2K7BA

Nmr structure of mg2+-bound cabp1 n-domain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
76
structure length
76
Chain Sequence
DRSLRPEEIEELREAFREFDKDKDGYINCRDLGNCMRTMGYMPTEMELIELSQQINMNLGGHVDFDDFVELMGPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calcium-binding protein 1
publication title NMR structure of Mg2+-bound CaBP1 N-domain
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 14
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2008-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2k7bA00
3E3RA 5B8IB 2A4JA 4YGEB 1YURA 2LVKA 4QJ4B 1A4PA 2LM5A 1WRZA 2LV7A 2MRDA 1UHKA 1KFXS 3BUNB 1NPQA 3CR2A 2JNFA 1L7ZA 2BBNA 4MN0A 3PFVA 1GGZA 1S26D 2D8NA 1CM1A 1S1EA 2LP3A 1SCVA 1MUXA 4PE0A 4CPVA 4BY4A 1CKKA 3SG2A 4JWQA 3TS5C 3OHMB 4ORBB 5JJGA 5AANA 2L5XB 1IRJA 1Y1XA 1H4BA 1SCMB 2JOJA 1TTXA 5KSZA 1EG4A 1CLLA 1QLKA 3SG7A 5HLOA 1PSRA 2KFGA 2BKHB 2B1UA 1KK7Z 3SG5A 4GGNA 4F0ZB 2KFHA 2CXJA 2KBMA 2JTZA 5AEQA 4DRWA 2CT9A 3EVUA 3LLEA 1FI5A 1K9PA 1L2OC 2NCOA 4PE4A 3I5GC 1RFJA 2LCPA 1LINA 3SG6A 3BXKA 5DKRA 2NXQA 5J3XA 1SL7A 1TCFA 1WLMA 1BODA 1M45A 2ZNDA 1TIZA 4NDCA 2BL0C 1IWQA 1KK8C 2MLEC 2K7OA 2ZRTA 3LK0A 4ORAB 1DT7B 1DJIA 1EH2A 1TOPA 4DUQA 1TNXA 4OR9B 4C0KA 2L98A 1XFXO 1G8IA 1LVCD 3VRRA 1CMGA 3ICBA 4MZJA 5GQQC 1CNPA 1UHJA 2JZIA 4MZKA 4E68A 3DVMA 4USLA 1B4CA 5HKYA 2FJUB 1A75B 1B47A 2JU0A 5PALA 4MZLA 1J7QA 1E8AA 1QX2A 1JFJA 3IF7A 1XFVO 1BT6A 2E6WA 3CZTX 1CFCA 3DF0B 2LE9B 1KSOA 3CTNA 3TUYC 2KBIA 1FI6A 3NSKA 1BLQA 1XK4A 1A75A 2AMIA 5AERA 2L0PA 2WCBA 2PASA 1XYDA 1H8BA 2MJWB 1ZFSA 3DF0A 3TDUA 3VRPA 1JF0A 1RK9A 2LUCA 2OTGB 4GFTA 1SNLA 1XFZO 4WRIA 2WCEA 1B8LA 3JVTC 2RGIA 1QATA 1DGVA 1NUBA 1J7RA 3FWBA 1YVLA 1NYAA 3O4YA 3KPXA 3PN7C 3M0WA 1J7PA 2HPSA 4NDDA 4P2YB 2MA2A 1JFKA 3BUMB 1NX3A 1UP5A 2QACA 2F3YA 1OMDA 2GGMA 4TNCA 1JWDA 5I2QA 1ZMZA 4PE1A 1NX1A 2QPTA 3BYAA 1OQPA 1IJ5A 2SCPA 1DJWA 1WRKA 2JXCA 1NCYA 2H61C 1F54A 1WRLA 2PVBA 1K8UA 1QJTA 2OS8C 3O6BA 4I5LB 4YGDB 1S5GZ 1FW4A 2JT3A 3LL8B 1HT9A 1KFXL 4OCIA 5ER5A 5CSNA 2I18A 4WQ2A 4CLNA 1EJ3A 2JPTA 4P5OE 3BUXB 1JC2A 2P6BB 2KFFA 1UHHA 2ZFDA 4XJKB 1RWYA 2WORA 2LLUA 4I5KA 1AJ4A 2E30A 2O60A 1BR1B 4A4BA 4PHJA 1UWOA 5KTYA 2K7CA 3I5IC 2JT0A 2M97A 3HX4A 4FTGA 4XJKA 1MXLC 2EHBA 2M1UA 1YUTA 1QX5B 1KQVA 5K89A 1K9KA 2I7AA 1YX8A 3OP0A 2MAZA 4ZCUA 1QS7A 2KYCA 4N1FA 2ZRSA 1V1FA 2MLFC 4AQJA 1LA0A 2JXLA 2G2BA 1J1DA 1QVIY 3LCPC 4PCWA 3JTDC 2Y1NA 1TNWA 1SPYA 2HETA 5KU1A 1AJ5A 2NLNA 3BUOB 4GUKA 5HKWA 1DTLA 1XFWO 1EXRA 1OOJA 3PALA 1WDCC 1WLZA 1AHRA 2JTTA 1SW8A 1W7JB 1UHNA 4ICBA 1ALVA 3CS1A 2JQ6A 1RECA 4NQGA 1DMOA 2JC2A 3CGAA 1DGUA 3VGOA 4QJ5B 1BF5A 2KI6D 3TS5B 5DKNA 2VRGA 3BQ3A 1XA5A 2CBLA 4Q04A 3AAKA 2LMTA 4YI8A 1DJXA 4YRUA 1KWOC 4PE7A 4MBEA 3SG3A 3O78A 5I2OA 2KI4C 1ZACA 1K9UA 1OZOA 2BKIB 2HQWA 3GK4X 1FPWA 2LC5A 1YX7A 2K2AA 3NSIA 1SY9A 1R2UA 2ZN9A 2F2PA 3I5FC 1K96A 3BUWB 2BCBA 3EK7A 1JSAA 2KQ6A 3D10A 1Y6WA 2FCDA 1CFFA 3CR5X 1S36A 2MHHA 1X02A 5ER4X 2KGRA 1BOCA 1CLMA 1NX2A 2OPOA 3I5GB 1AP4A 1K90D 1U5IB 1TCOB 4ZCVA 1LXFC 4GNKB 4MSPA 2PALA 2Q91A 1PSBA 1QIWA 1DJZA 3F45A 1CFPA 1CDLA 1KK7Y 2LP2A 2L4IA 1KQMC 3BOWB 2H2KA 4D1EA 2BL0B 2IS9A 4YGCB 1KK8B 1U5IA 1UURA 1SYMA 2F3ZA 2G9BA 1CB1A 1A29A 1PVAA 2TN4A 5CSJA 1MF8B 2K8MB 3CWGA 1EG3A 2M3WA 2CNPA 3EVVA 4L9MA 1TNQA 1YUSA 3BOWA 4MLWA 1IKUA 3MSEB 2KOTA 3I5HC 1MHOA 2BECA 2FOTA 4I5JA 4C0LA 1M31A 4JQ0D 3RM1A 3C1VA 4I5NB 1KFUS 1CDPA 2KYFA 1SMGA 2AAOA 2L2EA 4PALA 3TUYB 1IGVA 1NIWA 4GGFA 1QLSA 2KAXA 1B1GA 3AKAA 1A03A 1ALWA 1NCXA 2OTGC 4M2PA 1R6PA 2KHNA 1F71A 4PHKA 1Y1UA 2BBMA 5G08A 3PSRA 3TDIA 3JVTB 4OV2A 1M63B 4CFRA 2COLB 1DJYA 2Y5IA 1KSMA 4U8DA 1B7TZ 4AQIA 4HREE 1MQ1A 2GGZA 4YBHB 1IQ3A 1XVJA 1DJHA 2Y1MA 1DVIA 1MR8A 1N65A 2K0JA 1SR6C 3EVRA 1CDNA 1G33A 1F4QA 3FS7A 1NX0A 4HRGA 4GPLB 4M2OA 3OX5A 2LVVA 2JT8A 3ZNIA 4MRYA 3DD4A 4CFQA 2EC6C 3NSLA 2WNDA 1K2HA 2WCFA 1F4OA 1QV1A 2MBXA 1YR5A 2LUXA 2OS8B 1HQVA 1IH0A 2M0RA 3SJSA 1SL8A 1RJVA 2M9GA 2KGBC 2M29A 5CSIA 1SL9A 1M46A 2F33A 1AVSA 3KO0A 2R2IA 1QX7A 1V1GA 1A2XA 3SIAA 2H61A 5D69A 3GK1A 1S3PA 1OSAA 3H4SE 2Y4QA 4YGAA 1S6CA 3PLFB 2LMUA 3OB2B 1LA3A 2K2FA 3DVEA 4MVFA 1UUSA 2M7LA 4BY5A 1AK8A 1KCYA 2WC8A 2CTNA 3EK4A 2CCMA 1LKJA 2FCEA 1FF1A 1TN4A 1S5GY 1GJYA 4GBAA 4YGBB 3I5IB 3IQQA 1PALA 4DCKA 1G4YR 1J55A 2O5GA 3WXAA 4HSZA 2V53A 1ZOTB 1Y1AA 2LNKA 3IQOA 1SK6D 2ZNEA 1B8CA 1N2DA 3D0YA 4PHMA 1D1OA 2DOQA 1GGWA 1QIVA 2EGDA 1RROA 2JULA 3JTDB 1RTP1 1QV0A 2NZ0A 2F8PA 1SCMC 4FQOA 2I94A 5F6TA 1YRTB 1K95A 1JF2A 1QASA 3AKBA 2HQ8A 4XYNA 1C7WA 3DVJA 1WDCB 1C07A 3DVKA 2GV5A 3A8RA 3QRXA 1OMRA 1QTXA 1B9AA 1YUUA 2AUCA 1MXEA 3AAJA 4QJ3B 1BR4B 2ZN8A 4AOMA 2Q4UA 4ETOA 2LHLA 1IJ6A 2KDHA 1F70A 1F55A 1CM4A 1NSHA 3HCMA 1KWOB 2L51A 3GOFA 4N1GA 2PRUA 2KI4B 1L2OB 1Q80A 1AUIB 2LLSA 1JUOA 1YVHA 3CLNA 1ZUZA 3SIBA 2BCAA 3KEVA 1W7IB 3I5FB 3EKHA 3NXAA 4OKHA 4PHNA 1KFUL 3FIAA 2LVIA 1F8HA 2K61A 4MEWA 5DKQA 4PDZA 1BG1A 3WHUB 2LANA 5IBWA 1ODBA 2M8UA 1SRAA 2KAVA 5HYDA 3EK8A 5BPJA 2KSPA 1GQMA 4C0JA 1C7VA 1XK4C 2SASA 4HRHA 1KQMB 2JNXA 5I8NA 2BCXA 2BE4A 2HF5A 1PULA 2M1KB 3LK1A 4IL1A 1DJGA 1IG5A 5HLVA 1CMFA 4WQ3A 2KAYA 4DS7A 4R1EA 4M2QA 2F2OA 4GAOA 3EKJA 4GGFC 2BE6A 2KI6C 3PATA 1XFUO 2JRFA 2M49B 3I5HB 1EL4A 2KQYA 3VRQA 4ORCB 3K21A 1PK0D 4OVNF 4DIRA 1B8RA 3VRNA 1J1EA 1S6IA 1UHIA 1Y0VH 5FYXA 2ISDA 3WNXB 2KNEA 1SBJA 1DF0B 1J7OA 3PN7B 2NCPA 1XO5A 1MWNA 3VROA 2JWWA 1PRWA 1QXPA 3ZWHA 2L4HA 3NSOA 1BMOA 1N0YA 1YRUB 2I2RE 4YI9A 1M39A 1DF0A 3TDZA 1OZSA 2PSRA 1WY9A 2PMYA 5TNCA 2LHIA 3PM8A 1IQ5A 2WOSA 2ZKMX 1SR6B 4JPZB 2K7DA 1TRFA 1BU3A 1NWDA 2EC6B 5HKZA 2L50A 5CSFA 3GK2A 2LMVA 4A4CA 3KHEA 1S6JA 1B7TY 1CLBA 5CPVA 1TNPA 5JOLA 1SKTA 1QVIZ 3O2PA 1CDMA 1FBVA 2LLTA 1CTRA 5AXIA 1K94A 4CIDA 1CFDA 3CR4X 1BJFA 3A4UB 3OB1B 3KF9A 3WHTB 2K7BA 5AFPA 1K93D 2LVJA 3D0YB 1PVBA 1XFYO 4UPGA 1NCZA 3FWCA 4MRXA 3RLZA 4NDBA 1OMVA 1JBAA 1YTZC 3TZ1A 2M7NA 5I2LA 4N5XA 1VRKA 3SG4A 1OE9B 1NP8A 5D7FA 3OX6A 2LAPA
chains in the Genus database with same CATH superfamily
3E3RA 3CYZA 2A4JA 5B8IB 4YGEB 1YURA 2LVKA 4QJ4B 1A4PA 2LM5A 1WRZA 2LV7A 1DQEA 2MRDA 1UHKA 1KFXS 3BUNB 1NPQA 3CR2A 2JNFA 1L7ZA 2BBNA 4MN0A 3PFVA 1GGZA 1S26D 2D8NA 1CM1A 1S1EA 2LP3A 5HL1A 1SCVA 1MUXA 4PE0A 2H8VA 5DICA 4CPVA 4BY4A 1CKKA 3SG2A 4JWQA 3TS5C 3OHMB 4ORBB 5JJGA 5AANA 2L5XB 3RZSA 1IRJA 1Y1XA 1H4BA 1SCMB 2JOJA 1TTXA 5KSZA 1EG4A 1CLLA 1QLKA 3SG7A 5HLOA 1PSRA 2KFGA 2BKHB 2B1UA 1KK7Z 3SG5A 4GGNA 4F0ZB 2KFHA 2CXJA 2KBMA 2JTZA 5AEQA 4DRWA 2CT9A 3EVUA 3LLEA 1FI5A 3L4LA 1K9PA 1L2OC 3UO9A 2NCOA 4PE4A 3I5GC 1CFCA 3B6XA 1RFJA 2LCPA 1LINA 3SG6A 3BXKA 5DKRA 2NXQA 5J3XA 1IIOA 1SL7A 1TCFA 1WLMA 1BODA 1M45A 2ZNDA 1TIZA 4NDCA 2BL0C 4IJ7A 1IWQA 1KK8C 2MLEC 2K7OA 2QDIA 2ZRTA 3LK0A 4ORAB 1DJIA 1DT7B 1EH2A 2WCLA 1TOPA 4DUQA 1TNXA 4OR9B 4C0KA 2L98A 1XFXO 1G8IA 1LVCD 2PYQA 3CZ1A 3VRRA 1CMGA 3ICBA 4MZJA 5GQQC 1CNPA 1UHJA 2JZIA 4MZKA 4E68A 3DVMA 4USLA 1B4CA 5HKYA 4PT1A 2FJUB 1A75B 1B47A 2JU0A 5PALA 4MZLA 1J7QA 1E8AA 1QX2A 1JFJA 3IF7A 1XFVO 1BT6A 2E6WA 3B88A 3CZTX 3OGNA 3DF0B 2LE9B 1KSOA 3CTNA 3TUYC 2KBIA 3Q8IA 1FI6A 3NSKA 1BLQA 1XK4A 1A75A 2AMIA 3CZ2A 5AERA 2L0PA 2WCBA 2PASA 1XYDA 1H8BA 2MJWB 1ZFSA 1C3ZA 3DF0A 3SS3A 3TDUA 1JF0A 1RK9A 2LUCA 2OTGB 4GFTA 1SNLA 1XFZO 3FE8A 2WCEA 1B8LA 3JVTC 4WRIA 3FE9A 2RGIA 1QATA 3R1OA 1DGVA 1NUBA 1J7RA 3FWBA 1YVLA 3CDNA 1NYAA 3O4YA 3QMEA 3KPXA 1OOGA 1XFRA 3PN7C 3M0WA 1J7PA 2HPSA 4NDDA 4P2YB 2MA2A 1JFKA 3BUMB 1NX3A 1UP5A 2QACA 4JD9A 2F3YA 4JKTA 1OMDA 2GGMA 4TNCA 1JWDA 5I2QA 1ZMZA 4PE1A 1NX1A 2QPTA 3BYAA 1OQPA 1IJ5A 2YGUA 1DEKA 2SCPA 1DJWA 1WRKA 2JXCA 3S0EA 1NCYA 2H61C 1F54A 1WRLA 2PVBA 1K8UA 1QJTA 2OS8C 3O6BA 4I5LB 4YGDB 1S5GZ 1FW4A 2JT3A 3LL8B 1HT9A 1KFXL 4OCIA 2K60A 5ER5A 5CSNA 2I18A 4WQ2A 4CLNA 3OBVA 1EJ3A 2JPTA 2BAPA 4P5OE 3BUXB 1JC2A 2P6BB 2KFFA 1UHHA 4F7FA 2ZFDA 4XJKB 3PM2A 2QEBA 1RWYA 2WORA 2LLUA 1C3YA 4I5KA 1AJ4A 3O4XA 2E30A 2O60A 1BR1B 4A4BA 4PHJA 1UWOA 5KTYA 4FQTA 2K7CA 3I5IC 2JT0A 1LS8A 2M97A 3HX4A 4FTGA 1MXLC 2EHBA 4XJKA 2M1UA 1YUTA 1QX5B 1KQVA 5K89A 1K9KA 2I7AA 1YX8A 3B87A 3D76A 3OP0A 2MAZA 3DY9A 4ZCUA 1QS7A 2KYCA 4N1FA 2ZRSA 1V1FA 5D3OA 2JPOA 2MLFC 4AQJA 1LA0A 2JXLA 2G2BA 1J1DA 1QVIY 3LCPC 3S0FA 4PCWA 2QEHA 3JTDC 2Y1NA 1TNWA 3S0DA 1SPYA 2HETA 5KU1A 1AJ5A 3R72A 2NLNA 3BUOB 3BJHA 2WC6A 4GUKA 1DTLA 1XFWO 5HKWA 1EXRA 1OOJA 3PALA 1WDCC 1WLZA 3CZ0A 1AHRA 2JTTA 1SW8A 1W7JB 1UHNA 3D73A 1ALVA 4ICBA 3CS1A 2JQ6A 1RECA 4NQGA 1DMOA 2JC2A 3CGAA 1DGUA 3VGOA 4QJ5B 1BF5A 2KI6D 3TS5B 5DKNA 2VRGA 3BQ3A 1XA5A 2CBLA 4Q04A 3AAKA 2LMTA 4YI8A 1W9ZA 1DJXA 4YRUA 1KWOC 4PE7A 4MBEA 3SG3A 3O78A 5I2OA 2KI4C 1ZACA 1K9UA 1OZOA 2BKIB 2HQWA 3GK4X 1FPWA 2LC5A 1YX7A 2K2AA 3NSIA 1SY9A 1R2UA 2ZN9A 3D77A 3K1EA 2F2PA 3I5FC 1K96A 2WCJA 3BUWB 2BCBA 3EK7A 3R1VA 5I94A 1JSAA 2KQ6A 3D10A 1Y6WA 2FCDA 1CFFA 3CR5X 1S36A 2MHHA 1X02A 5ER4X 2KGRA 1BOCA 1CLMA 1NX2A 2OPOA 3I5GB 1AP4A 1K90D 1U5IB 1TCOB 4ZCVA 1LXFC 4GNKB 4MSPA 2PALA 3CABA 2Q91A 1PSBA 1QIWA 1DJZA 3F45A 1CFPA 1CDLA 3BFHA 1KK7Y 2LP2A 2L4IA 1KQMC 3BOWB 2H2KA 4D1EA 2BL0B 2IS9A 4YGCB 1KK8B 1U5IA 1UURA 1SYMA 2F3ZA 2G9BA 3VRPA 1CB1A 1A29A 1PVAA 4INWA 2TN4A 5CSJA 1MF8B 2K8MB 3CWGA 5FI2A 1EG3A 2M3WA 2CNPA 1OOFA 3EVVA 1TNQA 4L9MA 1YUSA 3BOWA 4MLWA 1IKUA 3D75A 3MSEB 1TUZA 2KOTA 3I5HC 1MHOA 2BECA 2FOTA 4I5JA 4C0LA 1M31A 4JQ0D 3RM1A 3C1VA 4I5NB 1KFUS 1CDPA 2KYFA 1SMGA 2AAOA 2L2EA 4PALA 3TUYB 1IGVA 1NIWA 4GGFA 1QLSA 2KAXA 1B1GA 3AKAA 1A03A 1ALWA 1NCXA 2OTGC 4M2PA 1R6PA 2KHNA 1F71A 1ORGA 4PHKA 1Y1UA 2BBMA 5G08A 3PSRA 3L4AA 2BNXA 3SS5A 3JVTB 4OV2A 1M63B 3TDIA 2COLB 4CFRA 2WCHA 1DJYA 2Y5IA 1KSMA 4U8DA 1B7TZ 1DC1A 4AQIA 4HREE 1MQ1A 2GGZA 3L47A 4YBHB 5FI6A 1IQ3A 1XVJA 1DJHA 2Y1MA 5FI7A 1DVIA 1MR8A 1N65A 2K0JA 1SR6C 3EVRA 1CDNA 3S0BA 1G33A 1F4QA 3FS7A 1NX0A 4HRGA 4GPLB 4M2OA 3OX5A 2LVVA 2JT8A 3ZNIA 4MRYA 2GTEA 3UNWA 3DD4A 4CFQA 2EC6C 3NSLA 2WNDA 1K2HA 2WCFA 1F4OA 1QV1A 2MBXA 3R1PA 1OW4A 1YR5A 3B86A 2LUXA 2OS8B 2KPHA 1HQVA 1IH0A 2M0RA 3SJSA 1SL8A 1RJVA 2M9GA 2KGBC 2M29A 2PQLA 5CSIA 1SL9A 1M46A 3DXLA 2F33A 1AVSA 2WC5A 3KO0A 2R2IA 1QX7A 1V1GA 3N7HA 1A2XA 3SIAA 2H61A 5D69A 3GK1A 1S3PA 1OSAA 3V2LA 3H4SE 2Y4QA 4YGAA 1S6CA 3PLFB 2LMUA 3OB2B 1LA3A 1OOIX 2K2FA 3DVEA 4MVFA 1UUSA 2M7LA 4BY5A 1AK8A 1KCYA 2WC8A 2CTNA 2QEOA 3EK4A 2CCMA 1LKJA 2FCEA 1FF1A 1TN4A 1S5GY 1GJYA 2ERBA 4GBAA 4YGBB 3I5IB 3IQQA 1PALA 4DCKA 1G4YR 3SS4A 1J55A 2O5GA 1T14A 3WXAA 4HSZA 2V53A 1ZOTB 1Y1AA 2LNKA 2WCKA 1SK6D 2ZNEA 1B8CA 1N2DA 3D0YA 3IQOA 4PHMA 1D1OA 2DOQA 1GGWA 1QIVA 2EGDA 1RROA 2JULA 2L2CA 1RTP1 3JTDB 1QV0A 2NZ0A 2F8PA 1SCMC 3D78A 4FQOA 2I94A 3FE6A 5F6TA 1YRTB 1TWOA 1JF2A 1K95A 1QASA 3AKBA 2HQ8A 4XYNA 1C7WA 2QEVA 3DVJA 4KYNA 1WDCB 1C07A 3DVKA 2GV5A 3A8RA 3QRXA 4INXA 1OOHA 1OMRA 2P70A 1QTXA 2WCMA 3DYEA 1B9AA 1YUUA 2AUCA 1MXEA 2L5YA 3AAJA 4QJ3B 1BR4B 2ZN8A 4AOMA 2Q4UA 4ETOA 2LHLA 1P28A 1IJ6A 2KDHA 1F70A 1F55A 1CM4A 1NSHA 1QWVA 3HCMA 1KWOB 2L51A 3GOFA 4N1GA 2PRUA 2KI4B 1L2OB 1Q80A 1AUIB 2LLSA 1SSEB 1JUOA 1YVHA 3CLNA 1ZUZA 3SIBA 2BCAA 3KEVA 1W7IB 3I5FB 3EKHA 3NXAA 4OKHA 4PHNA 1KFUL 3FIAA 2LVIA 1F8HA 2K61A 4MEWA 5DKQA 4PDZA 1BG1A 3WHUB 2LANA 5IBWA 1ODBA 2M8UA 1SRAA 2KLEA 2KAVA 5HYDA 3EK8A 5BPJA 2KLDA 2KSPA 1GQMA 4C0JA 3BFBA 1DELA 1C7VA 1XK4C 2SASA 4HRHA 1KQMB 2JNXA 3B7AA 5I8NA 2BCXA 2BE4A 2HF5A 1PULA 2M1KB 3LK1A 4IL1A 1DJGA 1IG5A 2P71A 5HLVA 3NHIA 1Z2CB 1CMFA 4WQ3A 2KAYA 4DS7A 4R1EA 4M2QA 2F2OA 4GAOA 2FJYA 3EKJA 4GGFC 2BE6A 2KI6C 3D74A 3PATA 1XFUO 5EL2A 2JRFA 2M49B 3I5HB 1EL4A 2KQYA 3VRQA 4ORCB 3K21A 1PK0D 4OVNF 4DIRA 1B8RA 3VRNA 3NHTA 1J1EA 1S6IA 1UHIA 1Y0VH 5FYXA 2ISDA 3WNXB 1GM0A 2KNEA 1SBJA 1DF0B 1J7OA 3PN7B 2NCPA 1Z4HA 1XO5A 1MWNA 3VROA 1TUJA 4OZDA 2JWWA 1PRWA 1QXPA 3ZWHA 2L4HA 3NSOA 1BMOA 1N0YA 1YRUB 2I2RE 4YI9A 1M39A 1DF0A 3TDZA 1OZSA 2PSRA 1WY9A 2PMYA 5TNCA 2LHIA 3PM8A 1IQ5A 2WOSA 2ZKMX 1SR6B 4JPZB 3S0AA 2K7DA 1TRFA 1BU3A 1NWDA 2EC6B 3DZTA 5HKZA 2L50A 5CSFA 3GK2A 3S0GA 2LMVA 4A4CA 3KHEA 1S6JA 1B7TY 1CLBA 5CPVA 1TNPA 3NGVA 5JOLA 1SKTA 1QVIZ 3O2PA 1CDMA 1FBVA 2LLTA 3IVTA 1CTRA 5AXIA 1K94A 4CIDA 1CFDA 3CR4X 1BJFA 3A4UB 3OB1B 3VB1A 3KF9A 3WHTB 2K7BA 5AFPA 1K93D 2LVJA 3D0YB 1PVBA 1XFYO 3PJIA 4UPGA 1NCZA 3FWCA 4MRXA 3RLZA 4NDBA 1OMVA 1JBAA 1YTZC 3EG5B 3TZ1A 2M7NA 5I2LA 4N5XA 1VRKA 3SG4A 1OE9B 1NP8A 5D7FA 3OX6A 3BFAA 2LAPA
chains in the Genus database with same CATH topology
3E3RA 5B8IB 2A4JA 4YGEB 1YURA 2LVKA 4QJ4B 1A4PA 2LM5A 1WRZA 2LV7A 2MRDA 1UHKA 1KFXS 3BUNB 1NPQA 3CR2A 2JNFA 1L7ZA 2BBNA 4MN0A 3PFVA 1GGZA 1S26D 2D8NA 1CM1A 1S1EA 2LP3A 1SCVA 1MUXA 4PE0A 4CPVA 4BY4A 1CKKA 3SG2A 4JWQA 3TS5C 3OHMB 4ORBB 5JJGA 5AANA 2L5XB 1IRJA 1Y1XA 1H4BA 1SCMB 2JOJA 1TTXA 5KSZA 1EG4A 1CLLA 1QLKA 3SG7A 5HLOA 1PSRA 2KFGA 2BKHB 2B1UA 1KK7Z 3SG5A 4GGNA 4F0ZB 2KFHA 2CXJA 2KBMA 2JTZA 5AEQA 4DRWA 2CT9A 3EVUA 3LLEA 1FI5A 1K9PA 1L2OC 2NCOA 4PE4A 3I5GC 1RFJA 2LCPA 1LINA 3SG6A 3BXKA 5DKRA 2NXQA 5J3XA 1SL7A 1TCFA 1WLMA 1BODA 1M45A 2ZNDA 1TIZA 4NDCA 2BL0C 1IWQA 1KK8C 2MLEC 2K7OA 2ZRTA 3LK0A 4ORAB 1DT7B 1DJIA 1EH2A 1TOPA 4DUQA 1TNXA 4OR9B 4C0KA 2L98A 1XFXO 1G8IA 1LVCD 3VRRA 1CMGA 3ICBA 4MZJA 5GQQC 1CNPA 1UHJA 2JZIA 4MZKA 4E68A 3DVMA 4USLA 1B4CA 5HKYA 2FJUB 1A75B 1B47A 2JU0A 5PALA 4MZLA 1J7QA 1E8AA 1QX2A 1JFJA 3IF7A 1XFVO 1BT6A 2E6WA 3CZTX 1CFCA 3DF0B 2LE9B 1KSOA 3CTNA 3TUYC 2KBIA 1FI6A 3NSKA 1BLQA 1XK4A 1A75A 2AMIA 5AERA 2L0PA 2WCBA 2PASA 1XYDA 1H8BA 2MJWB 1ZFSA 3DF0A 3TDUA 3VRPA 1JF0A 1RK9A 2LUCA 2OTGB 4GFTA 1SNLA 1XFZO 4WRIA 2WCEA 1B8LA 3JVTC 2RGIA 1QATA 1DGVA 1NUBA 1J7RA 3FWBA 1YVLA 1NYAA 3O4YA 3KPXA 3PN7C 3M0WA 1J7PA 2HPSA 4NDDA 4P2YB 2MA2A 1JFKA 3BUMB 1NX3A 1UP5A 2QACA 2F3YA 1OMDA 2GGMA 4TNCA 1JWDA 5I2QA 1ZMZA 4PE1A 1NX1A 2QPTA 3BYAA 1OQPA 1IJ5A 2SCPA 1DJWA 1WRKA 2JXCA 1NCYA 2H61C 1F54A 1WRLA 2PVBA 1K8UA 1QJTA 2OS8C 3O6BA 4I5LB 4YGDB 1S5GZ 1FW4A 2JT3A 3LL8B 1HT9A 1KFXL 4OCIA 5ER5A 5CSNA 2I18A 4WQ2A 4CLNA 1EJ3A 2JPTA 4P5OE 3BUXB 1JC2A 2P6BB 2KFFA 1UHHA 2ZFDA 4XJKB 1RWYA 2WORA 2LLUA 4I5KA 1AJ4A 2E30A 2O60A 1BR1B 4A4BA 4PHJA 1UWOA 5KTYA 2K7CA 3I5IC 2JT0A 2M97A 3HX4A 4FTGA 4XJKA 1MXLC 2EHBA 2M1UA 1YUTA 1QX5B 1KQVA 5K89A 1K9KA 2I7AA 1YX8A 3OP0A 2MAZA 4ZCUA 1QS7A 2KYCA 4N1FA 2ZRSA 1V1FA 2MLFC 4AQJA 1LA0A 2JXLA 2G2BA 1J1DA 1QVIY 3LCPC 4PCWA 3JTDC 2Y1NA 1TNWA 1SPYA 2HETA 5KU1A 1AJ5A 2NLNA 3BUOB 4GUKA 5HKWA 1DTLA 1XFWO 1EXRA 1OOJA 3PALA 1WDCC 1WLZA 1AHRA 2JTTA 1SW8A 1W7JB 1UHNA 4ICBA 1ALVA 3CS1A 2JQ6A 1RECA 4NQGA 1DMOA 2JC2A 3CGAA 1DGUA 3VGOA 4QJ5B 1BF5A 2KI6D 3TS5B 5DKNA 2VRGA 3BQ3A 1XA5A 2CBLA 4Q04A 3AAKA 2LMTA 4YI8A 1DJXA 4YRUA 1KWOC 4PE7A 4MBEA 3SG3A 3O78A 5I2OA 2KI4C 1ZACA 1K9UA 1OZOA 2BKIB 2HQWA 3GK4X 1FPWA 2LC5A 1YX7A 2K2AA 3NSIA 1SY9A 1R2UA 2ZN9A 2F2PA 3I5FC 1K96A 3BUWB 2BCBA 3EK7A 1JSAA 2KQ6A 3D10A 1Y6WA 2FCDA 1CFFA 3CR5X 1S36A 2MHHA 1X02A 5ER4X 2KGRA 1BOCA 1CLMA 1NX2A 2OPOA 3I5GB 1AP4A 1K90D 1U5IB 1TCOB 4ZCVA 1LXFC 4GNKB 4MSPA 2PALA 2Q91A 1PSBA 1QIWA 1DJZA 3F45A 1CFPA 1CDLA 1KK7Y 2LP2A 2L4IA 1KQMC 3BOWB 2H2KA 4D1EA 2BL0B 2IS9A 4YGCB 1KK8B 1U5IA 1UURA 1SYMA 2F3ZA 2G9BA 1CB1A 1A29A 1PVAA 2TN4A 5CSJA 1MF8B 2K8MB 3CWGA 1EG3A 2M3WA 2CNPA 3EVVA 4L9MA 1TNQA 1YUSA 3BOWA 4MLWA 1IKUA 3MSEB 2KOTA 3I5HC 1MHOA 2BECA 2FOTA 4I5JA 4C0LA 1M31A 4JQ0D 3RM1A 3C1VA 4I5NB 1KFUS 1CDPA 2KYFA 1SMGA 2AAOA 2L2EA 4PALA 3TUYB 1IGVA 1NIWA 4GGFA 1QLSA 2KAXA 1B1GA 3AKAA 1A03A 1ALWA 1NCXA 2OTGC 4M2PA 1R6PA 2KHNA 1F71A 4PHKA 1Y1UA 2BBMA 5G08A 3PSRA 3TDIA 3JVTB 4OV2A 1M63B 4CFRA 2COLB 1DJYA 2Y5IA 1KSMA 4U8DA 1B7TZ 4AQIA 4HREE 1MQ1A 2GGZA 4YBHB 1IQ3A 1XVJA 1DJHA 2Y1MA 1DVIA 1MR8A 1N65A 2K0JA 1SR6C 3EVRA 1CDNA 1G33A 1F4QA 3FS7A 1NX0A 4HRGA 4GPLB 4M2OA 3OX5A 2LVVA 2JT8A 3ZNIA 4MRYA 3DD4A 4CFQA 2EC6C 3NSLA 2WNDA 1K2HA 2WCFA 1F4OA 1QV1A 2MBXA 1YR5A 2LUXA 2OS8B 1HQVA 1IH0A 2M0RA 3SJSA 1SL8A 1RJVA 2M9GA 2KGBC 2M29A 5CSIA 1SL9A 1M46A 2F33A 1AVSA 3KO0A 2R2IA 1QX7A 1V1GA 1A2XA 3SIAA 2H61A 5D69A 3GK1A 1S3PA 1OSAA 3H4SE 2Y4QA 4YGAA 1S6CA 3PLFB 2LMUA 3OB2B 1LA3A 2K2FA 3DVEA 4MVFA 1UUSA 2M7LA 4BY5A 1AK8A 1KCYA 2WC8A 2CTNA 3EK4A 2CCMA 1LKJA 2FCEA 1FF1A 1TN4A 1S5GY 1GJYA 4GBAA 4YGBB 3I5IB 3IQQA 1PALA 4DCKA 1G4YR 1J55A 2O5GA 3WXAA 4HSZA 2V53A 1ZOTB 1Y1AA 2LNKA 3IQOA 1SK6D 2ZNEA 1B8CA 1N2DA 3D0YA 4PHMA 1D1OA 2DOQA 1GGWA 1QIVA 2EGDA 1RROA 2JULA 3JTDB 1RTP1 1QV0A 2NZ0A 2F8PA 1SCMC 4FQOA 2I94A 5F6TA 1YRTB 1K95A 1JF2A 1QASA 3AKBA 2HQ8A 4XYNA 1C7WA 3DVJA 1WDCB 1C07A 3DVKA 2GV5A 3A8RA 3QRXA 1OMRA 1QTXA 1B9AA 1YUUA 2AUCA 1MXEA 3AAJA 4QJ3B 1BR4B 2ZN8A 4AOMA 2Q4UA 4ETOA 2LHLA 1IJ6A 2KDHA 1F70A 1F55A 1CM4A 1NSHA 3HCMA 1KWOB 2L51A 3GOFA 4N1GA 2PRUA 2KI4B 1L2OB 1Q80A 1AUIB 2LLSA 1JUOA 1YVHA 3CLNA 1ZUZA 3SIBA 2BCAA 3KEVA 1W7IB 3I5FB 3EKHA 3NXAA 4OKHA 4PHNA 1KFUL 3FIAA 2LVIA 1F8HA 2K61A 4MEWA 5DKQA 4PDZA 1BG1A 3WHUB 2LANA 5IBWA 1ODBA 2M8UA 1SRAA 2KAVA 5HYDA 3EK8A 5BPJA 2KSPA 1GQMA 4C0JA 1C7VA 1XK4C 2SASA 4HRHA 1KQMB 2JNXA 5I8NA 2BCXA 2BE4A 2HF5A 1PULA 2M1KB 3LK1A 4IL1A 1DJGA 1IG5A 5HLVA 1CMFA 4WQ3A 2KAYA 4DS7A 4R1EA 4M2QA 2F2OA 4GAOA 3EKJA 4GGFC 2BE6A 2KI6C 3PATA 1XFUO 2JRFA 2M49B 3I5HB 1EL4A 2KQYA 3VRQA 4ORCB 3K21A 1PK0D 4OVNF 4DIRA 1B8RA 3VRNA 1J1EA 1S6IA 1UHIA 1Y0VH 5FYXA 2ISDA 3WNXB 2KNEA 1SBJA 1DF0B 1J7OA 3PN7B 2NCPA 1XO5A 1MWNA 3VROA 2JWWA 1PRWA 1QXPA 3ZWHA 2L4HA 3NSOA 1BMOA 1N0YA 1YRUB 2I2RE 4YI9A 1M39A 1DF0A 3TDZA 1OZSA 2PSRA 1WY9A 2PMYA 5TNCA 2LHIA 3PM8A 1IQ5A 2WOSA 2ZKMX 1SR6B 4JPZB 2K7DA 1TRFA 1BU3A 1NWDA 2EC6B 5HKZA 2L50A 5CSFA 3GK2A 2LMVA 4A4CA 3KHEA 1S6JA 1B7TY 1CLBA 5CPVA 1TNPA 5JOLA 1SKTA 1QVIZ 3O2PA 1CDMA 1FBVA 2LLTA 1CTRA 5AXIA 1K94A 4CIDA 1CFDA 3CR4X 1BJFA 3A4UB 3OB1B 3KF9A 3WHTB 2K7BA 5AFPA 1K93D 2LVJA 3D0YB 1PVBA 1XFYO 4UPGA 1NCZA 3FWCA 4MRXA 3RLZA 4NDBA 1OMVA 1JBAA 1YTZC 3TZ1A 2M7NA 5I2LA 4N5XA 1VRKA 3SG4A 1OE9B 1NP8A 5D7FA 3OX6A 2LAPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E3R A;  5B8I B;  2A4J A;  4YGE B;  1YUR A;  2LVK A;  4QJ4 B;  1A4P A;  2LM5 A;  1WRZ A;  2LV7 A;  2MRD A;  1UHK A;  1KFX S;  3BUN B;  1NPQ A;  3CR2 A;  2JNF A;  1L7Z A;  2BBN A;  4MN0 A;  3PFV A;  1GGZ A;  1S26 D;  2D8N A;  1CM1 A;  1S1E A;  2LP3 A;  1SCV A;  1MUX A;  4PE0 A;  4CPV A;  4BY4 A;  1CKK A;  3SG2 A;  4JWQ A;  3TS5 C;  3OHM B;  4ORB B;  5JJG A;  5AAN A;  2L5X B;  1IRJ A;  1Y1X A;  1H4B A;  1SCM B;  2JOJ A;  1TTX A;  5KSZ A;  1EG4 A;  1CLL A;  1QLK A;  3SG7 A;  5HLO A;  1PSR A;  2KFG A;  2BKH B;  2B1U A;  1KK7 Z;  3SG5 A;  4GGN A;  4F0Z B;  2KFH A;  2CXJ A;  2KBM A;  2JTZ A;  5AEQ A;  4DRW A;  2CT9 A;  3EVU A;  3LLE A;  1FI5 A;  1K9P A;  1L2O C;  2NCO A;  4PE4 A;  3I5G C;  1RFJ A;  2LCP A;  1LIN A;  3SG6 A;  3BXK A;  5DKR A;  2NXQ A;  5J3X A;  1SL7 A;  1TCF A;  1WLM A;  1BOD A;  1M45 A;  2ZND A;  1TIZ A;  4NDC A;  2BL0 C;  1IWQ A;  1KK8 C;  2MLE C;  2K7O A;  2ZRT A;  3LK0 A;  4ORA B;  1DT7 B;  1DJI A;  1EH2 A;  1TOP A;  4DUQ A;  1TNX A;  4OR9 B;  4C0K A;  2L98 A;  1XFX O;  1G8I A;  1LVC D;  3VRR A;  1CMG A;  3ICB A;  4MZJ A;  5GQQ C;  1CNP A;  1UHJ A;  2JZI A;  4MZK A;  4E68 A;  3DVM A;  4USL A;  1B4C A;  5HKY A;  2FJU B;  1A75 B;  1B47 A;  2JU0 A;  5PAL A;  4MZL A;  1J7Q A;  1E8A A;  1QX2 A;  1JFJ A;  3IF7 A;  1XFV O;  1BT6 A;  2E6W A;  3CZT X;  1CFC A;  3DF0 B;  2LE9 B;  1KSO A;  3CTN A;  3TUY C;  2KBI A;  1FI6 A;  3NSK A;  1BLQ A;  1XK4 A;  1A75 A;  2AMI A;  5AER A;  2L0P A;  2WCB A;  2PAS A;  1XYD A;  1H8B A;  2MJW B;  1ZFS A;  3DF0 A;  3TDU A;  3VRP A;  1JF0 A;  1RK9 A;  2LUC A;  2OTG B;  4GFT A;  1SNL A;  1XFZ O;  4WRI A;  2WCE A;  1B8L A;  3JVT C;  2RGI A;  1QAT A;  1DGV A;  1NUB A;  1J7R A;  3FWB A;  1YVL A;  1NYA A;  3O4Y A;  3KPX A;  3PN7 C;  3M0W A;  1J7P A;  2HPS A;  4NDD A;  4P2Y B;  2MA2 A;  1JFK A;  3BUM B;  1NX3 A;  1UP5 A;  2QAC A;  2F3Y A;  1OMD A;  2GGM A;  4TNC A;  1JWD A;  5I2Q A;  1ZMZ A;  4PE1 A;  1NX1 A;  2QPT A;  3BYA A;  1OQP A;  1IJ5 A;  2SCP A;  1DJW A;  1WRK A;  2JXC A;  1NCY A;  2H61 C;  1F54 A;  1WRL A;  2PVB A;  1K8U A;  1QJT A;  2OS8 C;  3O6B A;  4I5L B;  4YGD B;  1S5G Z;  1FW4 A;  2JT3 A;  3LL8 B;  1HT9 A;  1KFX L;  4OCI A;  5ER5 A;  5CSN A;  2I18 A;  4WQ2 A;  4CLN A;  1EJ3 A;  2JPT A;  4P5O E;  3BUX B;  1JC2 A;  2P6B B;  2KFF A;  1UHH A;  2ZFD A;  4XJK B;  1RWY A;  2WOR A;  2LLU A;  4I5K A;  1AJ4 A;  2E30 A;  2O60 A;  1BR1 B;  4A4B A;  4PHJ A;  1UWO A;  5KTY A;  2K7C A;  3I5I C;  2JT0 A;  2M97 A;  3HX4 A;  4FTG A;  4XJK A;  1MXL C;  2EHB A;  2M1U A;  1YUT A;  1QX5 B;  1KQV A;  5K89 A;  1K9K A;  2I7A A;  1YX8 A;  3OP0 A;  2MAZ A;  4ZCU A;  1QS7 A;  2KYC A;  4N1F A;  2ZRS A;  1V1F A;  2MLF C;  4AQJ A;  1LA0 A;  2JXL A;  2G2B A;  1J1D A;  1QVI Y;  3LCP C;  4PCW A;  3JTD C;  2Y1N A;  1TNW A;  1SPY A;  2HET A;  5KU1 A;  1AJ5 A;  2NLN A;  3BUO B;  4GUK A;  5HKW A;  1DTL A;  1XFW O;  1EXR A;  1OOJ A;  3PAL A;  1WDC C;  1WLZ A;  1AHR A;  2JTT A;  1SW8 A;  1W7J B;  1UHN A;  4ICB A;  1ALV A;  3CS1 A;  2JQ6 A;  1REC A;  4NQG A;  1DMO A;  2JC2 A;  3CGA A;  1DGU A;  3VGO A;  4QJ5 B;  1BF5 A;  2KI6 D;  3TS5 B;  5DKN A;  2VRG A;  3BQ3 A;  1XA5 A;  2CBL A;  4Q04 A;  3AAK A;  2LMT A;  4YI8 A;  1DJX A;  4YRU A;  1KWO C;  4PE7 A;  4MBE A;  3SG3 A;  3O78 A;  5I2O A;  2KI4 C;  1ZAC A;  1K9U A;  1OZO A;  2BKI B;  2HQW A;  3GK4 X;  1FPW A;  2LC5 A;  1YX7 A;  2K2A A;  3NSI A;  1SY9 A;  1R2U A;  2ZN9 A;  2F2P A;  3I5F C;  1K96 A;  3BUW B;  2BCB A;  3EK7 A;  1JSA A;  2KQ6 A;  3D10 A;  1Y6W A;  2FCD A;  1CFF A;  3CR5 X;  1S36 A;  2MHH A;  1X02 A;  5ER4 X;  2KGR A;  1BOC A;  1CLM A;  1NX2 A;  2OPO A;  3I5G B;  1AP4 A;  1K90 D;  1U5I B;  1TCO B;  4ZCV A;  1LXF C;  4GNK B;  4MSP A;  2PAL A;  2Q91 A;  1PSB A;  1QIW A;  1DJZ A;  3F45 A;  1CFP A;  1CDL A;  1KK7 Y;  2LP2 A;  2L4I A;  1KQM C;  3BOW B;  2H2K A;  4D1E A;  2BL0 B;  2IS9 A;  4YGC B;  1KK8 B;  1U5I A;  1UUR A;  1SYM A;  2F3Z A;  2G9B A;  1CB1 A;  1A29 A;  1PVA A;  2TN4 A;  5CSJ A;  1MF8 B;  2K8M B;  3CWG A;  1EG3 A;  2M3W A;  2CNP A;  3EVV A;  4L9M A;  1TNQ A;  1YUS A;  3BOW A;  4MLW A;  1IKU A;  3MSE B;  2KOT A;  3I5H C;  1MHO A;  2BEC A;  2FOT A;  4I5J A;  4C0L A;  1M31 A;  4JQ0 D;  3RM1 A;  3C1V A;  4I5N B;  1KFU S;  1CDP A;  2KYF A;  1SMG A;  2AAO A;  2L2E A;  4PAL A;  3TUY B;  1IGV A;  1NIW A;  4GGF A;  1QLS A;  2KAX A;  1B1G A;  3AKA A;  1A03 A;  1ALW A;  1NCX A;  2OTG C;  4M2P A;  1R6P A;  2KHN A;  1F71 A;  4PHK A;  1Y1U A;  2BBM A;  5G08 A;  3PSR A;  3TDI A;  3JVT B;  4OV2 A;  1M63 B;  4CFR A;  2COL B;  1DJY A;  2Y5I A;  1KSM A;  4U8D A;  1B7T Z;  4AQI A;  4HRE E;  1MQ1 A;  2GGZ A;  4YBH B;  1IQ3 A;  1XVJ A;  1DJH A;  2Y1M A;  1DVI A;  1MR8 A;  1N65 A;  2K0J A;  1SR6 C;  3EVR A;  1CDN A;  1G33 A;  1F4Q A;  3FS7 A;  1NX0 A;  4HRG A;  4GPL B;  4M2O A;  3OX5 A;  2LVV A;  2JT8 A;  3ZNI A;  4MRY A;  3DD4 A;  4CFQ A;  2EC6 C;  3NSL A;  2WND A;  1K2H A;  2WCF A;  1F4O A;  1QV1 A;  2MBX A;  1YR5 A;  2LUX A;  2OS8 B;  1HQV A;  1IH0 A;  2M0R A;  3SJS A;  1SL8 A;  1RJV A;  2M9G A;  2KGB C;  2M29 A;  5CSI A;  1SL9 A;  1M46 A;  2F33 A;  1AVS A;  3KO0 A;  2R2I A;  1QX7 A;  1V1G A;  1A2X A;  3SIA A;  2H61 A;  5D69 A;  3GK1 A;  1S3P A;  1OSA A;  3H4S E;  2Y4Q A;  4YGA A;  1S6C A;  3PLF B;  2LMU A;  3OB2 B;  1LA3 A;  2K2F A;  3DVE A;  4MVF A;  1UUS A;  2M7L A;  4BY5 A;  1AK8 A;  1KCY A;  2WC8 A;  2CTN A;  3EK4 A;  2CCM A;  1LKJ A;  2FCE A;  1FF1 A;  1TN4 A;  1S5G Y;  1GJY A;  4GBA A;  4YGB B;  3I5I B;  3IQQ A;  1PAL A;  4DCK A;  1G4Y R;  1J55 A;  2O5G A;  3WXA A;  4HSZ A;  2V53 A;  1ZOT B;  1Y1A A;  2LNK A;  3IQO A;  1SK6 D;  2ZNE A;  1B8C A;  1N2D A;  3D0Y A;  4PHM A;  1D1O A;  2DOQ A;  1GGW A;  1QIV A;  2EGD A;  1RRO A;  2JUL A;  3JTD B;  1RTP 1;  1QV0 A;  2NZ0 A;  2F8P A;  1SCM C;  4FQO A;  2I94 A;  5F6T A;  1YRT B;  1K95 A;  1JF2 A;  1QAS A;  3AKB A;  2HQ8 A;  4XYN A;  1C7W A;  3DVJ A;  1WDC B;  1C07 A;  3DVK A;  2GV5 A;  3A8R A;  3QRX A;  1OMR A;  1QTX A;  1B9A A;  1YUU A;  2AUC A;  1MXE A;  3AAJ A;  4QJ3 B;  1BR4 B;  2ZN8 A;  4AOM A;  2Q4U A;  4ETO A;  2LHL A;  1IJ6 A;  2KDH A;  1F70 A;  1F55 A;  1CM4 A;  1NSH A;  3HCM A;  1KWO B;  2L51 A;  3GOF A;  4N1G A;  2PRU A;  2KI4 B;  1L2O B;  1Q80 A;  1AUI B;  2LLS A;  1JUO A;  1YVH A;  3CLN A;  1ZUZ A;  3SIB A;  2BCA A;  3KEV A;  1W7I B;  3I5F B;  3EKH A;  3NXA A;  4OKH A;  4PHN A;  1KFU L;  3FIA A;  2LVI A;  1F8H A;  2K61 A;  4MEW A;  5DKQ A;  4PDZ A;  1BG1 A;  3WHU B;  2LAN A;  5IBW A;  1ODB A;  2M8U A;  1SRA A;  2KAV A;  5HYD A;  3EK8 A;  5BPJ A;  2KSP A;  1GQM A;  4C0J A;  1C7V A;  1XK4 C;  2SAS A;  4HRH A;  1KQM B;  2JNX A;  5I8N A;  2BCX A;  2BE4 A;  2HF5 A;  1PUL A;  2M1K B;  3LK1 A;  4IL1 A;  1DJG A;  1IG5 A;  5HLV A;  1CMF A;  4WQ3 A;  2KAY A;  4DS7 A;  4R1E A;  4M2Q A;  2F2O A;  4GAO A;  3EKJ A;  4GGF C;  2BE6 A;  2KI6 C;  3PAT A;  1XFU O;  2JRF A;  2M49 B;  3I5H B;  1EL4 A;  2KQY A;  3VRQ A;  4ORC B;  3K21 A;  1PK0 D;  4OVN F;  4DIR A;  1B8R A;  3VRN A;  1J1E A;  1S6I A;  1UHI A;  1Y0V H;  5FYX A;  2ISD A;  3WNX B;  2KNE A;  1SBJ A;  1DF0 B;  1J7O A;  3PN7 B;  2NCP A;  1XO5 A;  1MWN A;  3VRO A;  2JWW A;  1PRW A;  1QXP A;  3ZWH A;  2L4H A;  3NSO A;  1BMO A;  1N0Y A;  1YRU B;  2I2R E;  4YI9 A;  1M39 A;  1DF0 A;  3TDZ A;  1OZS A;  2PSR A;  1WY9 A;  2PMY A;  5TNC A;  2LHI A;  3PM8 A;  1IQ5 A;  2WOS A;  2ZKM X;  1SR6 B;  4JPZ B;  2K7D A;  1TRF A;  1BU3 A;  1NWD A;  2EC6 B;  5HKZ A;  2L50 A;  5CSF A;  3GK2 A;  2LMV A;  4A4C A;  3KHE A;  1S6J A;  1B7T Y;  1CLB A;  5CPV A;  1TNP A;  5JOL A;  1SKT A;  1QVI Z;  3O2P A;  1CDM A;  1FBV A;  2LLT A;  1CTR A;  5AXI A;  1K94 A;  4CID A;  1CFD A;  3CR4 X;  1BJF A;  3A4U B;  3OB1 B;  3KF9 A;  3WHT B;  2K7B A;  5AFP A;  1K93 D;  2LVJ A;  3D0Y B;  1PVB A;  1XFY O;  4UPG A;  1NCZ A;  3FWC A;  4MRX A;  3RLZ A;  4NDB A;  1OMV A;  1JBA A;  1YTZ C;  3TZ1 A;  2M7N A;  5I2L A;  4N5X A;  1VRK A;  3SG4 A;  1OE9 B;  1NP8 A;  5D7F A;  3OX6 A;  2LAP A; 
#chains in the Genus database with same CATH topology
 3E3R A;  3CYZ A;  2A4J A;  5B8I B;  4YGE B;  1YUR A;  2LVK A;  4QJ4 B;  1A4P A;  2LM5 A;  1WRZ A;  2LV7 A;  1DQE A;  2MRD A;  1UHK A;  1KFX S;  3BUN B;  1NPQ A;  3CR2 A;  2JNF A;  1L7Z A;  2BBN A;  4MN0 A;  3PFV A;  1GGZ A;  1S26 D;  2D8N A;  1CM1 A;  1S1E A;  2LP3 A;  5HL1 A;  1SCV A;  1MUX A;  4PE0 A;  2H8V A;  5DIC A;  4CPV A;  4BY4 A;  1CKK A;  3SG2 A;  4JWQ A;  3TS5 C;  3OHM B;  4ORB B;  5JJG A;  5AAN A;  2L5X B;  3RZS A;  1IRJ A;  1Y1X A;  1H4B A;  1SCM B;  2JOJ A;  1TTX A;  5KSZ A;  1EG4 A;  1CLL A;  1QLK A;  3SG7 A;  5HLO A;  1PSR A;  2KFG A;  2BKH B;  2B1U A;  1KK7 Z;  3SG5 A;  4GGN A;  4F0Z B;  2KFH A;  2CXJ A;  2KBM A;  2JTZ A;  5AEQ A;  4DRW A;  2CT9 A;  3EVU A;  3LLE A;  1FI5 A;  3L4L A;  1K9P A;  1L2O C;  3UO9 A;  2NCO A;  4PE4 A;  3I5G C;  1CFC A;  3B6X A;  1RFJ A;  2LCP A;  1LIN A;  3SG6 A;  3BXK A;  5DKR A;  2NXQ A;  5J3X A;  1IIO A;  1SL7 A;  1TCF A;  1WLM A;  1BOD A;  1M45 A;  2ZND A;  1TIZ A;  4NDC A;  2BL0 C;  4IJ7 A;  1IWQ A;  1KK8 C;  2MLE C;  2K7O A;  2QDI A;  2ZRT A;  3LK0 A;  4ORA B;  1DJI A;  1DT7 B;  1EH2 A;  2WCL A;  1TOP A;  4DUQ A;  1TNX A;  4OR9 B;  4C0K A;  2L98 A;  1XFX O;  1G8I A;  1LVC D;  2PYQ A;  3CZ1 A;  3VRR A;  1CMG A;  3ICB A;  4MZJ A;  5GQQ C;  1CNP A;  1UHJ A;  2JZI A;  4MZK A;  4E68 A;  3DVM A;  4USL A;  1B4C A;  5HKY A;  4PT1 A;  2FJU B;  1A75 B;  1B47 A;  2JU0 A;  5PAL A;  4MZL A;  1J7Q A;  1E8A A;  1QX2 A;  1JFJ A;  3IF7 A;  1XFV O;  1BT6 A;  2E6W A;  3B88 A;  3CZT X;  3OGN A;  3DF0 B;  2LE9 B;  1KSO A;  3CTN A;  3TUY C;  2KBI A;  3Q8I A;  1FI6 A;  3NSK A;  1BLQ A;  1XK4 A;  1A75 A;  2AMI A;  3CZ2 A;  5AER A;  2L0P A;  2WCB A;  2PAS A;  1XYD A;  1H8B A;  2MJW B;  1ZFS A;  1C3Z A;  3DF0 A;  3SS3 A;  3TDU A;  1JF0 A;  1RK9 A;  2LUC A;  2OTG B;  4GFT A;  1SNL A;  1XFZ O;  3FE8 A;  2WCE A;  1B8L A;  3JVT C;  4WRI A;  3FE9 A;  2RGI A;  1QAT A;  3R1O A;  1DGV A;  1NUB A;  1J7R A;  3FWB A;  1YVL A;  3CDN A;  1NYA A;  3O4Y A;  3QME A;  3KPX A;  1OOG A;  1XFR A;  3PN7 C;  3M0W A;  1J7P A;  2HPS A;  4NDD A;  4P2Y B;  2MA2 A;  1JFK A;  3BUM B;  1NX3 A;  1UP5 A;  2QAC A;  4JD9 A;  2F3Y A;  4JKT A;  1OMD A;  2GGM A;  4TNC A;  1JWD A;  5I2Q A;  1ZMZ A;  4PE1 A;  1NX1 A;  2QPT A;  3BYA A;  1OQP A;  1IJ5 A;  2YGU A;  1DEK A;  2SCP A;  1DJW A;  1WRK A;  2JXC A;  3S0E A;  1NCY A;  2H61 C;  1F54 A;  1WRL A;  2PVB A;  1K8U A;  1QJT A;  2OS8 C;  3O6B A;  4I5L B;  4YGD B;  1S5G Z;  1FW4 A;  2JT3 A;  3LL8 B;  1HT9 A;  1KFX L;  4OCI A;  2K60 A;  5ER5 A;  5CSN A;  2I18 A;  4WQ2 A;  4CLN A;  3OBV A;  1EJ3 A;  2JPT A;  2BAP A;  4P5O E;  3BUX B;  1JC2 A;  2P6B B;  2KFF A;  1UHH A;  4F7F A;  2ZFD A;  4XJK B;  3PM2 A;  2QEB A;  1RWY A;  2WOR A;  2LLU A;  1C3Y A;  4I5K A;  1AJ4 A;  3O4X A;  2E30 A;  2O60 A;  1BR1 B;  4A4B A;  4PHJ A;  1UWO A;  5KTY A;  4FQT A;  2K7C A;  3I5I C;  2JT0 A;  1LS8 A;  2M97 A;  3HX4 A;  4FTG A;  1MXL C;  2EHB A;  4XJK A;  2M1U A;  1YUT A;  1QX5 B;  1KQV A;  5K89 A;  1K9K A;  2I7A A;  1YX8 A;  3B87 A;  3D76 A;  3OP0 A;  2MAZ A;  3DY9 A;  4ZCU A;  1QS7 A;  2KYC A;  4N1F A;  2ZRS A;  1V1F A;  5D3O A;  2JPO A;  2MLF C;  4AQJ A;  1LA0 A;  2JXL A;  2G2B A;  1J1D A;  1QVI Y;  3LCP C;  3S0F A;  4PCW A;  2QEH A;  3JTD C;  2Y1N A;  1TNW A;  3S0D A;  1SPY A;  2HET A;  5KU1 A;  1AJ5 A;  3R72 A;  2NLN A;  3BUO B;  3BJH A;  2WC6 A;  4GUK A;  1DTL A;  1XFW O;  5HKW A;  1EXR A;  1OOJ A;  3PAL A;  1WDC C;  1WLZ A;  3CZ0 A;  1AHR A;  2JTT A;  1SW8 A;  1W7J B;  1UHN A;  3D73 A;  1ALV A;  4ICB A;  3CS1 A;  2JQ6 A;  1REC A;  4NQG A;  1DMO A;  2JC2 A;  3CGA A;  1DGU A;  3VGO A;  4QJ5 B;  1BF5 A;  2KI6 D;  3TS5 B;  5DKN A;  2VRG A;  3BQ3 A;  1XA5 A;  2CBL A;  4Q04 A;  3AAK A;  2LMT A;  4YI8 A;  1W9Z A;  1DJX A;  4YRU A;  1KWO C;  4PE7 A;  4MBE A;  3SG3 A;  3O78 A;  5I2O A;  2KI4 C;  1ZAC A;  1K9U A;  1OZO A;  2BKI B;  2HQW A;  3GK4 X;  1FPW A;  2LC5 A;  1YX7 A;  2K2A A;  3NSI A;  1SY9 A;  1R2U A;  2ZN9 A;  3D77 A;  3K1E A;  2F2P A;  3I5F C;  1K96 A;  2WCJ A;  3BUW B;  2BCB A;  3EK7 A;  3R1V A;  5I94 A;  1JSA A;  2KQ6 A;  3D10 A;  1Y6W A;  2FCD A;  1CFF A;  3CR5 X;  1S36 A;  2MHH A;  1X02 A;  5ER4 X;  2KGR A;  1BOC A;  1CLM A;  1NX2 A;  2OPO A;  3I5G B;  1AP4 A;  1K90 D;  1U5I B;  1TCO B;  4ZCV A;  1LXF C;  4GNK B;  4MSP A;  2PAL A;  3CAB A;  2Q91 A;  1PSB A;  1QIW A;  1DJZ A;  3F45 A;  1CFP A;  1CDL A;  3BFH A;  1KK7 Y;  2LP2 A;  2L4I A;  1KQM C;  3BOW B;  2H2K A;  4D1E A;  2BL0 B;  2IS9 A;  4YGC B;  1KK8 B;  1U5I A;  1UUR A;  1SYM A;  2F3Z A;  2G9B A;  3VRP A;  1CB1 A;  1A29 A;  1PVA A;  4INW A;  2TN4 A;  5CSJ A;  1MF8 B;  2K8M B;  3CWG A;  5FI2 A;  1EG3 A;  2M3W A;  2CNP A;  1OOF A;  3EVV A;  1TNQ A;  4L9M A;  1YUS A;  3BOW A;  4MLW A;  1IKU A;  3D75 A;  3MSE B;  1TUZ A;  2KOT A;  3I5H C;  1MHO A;  2BEC A;  2FOT A;  4I5J A;  4C0L A;  1M31 A;  4JQ0 D;  3RM1 A;  3C1V A;  4I5N B;  1KFU S;  1CDP A;  2KYF A;  1SMG A;  2AAO A;  2L2E A;  4PAL A;  3TUY B;  1IGV A;  1NIW A;  4GGF A;  1QLS A;  2KAX A;  1B1G A;  3AKA A;  1A03 A;  1ALW A;  1NCX A;  2OTG C;  4M2P A;  1R6P A;  2KHN A;  1F71 A;  1ORG A;  4PHK A;  1Y1U A;  2BBM A;  5G08 A;  3PSR A;  3L4A A;  2BNX A;  3SS5 A;  3JVT B;  4OV2 A;  1M63 B;  3TDI A;  2COL B;  4CFR A;  2WCH A;  1DJY A;  2Y5I A;  1KSM A;  4U8D A;  1B7T Z;  1DC1 A;  4AQI A;  4HRE E;  1MQ1 A;  2GGZ A;  3L47 A;  4YBH B;  5FI6 A;  1IQ3 A;  1XVJ A;  1DJH A;  2Y1M A;  5FI7 A;  1DVI A;  1MR8 A;  1N65 A;  2K0J A;  1SR6 C;  3EVR A;  1CDN A;  3S0B A;  1G33 A;  1F4Q A;  3FS7 A;  1NX0 A;  4HRG A;  4GPL B;  4M2O A;  3OX5 A;  2LVV A;  2JT8 A;  3ZNI A;  4MRY A;  2GTE A;  3UNW A;  3DD4 A;  4CFQ A;  2EC6 C;  3NSL A;  2WND A;  1K2H A;  2WCF A;  1F4O A;  1QV1 A;  2MBX A;  3R1P A;  1OW4 A;  1YR5 A;  3B86 A;  2LUX A;  2OS8 B;  2KPH A;  1HQV A;  1IH0 A;  2M0R A;  3SJS A;  1SL8 A;  1RJV A;  2M9G A;  2KGB C;  2M29 A;  2PQL A;  5CSI A;  1SL9 A;  1M46 A;  3DXL A;  2F33 A;  1AVS A;  2WC5 A;  3KO0 A;  2R2I A;  1QX7 A;  1V1G A;  3N7H A;  1A2X A;  3SIA A;  2H61 A;  5D69 A;  3GK1 A;  1S3P A;  1OSA A;  3V2L A;  3H4S E;  2Y4Q A;  4YGA A;  1S6C A;  3PLF B;  2LMU A;  3OB2 B;  1LA3 A;  1OOI X;  2K2F A;  3DVE A;  4MVF A;  1UUS A;  2M7L A;  4BY5 A;  1AK8 A;  1KCY A;  2WC8 A;  2CTN A;  2QEO A;  3EK4 A;  2CCM A;  1LKJ A;  2FCE A;  1FF1 A;  1TN4 A;  1S5G Y;  1GJY A;  2ERB A;  4GBA A;  4YGB B;  3I5I B;  3IQQ A;  1PAL A;  4DCK A;  1G4Y R;  3SS4 A;  1J55 A;  2O5G A;  1T14 A;  3WXA A;  4HSZ A;  2V53 A;  1ZOT B;  1Y1A A;  2LNK A;  2WCK A;  1SK6 D;  2ZNE A;  1B8C A;  1N2D A;  3D0Y A;  3IQO A;  4PHM A;  1D1O A;  2DOQ A;  1GGW A;  1QIV A;  2EGD A;  1RRO A;  2JUL A;  2L2C A;  1RTP 1;  3JTD B;  1QV0 A;  2NZ0 A;  2F8P A;  1SCM C;  3D78 A;  4FQO A;  2I94 A;  3FE6 A;  5F6T A;  1YRT B;  1TWO A;  1JF2 A;  1K95 A;  1QAS A;  3AKB A;  2HQ8 A;  4XYN A;  1C7W A;  2QEV A;  3DVJ A;  4KYN A;  1WDC B;  1C07 A;  3DVK A;  2GV5 A;  3A8R A;  3QRX A;  4INX A;  1OOH A;  1OMR A;  2P70 A;  1QTX A;  2WCM A;  3DYE A;  1B9A A;  1YUU A;  2AUC A;  1MXE A;  2L5Y A;  3AAJ A;  4QJ3 B;  1BR4 B;  2ZN8 A;  4AOM A;  2Q4U A;  4ETO A;  2LHL A;  1P28 A;  1IJ6 A;  2KDH A;  1F70 A;  1F55 A;  1CM4 A;  1NSH A;  1QWV A;  3HCM A;  1KWO B;  2L51 A;  3GOF A;  4N1G A;  2PRU A;  2KI4 B;  1L2O B;  1Q80 A;  1AUI B;  2LLS A;  1SSE B;  1JUO A;  1YVH A;  3CLN A;  1ZUZ A;  3SIB A;  2BCA A;  3KEV A;  1W7I B;  3I5F B;  3EKH A;  3NXA A;  4OKH A;  4PHN A;  1KFU L;  3FIA A;  2LVI A;  1F8H A;  2K61 A;  4MEW A;  5DKQ A;  4PDZ A;  1BG1 A;  3WHU B;  2LAN A;  5IBW A;  1ODB A;  2M8U A;  1SRA A;  2KLE A;  2KAV A;  5HYD A;  3EK8 A;  5BPJ A;  2KLD A;  2KSP A;  1GQM A;  4C0J A;  3BFB A;  1DEL A;  1C7V A;  1XK4 C;  2SAS A;  4HRH A;  1KQM B;  2JNX A;  3B7A A;  5I8N A;  2BCX A;  2BE4 A;  2HF5 A;  1PUL A;  2M1K B;  3LK1 A;  4IL1 A;  1DJG A;  1IG5 A;  2P71 A;  5HLV A;  3NHI A;  1Z2C B;  1CMF A;  4WQ3 A;  2KAY A;  4DS7 A;  4R1E A;  4M2Q A;  2F2O A;  4GAO A;  2FJY A;  3EKJ A;  4GGF C;  2BE6 A;  2KI6 C;  3D74 A;  3PAT A;  1XFU O;  5EL2 A;  2JRF A;  2M49 B;  3I5H B;  1EL4 A;  2KQY A;  3VRQ A;  4ORC B;  3K21 A;  1PK0 D;  4OVN F;  4DIR A;  1B8R A;  3VRN A;  3NHT A;  1J1E A;  1S6I A;  1UHI A;  1Y0V H;  5FYX A;  2ISD A;  3WNX B;  1GM0 A;  2KNE A;  1SBJ A;  1DF0 B;  1J7O A;  3PN7 B;  2NCP A;  1Z4H A;  1XO5 A;  1MWN A;  3VRO A;  1TUJ A;  4OZD A;  2JWW A;  1PRW A;  1QXP A;  3ZWH A;  2L4H A;  3NSO A;  1BMO A;  1N0Y A;  1YRU B;  2I2R E;  4YI9 A;  1M39 A;  1DF0 A;  3TDZ A;  1OZS A;  2PSR A;  1WY9 A;  2PMY A;  5TNC A;  2LHI A;  3PM8 A;  1IQ5 A;  2WOS A;  2ZKM X;  1SR6 B;  4JPZ B;  3S0A A;  2K7D A;  1TRF A;  1BU3 A;  1NWD A;  2EC6 B;  3DZT A;  5HKZ A;  2L50 A;  5CSF A;  3GK2 A;  3S0G A;  2LMV A;  4A4C A;  3KHE A;  1S6J A;  1B7T Y;  1CLB A;  5CPV A;  1TNP A;  3NGV A;  5JOL A;  1SKT A;  1QVI Z;  3O2P A;  1CDM A;  1FBV A;  2LLT A;  3IVT A;  1CTR A;  5AXI A;  1K94 A;  4CID A;  1CFD A;  3CR4 X;  1BJF A;  3A4U B;  3OB1 B;  3VB1 A;  3KF9 A;  3WHT B;  2K7B A;  5AFP A;  1K93 D;  2LVJ A;  3D0Y B;  1PVB A;  1XFY O;  3PJI A;  4UPG A;  1NCZ A;  3FWC A;  4MRX A;  3RLZ A;  4NDB A;  1OMV A;  1JBA A;  1YTZ C;  3EG5 B;  3TZ1 A;  2M7N A;  5I2L A;  4N5X A;  1VRK A;  3SG4 A;  1OE9 B;  1NP8 A;  5D7F A;  3OX6 A;  3BFA A;  2LAP A; 
#chains in the Genus database with same CATH homology
 3E3R A;  5B8I B;  2A4J A;  4YGE B;  1YUR A;  2LVK A;  4QJ4 B;  1A4P A;  2LM5 A;  1WRZ A;  2LV7 A;  2MRD A;  1UHK A;  1KFX S;  3BUN B;  1NPQ A;  3CR2 A;  2JNF A;  1L7Z A;  2BBN A;  4MN0 A;  3PFV A;  1GGZ A;  1S26 D;  2D8N A;  1CM1 A;  1S1E A;  2LP3 A;  1SCV A;  1MUX A;  4PE0 A;  4CPV A;  4BY4 A;  1CKK A;  3SG2 A;  4JWQ A;  3TS5 C;  3OHM B;  4ORB B;  5JJG A;  5AAN A;  2L5X B;  1IRJ A;  1Y1X A;  1H4B A;  1SCM B;  2JOJ A;  1TTX A;  5KSZ A;  1EG4 A;  1CLL A;  1QLK A;  3SG7 A;  5HLO A;  1PSR A;  2KFG A;  2BKH B;  2B1U A;  1KK7 Z;  3SG5 A;  4GGN A;  4F0Z B;  2KFH A;  2CXJ A;  2KBM A;  2JTZ A;  5AEQ A;  4DRW A;  2CT9 A;  3EVU A;  3LLE A;  1FI5 A;  1K9P A;  1L2O C;  2NCO A;  4PE4 A;  3I5G C;  1RFJ A;  2LCP A;  1LIN A;  3SG6 A;  3BXK A;  5DKR A;  2NXQ A;  5J3X A;  1SL7 A;  1TCF A;  1WLM A;  1BOD A;  1M45 A;  2ZND A;  1TIZ A;  4NDC A;  2BL0 C;  1IWQ A;  1KK8 C;  2MLE C;  2K7O A;  2ZRT A;  3LK0 A;  4ORA B;  1DT7 B;  1DJI A;  1EH2 A;  1TOP A;  4DUQ A;  1TNX A;  4OR9 B;  4C0K A;  2L98 A;  1XFX O;  1G8I A;  1LVC D;  3VRR A;  1CMG A;  3ICB A;  4MZJ A;  5GQQ C;  1CNP A;  1UHJ A;  2JZI A;  4MZK A;  4E68 A;  3DVM A;  4USL A;  1B4C A;  5HKY A;  2FJU B;  1A75 B;  1B47 A;  2JU0 A;  5PAL A;  4MZL A;  1J7Q A;  1E8A A;  1QX2 A;  1JFJ A;  3IF7 A;  1XFV O;  1BT6 A;  2E6W A;  3CZT X;  1CFC A;  3DF0 B;  2LE9 B;  1KSO A;  3CTN A;  3TUY C;  2KBI A;  1FI6 A;  3NSK A;  1BLQ A;  1XK4 A;  1A75 A;  2AMI A;  5AER A;  2L0P A;  2WCB A;  2PAS A;  1XYD A;  1H8B A;  2MJW B;  1ZFS A;  3DF0 A;  3TDU A;  3VRP A;  1JF0 A;  1RK9 A;  2LUC A;  2OTG B;  4GFT A;  1SNL A;  1XFZ O;  4WRI A;  2WCE A;  1B8L A;  3JVT C;  2RGI A;  1QAT A;  1DGV A;  1NUB A;  1J7R A;  3FWB A;  1YVL A;  1NYA A;  3O4Y A;  3KPX A;  3PN7 C;  3M0W A;  1J7P A;  2HPS A;  4NDD A;  4P2Y B;  2MA2 A;  1JFK A;  3BUM B;  1NX3 A;  1UP5 A;  2QAC A;  2F3Y A;  1OMD A;  2GGM A;  4TNC A;  1JWD A;  5I2Q A;  1ZMZ A;  4PE1 A;  1NX1 A;  2QPT A;  3BYA A;  1OQP A;  1IJ5 A;  2SCP A;  1DJW A;  1WRK A;  2JXC A;  1NCY A;  2H61 C;  1F54 A;  1WRL A;  2PVB A;  1K8U A;  1QJT A;  2OS8 C;  3O6B A;  4I5L B;  4YGD B;  1S5G Z;  1FW4 A;  2JT3 A;  3LL8 B;  1HT9 A;  1KFX L;  4OCI A;  5ER5 A;  5CSN A;  2I18 A;  4WQ2 A;  4CLN A;  1EJ3 A;  2JPT A;  4P5O E;  3BUX B;  1JC2 A;  2P6B B;  2KFF A;  1UHH A;  2ZFD A;  4XJK B;  1RWY A;  2WOR A;  2LLU A;  4I5K A;  1AJ4 A;  2E30 A;  2O60 A;  1BR1 B;  4A4B A;  4PHJ A;  1UWO A;  5KTY A;  2K7C A;  3I5I C;  2JT0 A;  2M97 A;  3HX4 A;  4FTG A;  4XJK A;  1MXL C;  2EHB A;  2M1U A;  1YUT A;  1QX5 B;  1KQV A;  5K89 A;  1K9K A;  2I7A A;  1YX8 A;  3OP0 A;  2MAZ A;  4ZCU A;  1QS7 A;  2KYC A;  4N1F A;  2ZRS A;  1V1F A;  2MLF C;  4AQJ A;  1LA0 A;  2JXL A;  2G2B A;  1J1D A;  1QVI Y;  3LCP C;  4PCW A;  3JTD C;  2Y1N A;  1TNW A;  1SPY A;  2HET A;  5KU1 A;  1AJ5 A;  2NLN A;  3BUO B;  4GUK A;  5HKW A;  1DTL A;  1XFW O;  1EXR A;  1OOJ A;  3PAL A;  1WDC C;  1WLZ A;  1AHR A;  2JTT A;  1SW8 A;  1W7J B;  1UHN A;  4ICB A;  1ALV A;  3CS1 A;  2JQ6 A;  1REC A;  4NQG A;  1DMO A;  2JC2 A;  3CGA A;  1DGU A;  3VGO A;  4QJ5 B;  1BF5 A;  2KI6 D;  3TS5 B;  5DKN A;  2VRG A;  3BQ3 A;  1XA5 A;  2CBL A;  4Q04 A;  3AAK A;  2LMT A;  4YI8 A;  1DJX A;  4YRU A;  1KWO C;  4PE7 A;  4MBE A;  3SG3 A;  3O78 A;  5I2O A;  2KI4 C;  1ZAC A;  1K9U A;  1OZO A;  2BKI B;  2HQW A;  3GK4 X;  1FPW A;  2LC5 A;  1YX7 A;  2K2A A;  3NSI A;  1SY9 A;  1R2U A;  2ZN9 A;  2F2P A;  3I5F C;  1K96 A;  3BUW B;  2BCB A;  3EK7 A;  1JSA A;  2KQ6 A;  3D10 A;  1Y6W A;  2FCD A;  1CFF A;  3CR5 X;  1S36 A;  2MHH A;  1X02 A;  5ER4 X;  2KGR A;  1BOC A;  1CLM A;  1NX2 A;  2OPO A;  3I5G B;  1AP4 A;  1K90 D;  1U5I B;  1TCO B;  4ZCV A;  1LXF C;  4GNK B;  4MSP A;  2PAL A;  2Q91 A;  1PSB A;  1QIW A;  1DJZ A;  3F45 A;  1CFP A;  1CDL A;  1KK7 Y;  2LP2 A;  2L4I A;  1KQM C;  3BOW B;  2H2K A;  4D1E A;  2BL0 B;  2IS9 A;  4YGC B;  1KK8 B;  1U5I A;  1UUR A;  1SYM A;  2F3Z A;  2G9B A;  1CB1 A;  1A29 A;  1PVA A;  2TN4 A;  5CSJ A;  1MF8 B;  2K8M B;  3CWG A;  1EG3 A;  2M3W A;  2CNP A;  3EVV A;  4L9M A;  1TNQ A;  1YUS A;  3BOW A;  4MLW A;  1IKU A;  3MSE B;  2KOT A;  3I5H C;  1MHO A;  2BEC A;  2FOT A;  4I5J A;  4C0L A;  1M31 A;  4JQ0 D;  3RM1 A;  3C1V A;  4I5N B;  1KFU S;  1CDP A;  2KYF A;  1SMG A;  2AAO A;  2L2E A;  4PAL A;  3TUY B;  1IGV A;  1NIW A;  4GGF A;  1QLS A;  2KAX A;  1B1G A;  3AKA A;  1A03 A;  1ALW A;  1NCX A;  2OTG C;  4M2P A;  1R6P A;  2KHN A;  1F71 A;  4PHK A;  1Y1U A;  2BBM A;  5G08 A;  3PSR A;  3TDI A;  3JVT B;  4OV2 A;  1M63 B;  4CFR A;  2COL B;  1DJY A;  2Y5I A;  1KSM A;  4U8D A;  1B7T Z;  4AQI A;  4HRE E;  1MQ1 A;  2GGZ A;  4YBH B;  1IQ3 A;  1XVJ A;  1DJH A;  2Y1M A;  1DVI A;  1MR8 A;  1N65 A;  2K0J A;  1SR6 C;  3EVR A;  1CDN A;  1G33 A;  1F4Q A;  3FS7 A;  1NX0 A;  4HRG A;  4GPL B;  4M2O A;  3OX5 A;  2LVV A;  2JT8 A;  3ZNI A;  4MRY A;  3DD4 A;  4CFQ A;  2EC6 C;  3NSL A;  2WND A;  1K2H A;  2WCF A;  1F4O A;  1QV1 A;  2MBX A;  1YR5 A;  2LUX A;  2OS8 B;  1HQV A;  1IH0 A;  2M0R A;  3SJS A;  1SL8 A;  1RJV A;  2M9G A;  2KGB C;  2M29 A;  5CSI A;  1SL9 A;  1M46 A;  2F33 A;  1AVS A;  3KO0 A;  2R2I A;  1QX7 A;  1V1G A;  1A2X A;  3SIA A;  2H61 A;  5D69 A;  3GK1 A;  1S3P A;  1OSA A;  3H4S E;  2Y4Q A;  4YGA A;  1S6C A;  3PLF B;  2LMU A;  3OB2 B;  1LA3 A;  2K2F A;  3DVE A;  4MVF A;  1UUS A;  2M7L A;  4BY5 A;  1AK8 A;  1KCY A;  2WC8 A;  2CTN A;  3EK4 A;  2CCM A;  1LKJ A;  2FCE A;  1FF1 A;  1TN4 A;  1S5G Y;  1GJY A;  4GBA A;  4YGB B;  3I5I B;  3IQQ A;  1PAL A;  4DCK A;  1G4Y R;  1J55 A;  2O5G A;  3WXA A;  4HSZ A;  2V53 A;  1ZOT B;  1Y1A A;  2LNK A;  3IQO A;  1SK6 D;  2ZNE A;  1B8C A;  1N2D A;  3D0Y A;  4PHM A;  1D1O A;  2DOQ A;  1GGW A;  1QIV A;  2EGD A;  1RRO A;  2JUL A;  3JTD B;  1RTP 1;  1QV0 A;  2NZ0 A;  2F8P A;  1SCM C;  4FQO A;  2I94 A;  5F6T A;  1YRT B;  1K95 A;  1JF2 A;  1QAS A;  3AKB A;  2HQ8 A;  4XYN A;  1C7W A;  3DVJ A;  1WDC B;  1C07 A;  3DVK A;  2GV5 A;  3A8R A;  3QRX A;  1OMR A;  1QTX A;  1B9A A;  1YUU A;  2AUC A;  1MXE A;  3AAJ A;  4QJ3 B;  1BR4 B;  2ZN8 A;  4AOM A;  2Q4U A;  4ETO A;  2LHL A;  1IJ6 A;  2KDH A;  1F70 A;  1F55 A;  1CM4 A;  1NSH A;  3HCM A;  1KWO B;  2L51 A;  3GOF A;  4N1G A;  2PRU A;  2KI4 B;  1L2O B;  1Q80 A;  1AUI B;  2LLS A;  1JUO A;  1YVH A;  3CLN A;  1ZUZ A;  3SIB A;  2BCA A;  3KEV A;  1W7I B;  3I5F B;  3EKH A;  3NXA A;  4OKH A;  4PHN A;  1KFU L;  3FIA A;  2LVI A;  1F8H A;  2K61 A;  4MEW A;  5DKQ A;  4PDZ A;  1BG1 A;  3WHU B;  2LAN A;  5IBW A;  1ODB A;  2M8U A;  1SRA A;  2KAV A;  5HYD A;  3EK8 A;  5BPJ A;  2KSP A;  1GQM A;  4C0J A;  1C7V A;  1XK4 C;  2SAS A;  4HRH A;  1KQM B;  2JNX A;  5I8N A;  2BCX A;  2BE4 A;  2HF5 A;  1PUL A;  2M1K B;  3LK1 A;  4IL1 A;  1DJG A;  1IG5 A;  5HLV A;  1CMF A;  4WQ3 A;  2KAY A;  4DS7 A;  4R1E A;  4M2Q A;  2F2O A;  4GAO A;  3EKJ A;  4GGF C;  2BE6 A;  2KI6 C;  3PAT A;  1XFU O;  2JRF A;  2M49 B;  3I5H B;  1EL4 A;  2KQY A;  3VRQ A;  4ORC B;  3K21 A;  1PK0 D;  4OVN F;  4DIR A;  1B8R A;  3VRN A;  1J1E A;  1S6I A;  1UHI A;  1Y0V H;  5FYX A;  2ISD A;  3WNX B;  2KNE A;  1SBJ A;  1DF0 B;  1J7O A;  3PN7 B;  2NCP A;  1XO5 A;  1MWN A;  3VRO A;  2JWW A;  1PRW A;  1QXP A;  3ZWH A;  2L4H A;  3NSO A;  1BMO A;  1N0Y A;  1YRU B;  2I2R E;  4YI9 A;  1M39 A;  1DF0 A;  3TDZ A;  1OZS A;  2PSR A;  1WY9 A;  2PMY A;  5TNC A;  2LHI A;  3PM8 A;  1IQ5 A;  2WOS A;  2ZKM X;  1SR6 B;  4JPZ B;  2K7D A;  1TRF A;  1BU3 A;  1NWD A;  2EC6 B;  5HKZ A;  2L50 A;  5CSF A;  3GK2 A;  2LMV A;  4A4C A;  3KHE A;  1S6J A;  1B7T Y;  1CLB A;  5CPV A;  1TNP A;  5JOL A;  1SKT A;  1QVI Z;  3O2P A;  1CDM A;  1FBV A;  2LLT A;  1CTR A;  5AXI A;  1K94 A;  4CID A;  1CFD A;  3CR4 X;  1BJF A;  3A4U B;  3OB1 B;  3KF9 A;  3WHT B;  2K7B A;  5AFP A;  1K93 D;  2LVJ A;  3D0Y B;  1PVB A;  1XFY O;  4UPG A;  1NCZ A;  3FWC A;  4MRX A;  3RLZ A;  4NDB A;  1OMV A;  1JBA A;  1YTZ C;  3TZ1 A;  2M7N A;  5I2L A;  4N5X A;  1VRK A;  3SG4 A;  1OE9 B;  1NP8 A;  5D7F A;  3OX6 A;  2LAP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...