2K7BA

Nmr structure of mg2+-bound cabp1 n-domain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
76
structure length
76
Chain Sequence
b'DRSLRPEEIEELREAFREFDKDKDGYINCRDLGNCMRTMGYMPTEMELIELSQQINMNLGGHVDFDDFVELMGPKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calcium-binding protein 1
publication title NMR structure of Mg2+-bound CaBP1 N-domain
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 14
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2008-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2k7bA00
5F6TA 4I5JA 1DJGA 1JSAA 1XFXO 2GV5A 1KQVA 3PSRA 2L4IA 3BUOB 5D7FA 2LNKA 4CIDA 2M9GA 4M2OA 1DGVA 1QLKA 2JC2A 4MRYA 4CPVA 2AAOA 4UPGA 2KFGA 3VRPA 1DTLA 1QASA 1MXEA 3NSLA 4HRGA 5AXIA 1BG1A 1NIWA 2PVBA 1FI6A 5BPJA 4DRWA 4GGFC 2F8PA 1ZFSA 1DF0A 1RECA 4PHMA 1J7PA 1U5IA 1WRZA 4R1EA 4ZCVA 3KF9A 4NDBA 5DKNA 3D10A 1Y1AA 2HQWA 5CSFA 1DJYA 2M0RA 2KQ6A 1A29A 2L51A 2I2RE 2LAPA 1RROA 2QACA 1B4CA 3DVJA 1YRUB 3PLFB 3SG4A 4CFRA 1CMFA 1CKKA 2O60A 3FS7A 1HT9A 1M63B 1B9AA 4GPLB 2H2KA 2MAZA 5FYXA 2JRFA 1XVJA 2M97A 1M46A 1SR6B 1NSHA 5J3XA 2KI6C 1D1OA 1DJZA 3CLNA 5DKQA 1ALVA 4QJ5B 1K94A 1KFUL 1ZACA 4MSPA 1OMDA 2E6WA 2ZNDA 1QIVA 3CWGA 4NDDA 3OX6A 3JTDB 2KBIA 3WXAA 2JWWA 2LC5A 1Y1XA 1S3PA 2BCBA 1BODA 1JFKA 2JQ6A 1WLMA 1XK4C 3RLZA 4FQOA 2KYFA 1ALWA 1NPQA 4PHNA 2D8NA 1XA5A 1J7OA 4QJ3B 1RWYA 1OQPA 4AQIA 3K21A 1WY9A 1M31A 1V1FA 4YI8A 1OZSA 1KWOC 1OMRA 1UURA 3AKAA 4N1GA 1UHKA 3I5FB 1Y6WA 4MZJA 4WRIA 1PSBA 3I5IC 5I2OA 2I7AA 5KSZA 2MRDA 1CMGA 2K7OA 1EG3A 1W7JB 1Y0VH 3CGAA 3TS5C 2K7DA 3IQOA 1V1GA 3EKJA 2G9BA 2KNEA 3SG6A 1TCFA 1TIZA 4C0JA 3CZTX 3TDZA 2LANA 1WRKA 2M8UA 3C1VA 2EC6B 4L9MA 3SIBA 4OV2A 2MJWB 4MZKA 5TNCA 1IH0A 2BBMA 3BYAA 3SG7A 1KFXS 2E30A 1M45A 2BECA 3NSOA 1SCMB 1M39A 2BL0C 1VRKA 1KFXL 1K9KA 2LM5A 2FCEA 1S6JA 4ZCUA 1PK0D 2L98A 2WOSA 4A4CA 2AUCA 2GGZA 2OTGC 2NLNA 3BOWB 5HLOA 1XFUO 2GGMA 2I94A 4M2QA 1C7WA 3M0WA 1NUBA 1E8AA 2OPOA 2F33A 2BCXA 5AERA 4JWQA 3OP0A 2K61A 3FIAA 5HKWA 2NCPA 4NDCA 1YVHA 4YGAA 3LK1A 4ICBA 1S1EA 1ZMZA 2KHNA 3GK1A 1PULA 1G4YR 1EH2A 2BE6A 2B1UA 2SCPA 1L2OB 4MEWA 5HKYA 4ORCB 2NZ0A 3PN7C 2LVIA 1RK9A 1J1EA 4DIRA 1TN4A 4N5XA 1F4OA 3PM8A 4PE0A 1GJYA 1SNLA 3RM1A 1YUTA 1QVIY 3TUYB 2M49B 2JNFA 3SIAA 1XFYO 4OVNF 1B47A 4ETOA 1S6CA 3JVTB 2L0PA 3D0YB 2KQYA 1WDCB 1TNQA 2JULA 2QPTA 1CDNA 2IS9A 2K0JA 1LVCD 4AOMA 2LUCA 2HPSA 3OB1B 2M3WA 1RFJA 1KK8B 2CBLA 4TNCA 2WC8A 3IQQA 4GUKA 2COLB 3O2PA 2PRUA 1Q80A 2ZN9A 3FWCA 4USLA 4PE7A 1RJVA 1QXPA 1B8CA 3I5GB 4YGDB 1QJTA 4HRHA 1BF5A 1B8RA 1CLMA 1IJ6A 2M29A 3BUMB 3EK4A 3TDIA 3VRQA 2KI4C 2WCFA 2KGRA 2JT0A 4CFQA 1B1GA 1K9PA 2L2EA 2Y5IA 2ZRTA 1J7RA 1KK7Y 2LVVA 4MVFA 1H4BA 3LK0A 1JBAA 3MSEB 2FCDA 1IGVA 4XJKB 4DS7A 1XFZO 1B7TY 1UHNA 2F3ZA 4FTGA 4I5LB 1NCZA 1EL4A 1YTZC 1YX7A 3DD4A 3KHEA 3A4UB 1KFUS 4WQ3A 3D0YA 1A75B 3TDUA 4PHJA 1IWQA 1SMGA 3NXAA 1QX5B 3AAKA 3KEVA 5JOLA 1UHJA 1TNPA 1K93D 2JXLA 1QV1A 2I18A 2VRGA 1A4PA 4PCWA 2PMYA 4MBEA 2OS8B 1NX0A 1J55A 2K2FA 1NP8A 1DJHA 1ODBA 2NCOA 5AANA 1C7VA 1CB1A 1DMOA 1MUXA 1S6IA 4JPZB 1PSRA 1NX2A 4OR9B 4P2YB 1SL9A 1FW4A 1TTXA 4YRUA 2ZRSA 3NSKA 3LL8B 4GFTA 1GQMA 5B8IB 1CDMA 2KFHA 1CLBA 1NYAA 1QIWA 3HX4A 3WHTB 3AKBA 3CS1A 4F0ZB 1TOPA 2ZFDA 4YGCB 4YI9A 4C0KA 1B7TZ 1IKUA 1LXFC 1OSAA 1SL8A 1QLSA 3DVEA 1AK8A 1PALA 2L50A 3O6BA 1BR1B 1TRFA 2NXQA 3CTNA 1RTP1 1K95A 2LP3A 1SBJA 2JTZA 2TN4A 1K2HA 1SW8A 4PDZA 5HKZA 1AUIB 1XYDA 3GK2A 1C07A 1OMVA 2R2IA 4YGBB 2F2OA 2KFFA 2JT3A 5D69A 4U8DA 2CT9A 4PHKA 1QS7A 2BCAA 3VRRA 1J1DA 4ORBB 1IJ5A 1NWDA 2K7BA 4GGNA 1G33A 3HCMA 1XO5A 2CNPA 5CSIA 4BY5A 1IRJA 3DVMA 5G08A 1AHRA 4N1FA 1YR5A 3AAJA 1UWOA 5JJGA 1S5GY 1N0YA 3SG2A 1PVAA 1CFPA 1GGWA 3EKHA 3KO0A 2JPTA 4Q04A 2Y1MA 4PE1A 1K9UA 1N2DA 5ER5A 3SG3A 4GBAA 5AEQA 3LLEA 2LCPA 1SCVA 2WCEA 1LKJA 1WLZA 2LLUA 1XFWO 1CFCA 4ORAB 2OTGB 2JTTA 3PFVA 2V53A 3FWBA 5CPVA 1NCXA 2ZKMX 5I2QA 3JVTC 3I5HB 5PALA 4JQ0D 1DGUA 1SRAA 1WDCC 1KSOA 1XFVO 1KQMB 1S36A 1AJ4A 1IG5A 5HYDA 1DF0B 2KAXA 4I5NB 4YBHB 1YRTB 2Q4UA 4I5KA 3EVUA 1AJ5A 2HQ8A 4OKHA 2LLSA 1J7QA 2PSRA 1NX1A 1F8HA 5KU1A 1KK8C 3OB2B 4OCIA 1DVIA 1DJXA 1F71A 3PN7B 3QRXA 4MRXA 1BMOA 1YX8A 1TNXA 2BKIB 3BUWB 3EVVA 1JC2A 3BOWA 1MF8B 4DCKA 2A4JA 4YGEB 1S5GZ 2MA2A 3GOFA 3ICBA 4MN0A 4MLWA 1DJIA 2LUXA 4NQGA 1UP5A 3H4SE 1CLLA 2ZN8A 1A03A 2ISDA 3LCPC 1BR4B 1OZOA 2K2AA 4C0LA 3CR5X 3O4YA 2KAVA 1FPWA 2CTNA 2HETA 2LMTA 3BXKA 1BJFA 2M1KB 1DT7B 1QVIZ 1S26D 2PALA 1YVLA 1SYMA 2JZIA 2BKHB 2O5GA 4BY4A 1Y1UA 1LINA 1FBVA 2Y1NA 3CR4X 3DVKA 4DUQA 2JT8A 1ZOTB 1JWDA 2CCMA 2MLFC 4P5OE 3BUXB 2KYCA 1LA0A 1SR6C 1F4QA 1QX2A 5GQQC 2KI4B 2JXCA 1SY9A 2Y4QA 1KSMA 3JTDC 2LHIA 1YUUA 3GK4X 1QX7A 1LA3A 1TCOB 3DF0B 2F2PA 1QATA 5KTYA 1JUOA 2H61A 2L5XB 2OS8C 2Q91A 2EHBA 1CFFA 3EVRA 1DJWA 1K8UA 4M2PA 2LE9B 3VRNA 1OE9B 1YUSA 5HLVA 2JU0A 2FJUB 1FF1A 2LP2A 1UHHA 2F3YA 3BQ3A 1HQVA 3I5FC 3WNXB 1KK7Z 2LMUA 1JF0A 1CDPA 1CM4A 1IQ5A 4QJ4B 1K96A 2CXJA 2HF5A 2BBNA 5I2LA 1IQ3A 1K90D 5K89A 1PRWA 2WNDA 4GNKB 1UUSA 1SL7A 2MLEC 3TZ1A 2JNXA 5DKRA 4XJKA 2K7CA 3WHUB 1F70A 3A8RA 4XYNA 2EGDA 2MHHA 1QTXA 1CM1A 2EC6C 4A4BA 1BOCA 1QV0A 4MZLA 2L4HA 3OHMB 4GGFA 4E68A 3F45A 1A75A 1JF2A 3ZWHA 1R6PA 3BUNB 1KWOB 1ZUZA 2BE4A 2M7LA 2JOJA 2M7NA 1SCMC 1X02A 1PVBA 3EK8A 1JFJA 3KPXA 2PASA 3I5IB 1EG4A 1R2UA 5CSNA 2ZNEA 3DF0A 4HSZA 3TS5B 3NSIA 3IF7A 1YURA 3SG5A 2P6BB 1G8IA 1L7ZA 4D1EA 5ER4X 5IBWA 2G2BA 3EK7A 1CFDA 3SJSA 1F54A 2K8MB 2RGIA 1NCYA 1GGZA 3O78A 1BLQA 2AMIA 1N65A 1AVSA 1EXRA 1L2OC 1BT6A 1W7IB 4PALA 4PE4A 1UHIA 1MR8A 1B8LA 1SK6D 2BL0B 5I8NA 1KCYA 2LMVA 4WQ2A 5CSJA 1MQ1A 3TUYC 1TNWA 3CR2A 1SPYA 1XK4A 3E3RA 3I5HC 1FI5A 1AP4A 1KQMC 2LLTA 2MBXA 3PALA 2KDHA 2KOTA 3VROA 1U5IB 4CLNA 1MHOA 3ZNIA 4AQJA 1NX3A 1H8BA 2LVJA 1CDLA 3VGOA 2KAYA 4IL1A 2KBMA 1EJ3A 1MXLC 1MWNA 1OOJA 2FOTA 2LHLA 2LV7A 4HREE 1CNPA 3OX5A 2KI6D 2H61C 2LVKA 1SKTA 2WORA 3PATA 4GAOA 2KGBC 2WCBA 1BU3A 3I5GC 1F55A 2SASA 1CTRA 2KSPA 5AFPA 2M1UA 1A2XA 1WRLA 2DOQA
chains in the Genus database with same CATH superfamily
5F6TA 4I5JA 3B6XA 1DJGA 1JSAA 1XFXO 2GV5A 1KQVA 3PSRA 2L4IA 3BUOB 5D7FA 2LNKA 4CIDA 2M9GA 4M2OA 1DGVA 1QLKA 2JC2A 4MRYA 4CPVA 2AAOA 4UPGA 3CZ1A 2KFGA 3VRPA 2KPHA 1DTLA 1QASA 1MXEA 3NSLA 4HRGA 5AXIA 1BG1A 1NIWA 2PVBA 1FI6A 5BPJA 4DRWA 4GGFC 2F8PA 1ZFSA 3B86A 3B87A 1DF0A 1RECA 4PHMA 1J7PA 1U5IA 1WRZA 4R1EA 4ZCVA 3KF9A 4NDBA 5DKNA 3D10A 1Y1AA 5FI7A 2HQWA 5CSFA 1DJYA 2M0RA 2KQ6A 1A29A 2L51A 1OOHA 2I2RE 2LAPA 1RROA 2QACA 1B4CA 3DVJA 1YRUB 3PLFB 3SG4A 4CFRA 1CMFA 1CKKA 2QEVA 2O60A 3FS7A 1HT9A 1M63B 1B9AA 4GPLB 2H2KA 2MAZA 5FYXA 2JRFA 1XVJA 2M97A 1M46A 1SR6B 1NSHA 5J3XA 1C07A 2KI6C 1D1OA 1DJZA 3CLNA 5DKQA 1ALVA 3O4XA 4QJ5B 1K94A 1KFUL 1ZACA 4MSPA 1OMDA 2E6WA 2ZNDA 1OOGA 1QIVA 3D77A 3CWGA 4NDDA 3OX6A 3JTDB 2KBIA 3WXAA 2JWWA 2LC5A 1Y1XA 3B88A 1S3PA 2BCBA 1BODA 1JFKA 2JQ6A 1WLMA 1XK4C 3RLZA 4FQOA 3D78A 2KYFA 1ALWA 1NPQA 3NHIA 4PHNA 2D8NA 1XA5A 1J7OA 4QJ3B 3L47A 1RWYA 1OQPA 4AQIA 3K21A 1WY9A 1M31A 1V1FA 4YI8A 1OZSA 1KWOC 1OMRA 1UURA 2JPOA 3AKAA 4N1GA 1UHKA 3I5FB 1Y6WA 4MZJA 4WRIA 1PSBA 3I5IC 5I2OA 2I7AA 5KSZA 4INXA 2MRDA 1CMGA 2K7OA 1EG3A 1W7JB 1Y0VH 3CGAA 1TWOA 3TS5C 2K7DA 3IQOA 1V1GA 3EKJA 1DELA 2G9BA 2KNEA 1TCFA 1TIZA 3SG6A 3CZTX 3TDZA 4C0JA 2LANA 1WRKA 2M8UA 3C1VA 3CZ0A 2EC6B 4L9MA 3SIBA 4OV2A 2MJWB 4MZKA 5TNCA 1Z4HA 2BBMA 2K60A 3DXLA 3UNWA 1IH0A 2PYQA 3BYAA 3SG7A 1KFXS 2E30A 1M45A 2L5YA 2BECA 3NSOA 1SCMB 1M39A 1Z2CB 1VRKA 1KFXL 1K9KA 2BL0C 2FCEA 2LM5A 1S6JA 4ZCUA 1PK0D 2L98A 2WOSA 4A4CA 2AUCA 2GGZA 2OTGC 2NLNA 3BOWB 5HLOA 1XFUO 2GGMA 2I94A 4M2QA 1C7WA 3M0WA 1NUBA 1E8AA 2OPOA 2F33A 2BCXA 5AERA 2KLEA 4JWQA 3OP0A 2K61A 3FIAA 5HKWA 2NCPA 4NDCA 1YVHA 5DICA 2WC5A 3DZTA 4YGAA 3LK1A 4ICBA 1S1EA 1ZMZA 1TUZA 2KHNA 3GK1A 1PULA 1G4YR 1EH2A 2BE6A 2B1UA 2SCPA 1L2OB 4MEWA 5HKYA 4ORCB 2NZ0A 3PN7C 2LVIA 1RK9A 1J1EA 4DIRA 1TN4A 4N5XA 1F4OA 3PM8A 4PE0A 1GJYA 1SNLA 3RM1A 3CYZA 1YUTA 1QVIY 3TUYB 2M49B 2JNFA 3SIAA 1XFYO 4OVNF 1B47A 4ETOA 3BJHA 1S6CA 3JVTB 1TUJA 2L0PA 2WCJA 2KQYA 1WDCB 3D0YB 1TNQA 2JULA 2QPTA 1CDNA 2IS9A 5FI6A 2K0JA 1LVCD 2BAPA 4AOMA 2LUCA 2HPSA 3OB1B 2M3WA 1RFJA 1KK8B 2CBLA 4TNCA 2WC8A 3R1PA 3IQQA 4GUKA 2COLB 3O2PA 2PRUA 1Q80A 2ZN9A 3FWCA 4USLA 4PE7A 1RJVA 1QXPA 1B8CA 3I5GB 4YGDB 1QJTA 4HRHA 1BF5A 1B8RA 1CLMA 1IJ6A 2M29A 3BUMB 3EK4A 4INWA 3TDIA 3VRQA 2KI4C 2WCFA 3DY9A 2KGRA 2JT0A 4CFQA 1B1GA 1K9PA 2L2EA 1W9ZA 2Y5IA 2ZRTA 1J7RA 1KK7Y 2LVVA 4MVFA 1H4BA 3LK0A 1JBAA 3MSEB 2FCDA 1IGVA 4XJKB 4DS7A 3V2LA 1XFZO 1B7TY 1UHNA 2F3ZA 4FTGA 2PQLA 4I5LB 1NCZA 1EL4A 1YTZC 1YX7A 3DD4A 3KHEA 3A4UB 1KFUS 2WCLA 4WQ3A 3D0YA 1A75B 3TDUA 4PHJA 1IWQA 1SMGA 3NXAA 3PJIA 1QX5B 3L4LA 3AAKA 3KEVA 5JOLA 1UHJA 3SS3A 1TNPA 5D3OA 1K93D 2JXLA 1QV1A 2I18A 2VRGA 1A4PA 4PCWA 2PMYA 4MBEA 1LS8A 2OS8B 1NX0A 1J55A 2K2FA 1NP8A 1DJHA 1ODBA 2NCOA 4PT1A 5AANA 1C7VA 1CB1A 1DMOA 1S6IA 1MUXA 1QWVA 1DEKA 4JPZB 1PSRA 1NX2A 4OR9B 4P2YB 1SL9A 1FW4A 1TTXA 4YRUA 2ZRSA 1T14A 3NSKA 3LL8B 4GFTA 1GQMA 1IIOA 5B8IB 1CDMA 2KFHA 1CLBA 1NYAA 1QIWA 3HX4A 3WHTB 3AKBA 3CS1A 4F0ZB 1TOPA 2ZFDA 4YGCB 1DQEA 4YI9A 4C0KA 1B7TZ 1IKUA 1LXFC 1OSAA 3D76A 1SL8A 2ERBA 1QLSA 3DVEA 1AK8A 1PALA 2WCHA 2L50A 3O6BA 1BR1B 3SS5A 1TRFA 2NXQA 3CTNA 1RTP1 1K95A 2LP3A 1SBJA 2JTZA 2TN4A 1K2HA 1GM0A 1SW8A 4PDZA 5HKZA 1AUIB 1XYDA 3GK2A 3Q8IA 1OMVA 2R2IA 4JKTA 2F2OA 2KFFA 2JT3A 4YGBB 5D69A 3IVTA 4U8DA 2CT9A 4PHKA 4KYNA 1QS7A 2BCAA 3VRRA 1J1DA 4ORBB 1IJ5A 1NWDA 2K7BA 4GGNA 1G33A 3HCMA 1XO5A 2CNPA 5CSIA 4BY5A 1IRJA 3DVMA 5G08A 1AHRA 4N1FA 1YR5A 3AAJA 1UWOA 5JJGA 1S5GY 3NHTA 1N0YA 3SG2A 2H8VA 1PVAA 1CFPA 1GGWA 3EKHA 3KO0A 2JPTA 4Q04A 2Y1MA 4PE1A 1K9UA 1N2DA 5ER5A 3SG3A 4GBAA 5AEQA 3LLEA 2LCPA 1SCVA 2WCEA 1LKJA 1WLZA 2LLUA 3CDNA 1XFWO 4OZDA 1CFCA 4ORAB 1C3ZA 3B7AA 2OTGB 2JTTA 3PFVA 2V53A 3FWBA 5CPVA 1NCXA 2ZKMX 5I2QA 3JVTC 3I5HB 5PALA 4JQ0D 1DGUA 1OOFA 1SRAA 1WDCC 2BNXA 1KSOA 1XFVO 2KLDA 1KQMB 1S36A 1AJ4A 1IG5A 5HYDA 1DF0B 2KAXA 4I5NB 4YBHB 1YRTB 2Q4UA 4I5KA 3EVUA 1AJ5A 2HQ8A 4OKHA 2LLSA 1J7QA 2PSRA 1NX1A 1F8HA 5KU1A 1KK8C 3OB2B 4OCIA 1DVIA 1DJXA 3RZSA 3PN7B 3QRXA 4MRXA 1F71A 1BMOA 3R72A 1YX8A 1C3YA 1TNXA 2BKIB 3BUWB 3EVVA 1JC2A 3R1OA 3BOWA 1MF8B 4DCKA 2A4JA 3S0GA 4YGEB 1S5GZ 2MA2A 3GOFA 3ICBA 4MN0A 1P28A 1DJIA 4MLWA 2P70A 2LUXA 4NQGA 1UP5A 3H4SE 1CLLA 4JD9A 2ZN8A 1A03A 2P71A 2ISDA 1OOIX 3LCPC 1BR4B 1OZOA 2K2AA 4C0LA 3CR5X 3O4YA 2KAVA 1FPWA 3D73A 2CTNA 2HETA 2LMTA 3BXKA 2QEOA 1BJFA 2M1KB 1DT7B 1QVIZ 3FE6A 1S26D 2PALA 1YVLA 3S0BA 1SYMA 2JZIA 2BKHB 2O5GA 3SS4A 4BY4A 1Y1UA 1LINA 1FBVA 2Y1NA 3CR4X 3DVKA 4DUQA 2JT8A 3R1VA 1ZOTB 4F7FA 1JWDA 3S0DA 2CCMA 2MLFC 4FQTA 4P5OE 3BUXB 2KYCA 3NGVA 1LA0A 3S0EA 1SR6C 1F4QA 2QEBA 1QX2A 5GQQC 5FI2A 2KI4B 3S0AA 2JXCA 1SY9A 2Y4QA 1KSMA 3OGNA 3JTDC 2LHIA 2YGUA 1YUUA 3GK4X 1QX7A 1LA3A 5I94A 1TCOB 3DF0B 2F2PA 1QATA 5KTYA 1JUOA 2H61A 2L5XB 2OS8C 2Q91A 2EHBA 1CFFA 3EVRA 1DJWA 1K8UA 4M2PA 2LE9B 5EL2A 3VRNA 1OE9B 1YUSA 5HLVA 2JU0A 2FJUB 1FF1A 2LP2A 1XFRA 1UHHA 2F3YA 3BQ3A 1HQVA 3I5FC 3WNXB 1KK7Z 2LMUA 1JF0A 1CDPA 1CM4A 3BFHA 1IQ5A 4QJ4B 1K96A 1OW4A 2CXJA 2HF5A 2BBNA 5I2LA 1IQ3A 1K90D 5K89A 1PRWA 2WNDA 4GNKB 1UUSA 1SL7A 2MLEC 3TZ1A 2JNXA 2QDIA 5DKRA 3CZ2A 4XJKA 2K7CA 3WHUB 1F70A 3A8RA 4XYNA 2EGDA 2MHHA 2L2CA 1QTXA 1CM1A 2EC6C 2WC6A 4A4BA 1BOCA 1QV0A 4MZLA 2L4HA 3OHMB 4GGFA 4E68A 3F45A 1A75A 1JF2A 3ZWHA 1R6PA 3BUNB 1KWOB 1ZUZA 2BE4A 2M7LA 2JOJA 2M7NA 1SCMC 1X02A 1PVBA 3EK8A 3FE8A 3N7HA 3KPXA 1JFJA 3VB1A 2PASA 3I5IB 1EG4A 1R2UA 5CSNA 2ZNEA 3DYEA 3DF0A 1SSEB 3BFBA 3NSIA 4HSZA 3TS5B 3IF7A 1YURA 2FJYA 2WCKA 2P6BB 3SG5A 1G8IA 1L7ZA 4D1EA 5ER4X 5IBWA 2G2BA 3EK7A 1CFDA 3SJSA 1F54A 2K8MB 2RGIA 1NCYA 3S0FA 3K1EA 1GGZA 3O78A 1DC1A 1BLQA 2AMIA 3L4AA 1N65A 1AVSA 1EXRA 1L2OC 1BT6A 1W7IB 4PALA 4PE4A 1UHIA 1MR8A 1B8LA 1SK6D 2BL0B 5I8NA 2QEHA 1KCYA 2LMVA 4WQ2A 5CSJA 1MQ1A 3TUYC 1TNWA 3CR2A 1SPYA 1XK4A 3BFAA 3E3RA 3I5HC 1FI5A 1AP4A 3UO9A 1KQMC 2LLTA 3PM2A 2MBXA 3PALA 2KDHA 3OBVA 3CABA 2KOTA 3FE9A 3VROA 2GTEA 1U5IB 4CLNA 1MHOA 3QMEA 3ZNIA 4AQJA 1NX3A 1H8BA 2LVJA 1CDLA 3EG5B 3VGOA 3D75A 2KAYA 4IL1A 2KBMA 1EJ3A 1MXLC 1MWNA 1OOJA 2FOTA 2LHLA 2LV7A 4HREE 1CNPA 3OX5A 2KI6D 5HL1A 2H61C 2LVKA 1SKTA 2WORA 3PATA 4GAOA 2KGBC 2WCBA 1BU3A 3I5GC 1F55A 2SASA 4IJ7A 1CTRA 2KSPA 5AFPA 1ORGA 2WCMA 2M1UA 1A2XA 1WRLA 3D74A 2DOQA
chains in the Genus database with same CATH topology
5F6TA 4I5JA 1DJGA 1JSAA 1XFXO 2GV5A 1KQVA 3PSRA 2L4IA 3BUOB 5D7FA 2LNKA 4CIDA 2M9GA 4M2OA 1DGVA 1QLKA 2JC2A 4MRYA 4CPVA 2AAOA 4UPGA 2KFGA 3VRPA 1DTLA 1QASA 1MXEA 3NSLA 4HRGA 5AXIA 1BG1A 1NIWA 2PVBA 1FI6A 5BPJA 4DRWA 4GGFC 2F8PA 1ZFSA 1DF0A 1RECA 4PHMA 1J7PA 1U5IA 1WRZA 4R1EA 4ZCVA 3KF9A 4NDBA 5DKNA 3D10A 1Y1AA 2HQWA 5CSFA 1DJYA 2M0RA 2KQ6A 1A29A 2L51A 2I2RE 2LAPA 1RROA 2QACA 1B4CA 3DVJA 1YRUB 3PLFB 3SG4A 4CFRA 1CMFA 1CKKA 2O60A 3FS7A 1HT9A 1M63B 1B9AA 4GPLB 2H2KA 2MAZA 5FYXA 2JRFA 1XVJA 2M97A 1M46A 1SR6B 1NSHA 5J3XA 2KI6C 1D1OA 1DJZA 3CLNA 5DKQA 1ALVA 4QJ5B 1K94A 1KFUL 1ZACA 4MSPA 1OMDA 2E6WA 2ZNDA 1QIVA 3CWGA 4NDDA 3OX6A 3JTDB 2KBIA 3WXAA 2JWWA 2LC5A 1Y1XA 1S3PA 2BCBA 1BODA 1JFKA 2JQ6A 1WLMA 1XK4C 3RLZA 4FQOA 2KYFA 1ALWA 1NPQA 4PHNA 2D8NA 1XA5A 1J7OA 4QJ3B 1RWYA 1OQPA 4AQIA 3K21A 1WY9A 1M31A 1V1FA 4YI8A 1OZSA 1KWOC 1OMRA 1UURA 3AKAA 4N1GA 1UHKA 3I5FB 1Y6WA 4MZJA 4WRIA 1PSBA 3I5IC 5I2OA 2I7AA 5KSZA 2MRDA 1CMGA 2K7OA 1EG3A 1W7JB 1Y0VH 3CGAA 3TS5C 2K7DA 3IQOA 1V1GA 3EKJA 2G9BA 2KNEA 3SG6A 1TCFA 1TIZA 4C0JA 3CZTX 3TDZA 2LANA 1WRKA 2M8UA 3C1VA 2EC6B 4L9MA 3SIBA 4OV2A 2MJWB 4MZKA 5TNCA 1IH0A 2BBMA 3BYAA 3SG7A 1KFXS 2E30A 1M45A 2BECA 3NSOA 1SCMB 1M39A 2BL0C 1VRKA 1KFXL 1K9KA 2LM5A 2FCEA 1S6JA 4ZCUA 1PK0D 2L98A 2WOSA 4A4CA 2AUCA 2GGZA 2OTGC 2NLNA 3BOWB 5HLOA 1XFUO 2GGMA 2I94A 4M2QA 1C7WA 3M0WA 1NUBA 1E8AA 2OPOA 2F33A 2BCXA 5AERA 4JWQA 3OP0A 2K61A 3FIAA 5HKWA 2NCPA 4NDCA 1YVHA 4YGAA 3LK1A 4ICBA 1S1EA 1ZMZA 2KHNA 3GK1A 1PULA 1G4YR 1EH2A 2BE6A 2B1UA 2SCPA 1L2OB 4MEWA 5HKYA 4ORCB 2NZ0A 3PN7C 2LVIA 1RK9A 1J1EA 4DIRA 1TN4A 4N5XA 1F4OA 3PM8A 4PE0A 1GJYA 1SNLA 3RM1A 1YUTA 1QVIY 3TUYB 2M49B 2JNFA 3SIAA 1XFYO 4OVNF 1B47A 4ETOA 1S6CA 3JVTB 2L0PA 3D0YB 2KQYA 1WDCB 1TNQA 2JULA 2QPTA 1CDNA 2IS9A 2K0JA 1LVCD 4AOMA 2LUCA 2HPSA 3OB1B 2M3WA 1RFJA 1KK8B 2CBLA 4TNCA 2WC8A 3IQQA 4GUKA 2COLB 3O2PA 2PRUA 1Q80A 2ZN9A 3FWCA 4USLA 4PE7A 1RJVA 1QXPA 1B8CA 3I5GB 4YGDB 1QJTA 4HRHA 1BF5A 1B8RA 1CLMA 1IJ6A 2M29A 3BUMB 3EK4A 3TDIA 3VRQA 2KI4C 2WCFA 2KGRA 2JT0A 4CFQA 1B1GA 1K9PA 2L2EA 2Y5IA 2ZRTA 1J7RA 1KK7Y 2LVVA 4MVFA 1H4BA 3LK0A 1JBAA 3MSEB 2FCDA 1IGVA 4XJKB 4DS7A 1XFZO 1B7TY 1UHNA 2F3ZA 4FTGA 4I5LB 1NCZA 1EL4A 1YTZC 1YX7A 3DD4A 3KHEA 3A4UB 1KFUS 4WQ3A 3D0YA 1A75B 3TDUA 4PHJA 1IWQA 1SMGA 3NXAA 1QX5B 3AAKA 3KEVA 5JOLA 1UHJA 1TNPA 1K93D 2JXLA 1QV1A 2I18A 2VRGA 1A4PA 4PCWA 2PMYA 4MBEA 2OS8B 1NX0A 1J55A 2K2FA 1NP8A 1DJHA 1ODBA 2NCOA 5AANA 1C7VA 1CB1A 1DMOA 1MUXA 1S6IA 4JPZB 1PSRA 1NX2A 4OR9B 4P2YB 1SL9A 1FW4A 1TTXA 4YRUA 2ZRSA 3NSKA 3LL8B 4GFTA 1GQMA 5B8IB 1CDMA 2KFHA 1CLBA 1NYAA 1QIWA 3HX4A 3WHTB 3AKBA 3CS1A 4F0ZB 1TOPA 2ZFDA 4YGCB 4YI9A 4C0KA 1B7TZ 1IKUA 1LXFC 1OSAA 1SL8A 1QLSA 3DVEA 1AK8A 1PALA 2L50A 3O6BA 1BR1B 1TRFA 2NXQA 3CTNA 1RTP1 1K95A 2LP3A 1SBJA 2JTZA 2TN4A 1K2HA 1SW8A 4PDZA 5HKZA 1AUIB 1XYDA 3GK2A 1C07A 1OMVA 2R2IA 4YGBB 2F2OA 2KFFA 2JT3A 5D69A 4U8DA 2CT9A 4PHKA 1QS7A 2BCAA 3VRRA 1J1DA 4ORBB 1IJ5A 1NWDA 2K7BA 4GGNA 1G33A 3HCMA 1XO5A 2CNPA 5CSIA 4BY5A 1IRJA 3DVMA 5G08A 1AHRA 4N1FA 1YR5A 3AAJA 1UWOA 5JJGA 1S5GY 1N0YA 3SG2A 1PVAA 1CFPA 1GGWA 3EKHA 3KO0A 2JPTA 4Q04A 2Y1MA 4PE1A 1K9UA 1N2DA 5ER5A 3SG3A 4GBAA 5AEQA 3LLEA 2LCPA 1SCVA 2WCEA 1LKJA 1WLZA 2LLUA 1XFWO 1CFCA 4ORAB 2OTGB 2JTTA 3PFVA 2V53A 3FWBA 5CPVA 1NCXA 2ZKMX 5I2QA 3JVTC 3I5HB 5PALA 4JQ0D 1DGUA 1SRAA 1WDCC 1KSOA 1XFVO 1KQMB 1S36A 1AJ4A 1IG5A 5HYDA 1DF0B 2KAXA 4I5NB 4YBHB 1YRTB 2Q4UA 4I5KA 3EVUA 1AJ5A 2HQ8A 4OKHA 2LLSA 1J7QA 2PSRA 1NX1A 1F8HA 5KU1A 1KK8C 3OB2B 4OCIA 1DVIA 1DJXA 1F71A 3PN7B 3QRXA 4MRXA 1BMOA 1YX8A 1TNXA 2BKIB 3BUWB 3EVVA 1JC2A 3BOWA 1MF8B 4DCKA 2A4JA 4YGEB 1S5GZ 2MA2A 3GOFA 3ICBA 4MN0A 4MLWA 1DJIA 2LUXA 4NQGA 1UP5A 3H4SE 1CLLA 2ZN8A 1A03A 2ISDA 3LCPC 1BR4B 1OZOA 2K2AA 4C0LA 3CR5X 3O4YA 2KAVA 1FPWA 2CTNA 2HETA 2LMTA 3BXKA 1BJFA 2M1KB 1DT7B 1QVIZ 1S26D 2PALA 1YVLA 1SYMA 2JZIA 2BKHB 2O5GA 4BY4A 1Y1UA 1LINA 1FBVA 2Y1NA 3CR4X 3DVKA 4DUQA 2JT8A 1ZOTB 1JWDA 2CCMA 2MLFC 4P5OE 3BUXB 2KYCA 1LA0A 1SR6C 1F4QA 1QX2A 5GQQC 2KI4B 2JXCA 1SY9A 2Y4QA 1KSMA 3JTDC 2LHIA 1YUUA 3GK4X 1QX7A 1LA3A 1TCOB 3DF0B 2F2PA 1QATA 5KTYA 1JUOA 2H61A 2L5XB 2OS8C 2Q91A 2EHBA 1CFFA 3EVRA 1DJWA 1K8UA 4M2PA 2LE9B 3VRNA 1OE9B 1YUSA 5HLVA 2JU0A 2FJUB 1FF1A 2LP2A 1UHHA 2F3YA 3BQ3A 1HQVA 3I5FC 3WNXB 1KK7Z 2LMUA 1JF0A 1CDPA 1CM4A 1IQ5A 4QJ4B 1K96A 2CXJA 2HF5A 2BBNA 5I2LA 1IQ3A 1K90D 5K89A 1PRWA 2WNDA 4GNKB 1UUSA 1SL7A 2MLEC 3TZ1A 2JNXA 5DKRA 4XJKA 2K7CA 3WHUB 1F70A 3A8RA 4XYNA 2EGDA 2MHHA 1QTXA 1CM1A 2EC6C 4A4BA 1BOCA 1QV0A 4MZLA 2L4HA 3OHMB 4GGFA 4E68A 3F45A 1A75A 1JF2A 3ZWHA 1R6PA 3BUNB 1KWOB 1ZUZA 2BE4A 2M7LA 2JOJA 2M7NA 1SCMC 1X02A 1PVBA 3EK8A 1JFJA 3KPXA 2PASA 3I5IB 1EG4A 1R2UA 5CSNA 2ZNEA 3DF0A 4HSZA 3TS5B 3NSIA 3IF7A 1YURA 3SG5A 2P6BB 1G8IA 1L7ZA 4D1EA 5ER4X 5IBWA 2G2BA 3EK7A 1CFDA 3SJSA 1F54A 2K8MB 2RGIA 1NCYA 1GGZA 3O78A 1BLQA 2AMIA 1N65A 1AVSA 1EXRA 1L2OC 1BT6A 1W7IB 4PALA 4PE4A 1UHIA 1MR8A 1B8LA 1SK6D 2BL0B 5I8NA 1KCYA 2LMVA 4WQ2A 5CSJA 1MQ1A 3TUYC 1TNWA 3CR2A 1SPYA 1XK4A 3E3RA 3I5HC 1FI5A 1AP4A 1KQMC 2LLTA 2MBXA 3PALA 2KDHA 2KOTA 3VROA 1U5IB 4CLNA 1MHOA 3ZNIA 4AQJA 1NX3A 1H8BA 2LVJA 1CDLA 3VGOA 2KAYA 4IL1A 2KBMA 1EJ3A 1MXLC 1MWNA 1OOJA 2FOTA 2LHLA 2LV7A 4HREE 1CNPA 3OX5A 2KI6D 2H61C 2LVKA 1SKTA 2WORA 3PATA 4GAOA 2KGBC 2WCBA 1BU3A 3I5GC 1F55A 2SASA 1CTRA 2KSPA 5AFPA 2M1UA 1A2XA 1WRLA 2DOQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F6T A;  4I5J A;  1DJG A;  1JSA A;  1XFX O;  2GV5 A;  1KQV A;  3PSR A;  2L4I A;  3BUO B;  5D7F A;  2LNK A;  4CID A;  2M9G A;  4M2O A;  1DGV A;  1QLK A;  2JC2 A;  4MRY A;  4CPV A;  2AAO A;  4UPG A;  2KFG A;  3VRP A;  1DTL A;  1QAS A;  1MXE A;  3NSL A;  4HRG A;  5AXI A;  1BG1 A;  1NIW A;  2PVB A;  1FI6 A;  5BPJ A;  4DRW A;  4GGF C;  2F8P A;  1ZFS A;  1DF0 A;  1REC A;  4PHM A;  1J7P A;  1U5I A;  1WRZ A;  4R1E A;  4ZCV A;  3KF9 A;  4NDB A;  5DKN A;  3D10 A;  1Y1A A;  2HQW A;  5CSF A;  1DJY A;  2M0R A;  2KQ6 A;  1A29 A;  2L51 A;  2I2R E;  2LAP A;  1RRO A;  2QAC A;  1B4C A;  3DVJ A;  1YRU B;  3PLF B;  3SG4 A;  4CFR A;  1CMF A;  1CKK A;  2O60 A;  3FS7 A;  1HT9 A;  1M63 B;  1B9A A;  4GPL B;  2H2K A;  2MAZ A;  5FYX A;  2JRF A;  1XVJ A;  2M97 A;  1M46 A;  1SR6 B;  1NSH A;  5J3X A;  2KI6 C;  1D1O A;  1DJZ A;  3CLN A;  5DKQ A;  1ALV A;  4QJ5 B;  1K94 A;  1KFU L;  1ZAC A;  4MSP A;  1OMD A;  2E6W A;  2ZND A;  1QIV A;  3CWG A;  4NDD A;  3OX6 A;  3JTD B;  2KBI A;  3WXA A;  2JWW A;  2LC5 A;  1Y1X A;  1S3P A;  2BCB A;  1BOD A;  1JFK A;  2JQ6 A;  1WLM A;  1XK4 C;  3RLZ A;  4FQO A;  2KYF A;  1ALW A;  1NPQ A;  4PHN A;  2D8N A;  1XA5 A;  1J7O A;  4QJ3 B;  1RWY A;  1OQP A;  4AQI A;  3K21 A;  1WY9 A;  1M31 A;  1V1F A;  4YI8 A;  1OZS A;  1KWO C;  1OMR A;  1UUR A;  3AKA A;  4N1G A;  1UHK A;  3I5F B;  1Y6W A;  4MZJ A;  4WRI A;  1PSB A;  3I5I C;  5I2O A;  2I7A A;  5KSZ A;  2MRD A;  1CMG A;  2K7O A;  1EG3 A;  1W7J B;  1Y0V H;  3CGA A;  3TS5 C;  2K7D A;  3IQO A;  1V1G A;  3EKJ A;  2G9B A;  2KNE A;  3SG6 A;  1TCF A;  1TIZ A;  4C0J A;  3CZT X;  3TDZ A;  2LAN A;  1WRK A;  2M8U A;  3C1V A;  2EC6 B;  4L9M A;  3SIB A;  4OV2 A;  2MJW B;  4MZK A;  5TNC A;  1IH0 A;  2BBM A;  3BYA A;  3SG7 A;  1KFX S;  2E30 A;  1M45 A;  2BEC A;  3NSO A;  1SCM B;  1M39 A;  2BL0 C;  1VRK A;  1KFX L;  1K9K A;  2LM5 A;  2FCE A;  1S6J A;  4ZCU A;  1PK0 D;  2L98 A;  2WOS A;  4A4C A;  2AUC A;  2GGZ A;  2OTG C;  2NLN A;  3BOW B;  5HLO A;  1XFU O;  2GGM A;  2I94 A;  4M2Q A;  1C7W A;  3M0W A;  1NUB A;  1E8A A;  2OPO A;  2F33 A;  2BCX A;  5AER A;  4JWQ A;  3OP0 A;  2K61 A;  3FIA A;  5HKW A;  2NCP A;  4NDC A;  1YVH A;  4YGA A;  3LK1 A;  4ICB A;  1S1E A;  1ZMZ A;  2KHN A;  3GK1 A;  1PUL A;  1G4Y R;  1EH2 A;  2BE6 A;  2B1U A;  2SCP A;  1L2O B;  4MEW A;  5HKY A;  4ORC B;  2NZ0 A;  3PN7 C;  2LVI A;  1RK9 A;  1J1E A;  4DIR A;  1TN4 A;  4N5X A;  1F4O A;  3PM8 A;  4PE0 A;  1GJY A;  1SNL A;  3RM1 A;  1YUT A;  1QVI Y;  3TUY B;  2M49 B;  2JNF A;  3SIA A;  1XFY O;  4OVN F;  1B47 A;  4ETO A;  1S6C A;  3JVT B;  2L0P A;  3D0Y B;  2KQY A;  1WDC B;  1TNQ A;  2JUL A;  2QPT A;  1CDN A;  2IS9 A;  2K0J A;  1LVC D;  4AOM A;  2LUC A;  2HPS A;  3OB1 B;  2M3W A;  1RFJ A;  1KK8 B;  2CBL A;  4TNC A;  2WC8 A;  3IQQ A;  4GUK A;  2COL B;  3O2P A;  2PRU A;  1Q80 A;  2ZN9 A;  3FWC A;  4USL A;  4PE7 A;  1RJV A;  1QXP A;  1B8C A;  3I5G B;  4YGD B;  1QJT A;  4HRH A;  1BF5 A;  1B8R A;  1CLM A;  1IJ6 A;  2M29 A;  3BUM B;  3EK4 A;  3TDI A;  3VRQ A;  2KI4 C;  2WCF A;  2KGR A;  2JT0 A;  4CFQ A;  1B1G A;  1K9P A;  2L2E A;  2Y5I A;  2ZRT A;  1J7R A;  1KK7 Y;  2LVV A;  4MVF A;  1H4B A;  3LK0 A;  1JBA A;  3MSE B;  2FCD A;  1IGV A;  4XJK B;  4DS7 A;  1XFZ O;  1B7T Y;  1UHN A;  2F3Z A;  4FTG A;  4I5L B;  1NCZ A;  1EL4 A;  1YTZ C;  1YX7 A;  3DD4 A;  3KHE A;  3A4U B;  1KFU S;  4WQ3 A;  3D0Y A;  1A75 B;  3TDU A;  4PHJ A;  1IWQ A;  1SMG A;  3NXA A;  1QX5 B;  3AAK A;  3KEV A;  5JOL A;  1UHJ A;  1TNP A;  1K93 D;  2JXL A;  1QV1 A;  2I18 A;  2VRG A;  1A4P A;  4PCW A;  2PMY A;  4MBE A;  2OS8 B;  1NX0 A;  1J55 A;  2K2F A;  1NP8 A;  1DJH A;  1ODB A;  2NCO A;  5AAN A;  1C7V A;  1CB1 A;  1DMO A;  1MUX A;  1S6I A;  4JPZ B;  1PSR A;  1NX2 A;  4OR9 B;  4P2Y B;  1SL9 A;  1FW4 A;  1TTX A;  4YRU A;  2ZRS A;  3NSK A;  3LL8 B;  4GFT A;  1GQM A;  5B8I B;  1CDM A;  2KFH A;  1CLB A;  1NYA A;  1QIW A;  3HX4 A;  3WHT B;  3AKB A;  3CS1 A;  4F0Z B;  1TOP A;  2ZFD A;  4YGC B;  4YI9 A;  4C0K A;  1B7T Z;  1IKU A;  1LXF C;  1OSA A;  1SL8 A;  1QLS A;  3DVE A;  1AK8 A;  1PAL A;  2L50 A;  3O6B A;  1BR1 B;  1TRF A;  2NXQ A;  3CTN A;  1RTP 1;  1K95 A;  2LP3 A;  1SBJ A;  2JTZ A;  2TN4 A;  1K2H A;  1SW8 A;  4PDZ A;  5HKZ A;  1AUI B;  1XYD A;  3GK2 A;  1C07 A;  1OMV A;  2R2I A;  4YGB B;  2F2O A;  2KFF A;  2JT3 A;  5D69 A;  4U8D A;  2CT9 A;  4PHK A;  1QS7 A;  2BCA A;  3VRR A;  1J1D A;  4ORB B;  1IJ5 A;  1NWD A;  2K7B A;  4GGN A;  1G33 A;  3HCM A;  1XO5 A;  2CNP A;  5CSI A;  4BY5 A;  1IRJ A;  3DVM A;  5G08 A;  1AHR A;  4N1F A;  1YR5 A;  3AAJ A;  1UWO A;  5JJG A;  1S5G Y;  1N0Y A;  3SG2 A;  1PVA A;  1CFP A;  1GGW A;  3EKH A;  3KO0 A;  2JPT A;  4Q04 A;  2Y1M A;  4PE1 A;  1K9U A;  1N2D A;  5ER5 A;  3SG3 A;  4GBA A;  5AEQ A;  3LLE A;  2LCP A;  1SCV A;  2WCE A;  1LKJ A;  1WLZ A;  2LLU A;  1XFW O;  1CFC A;  4ORA B;  2OTG B;  2JTT A;  3PFV A;  2V53 A;  3FWB A;  5CPV A;  1NCX A;  2ZKM X;  5I2Q A;  3JVT C;  3I5H B;  5PAL A;  4JQ0 D;  1DGU A;  1SRA A;  1WDC C;  1KSO A;  1XFV O;  1KQM B;  1S36 A;  1AJ4 A;  1IG5 A;  5HYD A;  1DF0 B;  2KAX A;  4I5N B;  4YBH B;  1YRT B;  2Q4U A;  4I5K A;  3EVU A;  1AJ5 A;  2HQ8 A;  4OKH A;  2LLS A;  1J7Q A;  2PSR A;  1NX1 A;  1F8H A;  5KU1 A;  1KK8 C;  3OB2 B;  4OCI A;  1DVI A;  1DJX A;  1F71 A;  3PN7 B;  3QRX A;  4MRX A;  1BMO A;  1YX8 A;  1TNX A;  2BKI B;  3BUW B;  3EVV A;  1JC2 A;  3BOW A;  1MF8 B;  4DCK A;  2A4J A;  4YGE B;  1S5G Z;  2MA2 A;  3GOF A;  3ICB A;  4MN0 A;  4MLW A;  1DJI A;  2LUX A;  4NQG A;  1UP5 A;  3H4S E;  1CLL A;  2ZN8 A;  1A03 A;  2ISD A;  3LCP C;  1BR4 B;  1OZO A;  2K2A A;  4C0L A;  3CR5 X;  3O4Y A;  2KAV A;  1FPW A;  2CTN A;  2HET A;  2LMT A;  3BXK A;  1BJF A;  2M1K B;  1DT7 B;  1QVI Z;  1S26 D;  2PAL A;  1YVL A;  1SYM A;  2JZI A;  2BKH B;  2O5G A;  4BY4 A;  1Y1U A;  1LIN A;  1FBV A;  2Y1N A;  3CR4 X;  3DVK A;  4DUQ A;  2JT8 A;  1ZOT B;  1JWD A;  2CCM A;  2MLF C;  4P5O E;  3BUX B;  2KYC A;  1LA0 A;  1SR6 C;  1F4Q A;  1QX2 A;  5GQQ C;  2KI4 B;  2JXC A;  1SY9 A;  2Y4Q A;  1KSM A;  3JTD C;  2LHI A;  1YUU A;  3GK4 X;  1QX7 A;  1LA3 A;  1TCO B;  3DF0 B;  2F2P A;  1QAT A;  5KTY A;  1JUO A;  2H61 A;  2L5X B;  2OS8 C;  2Q91 A;  2EHB A;  1CFF A;  3EVR A;  1DJW A;  1K8U A;  4M2P A;  2LE9 B;  3VRN A;  1OE9 B;  1YUS A;  5HLV A;  2JU0 A;  2FJU B;  1FF1 A;  2LP2 A;  1UHH A;  2F3Y A;  3BQ3 A;  1HQV A;  3I5F C;  3WNX B;  1KK7 Z;  2LMU A;  1JF0 A;  1CDP A;  1CM4 A;  1IQ5 A;  4QJ4 B;  1K96 A;  2CXJ A;  2HF5 A;  2BBN A;  5I2L A;  1IQ3 A;  1K90 D;  5K89 A;  1PRW A;  2WND A;  4GNK B;  1UUS A;  1SL7 A;  2MLE C;  3TZ1 A;  2JNX A;  5DKR A;  4XJK A;  2K7C A;  3WHU B;  1F70 A;  3A8R A;  4XYN A;  2EGD A;  2MHH A;  1QTX A;  1CM1 A;  2EC6 C;  4A4B A;  1BOC A;  1QV0 A;  4MZL A;  2L4H A;  3OHM B;  4GGF A;  4E68 A;  3F45 A;  1A75 A;  1JF2 A;  3ZWH A;  1R6P A;  3BUN B;  1KWO B;  1ZUZ A;  2BE4 A;  2M7L A;  2JOJ A;  2M7N A;  1SCM C;  1X02 A;  1PVB A;  3EK8 A;  1JFJ A;  3KPX A;  2PAS A;  3I5I B;  1EG4 A;  1R2U A;  5CSN A;  2ZNE A;  3DF0 A;  4HSZ A;  3TS5 B;  3NSI A;  3IF7 A;  1YUR A;  3SG5 A;  2P6B B;  1G8I A;  1L7Z A;  4D1E A;  5ER4 X;  5IBW A;  2G2B A;  3EK7 A;  1CFD A;  3SJS A;  1F54 A;  2K8M B;  2RGI A;  1NCY A;  1GGZ A;  3O78 A;  1BLQ A;  2AMI A;  1N65 A;  1AVS A;  1EXR A;  1L2O C;  1BT6 A;  1W7I B;  4PAL A;  4PE4 A;  1UHI A;  1MR8 A;  1B8L A;  1SK6 D;  2BL0 B;  5I8N A;  1KCY A;  2LMV A;  4WQ2 A;  5CSJ A;  1MQ1 A;  3TUY C;  1TNW A;  3CR2 A;  1SPY A;  1XK4 A;  3E3R A;  3I5H C;  1FI5 A;  1AP4 A;  1KQM C;  2LLT A;  2MBX A;  3PAL A;  2KDH A;  2KOT A;  3VRO A;  1U5I B;  4CLN A;  1MHO A;  3ZNI A;  4AQJ A;  1NX3 A;  1H8B A;  2LVJ A;  1CDL A;  3VGO A;  2KAY A;  4IL1 A;  2KBM A;  1EJ3 A;  1MXL C;  1MWN A;  1OOJ A;  2FOT A;  2LHL A;  2LV7 A;  4HRE E;  1CNP A;  3OX5 A;  2KI6 D;  2H61 C;  2LVK A;  1SKT A;  2WOR A;  3PAT A;  4GAO A;  2KGB C;  2WCB A;  1BU3 A;  3I5G C;  1F55 A;  2SAS A;  1CTR A;  2KSP A;  5AFP A;  2M1U A;  1A2X A;  1WRL A;  2DOQ A; 
#chains in the Genus database with same CATH topology
 5F6T A;  4I5J A;  3B6X A;  1DJG A;  1JSA A;  1XFX O;  2GV5 A;  1KQV A;  3PSR A;  2L4I A;  3BUO B;  5D7F A;  2LNK A;  4CID A;  2M9G A;  4M2O A;  1DGV A;  1QLK A;  2JC2 A;  4MRY A;  4CPV A;  2AAO A;  4UPG A;  3CZ1 A;  2KFG A;  3VRP A;  2KPH A;  1DTL A;  1QAS A;  1MXE A;  3NSL A;  4HRG A;  5AXI A;  1BG1 A;  1NIW A;  2PVB A;  1FI6 A;  5BPJ A;  4DRW A;  4GGF C;  2F8P A;  1ZFS A;  3B86 A;  3B87 A;  1DF0 A;  1REC A;  4PHM A;  1J7P A;  1U5I A;  1WRZ A;  4R1E A;  4ZCV A;  3KF9 A;  4NDB A;  5DKN A;  3D10 A;  1Y1A A;  5FI7 A;  2HQW A;  5CSF A;  1DJY A;  2M0R A;  2KQ6 A;  1A29 A;  2L51 A;  1OOH A;  2I2R E;  2LAP A;  1RRO A;  2QAC A;  1B4C A;  3DVJ A;  1YRU B;  3PLF B;  3SG4 A;  4CFR A;  1CMF A;  1CKK A;  2QEV A;  2O60 A;  3FS7 A;  1HT9 A;  1M63 B;  1B9A A;  4GPL B;  2H2K A;  2MAZ A;  5FYX A;  2JRF A;  1XVJ A;  2M97 A;  1M46 A;  1SR6 B;  1NSH A;  5J3X A;  1C07 A;  2KI6 C;  1D1O A;  1DJZ A;  3CLN A;  5DKQ A;  1ALV A;  3O4X A;  4QJ5 B;  1K94 A;  1KFU L;  1ZAC A;  4MSP A;  1OMD A;  2E6W A;  2ZND A;  1OOG A;  1QIV A;  3D77 A;  3CWG A;  4NDD A;  3OX6 A;  3JTD B;  2KBI A;  3WXA A;  2JWW A;  2LC5 A;  1Y1X A;  3B88 A;  1S3P A;  2BCB A;  1BOD A;  1JFK A;  2JQ6 A;  1WLM A;  1XK4 C;  3RLZ A;  4FQO A;  3D78 A;  2KYF A;  1ALW A;  1NPQ A;  3NHI A;  4PHN A;  2D8N A;  1XA5 A;  1J7O A;  4QJ3 B;  3L47 A;  1RWY A;  1OQP A;  4AQI A;  3K21 A;  1WY9 A;  1M31 A;  1V1F A;  4YI8 A;  1OZS A;  1KWO C;  1OMR A;  1UUR A;  2JPO A;  3AKA A;  4N1G A;  1UHK A;  3I5F B;  1Y6W A;  4MZJ A;  4WRI A;  1PSB A;  3I5I C;  5I2O A;  2I7A A;  5KSZ A;  4INX A;  2MRD A;  1CMG A;  2K7O A;  1EG3 A;  1W7J B;  1Y0V H;  3CGA A;  1TWO A;  3TS5 C;  2K7D A;  3IQO A;  1V1G A;  3EKJ A;  1DEL A;  2G9B A;  2KNE A;  1TCF A;  1TIZ A;  3SG6 A;  3CZT X;  3TDZ A;  4C0J A;  2LAN A;  1WRK A;  2M8U A;  3C1V A;  3CZ0 A;  2EC6 B;  4L9M A;  3SIB A;  4OV2 A;  2MJW B;  4MZK A;  5TNC A;  1Z4H A;  2BBM A;  2K60 A;  3DXL A;  3UNW A;  1IH0 A;  2PYQ A;  3BYA A;  3SG7 A;  1KFX S;  2E30 A;  1M45 A;  2L5Y A;  2BEC A;  3NSO A;  1SCM B;  1M39 A;  1Z2C B;  1VRK A;  1KFX L;  1K9K A;  2BL0 C;  2FCE A;  2LM5 A;  1S6J A;  4ZCU A;  1PK0 D;  2L98 A;  2WOS A;  4A4C A;  2AUC A;  2GGZ A;  2OTG C;  2NLN A;  3BOW B;  5HLO A;  1XFU O;  2GGM A;  2I94 A;  4M2Q A;  1C7W A;  3M0W A;  1NUB A;  1E8A A;  2OPO A;  2F33 A;  2BCX A;  5AER A;  2KLE A;  4JWQ A;  3OP0 A;  2K61 A;  3FIA A;  5HKW A;  2NCP A;  4NDC A;  1YVH A;  5DIC A;  2WC5 A;  3DZT A;  4YGA A;  3LK1 A;  4ICB A;  1S1E A;  1ZMZ A;  1TUZ A;  2KHN A;  3GK1 A;  1PUL A;  1G4Y R;  1EH2 A;  2BE6 A;  2B1U A;  2SCP A;  1L2O B;  4MEW A;  5HKY A;  4ORC B;  2NZ0 A;  3PN7 C;  2LVI A;  1RK9 A;  1J1E A;  4DIR A;  1TN4 A;  4N5X A;  1F4O A;  3PM8 A;  4PE0 A;  1GJY A;  1SNL A;  3RM1 A;  3CYZ A;  1YUT A;  1QVI Y;  3TUY B;  2M49 B;  2JNF A;  3SIA A;  1XFY O;  4OVN F;  1B47 A;  4ETO A;  3BJH A;  1S6C A;  3JVT B;  1TUJ A;  2L0P A;  2WCJ A;  2KQY A;  1WDC B;  3D0Y B;  1TNQ A;  2JUL A;  2QPT A;  1CDN A;  2IS9 A;  5FI6 A;  2K0J A;  1LVC D;  2BAP A;  4AOM A;  2LUC A;  2HPS A;  3OB1 B;  2M3W A;  1RFJ A;  1KK8 B;  2CBL A;  4TNC A;  2WC8 A;  3R1P A;  3IQQ A;  4GUK A;  2COL B;  3O2P A;  2PRU A;  1Q80 A;  2ZN9 A;  3FWC A;  4USL A;  4PE7 A;  1RJV A;  1QXP A;  1B8C A;  3I5G B;  4YGD B;  1QJT A;  4HRH A;  1BF5 A;  1B8R A;  1CLM A;  1IJ6 A;  2M29 A;  3BUM B;  3EK4 A;  4INW A;  3TDI A;  3VRQ A;  2KI4 C;  2WCF A;  3DY9 A;  2KGR A;  2JT0 A;  4CFQ A;  1B1G A;  1K9P A;  2L2E A;  1W9Z A;  2Y5I A;  2ZRT A;  1J7R A;  1KK7 Y;  2LVV A;  4MVF A;  1H4B A;  3LK0 A;  1JBA A;  3MSE B;  2FCD A;  1IGV A;  4XJK B;  4DS7 A;  3V2L A;  1XFZ O;  1B7T Y;  1UHN A;  2F3Z A;  4FTG A;  2PQL A;  4I5L B;  1NCZ A;  1EL4 A;  1YTZ C;  1YX7 A;  3DD4 A;  3KHE A;  3A4U B;  1KFU S;  2WCL A;  4WQ3 A;  3D0Y A;  1A75 B;  3TDU A;  4PHJ A;  1IWQ A;  1SMG A;  3NXA A;  3PJI A;  1QX5 B;  3L4L A;  3AAK A;  3KEV A;  5JOL A;  1UHJ A;  3SS3 A;  1TNP A;  5D3O A;  1K93 D;  2JXL A;  1QV1 A;  2I18 A;  2VRG A;  1A4P A;  4PCW A;  2PMY A;  4MBE A;  1LS8 A;  2OS8 B;  1NX0 A;  1J55 A;  2K2F A;  1NP8 A;  1DJH A;  1ODB A;  2NCO A;  4PT1 A;  5AAN A;  1C7V A;  1CB1 A;  1DMO A;  1S6I A;  1MUX A;  1QWV A;  1DEK A;  4JPZ B;  1PSR A;  1NX2 A;  4OR9 B;  4P2Y B;  1SL9 A;  1FW4 A;  1TTX A;  4YRU A;  2ZRS A;  1T14 A;  3NSK A;  3LL8 B;  4GFT A;  1GQM A;  1IIO A;  5B8I B;  1CDM A;  2KFH A;  1CLB A;  1NYA A;  1QIW A;  3HX4 A;  3WHT B;  3AKB A;  3CS1 A;  4F0Z B;  1TOP A;  2ZFD A;  4YGC B;  1DQE A;  4YI9 A;  4C0K A;  1B7T Z;  1IKU A;  1LXF C;  1OSA A;  3D76 A;  1SL8 A;  2ERB A;  1QLS A;  3DVE A;  1AK8 A;  1PAL A;  2WCH A;  2L50 A;  3O6B A;  1BR1 B;  3SS5 A;  1TRF A;  2NXQ A;  3CTN A;  1RTP 1;  1K95 A;  2LP3 A;  1SBJ A;  2JTZ A;  2TN4 A;  1K2H A;  1GM0 A;  1SW8 A;  4PDZ A;  5HKZ A;  1AUI B;  1XYD A;  3GK2 A;  3Q8I A;  1OMV A;  2R2I A;  4JKT A;  2F2O A;  2KFF A;  2JT3 A;  4YGB B;  5D69 A;  3IVT A;  4U8D A;  2CT9 A;  4PHK A;  4KYN A;  1QS7 A;  2BCA A;  3VRR A;  1J1D A;  4ORB B;  1IJ5 A;  1NWD A;  2K7B A;  4GGN A;  1G33 A;  3HCM A;  1XO5 A;  2CNP A;  5CSI A;  4BY5 A;  1IRJ A;  3DVM A;  5G08 A;  1AHR A;  4N1F A;  1YR5 A;  3AAJ A;  1UWO A;  5JJG A;  1S5G Y;  3NHT A;  1N0Y A;  3SG2 A;  2H8V A;  1PVA A;  1CFP A;  1GGW A;  3EKH A;  3KO0 A;  2JPT A;  4Q04 A;  2Y1M A;  4PE1 A;  1K9U A;  1N2D A;  5ER5 A;  3SG3 A;  4GBA A;  5AEQ A;  3LLE A;  2LCP A;  1SCV A;  2WCE A;  1LKJ A;  1WLZ A;  2LLU A;  3CDN A;  1XFW O;  4OZD A;  1CFC A;  4ORA B;  1C3Z A;  3B7A A;  2OTG B;  2JTT A;  3PFV A;  2V53 A;  3FWB A;  5CPV A;  1NCX A;  2ZKM X;  5I2Q A;  3JVT C;  3I5H B;  5PAL A;  4JQ0 D;  1DGU A;  1OOF A;  1SRA A;  1WDC C;  2BNX A;  1KSO A;  1XFV O;  2KLD A;  1KQM B;  1S36 A;  1AJ4 A;  1IG5 A;  5HYD A;  1DF0 B;  2KAX A;  4I5N B;  4YBH B;  1YRT B;  2Q4U A;  4I5K A;  3EVU A;  1AJ5 A;  2HQ8 A;  4OKH A;  2LLS A;  1J7Q A;  2PSR A;  1NX1 A;  1F8H A;  5KU1 A;  1KK8 C;  3OB2 B;  4OCI A;  1DVI A;  1DJX A;  3RZS A;  3PN7 B;  3QRX A;  4MRX A;  1F71 A;  1BMO A;  3R72 A;  1YX8 A;  1C3Y A;  1TNX A;  2BKI B;  3BUW B;  3EVV A;  1JC2 A;  3R1O A;  3BOW A;  1MF8 B;  4DCK A;  2A4J A;  3S0G A;  4YGE B;  1S5G Z;  2MA2 A;  3GOF A;  3ICB A;  4MN0 A;  1P28 A;  1DJI A;  4MLW A;  2P70 A;  2LUX A;  4NQG A;  1UP5 A;  3H4S E;  1CLL A;  4JD9 A;  2ZN8 A;  1A03 A;  2P71 A;  2ISD A;  1OOI X;  3LCP C;  1BR4 B;  1OZO A;  2K2A A;  4C0L A;  3CR5 X;  3O4Y A;  2KAV A;  1FPW A;  3D73 A;  2CTN A;  2HET A;  2LMT A;  3BXK A;  2QEO A;  1BJF A;  2M1K B;  1DT7 B;  1QVI Z;  3FE6 A;  1S26 D;  2PAL A;  1YVL A;  3S0B A;  1SYM A;  2JZI A;  2BKH B;  2O5G A;  3SS4 A;  4BY4 A;  1Y1U A;  1LIN A;  1FBV A;  2Y1N A;  3CR4 X;  3DVK A;  4DUQ A;  2JT8 A;  3R1V A;  1ZOT B;  4F7F A;  1JWD A;  3S0D A;  2CCM A;  2MLF C;  4FQT A;  4P5O E;  3BUX B;  2KYC A;  3NGV A;  1LA0 A;  3S0E A;  1SR6 C;  1F4Q A;  2QEB A;  1QX2 A;  5GQQ C;  5FI2 A;  2KI4 B;  3S0A A;  2JXC A;  1SY9 A;  2Y4Q A;  1KSM A;  3OGN A;  3JTD C;  2LHI A;  2YGU A;  1YUU A;  3GK4 X;  1QX7 A;  1LA3 A;  5I94 A;  1TCO B;  3DF0 B;  2F2P A;  1QAT A;  5KTY A;  1JUO A;  2H61 A;  2L5X B;  2OS8 C;  2Q91 A;  2EHB A;  1CFF A;  3EVR A;  1DJW A;  1K8U A;  4M2P A;  2LE9 B;  5EL2 A;  3VRN A;  1OE9 B;  1YUS A;  5HLV A;  2JU0 A;  2FJU B;  1FF1 A;  2LP2 A;  1XFR A;  1UHH A;  2F3Y A;  3BQ3 A;  1HQV A;  3I5F C;  3WNX B;  1KK7 Z;  2LMU A;  1JF0 A;  1CDP A;  1CM4 A;  3BFH A;  1IQ5 A;  4QJ4 B;  1K96 A;  1OW4 A;  2CXJ A;  2HF5 A;  2BBN A;  5I2L A;  1IQ3 A;  1K90 D;  5K89 A;  1PRW A;  2WND A;  4GNK B;  1UUS A;  1SL7 A;  2MLE C;  3TZ1 A;  2JNX A;  2QDI A;  5DKR A;  3CZ2 A;  4XJK A;  2K7C A;  3WHU B;  1F70 A;  3A8R A;  4XYN A;  2EGD A;  2MHH A;  2L2C A;  1QTX A;  1CM1 A;  2EC6 C;  2WC6 A;  4A4B A;  1BOC A;  1QV0 A;  4MZL A;  2L4H A;  3OHM B;  4GGF A;  4E68 A;  3F45 A;  1A75 A;  1JF2 A;  3ZWH A;  1R6P A;  3BUN B;  1KWO B;  1ZUZ A;  2BE4 A;  2M7L A;  2JOJ A;  2M7N A;  1SCM C;  1X02 A;  1PVB A;  3EK8 A;  3FE8 A;  3N7H A;  3KPX A;  1JFJ A;  3VB1 A;  2PAS A;  3I5I B;  1EG4 A;  1R2U A;  5CSN A;  2ZNE A;  3DYE A;  3DF0 A;  1SSE B;  3BFB A;  3NSI A;  4HSZ A;  3TS5 B;  3IF7 A;  1YUR A;  2FJY A;  2WCK A;  2P6B B;  3SG5 A;  1G8I A;  1L7Z A;  4D1E A;  5ER4 X;  5IBW A;  2G2B A;  3EK7 A;  1CFD A;  3SJS A;  1F54 A;  2K8M B;  2RGI A;  1NCY A;  3S0F A;  3K1E A;  1GGZ A;  3O78 A;  1DC1 A;  1BLQ A;  2AMI A;  3L4A A;  1N65 A;  1AVS A;  1EXR A;  1L2O C;  1BT6 A;  1W7I B;  4PAL A;  4PE4 A;  1UHI A;  1MR8 A;  1B8L A;  1SK6 D;  2BL0 B;  5I8N A;  2QEH A;  1KCY A;  2LMV A;  4WQ2 A;  5CSJ A;  1MQ1 A;  3TUY C;  1TNW A;  3CR2 A;  1SPY A;  1XK4 A;  3BFA A;  3E3R A;  3I5H C;  1FI5 A;  1AP4 A;  3UO9 A;  1KQM C;  2LLT A;  3PM2 A;  2MBX A;  3PAL A;  2KDH A;  3OBV A;  3CAB A;  2KOT A;  3FE9 A;  3VRO A;  2GTE A;  1U5I B;  4CLN A;  1MHO A;  3QME A;  3ZNI A;  4AQJ A;  1NX3 A;  1H8B A;  2LVJ A;  1CDL A;  3EG5 B;  3VGO A;  3D75 A;  2KAY A;  4IL1 A;  2KBM A;  1EJ3 A;  1MXL C;  1MWN A;  1OOJ A;  2FOT A;  2LHL A;  2LV7 A;  4HRE E;  1CNP A;  3OX5 A;  2KI6 D;  5HL1 A;  2H61 C;  2LVK A;  1SKT A;  2WOR A;  3PAT A;  4GAO A;  2KGB C;  2WCB A;  1BU3 A;  3I5G C;  1F55 A;  2SAS A;  4IJ7 A;  1CTR A;  2KSP A;  5AFP A;  1ORG A;  2WCM A;  2M1U A;  1A2X A;  1WRL A;  3D74 A;  2DOQ A; 
#chains in the Genus database with same CATH homology
 5F6T A;  4I5J A;  1DJG A;  1JSA A;  1XFX O;  2GV5 A;  1KQV A;  3PSR A;  2L4I A;  3BUO B;  5D7F A;  2LNK A;  4CID A;  2M9G A;  4M2O A;  1DGV A;  1QLK A;  2JC2 A;  4MRY A;  4CPV A;  2AAO A;  4UPG A;  2KFG A;  3VRP A;  1DTL A;  1QAS A;  1MXE A;  3NSL A;  4HRG A;  5AXI A;  1BG1 A;  1NIW A;  2PVB A;  1FI6 A;  5BPJ A;  4DRW A;  4GGF C;  2F8P A;  1ZFS A;  1DF0 A;  1REC A;  4PHM A;  1J7P A;  1U5I A;  1WRZ A;  4R1E A;  4ZCV A;  3KF9 A;  4NDB A;  5DKN A;  3D10 A;  1Y1A A;  2HQW A;  5CSF A;  1DJY A;  2M0R A;  2KQ6 A;  1A29 A;  2L51 A;  2I2R E;  2LAP A;  1RRO A;  2QAC A;  1B4C A;  3DVJ A;  1YRU B;  3PLF B;  3SG4 A;  4CFR A;  1CMF A;  1CKK A;  2O60 A;  3FS7 A;  1HT9 A;  1M63 B;  1B9A A;  4GPL B;  2H2K A;  2MAZ A;  5FYX A;  2JRF A;  1XVJ A;  2M97 A;  1M46 A;  1SR6 B;  1NSH A;  5J3X A;  2KI6 C;  1D1O A;  1DJZ A;  3CLN A;  5DKQ A;  1ALV A;  4QJ5 B;  1K94 A;  1KFU L;  1ZAC A;  4MSP A;  1OMD A;  2E6W A;  2ZND A;  1QIV A;  3CWG A;  4NDD A;  3OX6 A;  3JTD B;  2KBI A;  3WXA A;  2JWW A;  2LC5 A;  1Y1X A;  1S3P A;  2BCB A;  1BOD A;  1JFK A;  2JQ6 A;  1WLM A;  1XK4 C;  3RLZ A;  4FQO A;  2KYF A;  1ALW A;  1NPQ A;  4PHN A;  2D8N A;  1XA5 A;  1J7O A;  4QJ3 B;  1RWY A;  1OQP A;  4AQI A;  3K21 A;  1WY9 A;  1M31 A;  1V1F A;  4YI8 A;  1OZS A;  1KWO C;  1OMR A;  1UUR A;  3AKA A;  4N1G A;  1UHK A;  3I5F B;  1Y6W A;  4MZJ A;  4WRI A;  1PSB A;  3I5I C;  5I2O A;  2I7A A;  5KSZ A;  2MRD A;  1CMG A;  2K7O A;  1EG3 A;  1W7J B;  1Y0V H;  3CGA A;  3TS5 C;  2K7D A;  3IQO A;  1V1G A;  3EKJ A;  2G9B A;  2KNE A;  3SG6 A;  1TCF A;  1TIZ A;  4C0J A;  3CZT X;  3TDZ A;  2LAN A;  1WRK A;  2M8U A;  3C1V A;  2EC6 B;  4L9M A;  3SIB A;  4OV2 A;  2MJW B;  4MZK A;  5TNC A;  1IH0 A;  2BBM A;  3BYA A;  3SG7 A;  1KFX S;  2E30 A;  1M45 A;  2BEC A;  3NSO A;  1SCM B;  1M39 A;  2BL0 C;  1VRK A;  1KFX L;  1K9K A;  2LM5 A;  2FCE A;  1S6J A;  4ZCU A;  1PK0 D;  2L98 A;  2WOS A;  4A4C A;  2AUC A;  2GGZ A;  2OTG C;  2NLN A;  3BOW B;  5HLO A;  1XFU O;  2GGM A;  2I94 A;  4M2Q A;  1C7W A;  3M0W A;  1NUB A;  1E8A A;  2OPO A;  2F33 A;  2BCX A;  5AER A;  4JWQ A;  3OP0 A;  2K61 A;  3FIA A;  5HKW A;  2NCP A;  4NDC A;  1YVH A;  4YGA A;  3LK1 A;  4ICB A;  1S1E A;  1ZMZ A;  2KHN A;  3GK1 A;  1PUL A;  1G4Y R;  1EH2 A;  2BE6 A;  2B1U A;  2SCP A;  1L2O B;  4MEW A;  5HKY A;  4ORC B;  2NZ0 A;  3PN7 C;  2LVI A;  1RK9 A;  1J1E A;  4DIR A;  1TN4 A;  4N5X A;  1F4O A;  3PM8 A;  4PE0 A;  1GJY A;  1SNL A;  3RM1 A;  1YUT A;  1QVI Y;  3TUY B;  2M49 B;  2JNF A;  3SIA A;  1XFY O;  4OVN F;  1B47 A;  4ETO A;  1S6C A;  3JVT B;  2L0P A;  3D0Y B;  2KQY A;  1WDC B;  1TNQ A;  2JUL A;  2QPT A;  1CDN A;  2IS9 A;  2K0J A;  1LVC D;  4AOM A;  2LUC A;  2HPS A;  3OB1 B;  2M3W A;  1RFJ A;  1KK8 B;  2CBL A;  4TNC A;  2WC8 A;  3IQQ A;  4GUK A;  2COL B;  3O2P A;  2PRU A;  1Q80 A;  2ZN9 A;  3FWC A;  4USL A;  4PE7 A;  1RJV A;  1QXP A;  1B8C A;  3I5G B;  4YGD B;  1QJT A;  4HRH A;  1BF5 A;  1B8R A;  1CLM A;  1IJ6 A;  2M29 A;  3BUM B;  3EK4 A;  3TDI A;  3VRQ A;  2KI4 C;  2WCF A;  2KGR A;  2JT0 A;  4CFQ A;  1B1G A;  1K9P A;  2L2E A;  2Y5I A;  2ZRT A;  1J7R A;  1KK7 Y;  2LVV A;  4MVF A;  1H4B A;  3LK0 A;  1JBA A;  3MSE B;  2FCD A;  1IGV A;  4XJK B;  4DS7 A;  1XFZ O;  1B7T Y;  1UHN A;  2F3Z A;  4FTG A;  4I5L B;  1NCZ A;  1EL4 A;  1YTZ C;  1YX7 A;  3DD4 A;  3KHE A;  3A4U B;  1KFU S;  4WQ3 A;  3D0Y A;  1A75 B;  3TDU A;  4PHJ A;  1IWQ A;  1SMG A;  3NXA A;  1QX5 B;  3AAK A;  3KEV A;  5JOL A;  1UHJ A;  1TNP A;  1K93 D;  2JXL A;  1QV1 A;  2I18 A;  2VRG A;  1A4P A;  4PCW A;  2PMY A;  4MBE A;  2OS8 B;  1NX0 A;  1J55 A;  2K2F A;  1NP8 A;  1DJH A;  1ODB A;  2NCO A;  5AAN A;  1C7V A;  1CB1 A;  1DMO A;  1MUX A;  1S6I A;  4JPZ B;  1PSR A;  1NX2 A;  4OR9 B;  4P2Y B;  1SL9 A;  1FW4 A;  1TTX A;  4YRU A;  2ZRS A;  3NSK A;  3LL8 B;  4GFT A;  1GQM A;  5B8I B;  1CDM A;  2KFH A;  1CLB A;  1NYA A;  1QIW A;  3HX4 A;  3WHT B;  3AKB A;  3CS1 A;  4F0Z B;  1TOP A;  2ZFD A;  4YGC B;  4YI9 A;  4C0K A;  1B7T Z;  1IKU A;  1LXF C;  1OSA A;  1SL8 A;  1QLS A;  3DVE A;  1AK8 A;  1PAL A;  2L50 A;  3O6B A;  1BR1 B;  1TRF A;  2NXQ A;  3CTN A;  1RTP 1;  1K95 A;  2LP3 A;  1SBJ A;  2JTZ A;  2TN4 A;  1K2H A;  1SW8 A;  4PDZ A;  5HKZ A;  1AUI B;  1XYD A;  3GK2 A;  1C07 A;  1OMV A;  2R2I A;  4YGB B;  2F2O A;  2KFF A;  2JT3 A;  5D69 A;  4U8D A;  2CT9 A;  4PHK A;  1QS7 A;  2BCA A;  3VRR A;  1J1D A;  4ORB B;  1IJ5 A;  1NWD A;  2K7B A;  4GGN A;  1G33 A;  3HCM A;  1XO5 A;  2CNP A;  5CSI A;  4BY5 A;  1IRJ A;  3DVM A;  5G08 A;  1AHR A;  4N1F A;  1YR5 A;  3AAJ A;  1UWO A;  5JJG A;  1S5G Y;  1N0Y A;  3SG2 A;  1PVA A;  1CFP A;  1GGW A;  3EKH A;  3KO0 A;  2JPT A;  4Q04 A;  2Y1M A;  4PE1 A;  1K9U A;  1N2D A;  5ER5 A;  3SG3 A;  4GBA A;  5AEQ A;  3LLE A;  2LCP A;  1SCV A;  2WCE A;  1LKJ A;  1WLZ A;  2LLU A;  1XFW O;  1CFC A;  4ORA B;  2OTG B;  2JTT A;  3PFV A;  2V53 A;  3FWB A;  5CPV A;  1NCX A;  2ZKM X;  5I2Q A;  3JVT C;  3I5H B;  5PAL A;  4JQ0 D;  1DGU A;  1SRA A;  1WDC C;  1KSO A;  1XFV O;  1KQM B;  1S36 A;  1AJ4 A;  1IG5 A;  5HYD A;  1DF0 B;  2KAX A;  4I5N B;  4YBH B;  1YRT B;  2Q4U A;  4I5K A;  3EVU A;  1AJ5 A;  2HQ8 A;  4OKH A;  2LLS A;  1J7Q A;  2PSR A;  1NX1 A;  1F8H A;  5KU1 A;  1KK8 C;  3OB2 B;  4OCI A;  1DVI A;  1DJX A;  1F71 A;  3PN7 B;  3QRX A;  4MRX A;  1BMO A;  1YX8 A;  1TNX A;  2BKI B;  3BUW B;  3EVV A;  1JC2 A;  3BOW A;  1MF8 B;  4DCK A;  2A4J A;  4YGE B;  1S5G Z;  2MA2 A;  3GOF A;  3ICB A;  4MN0 A;  4MLW A;  1DJI A;  2LUX A;  4NQG A;  1UP5 A;  3H4S E;  1CLL A;  2ZN8 A;  1A03 A;  2ISD A;  3LCP C;  1BR4 B;  1OZO A;  2K2A A;  4C0L A;  3CR5 X;  3O4Y A;  2KAV A;  1FPW A;  2CTN A;  2HET A;  2LMT A;  3BXK A;  1BJF A;  2M1K B;  1DT7 B;  1QVI Z;  1S26 D;  2PAL A;  1YVL A;  1SYM A;  2JZI A;  2BKH B;  2O5G A;  4BY4 A;  1Y1U A;  1LIN A;  1FBV A;  2Y1N A;  3CR4 X;  3DVK A;  4DUQ A;  2JT8 A;  1ZOT B;  1JWD A;  2CCM A;  2MLF C;  4P5O E;  3BUX B;  2KYC A;  1LA0 A;  1SR6 C;  1F4Q A;  1QX2 A;  5GQQ C;  2KI4 B;  2JXC A;  1SY9 A;  2Y4Q A;  1KSM A;  3JTD C;  2LHI A;  1YUU A;  3GK4 X;  1QX7 A;  1LA3 A;  1TCO B;  3DF0 B;  2F2P A;  1QAT A;  5KTY A;  1JUO A;  2H61 A;  2L5X B;  2OS8 C;  2Q91 A;  2EHB A;  1CFF A;  3EVR A;  1DJW A;  1K8U A;  4M2P A;  2LE9 B;  3VRN A;  1OE9 B;  1YUS A;  5HLV A;  2JU0 A;  2FJU B;  1FF1 A;  2LP2 A;  1UHH A;  2F3Y A;  3BQ3 A;  1HQV A;  3I5F C;  3WNX B;  1KK7 Z;  2LMU A;  1JF0 A;  1CDP A;  1CM4 A;  1IQ5 A;  4QJ4 B;  1K96 A;  2CXJ A;  2HF5 A;  2BBN A;  5I2L A;  1IQ3 A;  1K90 D;  5K89 A;  1PRW A;  2WND A;  4GNK B;  1UUS A;  1SL7 A;  2MLE C;  3TZ1 A;  2JNX A;  5DKR A;  4XJK A;  2K7C A;  3WHU B;  1F70 A;  3A8R A;  4XYN A;  2EGD A;  2MHH A;  1QTX A;  1CM1 A;  2EC6 C;  4A4B A;  1BOC A;  1QV0 A;  4MZL A;  2L4H A;  3OHM B;  4GGF A;  4E68 A;  3F45 A;  1A75 A;  1JF2 A;  3ZWH A;  1R6P A;  3BUN B;  1KWO B;  1ZUZ A;  2BE4 A;  2M7L A;  2JOJ A;  2M7N A;  1SCM C;  1X02 A;  1PVB A;  3EK8 A;  1JFJ A;  3KPX A;  2PAS A;  3I5I B;  1EG4 A;  1R2U A;  5CSN A;  2ZNE A;  3DF0 A;  4HSZ A;  3TS5 B;  3NSI A;  3IF7 A;  1YUR A;  3SG5 A;  2P6B B;  1G8I A;  1L7Z A;  4D1E A;  5ER4 X;  5IBW A;  2G2B A;  3EK7 A;  1CFD A;  3SJS A;  1F54 A;  2K8M B;  2RGI A;  1NCY A;  1GGZ A;  3O78 A;  1BLQ A;  2AMI A;  1N65 A;  1AVS A;  1EXR A;  1L2O C;  1BT6 A;  1W7I B;  4PAL A;  4PE4 A;  1UHI A;  1MR8 A;  1B8L A;  1SK6 D;  2BL0 B;  5I8N A;  1KCY A;  2LMV A;  4WQ2 A;  5CSJ A;  1MQ1 A;  3TUY C;  1TNW A;  3CR2 A;  1SPY A;  1XK4 A;  3E3R A;  3I5H C;  1FI5 A;  1AP4 A;  1KQM C;  2LLT A;  2MBX A;  3PAL A;  2KDH A;  2KOT A;  3VRO A;  1U5I B;  4CLN A;  1MHO A;  3ZNI A;  4AQJ A;  1NX3 A;  1H8B A;  2LVJ A;  1CDL A;  3VGO A;  2KAY A;  4IL1 A;  2KBM A;  1EJ3 A;  1MXL C;  1MWN A;  1OOJ A;  2FOT A;  2LHL A;  2LV7 A;  4HRE E;  1CNP A;  3OX5 A;  2KI6 D;  2H61 C;  2LVK A;  1SKT A;  2WOR A;  3PAT A;  4GAO A;  2KGB C;  2WCB A;  1BU3 A;  3I5G C;  1F55 A;  2SAS A;  1CTR A;  2KSP A;  5AFP A;  2M1U A;  1A2X A;  1WRL A;  2DOQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...