;  3O78 A;  2FJU B;  4ZCU A;  1JFJ A;  2MAZ A;  1DEL A;  1YUT A;  1NUB A;  2D8N A;  1Y0V H;  4AQJ A;  1J7Q A;  2KGB C;  2MLE C;  3CZ1 A;  5FI6 A;  3IQQ A;  4CFQ A;  1JSA A;  4I5K A;  3K21 A;  3DVK A;  1DJZ A;  1UWO A;  3JTD B;  1H8B A;  3SIA A;  1J55 A;  4HRH A;  1RRO A;  3BOW A;  1TCF A;  2PAL A;  4XJK A;  2P6B B;  2WND A;  1F4Q A;  1TWO A;  1AJ4 A;  3D73 A;  5I8N A;  4QJ5 B;  1QAS A;  2Q91 A;  4GGN A;  1P28 A;  1UUS A;  3JVT B; 
#chains in the Genus database with same CATH homology
 5GQQ C;  1BOC A;  2DOQ A;  2LVI A;  1ZUZ A;  2SCP A;  2JT3 A;  3AAJ A;  1RTP 1;  2Y5I A;  4M2Q A;  1NCY A;  2R2I A;  1KSM A;  2LVV A;  3DD4 A;  3SJS A;  1K2H A;  5BPJ A;  3KPX A;  3AKA A;  1KQV A;  1UHJ A;  1AJ5 A;  1DTL A;  4E68 A;  1CNP A;  1K94 A;  1YVH A;  1OMR A;  3M0W A;  4MBE A;  1EXR A;  2KDH A;  3CR5 X;  2KQY A;  5IBW A;  2LAP A;  1XK4 C;  1KK7 Y;  1K96 A;  1C7W A;  1N65 A;  2Y4Q A;  3BXK A;  1ZOT B;  2CXJ A;  2L4I A;  3I5F B;  4USL A;  1DJY A;  1IRJ A;  4BY4 A;  3SG5 A;  4JQ0 D;  2M29 A;  1J7R A;  4WQ2 A;  1F71 A;  2LUC A;  1RFJ A;  2SAS A;  1CFF A;  3O2P A;  3WNX B;  1WDC C;  3F45 A;  5I2Q A;  1NX0 A;  1V1F A;  2M7N A;  4GGF A;  2F8P A;  4YGE B;  1SNL A;  3SG6 A;  1M45 A;  2M97 A;  3CR2 A;  3KO0 A;  2JTT A;  4MN0 A;  5AER A;  2HET A;  2JC2 A;  1Y6W A;  5K89 A;  2BCA A;  1YR5 A;  1FPW A;  1UHI A;  4BY5 A;  2MBX A;  2JU0 A;  1FI6 A;  2I2R E;  1H4B A;  1CLB A;  2JXC A;  1S6C A;  2BBN A;  3BOW B;  3SG2 A;  3VRR A;  1TTX A;  1J1D A;  4XJK B;  1KCY A;  2O5G A;  1IQ3 A;  4ORA B;  1XVJ A;  2F3Y A;  1KQM C;  1M46 A;  1U5I A;  4MZL A;  3I5H C;  2PMY A;  2BEC A;  2K2F A;  4OVN F;  3SG4 A;  3LCP C;  4XYN A;  1WRL A;  1F54 A;  1JUO A;  4TNC A;  1SR6 B;  3LK0 A;  5G08 A;  1A4P A;  1UHK A;  2M49 B;  2H61 C;  1CM1 A;  3RM1 A;  4PHN A;  2KAX A;  2TN4 A;  1K8U A;  1OZO A;  5CSI A;  2O60 A;  2WOR A;  3CTN A;  1PVB A;  3MSE B;  4HRE E;  2CBL A;  3QRX A;  2BKH B;  2KFG A;  3LLE A;  1R6P A;  1J7P A;  1UHN A;  1B8R A;  1AHR A;  1B8C A;  1QVI Z;  2LE9 B;  4C0L A;  1MQ1 A;  1VRK A;  3DF0 A;  4OCI A;  4A4C A;  1BR1 B;  1OZS A;  1QX5 B;  1CFC A;  1S1E A;  1CDM A;  1DJX A;  1REC A;  1SYM A;  4DIR A;  1YRU B;  1L7Z A;  1NIW A;  3EVR A;  2M1U A;  5JJG A;  3HCM A;  1B47 A;  1QIV A;  3SIB A;  1CDP A;  2Y1N A;  3EVU A;  3PN7 B;  2KHN A;  2L2E A;  2KFF A;  5CSJ A;  3VRO A;  1F55 A;  1XFY O;  2ZN8 A;  3ZWH A;  4C0K A;  2EC6 C;  2LAN A;  3HX4 A;  2F33 A;  5CPV A;  2VRG A;  1K90 D;  1B9A A;  2MRD A;  3DVJ A;  4ORC B;  1KK8 B;  1WY9 A;  1XO5 A;  2K7O A;  4YGC B;  1YVL A;  5HYD A;  1CTR A;  1NWD A;  2LVK A;  1S26 D;  2KSP A;  4ICB A;  5HKW A;  1ZMZ A;  2LNK A;  1QAT A;  1K9P A;  1SL8 A;  2KGR A;  4AQI A;  2BL0 B;  4ZCV A;  2ZND A;  4UPG A;  3TDZ A;  2WC8 A;  3C1V A;  1UP5 A;  1A2X A;  1DJW A;  2M3W A;  1BOD A;  1S6I A;  1CDL A;  4I5L B;  1PUL A;  4AOM A;  1U5I B;  1YTZ C;  4OR9 B;  1TIZ A;  3A8R A;  4PCW A;  5JOL A;  5D69 A;  1LKJ A;  1QS7 A;  1OMV A;  2BBM A;  1R2U A;  2KI6 C;  1XK4 A;  4Q04 A;  3TDI A;  1B7T Y;  3KEV A;  2E6W A;  1B4C A;  2BE4 A;  5HLV A;  2JXL A;  4HRG A;  2MA2 A;  1J7O A;  2KI4 C;  2M7L A;  1BF5 A;  3TS5 C;  3D10 A;  2CT9 A;  2L0P A;  2JOJ A;  1RWY A;  2KI6 D;  2E30 A;  3BQ3 A;  1KWO C;  1SPY A;  4YRU A;  1Y1A A;  2LCP A;  3DF0 B;  1IQ5 A;  3IQO A;  3NSO A;  1CLL A;  3I5G C;  4I5N B;  3FIA A;  3NSL A;  1NCZ A;  3LL8 B;  2JNX A;  1XA5 A;  1BG1 A;  4WQ3 A;  1CDN A;  1S5G Z;  4IL1 A;  1E8A A;  1LVC D;  3OX6 A;  4DRW A;  3OB2 B;  1DF0 A;  2FCD A;  1ZAC A;  2OS8 C;  2NLN A;  1DT7 B;  3I5F C;  1OE9 B;  3BUW B;  3H4S E;  1NP8 A;  4GBA A;  1AUI B;  3OHM B;  1HQV A;  2JZI A;  1G33 A;  1F8H A;  4P5O E;  1MWN A;  1QVI Y;  2JNF A;  3GK2 A;  1GGZ A;  3E3R A;  3NXA A;  4R1E A;  2KQ6 A;  1K9U A;  4PAL A;  1LXF C;  4A4B A;  3PLF B;  1MF8 B;  1NSH A;  2BCB A;  2H61 A;  2MHH A;  1UUR A;  1SCV A;  4PE7 A;  1GQM A;  2PVB A;  2OPO A;  5CSN A;  4CID A;  1MHO A;  5D7F A;  2QPT A;  4PDZ A;  2HF5 A;  1PRW A;  2HQ8 A;  4F0Z B;  1M63 B;  5PAL A;  2LMT A;  1IJ5 A;  2KBM A;  1SCM C;  1SK6 D;  2Y1M A;  4M2O A;  2WCB A;  1JF2 A;  1BR4 B;  4ORB B;  2K7B A;  1V1G A;  3BUN B;  1M31 A;  1AK8 A;  3TUY C;  1YUS A;  4MEW A;  1FW4 A;  2V53 A;  2OTG C;  4N1F A;  1CB1 A;  1MR8 A;  2FCE A;  3DVE A;  3BYA A;  5HKZ A;  1QV0 A;  4MRY A;  1EG4 A;  2CNP A;  1XFX O;  1WDC B;  1QIW A;  1RJV A;  1SW8 A;  4MLW A;  3CGA A;  1NPQ A;  4YGD B;  5AFP A;  2EGD A;  1TOP A;  5FYX A;  1OQP A;  4MZJ A;  2ZRT A;  1DF0 B;  2IS9 A;  2JPT A;  3EK7 A;  2KYC A;  3I5I C;  2JWW A;  1EH2 A;  2ZFD A;  1XFZ O;  4PHM A;  2BKI B;  2MJW B;  4OKH A;  1JF0 A;  2I7A A;  1DJH A;  3O6B A;  2QAC A;  4CPV A;  2M9G A;  1S3P A;  2ZRS A;  1CFD A;  2NCO A;  1DMO A;  1KFX L;  1KQM B;  2LP3 A;  2JT8 A;  2Q4U A;  2LV7 A;  3I5H B;  4MSP A;  1C07 A;  2LC5 A;  2KBI A;  3AAK A;  4L9M A;  4P2Y B;  4DUQ A;  1SY9 A;  1L2O C;  2KNE A;  1X02 A;  2F3Z A;  1NYA A;  2LLS A;  1S5G Y;  1PSB A;  1KK7 Z;  1Y1U A;  3TZ1 A;  2WCF A;  1JWD A;  4YI9 A;  5AEQ A;  5AAN A;  5KU1 A;  5AXI A;  1DJG A;  3AKB A;  1SRA A;  3FS7 A;  1BT6 A;  3GK1 A;  4NQG A;  3CLN A;  1QV1 A;  4GFT A;  2WOS A;  4PHK A;  3VRQ A;  3ZNI A;  2GGZ A;  1D1O A;  3ICB A;  3PAL A;  2G2B A;  4YGA A;  1GGW A;  2BE6 A;  3WXA A;  2AAO A;  1YX8 A;  1CM4 A;  2PSR A;  3BUM B;  3LK1 A;  4JPZ B;  1K95 A;  5KSZ A;  2HQW A;  2KAV A;  3EVV A;  3JTD C;  1NX3 A;  2WCE A;  1NX1 A;  1FI5 A;  2KOT A;  3VGO A;  4GNK B;  2RGI A;  1FF1 A;  1XYD A;  1BU3 A;  3PAT A;  3FWC A;  1WLZ A;  2EC6 B;  5KTY A;  1TRF A;  2L4H A;  5DKN A;  3DVM A;  4PE1 A;  1G8I A;  1HT9 A;  1PSR A;  1TNW A;  3JVT C;  5HLO A;  1EJ3 A;  1UHH A;  1BLQ A;  1ALV A;  2L51 A;  1DVI A;  1S6J A;  5TNC A;  1RK9 A;  1IH0 A;  1TNP A;  1XFU O;  3D0Y A;  1WLM A;  4PE4 A;  2B1U A;  2PRU A;  1FBV A;  3OP0 A;  1QLS A;  3CWG A;  2H2K A;  2JUL A;  4FTG A;  2ZN9 A;  2KFH A;  4C0J A;  1SMG A;  1N0Y A;  5F6T A;  4NDB A;  1QXP A;  3BUX B;  1JC2 A;  5ER5 A;  5DKR A;  3NSI A;  2MLF C;  2CTN A;  1A03 A;  1ODB A;  2K8M B;  2LLU A;  1CMF A;  1WRZ A;  1KFU S;  2HPS A;  1G4Y R;  3FWB A;  4YBH B;  2KI4 B;  4GPL B;  2EHB A;  2LP2 A;  3TS5 B;  4M2P A;  1YUU A;  1YUR A;  2KAY A;  1IKU A;  2K61 A;  4DCK A;  1KWO B;  1XFW O;  2K7C A;  4YGB B;  3TDU A;  5I2O A;  1EL4 A;  3PSR A;  3PM8 A;  3I5G B;  1GJY A;  3RLZ A;  3BUO B;  5DKQ A;  1F70 A;  2CCM A;  2JT0 A;  2GV5 A;  3PFV A;  1OSA A;  3VRP A;  2LHL A;  3A4U B;  1KFU L;  1LIN A;  1J1E A;  1C7V A;  2OS8 B;  1CFP A;  3OX5 A;  4U8D A;  1CMG A;  1A75 A;  3OB1 B;  1DJI A;  1Q80 A;  1KSO A;  4PHJ A;  4PE0 A;  5CSF A;  2COL B;  3WHT B;  2FOT A;  2BCX A;  1DGU A;  4CFR A;  1SR6 C;  2L5X B;  4OV2 A;  1B8L A;  3CS1 A;  3CZT X;  2KYF A;  2ISD A;  3D0Y B;  4JWQ A;  1TNX A;  4CLN A;  1IGV A;  5J3X A;  1A29 A;  2AUC A;  1AP4 A;  1QJT A;  3EK4 A;  2AMI A;  4QJ4 B;  1B7T Z;  1LA0 A;  1KFX S;  3O4Y A;  2G9B A;  2K7D A;  2LMU A;  2A4J A;  4HSZ A;  2ZKM X;  5ER4 X;  2NCP A;  4N5X A;  2NXQ A;  2L98 A;  2NZ0 A;  4WRI A;  2JRF A;  1ALW A;  3IF7 A;  1QTX A;  1YRT B;  3NSK A;  1DGV A;  1CKK A;  1LA3 A;  3EKH A;  1IG5 A;  1SCM B;  1QX2 A;  3GOF A;  5HKY A;  4YI8 A;  1QX7 A;  3PN7 C;  1IWQ A;  3TUY B;  4D1E A;  2JQ6 A;  1W7I B;  2K0J A;  1CLM A;  2OTG B;  1TN4 A;  2LLT A;  4NDD A;  2M0R A;  1MUX A;  1S36 A;  2I18 A;  2M1K B;  3SG7 A;  5B8I B;  4FQO A;  4GGF C;  1KK8 C;  4MVF A;  3GK4 X;  1B1G A;  2M8U A;  1ZFS A;  1WRK A;  3EK8 A;  2LHI A;  1EG3 A;  2LUX A;  1TNQ A;  2F2P A;  1MXE A;  4MRX A;  1M39 A;  2BL0 C;  2ZNE A;  4N1G A;  4GUK A;  1BJF A;  4I5J A;  1SKT A;  1PK0 D;  4ETO A;  3I5I B;  1A75 B;  3KHE A;  2L50 A;  1OOJ A;  1W7J B;  2PAS A;  1JFK A;  2GGM A;  3EKJ A;  1AVS A;  2JTZ A;  2K2A A;  1XFV O;  1JBA A;  2F2O A;  4DS7 A;  2LM5 A;  5I2L A;  1N2D A;  1NX2 A;  2I94 A;  1L2O B;  2LMV A;  3KF9 A;  2LVJ A;  3SG3 A;  1PAL A;  4QJ3 B;  1QLK A;  1Y1X A;  1YX7 A;  1NCX A;  1OMD A;  1K9K A;  1F4O A;  1SL9 A;  4GAO A;  1K93 D;  1PVA A;  4MZK A;  3VRN A;  1IJ6 A;  1SL7 A;  1SBJ A;  1TCO B;  3CR4 X;  4NDC A;  3WHU B;  1MXL C;  1BMO A;  3O78 A;  2FJU B;  4ZCU A;  1JFJ A;  2MAZ A;  1YUT A;  1NUB A;  2D8N A;  1Y0V H;  4AQJ A;  1J7Q A;  2KGB C;  2MLE C;  4CFQ A;  3IQQ A;  1JSA A;  4I5K A;  3K21 A;  3DVK A;  1DJZ A;  1UWO A;  3JTD B;  1H8B A;  3SIA A;  1J55 A;  4HRH A;  1RRO A;  3BOW A;  1TCF A;  2PAL A;  4XJK A;  2P6B B;  2WND A;  1F4Q A;  1AJ4 A;  5I8N A;  4QJ5 B;  1QAS A;  2Q91 A;  4GGN A;  1UUS A;  3JVT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...