5IBWA

Complex of mlcc bound to the tandem iq motif of myoc
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
76
structure length
76
Chain Sequence
SHMNHINTKAQVIEAFKVFDRDGNGYVTVDYLRKVLNELGDMMPADEIEEMIYEADPQNSGYVQYETFVGMLFLWD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Single-lobe Myosin Light Chain C in Complex with the Light Chain-binding Domains of Myosin-1C Provides Insights into Divergent IQ Motif Recognition.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Motor protein
molecule keywords Calcium-binding EF-hand domain-containing protein
total genus 23
structure length 76
sequence length 76
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5ibwA00
1QX5B 2PSRA 3GK1A 3ICBA 5HKZA 2COLB 1BF5A 3OB2B 1S5GY 5HKWA 1VRKA 4PCWA 3WHUB 2R2IA 2K7OA 3VRPA 1K9UA 2EGDA 1QVIZ 4C0LA 2B1UA 3CTNA 2JNXA 2H61C 1UHIA 1CLMA 1LXFC 1BOCA 2JULA 1KWOB 2LLUA 1BT6A 3KF9A 1NCXA 1MUXA 4CIDA 1MXLC 3EVUA 4BY4A 1RFJA 2JC2A 3EK7A 4QJ5B 1KK7Z 1Q80A 4P2YB 4M2PA 1Y6WA 1C7WA 1RK9A 1TCFA 1OE9B 2FOTA 2KYCA 1OOJA 3BUNB 3DVKA 1A03A 3VRRA 3RLZA 3CGAA 1DJZA 1BMOA 1MQ1A 2L4IA 2BECA 1QATA 4OCIA 3KPXA 1QIVA 2JTZA 2MAZA 1EXRA 1V1GA 2LMTA 1CDNA 1DTLA 1KCYA 2KFHA 1XO5A 2KSPA 2M49B 2KDHA 4BY5A 5KSZA 4YRUA 2O5GA 1XFUO 3AAKA 2IS9A 4CLNA 3CLNA 1AP4A 1Y1XA 2I2RE 2JT8A 3I5FB 2FCDA 1L2OB 3PATA 1PSBA 1NX3A 2F2PA 1YUSA 4FQOA 2HQWA 2L98A 4GAOA 1AUIB 1SNLA 3CR4X 2Y5IA 4XJKA 2BCAA 1PVAA 3PSRA 2OTGB 2LVVA 2BL0C 1B7TY 4GUKA 1CNPA 2E6WA 1GGZA 2AUCA 2O60A 5IBWA 1W7IB 1E8AA 1SYMA 3VGOA 3TUYC 2ZFDA 2LUCA 2M1KB 4ICBA 1JF0A 1UP5A 2EC6C 3DVMA 3OB1B 1SCMC 2H2KA 2JT3A 4MBEA 1PVBA 4PHNA 4PE4A 5I2OA 1Y0VH 3RM1A 2PRUA 1QX7A 1D1OA 3K21A 2LAPA 1ZACA 4GBAA 3TZ1A 2CXJA 2KQYA 4GGFA 1N2DA 3OP0A 2ZRTA 1SW8A 2I94A 3TDZA 2KFFA 1F55A 2KI4B 1DJYA 1SK6D 1S5GZ 5KTYA 1TCOB 3BUOB 3PFVA 4GNKB 1B8RA 1KSOA 1NWDA 4HSZA 4MEWA 2Q91A 5J3XA 1AJ4A 1XFXO 1SCVA 1M39A 1CFDA 1S1EA 4PE0A 2MJWB 2OS8C 1SR6B 2M29A 1XFYO 1HT9A 2BBNA 4NDBA 1TRFA 2M3WA 1FBVA 2D8NA 5HLVA 3OX5A 4WQ2A 2BE6A 2JWWA 3D0YB 1PULA 2M0RA 1KQMC 1J55A 1CFFA 4UPGA 1OMVA 3TDUA 2NLNA 1WRZA 4NQGA 2TN4A 4ZCUA 1WRLA 3TS5B 1B7TZ 3GK4X 1ZUZA 1ALVA 1SR6C 1MF8B 2OS8B 2LVIA 3BUMB 3SJSA 3JVTB 1IH0A 2OPOA 1CDPA 4FTGA 4YGDB 1LINA 3C1VA 1RECA 4M2OA 5JOLA 2KI4C 1J7OA 1BU3A 4A4BA 3LK1A 2BCBA 1K9PA 1DMOA 1CM4A 1CKKA 5HYDA 1OZOA 5CSFA 1NX0A 4M2QA 4YGEB 1S6CA 5I2QA 3OHMB 3FWBA 3AKAA 3FWCA 4MVFA 5G08A 5AFPA 1Y1AA 1J7QA 1DJWA 3EK4A 1OSAA 5D69A 1H8BA 2EC6B 2M97A 2PASA 1NX1A 3FS7A 1FI5A 1GJYA 1XK4A 4OKHA 4YGAA 1TTXA 3CR2A 3ZNIA 1JBAA 1G8IA 2MRDA 2E30A 1J1DA 2BL0B 2NCOA 4ORAB 2ZKMX 2JPTA 2Q4UA 2M1UA 2MLFC 1SPYA 1RTP1 2GV5A 3SG7A 2ZNDA 2LE9B 1DJIA 2CT9A 1L2OC 1NYAA 1FI6A 2KNEA 2MA2A 1IRJA 1QLKA 2JNFA 4PHMA 1QASA 4PE7A 1H4BA 3NSKA 4HRGA 4ORCB 1DJHA 1TNXA 2LUXA 4CFRA 1DT7B 3DD4A 3VRNA 2K7DA 1LKJA 2I18A 2RGIA 4AQJA 1J7PA 1MHOA 1LVCD 1TN4A 1TNWA 2M8UA 3D0YA 3PN7C 1ZFSA 1CDLA 4DCKA 1J7RA 2MBXA 4TNCA 3AKBA 2G2BA 2MLEC 1M63B 1G4YR 3O78A 2JXCA 2LV7A 4U8DA 4XYNA 2CCMA 2AMIA 3BYAA 3TDIA 5PALA 1B9AA 2JRFA 2LVKA 3PN7B 1KWOC 1TOPA 1CFCA 1GQMA 2CTNA 5K89A 5ER5A 1QIWA 2SCPA 4I5JA 2V53A 3EK8A 4MN0A 5CSNA 2LVJA 2BKHB 4PALA 1F54A 1TNQA 2KGRA 4MRXA 3KEVA 1K93D 1LA3A 4ORBB 3EKHA 2K0JA 4OR9B 3EVRA 4NDDA 5DKQA 1R6PA 1QVIY 2LP3A 1DF0A 2PMYA 2LLSA 2MHHA 1NX2A 1A4PA 1DF0B 3D10A 1BJFA 1M45A 4YI9A 2JXLA 1S36A 5B8IB 2JZIA 2NZ0A 1JSAA 1NCZA 2KI6D 1ZOTB 4ZCVA 1NPQA 5CPVA 4I5KA 1CMGA 1CLBA 1B47A 3AAJA 3LCPC 1ALWA 1CDMA 2G9BA 2GGMA 3M0WA 4GGFC 1B8LA 1WLMA 4MZJA 4MSPA 5ER4X 1KK7Y 1CMFA 1J1EA 1MWNA 1FPWA 5TNCA 5FYXA 3QRXA 2Y1MA 4HREE 1WDCB 1SL7A 3I5IC 3SIAA 1JC2A 1EG4A 1JWDA 3NSIA 1CTRA 2WCFA 4JWQA 1S6IA 5HKYA 1DJXA 4YBHB 2KOTA 3A4UB 4ETOA 1SL9A 3BQ3A 1YUUA 1F8HA 1DJGA 2ZNEA 2K2FA 3JVTC 2QACA 1Y1UA 2LLTA 2LANA 2WCEA 3A8RA 1R2UA 4PHJA 1V1FA 4E68A 1IGVA 3I5GC 1RJVA 2KAYA 4A4CA 4QJ3B 1KK8C 1KSMA 2K8MB 3TS5C 1NIWA 2WNDA 3KO0A 3DF0B 3IQQA 5HLOA 1QTXA 2KBMA 3NSOA 1KQMB 3SG3A 2WOSA 1KFXL 4HRHA 2K7CA 2I7AA 1SKTA 1LA0A 1IQ3A 2JU0A 2HQ8A 3O4YA 3LLEA 4GPLB 1K9KA 1A2XA 2BE4A 2K7BA 1YUTA 3CR5X 1C07A 3NSLA 3WHTB 1TNPA 3CWGA 1OZSA 1K94A 3ZWHA 2Y4QA 4DS7A 3OX6A 1IJ6A 2LHIA 1YURA 5I8NA 4YI8A 3BUWB 3I5HB 1M31A 2VRGA 3E3RA 3VRQA 3WNXB 3EKJA 1F70A 2KAXA 1S6JA 3O6BA 3BXKA 4N1GA 2JOJA 2DOQA 2QPTA 3IQOA 1BODA 1WRKA 1YRUB 2ZRSA 1XYDA 3O2PA 1DVIA 3CZTX 4XJKB 4DIRA 2L50A 3SG5A 5AANA 2F3ZA 4I5LB 4OV2A 1EH2A 2LM5A 2SASA 1PALA 1XFWO 1NSHA 3LK0A 1SCMB 1KFUL 3PM8A 3FIAA 3DVJA 1YVHA 5D7FA 1YRTB 5BPJA 4MZLA 3TUYB 1UHJA 2WORA 1IG5A 1EL4A 1PRWA 1YVLA 2EHBA 4NDCA 5DKNA 2LMVA 2P6BB 4YGBB 2OTGC 1JUOA 1SBJA 3CS1A 4GGNA 1X02A 1YR5A 1WLZA 4R1EA 2ZN8A 4USLA 3JTDB 3NXAA 4I5NB 4PE1A 3JTDC 3I5FC 2F8PA 2L0PA 1XFVO 1G33A 5AERA 5AXIA 3SG2A 4Q04A 1CM1A 2LP2A 2KYFA 1A29A 1OQPA 2HETA 1B1GA 1EJ3A 3HCMA 2BCXA 1UURA 4C0KA 2L5XB 4WQ3A 2JQ6A 4F0ZB 3HX4A 5AEQA 1N65A 1XFZO 4GFTA 2ZN9A 1SY9A 2K61A 1JFKA 2KQ6A 1PK0D 5DKRA 2PALA 3IF7A 2LC5A 5F6TA 1QV1A 2KHNA 4DRWA 3F45A 2KGBC 3DVEA 4YGCB 1GGWA 2L2EA 1SMGA 2KBIA 2FJUB 1U5IA 1YTZC 4P5OE 3LL8B 3SG6A 1UHKA 3BOWA 2LNKA 1BR1B 1TIZA 2F2OA 2LCPA 5JJGA 1QV0A 1SRAA 1QJTA 1UHNA 3BUXB 3I5HC 2H61A 3PALA 3VROA 5I2LA 2GGZA 2HF5A 2JTTA 5CSIA 2F3YA 1N0YA 1QS7A 4AQIA 1K90D 1PSRA 2A4JA 1KFUS 4PDZA 1XVJA 2AAOA 1AHRA 1MR8A 4DUQA 1B8CA 5CSJA 2L51A 1DGUA 1BG1A 1WY9A 4MZKA 1UWOA 2CNPA 2M7LA 4CFQA 1HQVA 2JT0A 1F4QA 1QXPA 1XK4C 1NP8A 1IQ5A 1ODBA 2BBMA 1NCYA 1CFPA 1KQVA 1JF2A 4MRYA 1FF1A 1RWYA 2NCPA 2NXQA 3BOWB 5KU1A 3SIBA 4AOMA 4D1EA 4MLWA 1UHHA 1K95A 2M7NA 2ISDA 2LHLA 4JPZB 2HPSA 1YX7A 3KHEA 1KK8B 3WXAA 1L7ZA 1M46A 2FCEA 3I5GB 4QJ4B 4OVNF 1A75B 1BR4B 3EVVA 1DGVA 4IL1A 2K2AA 1FW4A 1IKUA 1S3PA 1QLSA 5GQQC 4N5XA 2CBLA 1K96A 1IWQA 1K2HA 1CLLA 2M9GA 1BLQA 3GOFA 1JFJA 4C0JA 1F4OA 1KFXS 1YX8A 2PVBA 1NUBA 4N1FA 4JQ0D 3SG4A 2KI6C 3DF0A 3I5IB 2LMUA 1RROA 1WDCC 2WCBA 1S26D 1C7VA 1CB1A 4WRIA 1A75A 1K8UA 2WC8A 1QX2A 2F33A 2Y1NA 1OMRA 1XA5A 1EG3A 1AJ5A 1MXEA 1SL8A 1F71A 4PHKA 4CPVA 1U5IB 3MSEB 2KAVA 3GK2A 2L4HA 1AVSA 3PLFB 1W7JB 1ZMZA 4L9MA 2BKIB 1OMDA 1UUSA 1AK8A 1IJ5A 1B4CA 3H4SE 2KFGA
chains in the Genus database with same CATH superfamily
1QX5B 2PSRA 3GK1A 3ICBA 4JKTA 2COLB 5HKZA 1BF5A 3OB2B 2JPOA 1S5GY 5HKWA 1VRKA 4PCWA 3WHUB 3L4LA 2R2IA 2K7OA 3VRPA 1K9UA 2EGDA 1QVIZ 4C0LA 1W9ZA 2B1UA 3CTNA 1T14A 2JNXA 2H61C 1TUJA 1UHIA 3R72A 1CLMA 2PQLA 3D76A 1LXFC 3N7HA 1BOCA 2JULA 1KWOB 2LLUA 3SS5A 1BT6A 3KF9A 1NCXA 1MUXA 4CIDA 1MXLC 3EVUA 4BY4A 1RFJA 2JC2A 3EK7A 4QJ5B 1KK7Z 1Q80A 4P2YB 4INXA 4M2PA 1Y6WA 1C7WA 1RK9A 1TCFA 1OE9B 2FOTA 2KYCA 1OOJA 3BUNB 3DVKA 1A03A 3VRRA 3RLZA 3CGAA 1DJZA 2PYQA 1BMOA 1MQ1A 2L4IA 2BECA 1QATA 4OCIA 3KPXA 1QIVA 2JTZA 2MAZA 1EXRA 1V1GA 2LMTA 1CDNA 1DTLA 1KCYA 2KFHA 2WCHA 1XO5A 2KSPA 2M49B 2KDHA 4BY5A 5KSZA 4YRUA 2O5GA 3IVTA 1XFUO 3AAKA 2IS9A 4CLNA 3CLNA 1AP4A 1Y1XA 1QWVA 2I2RE 2JT8A 3I5FB 2FCDA 1L2OB 3PATA 1PSBA 1NX3A 2F2PA 1YUSA 4FQOA 2HQWA 2L98A 4GAOA 1AUIB 1SNLA 5I94A 3CR4X 2Y5IA 3B7AA 2BCAA 1PVAA 3PSRA 4XJKA 2OTGB 2LVVA 2BL0C 1B7TY 4GUKA 1CNPA 2E6WA 1GGZA 2AUCA 2O60A 5IBWA 1W7IB 1E8AA 1SYMA 3VGOA 3NHIA 3TUYC 2ZFDA 2LUCA 2M1KB 3CDNA 3FE9A 3OGNA 4ICBA 1JF0A 1OOHA 1UP5A 2EC6C 3DVMA 3B87A 1SCMC 2H2KA 2JT3A 3OB1B 1PVBA 4MBEA 4PHNA 1DC1A 4PE4A 5I2OA 2QDIA 1Y0VH 3RM1A 2PRUA 1QX7A 1D1OA 3K21A 1DEKA 2LAPA 1ZACA 4GBAA 3TZ1A 2CXJA 1Z4HA 2KQYA 4GGFA 1N2DA 3OP0A 2ZRTA 1SW8A 2I94A 4JD9A 3TDZA 2KFFA 3DY9A 1F55A 2KI4B 1DJYA 1SK6D 1S5GZ 5KTYA 1TCOB 3BUOB 3PFVA 4GNKB 1B8RA 1KSOA 1TWOA 2QEHA 5DICA 1NWDA 4HSZA 4MEWA 2Q91A 5J3XA 1AJ4A 1XFXO 1OW4A 1SCVA 1M39A 1CFDA 1S1EA 4PE0A 2MJWB 2OS8C 1SR6B 2M29A 1XFYO 1HT9A 4OZDA 3SS3A 2BBNA 4NDBA 1TRFA 5HL1A 3UNWA 3CZ0A 2M3WA 1FBVA 2D8NA 3DXLA 3O4XA 3OX5A 5HLVA 4WQ2A 2BE6A 2JWWA 3D0YB 1PULA 2KLDA 2M0RA 1KQMC 1J55A 1CFFA 4UPGA 1OMVA 3TDUA 2NLNA 1WRZA 4NQGA 2TN4A 4ZCUA 2KLEA 1WRLA 3TS5B 1B7TZ 3GK4X 1ZUZA 1ALVA 1SR6C 1MF8B 2OS8B 2LVIA 3CZ2A 5D3OA 3BUMB 3SJSA 3JVTB 2L5YA 3BFAA 2P70A 1C3YA 2OPOA 1CDPA 4FTGA 2FJYA 1IH0A 3S0DA 4YGDB 1LINA 3L47A 3C1VA 1RECA 4M2OA 5JOLA 2KI4C 1J7OA 1BU3A 4A4BA 3LK1A 2BCBA 1K9PA 1DMOA 1CM4A 1CKKA 4FQTA 5HYDA 1OZOA 3DZTA 5CSFA 1NX0A 4M2QA 4YGEB 1S6CA 5I2QA 3OHMB 3FWBA 3AKAA 3FWCA 4MVFA 5G08A 5AFPA 1Y1AA 1J7QA 1DJWA 3EK4A 1OSAA 5D69A 2YGUA 1H8BA 2EC6B 2M97A 2PASA 1NX1A 3FS7A 1FI5A 1GJYA 1XK4A 4OKHA 4YGAA 1TTXA 3CR2A 3UO9A 3ZNIA 1JBAA 1G8IA 3D73A 2MRDA 3EG5B 2E30A 1J1DA 3B6XA 2BL0B 2NCOA 4ORAB 2ZKMX 2JPTA 2Q4UA 2M1UA 2MLFC 1SPYA 3BJHA 1RTP1 2GV5A 3SG7A 3FE6A 2ZNDA 2BNXA 1IIOA 2LE9B 2QEBA 1DJIA 2CT9A 1L2OC 1NYAA 1FI6A 2KNEA 2MA2A 1IRJA 1QLKA 2JNFA 4PHMA 1QASA 4PE7A 1GM0A 1H4BA 3NSKA 4HRGA 3S0EA 4ORCB 1DJHA 1TNXA 2LUXA 4CFRA 1DT7B 3DD4A 3VRNA 2K7DA 1LKJA 2I18A 2RGIA 4AQJA 1J7PA 1MHOA 1LVCD 3L4AA 1TN4A 1TNWA 2M8UA 3D0YA 3PN7C 1ZFSA 1CDLA 4DCKA 1J7RA 2MBXA 4TNCA 3AKBA 2G2BA 2MLEC 1M63B 1G4YR 3O78A 2JXCA 2LV7A 4U8DA 2L2CA 4XYNA 2CCMA 2AMIA 3BYAA 3TDIA 5PALA 1B9AA 2JRFA 2LVKA 3CZ1A 1KWOC 1TOPA 3PN7B 1GQMA 2CTNA 5K89A 1CFCA 5ER5A 1QIWA 2SCPA 4I5JA 2V53A 2KPHA 3EK8A 4MN0A 5CSNA 2LVJA 3QMEA 2BKHB 4IJ7A 3S0BA 4PALA 1F54A 1TNQA 3D77A 2KGRA 4MRXA 3D78A 3KEVA 1DELA 1K93D 1LA3A 4ORBB 3EKHA 2K0JA 2QEVA 4OR9B 3EVRA 4NDDA 2WC6A 1R6PA 2H8VA 5DKQA 3S0FA 1QVIY 2LP3A 1DF0A 2PMYA 2LLSA 2MHHA 1NX2A 1A4PA 1DF0B 3CYZA 3D10A 1BJFA 1M45A 4YI9A 2JXLA 1S36A 5B8IB 2JZIA 2NZ0A 1JSAA 1NCZA 2KI6D 1ZOTB 4ZCVA 1NPQA 5CPVA 3PM2A 4I5KA 3S0GA 1CMGA 1CLBA 1B47A 3AAJA 3LCPC 1ALWA 1CDMA 2G9BA 2GGMA 3M0WA 3OBVA 1B8LA 1WLMA 4GGFC 4MZJA 4MSPA 3BFBA 5ER4X 1KK7Y 1CMFA 1J1EA 1MWNA 1FPWA 5TNCA 2WC5A 3B88A 2WCKA 5FYXA 3QRXA 2Y1MA 4HREE 1WDCB 1SL7A 3I5IC 3SIAA 1JC2A 1EG4A 1JWDA 3NSIA 1CTRA 2WCFA 4JWQA 1S6IA 5HKYA 1DJXA 4YBHB 2KOTA 3A4UB 4ETOA 1SL9A 3BQ3A 1YUUA 3NHTA 1F8HA 1DJGA 2ERBA 2K2FA 2ZNEA 3JVTC 2QACA 1Y1UA 2LLTA 2LANA 3D74A 2WCEA 3A8RA 1R2UA 4PHJA 1V1FA 4E68A 1IGVA 3I5GC 4PT1A 1RJVA 2KAYA 4A4CA 4QJ3B 1KK8C 1KSMA 2K8MB 3TS5C 1NIWA 2K60A 2WNDA 3DF0B 3FE8A 3KO0A 3IQQA 5HLOA 1QTXA 2KBMA 3NSOA 1KQMB 3SG3A 2WOSA 1KFXL 4HRHA 2K7CA 2I7AA 1SKTA 1LA0A 1IQ3A 2JU0A 2HQ8A 3O4YA 3SS4A 3LLEA 4GPLB 1K9KA 1A2XA 2BE4A 2K7BA 1YUTA 3CR5X 1C07A 2QEOA 3NSLA 3WHTB 1TNPA 3CWGA 1OZSA 1K94A 3ZWHA 2Y4QA 4DS7A 3OX6A 1IJ6A 2LHIA 1YURA 5I8NA 4YI8A 3BUWB 3I5HB 1M31A 2VRGA 3E3RA 3K1EA 3VRQA 3EKJA 3WNXB 2KAXA 1F70A 4F7FA 1S6JA 3D75A 3BXKA 3O6BA 4N1GA 2JOJA 2DOQA 2QPTA 3IQOA 1BODA 1DQEA 1WRKA 1YRUB 2ZRSA 1XYDA 3O2PA 1DVIA 3CZTX 4XJKB 4DIRA 2WCLA 2L50A 3SG5A 5AANA 1Z2CB 2F3ZA 4I5LB 1LS8A 4OV2A 1EH2A 2LM5A 2SASA 1PALA 1XFWO 1NSHA 3LK0A 1SCMB 1KFUL 3PM8A 3Q8IA 3FIAA 3DVJA 1YVHA 5D7FA 1YRTB 1OOIX 5BPJA 1OOFA 4MZLA 3TUYB 1UHJA 2WORA 1IG5A 1EL4A 1PRWA 1YVLA 2EHBA 4NDCA 5DKNA 3CABA 2LMVA 2P6BB 4YGBB 2OTGC 1JUOA 1SBJA 2GTEA 3CS1A 1X02A 1YR5A 4GGNA 1WLZA 4R1EA 2ZN8A 4USLA 3JTDB 3NXAA 4I5NB 4PE1A 3NGVA 3JTDC 3I5FC 2F8PA 2L0PA 1XFVO 1G33A 5AERA 5AXIA 3SG2A 2WCMA 3R1VA 4Q04A 1CM1A 1ORGA 5FI6A 2LP2A 2KYFA 1A29A 1OQPA 2HETA 3R1OA 1EJ3A 1B1GA 3HCMA 2BCXA 1UURA 4C0KA 2L5XB 4WQ3A 3R1PA 2JQ6A 4F0ZB 3HX4A 4INWA 5AEQA 1N65A 1XFZO 4GFTA 3BFHA 2ZN9A 1SY9A 2K61A 1JFKA 2KQ6A 1PK0D 5DKRA 2PALA 3IF7A 2LC5A 5F6TA 1QV1A 2KHNA 5FI2A 2P71A 3F45A 4DRWA 2KGBC 3DVEA 4YGCB 1GGWA 2L2EA 1SMGA 2KBIA 2FJUB 1U5IA 1YTZC 4P5OE 3LL8B 3SG6A 1UHKA 3B86A 2WCJA 3BOWA 1C3ZA 2LNKA 1BR1B 1TIZA 2F2OA 2LCPA 4KYNA 5JJGA 1QV0A 1SRAA 1QJTA 1UHNA 3BUXB 3I5HC 2H61A 3PALA 1OOGA 3VROA 5I2LA 3S0AA 2GGZA 2HF5A 2JTTA 5CSIA 2F3YA 1N0YA 1QS7A 3VB1A 4AQIA 1P28A 1K90D 1PSRA 2A4JA 1KFUS 4PDZA 1XVJA 2AAOA 1AHRA 1MR8A 4DUQA 1B8CA 5CSJA 2L51A 1DGUA 1TUZA 1BG1A 1WY9A 4MZKA 1UWOA 2CNPA 2M7LA 4CFQA 2BAPA 1HQVA 2JT0A 1F4QA 1QXPA 1XK4C 5EL2A 1NP8A 1IQ5A 1ODBA 2BBMA 1NCYA 1CFPA 1KQVA 1JF2A 4MRYA 1FF1A 1RWYA 2NCPA 2NXQA 3BOWB 3PJIA 5KU1A 3SIBA 4AOMA 4D1EA 4MLWA 1UHHA 1K95A 2M7NA 5FI7A 2ISDA 2LHLA 4JPZB 2HPSA 1YX7A 3KHEA 1KK8B 3WXAA 1L7ZA 1M46A 2FCEA 3I5GB 4QJ4B 4OVNF 1A75B 1BR4B 3EVVA 1DGVA 4IL1A 2K2AA 1FW4A 1IKUA 1S3PA 1QLSA 1XFRA 5GQQC 4N5XA 2CBLA 1SSEB 1IWQA 1K96A 1K2HA 1CLLA 2M9GA 1BLQA 3GOFA 1JFJA 4C0JA 1F4OA 1KFXS 1YX8A 2PVBA 1NUBA 4N1FA 4JQ0D 3SG4A 2KI6C 3DF0A 3I5IB 2LMUA 1RROA 1WDCC 2WCBA 1S26D 1C7VA 1CB1A 3DYEA 4WRIA 1A75A 1K8UA 2WC8A 1QX2A 2F33A 2Y1NA 1OMRA 1XA5A 1EG3A 1AJ5A 1MXEA 1SL8A 3V2LA 1F71A 4PHKA 4CPVA 1U5IB 3MSEB 2KAVA 3GK2A 2L4HA 1AVSA 3PLFB 1W7JB 1ZMZA 3RZSA 4L9MA 2BKIB 1OMDA 1UUSA 1AK8A 1IJ5A 1B4CA 3H4SE 2KFGA
chains in the Genus database with same CATH topology
1QX5B 2PSRA 3GK1A 3ICBA 5HKZA 2COLB 1BF5A 3OB2B 1S5GY 5HKWA 1VRKA 4PCWA 3WHUB 2R2IA 2K7OA 3VRPA 1K9UA 2EGDA 1QVIZ 4C0LA 2B1UA 3CTNA 2JNXA 2H61C 1UHIA 1CLMA 1LXFC 1BOCA 2JULA 1KWOB 2LLUA 1BT6A 3KF9A 1NCXA 1MUXA 4CIDA 1MXLC 3EVUA 4BY4A 1RFJA 2JC2A 3EK7A 4QJ5B 1KK7Z 1Q80A 4P2YB 4M2PA 1Y6WA 1C7WA 1RK9A 1TCFA 1OE9B 2FOTA 2KYCA 1OOJA 3BUNB 3DVKA 1A03A 3VRRA 3RLZA 3CGAA 1DJZA 1BMOA 1MQ1A 2L4IA 2BECA 1QATA 4OCIA 3KPXA 1QIVA 2JTZA 2MAZA 1EXRA 1V1GA 2LMTA 1CDNA 1DTLA 1KCYA 2KFHA 1XO5A 2KSPA 2M49B 2KDHA 4BY5A 5KSZA 4YRUA 2O5GA 1XFUO 3AAKA 2IS9A 4CLNA 3CLNA 1AP4A 1Y1XA 2I2RE 2JT8A 3I5FB 2FCDA 1L2OB 3PATA 1PSBA 1NX3A 2F2PA 1YUSA 4FQOA 2HQWA 2L98A 4GAOA 1AUIB 1SNLA 3CR4X 2Y5IA 4XJKA 2BCAA 1PVAA 3PSRA 2OTGB 2LVVA 2BL0C 1B7TY 4GUKA 1CNPA 2E6WA 1GGZA 2AUCA 2O60A 5IBWA 1W7IB 1E8AA 1SYMA 3VGOA 3TUYC 2ZFDA 2LUCA 2M1KB 4ICBA 1JF0A 1UP5A 2EC6C 3DVMA 3OB1B 1SCMC 2H2KA 2JT3A 4MBEA 1PVBA 4PHNA 4PE4A 5I2OA 1Y0VH 3RM1A 2PRUA 1QX7A 1D1OA 3K21A 2LAPA 1ZACA 4GBAA 3TZ1A 2CXJA 2KQYA 4GGFA 1N2DA 3OP0A 2ZRTA 1SW8A 2I94A 3TDZA 2KFFA 1F55A 2KI4B 1DJYA 1SK6D 1S5GZ 5KTYA 1TCOB 3BUOB 3PFVA 4GNKB 1B8RA 1KSOA 1NWDA 4HSZA 4MEWA 2Q91A 5J3XA 1AJ4A 1XFXO 1SCVA 1M39A 1CFDA 1S1EA 4PE0A 2MJWB 2OS8C 1SR6B 2M29A 1XFYO 1HT9A 2BBNA 4NDBA 1TRFA 2M3WA 1FBVA 2D8NA 5HLVA 3OX5A 4WQ2A 2BE6A 2JWWA 3D0YB 1PULA 2M0RA 1KQMC 1J55A 1CFFA 4UPGA 1OMVA 3TDUA 2NLNA 1WRZA 4NQGA 2TN4A 4ZCUA 1WRLA 3TS5B 1B7TZ 3GK4X 1ZUZA 1ALVA 1SR6C 1MF8B 2OS8B 2LVIA 3BUMB 3SJSA 3JVTB 1IH0A 2OPOA 1CDPA 4FTGA 4YGDB 1LINA 3C1VA 1RECA 4M2OA 5JOLA 2KI4C 1J7OA 1BU3A 4A4BA 3LK1A 2BCBA 1K9PA 1DMOA 1CM4A 1CKKA 5HYDA 1OZOA 5CSFA 1NX0A 4M2QA 4YGEB 1S6CA 5I2QA 3OHMB 3FWBA 3AKAA 3FWCA 4MVFA 5G08A 5AFPA 1Y1AA 1J7QA 1DJWA 3EK4A 1OSAA 5D69A 1H8BA 2EC6B 2M97A 2PASA 1NX1A 3FS7A 1FI5A 1GJYA 1XK4A 4OKHA 4YGAA 1TTXA 3CR2A 3ZNIA 1JBAA 1G8IA 2MRDA 2E30A 1J1DA 2BL0B 2NCOA 4ORAB 2ZKMX 2JPTA 2Q4UA 2M1UA 2MLFC 1SPYA 1RTP1 2GV5A 3SG7A 2ZNDA 2LE9B 1DJIA 2CT9A 1L2OC 1NYAA 1FI6A 2KNEA 2MA2A 1IRJA 1QLKA 2JNFA 4PHMA 1QASA 4PE7A 1H4BA 3NSKA 4HRGA 4ORCB 1DJHA 1TNXA 2LUXA 4CFRA 1DT7B 3DD4A 3VRNA 2K7DA 1LKJA 2I18A 2RGIA 4AQJA 1J7PA 1MHOA 1LVCD 1TN4A 1TNWA 2M8UA 3D0YA 3PN7C 1ZFSA 1CDLA 4DCKA 1J7RA 2MBXA 4TNCA 3AKBA 2G2BA 2MLEC 1M63B 1G4YR 3O78A 2JXCA 2LV7A 4U8DA 4XYNA 2CCMA 2AMIA 3BYAA 3TDIA 5PALA 1B9AA 2JRFA 2LVKA 3PN7B 1KWOC 1TOPA 1CFCA 1GQMA 2CTNA 5K89A 5ER5A 1QIWA 2SCPA 4I5JA 2V53A 3EK8A 4MN0A 5CSNA 2LVJA 2BKHB 4PALA 1F54A 1TNQA 2KGRA 4MRXA 3KEVA 1K93D 1LA3A 4ORBB 3EKHA 2K0JA 4OR9B 3EVRA 4NDDA 5DKQA 1R6PA 1QVIY 2LP3A 1DF0A 2PMYA 2LLSA 2MHHA 1NX2A 1A4PA 1DF0B 3D10A 1BJFA 1M45A 4YI9A 2JXLA 1S36A 5B8IB 2JZIA 2NZ0A 1JSAA 1NCZA 2KI6D 1ZOTB 4ZCVA 1NPQA 5CPVA 4I5KA 1CMGA 1CLBA 1B47A 3AAJA 3LCPC 1ALWA 1CDMA 2G9BA 2GGMA 3M0WA 4GGFC 1B8LA 1WLMA 4MZJA 4MSPA 5ER4X 1KK7Y 1CMFA 1J1EA 1MWNA 1FPWA 5TNCA 5FYXA 3QRXA 2Y1MA 4HREE 1WDCB 1SL7A 3I5IC 3SIAA 1JC2A 1EG4A 1JWDA 3NSIA 1CTRA 2WCFA 4JWQA 1S6IA 5HKYA 1DJXA 4YBHB 2KOTA 3A4UB 4ETOA 1SL9A 3BQ3A 1YUUA 1F8HA 1DJGA 2ZNEA 2K2FA 3JVTC 2QACA 1Y1UA 2LLTA 2LANA 2WCEA 3A8RA 1R2UA 4PHJA 1V1FA 4E68A 1IGVA 3I5GC 1RJVA 2KAYA 4A4CA 4QJ3B 1KK8C 1KSMA 2K8MB 3TS5C 1NIWA 2WNDA 3KO0A 3DF0B 3IQQA 5HLOA 1QTXA 2KBMA 3NSOA 1KQMB 3SG3A 2WOSA 1KFXL 4HRHA 2K7CA 2I7AA 1SKTA 1LA0A 1IQ3A 2JU0A 2HQ8A 3O4YA 3LLEA 4GPLB 1K9KA 1A2XA 2BE4A 2K7BA 1YUTA 3CR5X 1C07A 3NSLA 3WHTB 1TNPA 3CWGA 1OZSA 1K94A 3ZWHA 2Y4QA 4DS7A 3OX6A 1IJ6A 2LHIA 1YURA 5I8NA 4YI8A 3BUWB 3I5HB 1M31A 2VRGA 3E3RA 3VRQA 3WNXB 3EKJA 1F70A 2KAXA 1S6JA 3O6BA 3BXKA 4N1GA 2JOJA 2DOQA 2QPTA 3IQOA 1BODA 1WRKA 1YRUB 2ZRSA 1XYDA 3O2PA 1DVIA 3CZTX 4XJKB 4DIRA 2L50A 3SG5A 5AANA 2F3ZA 4I5LB 4OV2A 1EH2A 2LM5A 2SASA 1PALA 1XFWO 1NSHA 3LK0A 1SCMB 1KFUL 3PM8A 3FIAA 3DVJA 1YVHA 5D7FA 1YRTB 5BPJA 4MZLA 3TUYB 1UHJA 2WORA 1IG5A 1EL4A 1PRWA 1YVLA 2EHBA 4NDCA 5DKNA 2LMVA 2P6BB 4YGBB 2OTGC 1JUOA 1SBJA 3CS1A 4GGNA 1X02A 1YR5A 1WLZA 4R1EA 2ZN8A 4USLA 3JTDB 3NXAA 4I5NB 4PE1A 3JTDC 3I5FC 2F8PA 2L0PA 1XFVO 1G33A 5AERA 5AXIA 3SG2A 4Q04A 1CM1A 2LP2A 2KYFA 1A29A 1OQPA 2HETA 1B1GA 1EJ3A 3HCMA 2BCXA 1UURA 4C0KA 2L5XB 4WQ3A 2JQ6A 4F0ZB 3HX4A 5AEQA 1N65A 1XFZO 4GFTA 2ZN9A 1SY9A 2K61A 1JFKA 2KQ6A 1PK0D 5DKRA 2PALA 3IF7A 2LC5A 5F6TA 1QV1A 2KHNA 4DRWA 3F45A 2KGBC 3DVEA 4YGCB 1GGWA 2L2EA 1SMGA 2KBIA 2FJUB 1U5IA 1YTZC 4P5OE 3LL8B 3SG6A 1UHKA 3BOWA 2LNKA 1BR1B 1TIZA 2F2OA 2LCPA 5JJGA 1QV0A 1SRAA 1QJTA 1UHNA 3BUXB 3I5HC 2H61A 3PALA 3VROA 5I2LA 2GGZA 2HF5A 2JTTA 5CSIA 2F3YA 1N0YA 1QS7A 4AQIA 1K90D 1PSRA 2A4JA 1KFUS 4PDZA 1XVJA 2AAOA 1AHRA 1MR8A 4DUQA 1B8CA 5CSJA 2L51A 1DGUA 1BG1A 1WY9A 4MZKA 1UWOA 2CNPA 2M7LA 4CFQA 1HQVA 2JT0A 1F4QA 1QXPA 1XK4C 1NP8A 1IQ5A 1ODBA 2BBMA 1NCYA 1CFPA 1KQVA 1JF2A 4MRYA 1FF1A 1RWYA 2NCPA 2NXQA 3BOWB 5KU1A 3SIBA 4AOMA 4D1EA 4MLWA 1UHHA 1K95A 2M7NA 2ISDA 2LHLA 4JPZB 2HPSA 1YX7A 3KHEA 1KK8B 3WXAA 1L7ZA 1M46A 2FCEA 3I5GB 4QJ4B 4OVNF 1A75B 1BR4B 3EVVA 1DGVA 4IL1A 2K2AA 1FW4A 1IKUA 1S3PA 1QLSA 5GQQC 4N5XA 2CBLA 1K96A 1IWQA 1K2HA 1CLLA 2M9GA 1BLQA 3GOFA 1JFJA 4C0JA 1F4OA 1KFXS 1YX8A 2PVBA 1NUBA 4N1FA 4JQ0D 3SG4A 2KI6C 3DF0A 3I5IB 2LMUA 1RROA 1WDCC 2WCBA 1S26D 1C7VA 1CB1A 4WRIA 1A75A 1K8UA 2WC8A 1QX2A 2F33A 2Y1NA 1OMRA 1XA5A 1EG3A 1AJ5A 1MXEA 1SL8A 1F71A 4PHKA 4CPVA 1U5IB 3MSEB 2KAVA 3GK2A 2L4HA 1AVSA 3PLFB 1W7JB 1ZMZA 4L9MA 2BKIB 1OMDA 1UUSA 1AK8A 1IJ5A 1B4CA 3H4SE 2KFGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QX5 B;  2PSR A;  3GK1 A;  3ICB A;  5HKZ A;  2COL B;  1BF5 A;  3OB2 B;  1S5G Y;  5HKW A;  1VRK A;  4PCW A;  3WHU B;  2R2I A;  2K7O A;  3VRP A;  1K9U A;  2EGD A;  1QVI Z;  4C0L A;  2B1U A;  3CTN A;  2JNX A;  2H61 C;  1UHI A;  1CLM A;  1LXF C;  1BOC A;  2JUL A;  1KWO B;  2LLU A;  1BT6 A;  3KF9 A;  1NCX A;  1MUX A;  4CID A;  1MXL C;  3EVU A;  4BY4 A;  1RFJ A;  2JC2 A;  3EK7 A;  4QJ5 B;  1KK7 Z;  1Q80 A;  4P2Y B;  4M2P A;  1Y6W A;  1C7W A;  1RK9 A;  1TCF A;  1OE9 B;  2FOT A;  2KYC A;  1OOJ A;  3BUN B;  3DVK A;  1A03 A;  3VRR A;  3RLZ A;  3CGA A;  1DJZ A;  1BMO A;  1MQ1 A;  2L4I A;  2BEC A;  1QAT A;  4OCI A;  3KPX A;  1QIV A;  2JTZ A;  2MAZ A;  1EXR A;  1V1G A;  2LMT A;  1CDN A;  1DTL A;  1KCY A;  2KFH A;  1XO5 A;  2KSP A;  2M49 B;  2KDH A;  4BY5 A;  5KSZ A;  4YRU A;  2O5G A;  1XFU O;  3AAK A;  2IS9 A;  4CLN A;  3CLN A;  1AP4 A;  1Y1X A;  2I2R E;  2JT8 A;  3I5F B;  2FCD A;  1L2O B;  3PAT A;  1PSB A;  1NX3 A;  2F2P A;  1YUS A;  4FQO A;  2HQW A;  2L98 A;  4GAO A;  1AUI B;  1SNL A;  3CR4 X;  2Y5I A;  4XJK A;  2BCA A;  1PVA A;  3PSR A;  2OTG B;  2LVV A;  2BL0 C;  1B7T Y;  4GUK A;  1CNP A;  2E6W A;  1GGZ A;  2AUC A;  2O60 A;  5IBW A;  1W7I B;  1E8A A;  1SYM A;  3VGO A;  3TUY C;  2ZFD A;  2LUC A;  2M1K B;  4ICB A;  1JF0 A;  1UP5 A;  2EC6 C;  3DVM A;  3OB1 B;  1SCM C;  2H2K A;  2JT3 A;  4MBE A;  1PVB A;  4PHN A;  4PE4 A;  5I2O A;  1Y0V H;  3RM1 A;  2PRU A;  1QX7 A;  1D1O A;  3K21 A;  2LAP A;  1ZAC A;  4GBA A;  3TZ1 A;  2CXJ A;  2KQY A;  4GGF A;  1N2D A;  3OP0 A;  2ZRT A;  1SW8 A;  2I94 A;  3TDZ A;  2KFF A;  1F55 A;  2KI4 B;  1DJY A;  1SK6 D;  1S5G Z;  5KTY A;  1TCO B;  3BUO B;  3PFV A;  4GNK B;  1B8R A;  1KSO A;  1NWD A;  4HSZ A;  4MEW A;  2Q91 A;  5J3X A;  1AJ4 A;  1XFX O;  1SCV A;  1M39 A;  1CFD A;  1S1E A;  4PE0 A;  2MJW B;  2OS8 C;  1SR6 B;  2M29 A;  1XFY O;  1HT9 A;  2BBN A;  4NDB A;  1TRF A;  2M3W A;  1FBV A;  2D8N A;  5HLV A;  3OX5 A;  4WQ2 A;  2BE6 A;  2JWW A;  3D0Y B;  1PUL A;  2M0R A;  1KQM C;  1J55 A;  1CFF A;  4UPG A;  1OMV A;  3TDU A;  2NLN A;  1WRZ A;  4NQG A;  2TN4 A;  4ZCU A;  1WRL A;  3TS5 B;  1B7T Z;  3GK4 X;  1ZUZ A;  1ALV A;  1SR6 C;  1MF8 B;  2OS8 B;  2LVI A;  3BUM B;  3SJS A;  3JVT B;  1IH0 A;  2OPO A;  1CDP A;  4FTG A;  4YGD B;  1LIN A;  3C1V A;  1REC A;  4M2O A;  5JOL A;  2KI4 C;  1J7O A;  1BU3 A;  4A4B A;  3LK1 A;  2BCB A;  1K9P A;  1DMO A;  1CM4 A;  1CKK A;  5HYD A;  1OZO A;  5CSF A;  1NX0 A;  4M2Q A;  4YGE B;  1S6C A;  5I2Q A;  3OHM B;  3FWB A;  3AKA A;  3FWC A;  4MVF A;  5G08 A;  5AFP A;  1Y1A A;  1J7Q A;  1DJW A;  3EK4 A;  1OSA A;  5D69 A;  1H8B A;  2EC6 B;  2M97 A;  2PAS A;  1NX1 A;  3FS7 A;  1FI5 A;  1GJY A;  1XK4 A;  4OKH A;  4YGA A;  1TTX A;  3CR2 A;  3ZNI A;  1JBA A;  1G8I A;  2MRD A;  2E30 A;  1J1D A;  2BL0 B;  2NCO A;  4ORA B;  2ZKM X;  2JPT A;  2Q4U A;  2M1U A;  2MLF C;  1SPY A;  1RTP 1;  2GV5 A;  3SG7 A;  2ZND A;  2LE9 B;  1DJI A;  2CT9 A;  1L2O C;  1NYA A;  1FI6 A;  2KNE A;  2MA2 A;  1IRJ A;  1QLK A;  2JNF A;  4PHM A;  1QAS A;  4PE7 A;  1H4B A;  3NSK A;  4HRG A;  4ORC B;  1DJH A;  1TNX A;  2LUX A;  4CFR A;  1DT7 B;  3DD4 A;  3VRN A;  2K7D A;  1LKJ A;  2I18 A;  2RGI A;  4AQJ A;  1J7P A;  1MHO A;  1LVC D;  1TN4 A;  1TNW A;  2M8U A;  3D0Y A;  3PN7 C;  1ZFS A;  1CDL A;  4DCK A;  1J7R A;  2MBX A;  4TNC A;  3AKB A;  2G2B A;  2MLE C;  1M63 B;  1G4Y R;  3O78 A;  2JXC A;  2LV7 A;  4U8D A;  4XYN A;  2CCM A;  2AMI A;  3BYA A;  3TDI A;  5PAL A;  1B9A A;  2JRF A;  2LVK A;  3PN7 B;  1KWO C;  1TOP A;  1CFC A;  1GQM A;  2CTN A;  5K89 A;  5ER5 A;  1QIW A;  2SCP A;  4I5J A;  2V53 A;  3EK8 A;  4MN0 A;  5CSN A;  2LVJ A;  2BKH B;  4PAL A;  1F54 A;  1TNQ A;  2KGR A;  4MRX A;  3KEV A;  1K93 D;  1LA3 A;  4ORB B;  3EKH A;  2K0J A;  4OR9 B;  3EVR A;  4NDD A;  5DKQ A;  1R6P A;  1QVI Y;  2LP3 A;  1DF0 A;  2PMY A;  2LLS A;  2MHH A;  1NX2 A;  1A4P A;  1DF0 B;  3D10 A;  1BJF A;  1M45 A;  4YI9 A;  2JXL A;  1S36 A;  5B8I B;  2JZI A;  2NZ0 A;  1JSA A;  1NCZ A;  2KI6 D;  1ZOT B;  4ZCV A;  1NPQ A;  5CPV A;  4I5K A;  1CMG A;  1CLB A;  1B47 A;  3AAJ A;  3LCP C;  1ALW A;  1CDM A;  2G9B A;  2GGM A;  3M0W A;  4GGF C;  1B8L A;  1WLM A;  4MZJ A;  4MSP A;  5ER4 X;  1KK7 Y;  1CMF A;  1J1E A;  1MWN A;  1FPW A;  5TNC A;  5FYX A;  3QRX A;  2Y1M A;  4HRE E;  1WDC B;  1SL7 A;  3I5I C;  3SIA A;  1JC2 A;  1EG4 A;  1JWD A;  3NSI A;  1CTR A;  2WCF A;  4JWQ A;  1S6I A;  5HKY A;  1DJX A;  4YBH B;  2KOT A;  3A4U B;  4ETO A;  1SL9 A;  3BQ3 A;  1YUU A;  1F8H A;  1DJG A;  2ZNE A;  2K2F A;  3JVT C;  2QAC A;  1Y1U A;  2LLT A;  2LAN A;  2WCE A;  3A8R A;  1R2U A;  4PHJ A;  1V1F A;  4E68 A;  1IGV A;  3I5G C;  1RJV A;  2KAY A;  4A4C A;  4QJ3 B;  1KK8 C;  1KSM A;  2K8M B;  3TS5 C;  1NIW A;  2WND A;  3KO0 A;  3DF0 B;  3IQQ A;  5HLO A;  1QTX A;  2KBM A;  3NSO A;  1KQM B;  3SG3 A;  2WOS A;  1KFX L;  4HRH A;  2K7C A;  2I7A A;  1SKT A;  1LA0 A;  1IQ3 A;  2JU0 A;  2HQ8 A;  3O4Y A;  3LLE A;  4GPL B;  1K9K A;  1A2X A;  2BE4 A;  2K7B A;  1YUT A;  3CR5 X;  1C07 A;  3NSL A;  3WHT B;  1TNP A;  3CWG A;  1OZS A;  1K94 A;  3ZWH A;  2Y4Q A;  4DS7 A;  3OX6 A;  1IJ6 A;  2LHI A;  1YUR A;  5I8N A;  4YI8 A;  3BUW B;  3I5H B;  1M31 A;  2VRG A;  3E3R A;  3VRQ A;  3WNX B;  3EKJ A;  1F70 A;  2KAX A;  1S6J A;  3O6B A;  3BXK A;  4N1G A;  2JOJ A;  2DOQ A;  2QPT A;  3IQO A;  1BOD A;  1WRK A;  1YRU B;  2ZRS A;  1XYD A;  3O2P A;  1DVI A;  3CZT X;  4XJK B;  4DIR A;  2L50 A;  3SG5 A;  5AAN A;  2F3Z A;  4I5L B;  4OV2 A;  1EH2 A;  2LM5 A;  2SAS A;  1PAL A;  1XFW O;  1NSH A;  3LK0 A;  1SCM B;  1KFU L;  3PM8 A;  3FIA A;  3DVJ A;  1YVH A;  5D7F A;  1YRT B;  5BPJ A;  4MZL A;  3TUY B;  1UHJ A;  2WOR A;  1IG5 A;  1EL4 A;  1PRW A;  1YVL A;  2EHB A;  4NDC A;  5DKN A;  2LMV A;  2P6B B;  4YGB B;  2OTG C;  1JUO A;  1SBJ A;  3CS1 A;  4GGN A;  1X02 A;  1YR5 A;  1WLZ A;  4R1E A;  2ZN8 A;  4USL A;  3JTD B;  3NXA A;  4I5N B;  4PE1 A;  3JTD C;  3I5F C;  2F8P A;  2L0P A;  1XFV O;  1G33 A;  5AER A;  5AXI A;  3SG2 A;  4Q04 A;  1CM1 A;  2LP2 A;  2KYF A;  1A29 A;  1OQP A;  2HET A;  1B1G A;  1EJ3 A;  3HCM A;  2BCX A;  1UUR A;  4C0K A;  2L5X B;  4WQ3 A;  2JQ6 A;  4F0Z B;  3HX4 A;  5AEQ A;  1N65 A;  1XFZ O;  4GFT A;  2ZN9 A;  1SY9 A;  2K61 A;  1JFK A;  2KQ6 A;  1PK0 D;  5DKR A;  2PAL A;  3IF7 A;  2LC5 A;  5F6T A;  1QV1 A;  2KHN A;  4DRW A;  3F45 A;  2KGB C;  3DVE A;  4YGC B;  1GGW A;  2L2E A;  1SMG A;  2KBI A;  2FJU B;  1U5I A;  1YTZ C;  4P5O E;  3LL8 B;  3SG6 A;  1UHK A;  3BOW A;  2LNK A;  1BR1 B;  1TIZ A;  2F2O A;  2LCP A;  5JJG A;  1QV0 A;  1SRA A;  1QJT A;  1UHN A;  3BUX B;  3I5H C;  2H61 A;  3PAL A;  3VRO A;  5I2L A;  2GGZ A;  2HF5 A;  2JTT A;  5CSI A;  2F3Y A;  1N0Y A;  1QS7 A;  4AQI A;  1K90 D;  1PSR A;  2A4J A;  1KFU S;  4PDZ A;  1XVJ A;  2AAO A;  1AHR A;  1MR8 A;  4DUQ A;  1B8C A;  5CSJ A;  2L51 A;  1DGU A;  1BG1 A;  1WY9 A;  4MZK A;  1UWO A;  2CNP A;  2M7L A;  4CFQ A;  1HQV A;  2JT0 A;  1F4Q A;  1QXP A;  1XK4 C;  1NP8 A;  1IQ5 A;  1ODB A;  2BBM A;  1NCY A;  1CFP A;  1KQV A;  1JF2 A;  4MRY A;  1FF1 A;  1RWY A;  2NCP A;  2NXQ A;  3BOW B;  5KU1 A;  3SIB A;  4AOM A;  4D1E A;  4MLW A;  1UHH A;  1K95 A;  2M7N A;  2ISD A;  2LHL A;  4JPZ B;  2HPS A;  1YX7 A;  3KHE A;  1KK8 B;  3WXA A;  1L7Z A;  1M46 A;  2FCE A;  3I5G B;  4QJ4 B;  4OVN F;  1A75 B;  1BR4 B;  3EVV A;  1DGV A;  4IL1 A;  2K2A A;  1FW4 A;  1IKU A;  1S3P A;  1QLS A;  5GQQ C;  4N5X A;  2CBL A;  1K96 A;  1IWQ A;  1K2H A;  1CLL A;  2M9G A;  1BLQ A;  3GOF A;  1JFJ A;  4C0J A;  1F4O A;  1KFX S;  1YX8 A;  2PVB A;  1NUB A;  4N1F A;  4JQ0 D;  3SG4 A;  2KI6 C;  3DF0 A;  3I5I B;  2LMU A;  1RRO A;  1WDC C;  2WCB A;  1S26 D;  1C7V A;  1CB1 A;  4WRI A;  1A75 A;  1K8U A;  2WC8 A;  1QX2 A;  2F33 A;  2Y1N A;  1OMR A;  1XA5 A;  1EG3 A;  1AJ5 A;  1MXE A;  1SL8 A;  1F71 A;  4PHK A;  4CPV A;  1U5I B;  3MSE B;  2KAV A;  3GK2 A;  2L4H A;  1AVS A;  3PLF B;  1W7J B;  1ZMZ A;  4L9M A;  2BKI B;  1OMD A;  1UUS A;  1AK8 A;  1IJ5 A;  1B4C A;  3H4S E;  2KFG A; 
#chains in the Genus database with same CATH topology
 1QX5 B;  2PSR A;  3GK1 A;  3ICB A;  4JKT A;  2COL B;  5HKZ A;  1BF5 A;  3OB2 B;  2JPO A;  1S5G Y;  5HKW A;  1VRK A;  4PCW A;  3WHU B;  3L4L A;  2R2I A;  2K7O A;  3VRP A;  1K9U A;  2EGD A;  1QVI Z;  4C0L A;  1W9Z A;  2B1U A;  3CTN A;  1T14 A;  2JNX A;  2H61 C;  1TUJ A;  1UHI A;  3R72 A;  1CLM A;  2PQL A;  3D76 A;  1LXF C;  3N7H A;  1BOC A;  2JUL A;  1KWO B;  2LLU A;  3SS5 A;  1BT6 A;  3KF9 A;  1NCX A;  1MUX A;  4CID A;  1MXL C;  3EVU A;  4BY4 A;  1RFJ A;  2JC2 A;  3EK7 A;  4QJ5 B;  1KK7 Z;  1Q80 A;  4P2Y B;  4INX A;  4M2P A;  1Y6W A;  1C7W A;  1RK9 A;  1TCF A;  1OE9 B;  2FOT A;  2KYC A;  1OOJ A;  3BUN B;  3DVK A;  1A03 A;  3VRR A;  3RLZ A;  3CGA A;  1DJZ A;  2PYQ A;  1BMO A;  1MQ1 A;  2L4I A;  2BEC A;  1QAT A;  4OCI A;  3KPX A;  1QIV A;  2JTZ A;  2MAZ A;  1EXR A;  1V1G A;  2LMT A;  1CDN A;  1DTL A;  1KCY A;  2KFH A;  2WCH A;  1XO5 A;  2KSP A;  2M49 B;  2KDH A;  4BY5 A;  5KSZ A;  4YRU A;  2O5G A;  3IVT A;  1XFU O;  3AAK A;  2IS9 A;  4CLN A;  3CLN A;  1AP4 A;  1Y1X A;  1QWV A;  2I2R E;  2JT8 A;  3I5F B;  2FCD A;  1L2O B;  3PAT A;  1PSB A;  1NX3 A;  2F2P A;  1YUS A;  4FQO A;  2HQW A;  2L98 A;  4GAO A;  1AUI B;  1SNL A;  5I94 A;  3CR4 X;  2Y5I A;  3B7A A;  2BCA A;  1PVA A;  3PSR A;  4XJK A;  2OTG B;  2LVV A;  2BL0 C;  1B7T Y;  4GUK A;  1CNP A;  2E6W A;  1GGZ A;  2AUC A;  2O60 A;  5IBW A;  1W7I B;  1E8A A;  1SYM A;  3VGO A;  3NHI A;  3TUY C;  2ZFD A;  2LUC A;  2M1K B;  3CDN A;  3FE9 A;  3OGN A;  4ICB A;  1JF0 A;  1OOH A;  1UP5 A;  2EC6 C;  3DVM A;  3B87 A;  1SCM C;  2H2K A;  2JT3 A;  3OB1 B;  1PVB A;  4MBE A;  4PHN A;  1DC1 A;  4PE4 A;  5I2O A;  2QDI A;  1Y0V H;  3RM1 A;  2PRU A;  1QX7 A;  1D1O A;  3K21 A;  1DEK A;  2LAP A;  1ZAC A;  4GBA A;  3TZ1 A;  2CXJ A;  1Z4H A;  2KQY A;  4GGF A;  1N2D A;  3OP0 A;  2ZRT A;  1SW8 A;  2I94 A;  4JD9 A;  3TDZ A;  2KFF A;  3DY9 A;  1F55 A;  2KI4 B;  1DJY A;  1SK6 D;  1S5G Z;  5KTY A;  1TCO B;  3BUO B;  3PFV A;  4GNK B;  1B8R A;  1KSO A;  1TWO A;  2QEH A;  5DIC A;  1NWD A;  4HSZ A;  4MEW A;  2Q91 A;  5J3X A;  1AJ4 A;  1XFX O;  1OW4 A;  1SCV A;  1M39 A;  1CFD A;  1S1E A;  4PE0 A;  2MJW B;  2OS8 C;  1SR6 B;  2M29 A;  1XFY O;  1HT9 A;  4OZD A;  3SS3 A;  2BBN A;  4NDB A;  1TRF A;  5HL1 A;  3UNW A;  3CZ0 A;  2M3W A;  1FBV A;  2D8N A;  3DXL A;  3O4X A;  3OX5 A;  5HLV A;  4WQ2 A;  2BE6 A;  2JWW A;  3D0Y B;  1PUL A;  2KLD A;  2M0R A;  1KQM C;  1J55 A;  1CFF A;  4UPG A;  1OMV A;  3TDU A;  2NLN A;  1WRZ A;  4NQG A;  2TN4 A;  4ZCU A;  2KLE A;  1WRL A;  3TS5 B;  1B7T Z;  3GK4 X;  1ZUZ A;  1ALV A;  1SR6 C;  1MF8 B;  2OS8 B;  2LVI A;  3CZ2 A;  5D3O A;  3BUM B;  3SJS A;  3JVT B;  2L5Y A;  3BFA A;  2P70 A;  1C3Y A;  2OPO A;  1CDP A;  4FTG A;  2FJY A;  1IH0 A;  3S0D A;  4YGD B;  1LIN A;  3L47 A;  3C1V A;  1REC A;  4M2O A;  5JOL A;  2KI4 C;  1J7O A;  1BU3 A;  4A4B A;  3LK1 A;  2BCB A;  1K9P A;  1DMO A;  1CM4 A;  1CKK A;  4FQT A;  5HYD A;  1OZO A;  3DZT A;  5CSF A;  1NX0 A;  4M2Q A;  4YGE B;  1S6C A;  5I2Q A;  3OHM B;  3FWB A;  3AKA A;  3FWC A;  4MVF A;  5G08 A;  5AFP A;  1Y1A A;  1J7Q A;  1DJW A;  3EK4 A;  1OSA A;  5D69 A;  2YGU A;  1H8B A;  2EC6 B;  2M97 A;  2PAS A;  1NX1 A;  3FS7 A;  1FI5 A;  1GJY A;  1XK4 A;  4OKH A;  4YGA A;  1TTX A;  3CR2 A;  3UO9 A;  3ZNI A;  1JBA A;  1G8I A;  3D73 A;  2MRD A;  3EG5 B;  2E30 A;  1J1D A;  3B6X A;  2BL0 B;  2NCO A;  4ORA B;  2ZKM X;  2JPT A;  2Q4U A;  2M1U A;  2MLF C;  1SPY A;  3BJH A;  1RTP 1;  2GV5 A;  3SG7 A;  3FE6 A;  2ZND A;  2BNX A;  1IIO A;  2LE9 B;  2QEB A;  1DJI A;  2CT9 A;  1L2O C;  1NYA A;  1FI6 A;  2KNE A;  2MA2 A;  1IRJ A;  1QLK A;  2JNF A;  4PHM A;  1QAS A;  4PE7 A;  1GM0 A;  1H4B A;  3NSK A;  4HRG A;  3S0E A;  4ORC B;  1DJH A;  1TNX A;  2LUX A;  4CFR A;  1DT7 B;  3DD4 A;  3VRN A;  2K7D A;  1LKJ A;  2I18 A;  2RGI A;  4AQJ A;  1J7P A;  1MHO A;  1LVC D;  3L4A A;  1TN4 A;  1TNW A;  2M8U A;  3D0Y A;  3PN7 C;  1ZFS A;  1CDL A;  4DCK A;  1J7R A;  2MBX A;  4TNC A;  3AKB A;  2G2B A;  2MLE C;  1M63 B;  1G4Y R;  3O78 A;  2JXC A;  2LV7 A;  4U8D A;  2L2C A;  4XYN A;  2CCM A;  2AMI A;  3BYA A;  3TDI A;  5PAL A;  1B9A A;  2JRF A;  2LVK A;  3CZ1 A;  1KWO C;  1TOP A;  3PN7 B;  1GQM A;  2CTN A;  5K89 A;  1CFC A;  5ER5 A;  1QIW A;  2SCP A;  4I5J A;  2V53 A;  2KPH A;  3EK8 A;  4MN0 A;  5CSN A;  2LVJ A;  3QME A;  2BKH B;  4IJ7 A;  3S0B A;  4PAL A;  1F54 A;  1TNQ A;  3D77 A;  2KGR A;  4MRX A;  3D78 A;  3KEV A;  1DEL A;  1K93 D;  1LA3 A;  4ORB B;  3EKH A;  2K0J A;  2QEV A;  4OR9 B;  3EVR A;  4NDD A;  2WC6 A;  1R6P A;  2H8V A;  5DKQ A;  3S0F A;  1QVI Y;  2LP3 A;  1DF0 A;  2PMY A;  2LLS A;  2MHH A;  1NX2 A;  1A4P A;  1DF0 B;  3CYZ A;  3D10 A;  1BJF A;  1M45 A;  4YI9 A;  2JXL A;  1S36 A;  5B8I B;  2JZI A;  2NZ0 A;  1JSA A;  1NCZ A;  2KI6 D;  1ZOT B;  4ZCV A;  1NPQ A;  5CPV A;  3PM2 A;  4I5K A;  3S0G A;  1CMG A;  1CLB A;  1B47 A;  3AAJ A;  3LCP C;  1ALW A;  1CDM A;  2G9B A;  2GGM A;  3M0W A;  3OBV A;  1B8L A;  1WLM A;  4GGF C;  4MZJ A;  4MSP A;  3BFB A;  5ER4 X;  1KK7 Y;  1CMF A;  1J1E A;  1MWN A;  1FPW A;  5TNC A;  2WC5 A;  3B88 A;  2WCK A;  5FYX A;  3QRX A;  2Y1M A;  4HRE E;  1WDC B;  1SL7 A;  3I5I C;  3SIA A;  1JC2 A;  1EG4 A;  1JWD A;  3NSI A;  1CTR A;  2WCF A;  4JWQ A;  1S6I A;  5HKY A;  1DJX A;  4YBH B;  2KOT A;  3A4U B;  4ETO A;  1SL9 A;  3BQ3 A;  1YUU A;  3NHT A;  1F8H A;  1DJG A;  2ERB A;  2K2F A;  2ZNE A;  3JVT C;  2QAC A;  1Y1U A;  2LLT A;  2LAN A;  3D74 A;  2WCE A;  3A8R A;  1R2U A;  4PHJ A;  1V1F A;  4E68 A;  1IGV A;  3I5G C;  4PT1 A;  1RJV A;  2KAY A;  4A4C A;  4QJ3 B;  1KK8 C;  1KSM A;  2K8M B;  3TS5 C;  1NIW A;  2K60 A;  2WND A;  3DF0 B;  3FE8 A;  3KO0 A;  3IQQ A;  5HLO A;  1QTX A;  2KBM A;  3NSO A;  1KQM B;  3SG3 A;  2WOS A;  1KFX L;  4HRH A;  2K7C A;  2I7A A;  1SKT A;  1LA0 A;  1IQ3 A;  2JU0 A;  2HQ8 A;  3O4Y A;  3SS4 A;  3LLE A;  4GPL B;  1K9K A;  1A2X A;  2BE4 A;  2K7B A;  1YUT A;  3CR5 X;  1C07 A;  2QEO A;  3NSL A;  3WHT B;  1TNP A;  3CWG A;  1OZS A;  1K94 A;  3ZWH A;  2Y4Q A;  4DS7 A;  3OX6 A;  1IJ6 A;  2LHI A;  1YUR A;  5I8N A;  4YI8 A;  3BUW B;  3I5H B;  1M31 A;  2VRG A;  3E3R A;  3K1E A;  3VRQ A;  3EKJ A;  3WNX B;  2KAX A;  1F70 A;  4F7F A;  1S6J A;  3D75 A;  3BXK A;  3O6B A;  4N1G A;  2JOJ A;  2DOQ A;  2QPT A;  3IQO A;  1BOD A;  1DQE A;  1WRK A;  1YRU B;  2ZRS A;  1XYD A;  3O2P A;  1DVI A;  3CZT X;  4XJK B;  4DIR A;  2WCL A;  2L50 A;  3SG5 A;  5AAN A;  1Z2C B;  2F3Z A;  4I5L B;  1LS8 A;  4OV2 A;  1EH2 A;  2LM5 A;  2SAS A;  1PAL A;  1XFW O;  1NSH A;  3LK0 A;  1SCM B;  1KFU L;  3PM8 A;  3Q8I A;  3FIA A;  3DVJ A;  1YVH A;  5D7F A;  1YRT B;  1OOI X;  5BPJ A;  1OOF A;  4MZL A;  3TUY B;  1UHJ A;  2WOR A;  1IG5 A;  1EL4 A;  1PRW A;  1YVL A;  2EHB A;  4NDC A;  5DKN A;  3CAB A;  2LMV A;  2P6B B;  4YGB B;  2OTG C;  1JUO A;  1SBJ A;  2GTE A;  3CS1 A;  1X02 A;  1YR5 A;  4GGN A;  1WLZ A;  4R1E A;  2ZN8 A;  4USL A;  3JTD B;  3NXA A;  4I5N B;  4PE1 A;  3NGV A;  3JTD C;  3I5F C;  2F8P A;  2L0P A;  1XFV O;  1G33 A;  5AER A;  5AXI A;  3SG2 A;  2WCM A;  3R1V A;  4Q04 A;  1CM1 A;  1ORG A;  5FI6 A;  2LP2 A;  2KYF A;  1A29 A;  1OQP A;  2HET A;  3R1O A;  1EJ3 A;  1B1G A;  3HCM A;  2BCX A;  1UUR A;  4C0K A;  2L5X B;  4WQ3 A;  3R1P A;  2JQ6 A;  4F0Z B;  3HX4 A;  4INW A;  5AEQ A;  1N65 A;  1XFZ O;  4GFT A;  3BFH A;  2ZN9 A;  1SY9 A;  2K61 A;  1JFK A;  2KQ6 A;  1PK0 D;  5DKR A;  2PAL A;  3IF7 A;  2LC5 A;  5F6T A;  1QV1 A;  2KHN A;  5FI2 A;  2P71 A;  3F45 A;  4DRW A;  2KGB C;  3DVE A;  4YGC B;  1GGW A;  2L2E A;  1SMG A;  2KBI A;  2FJU B;  1U5I A;  1YTZ C;  4P5O E;  3LL8 B;  3SG6 A;  1UHK A;  3B86 A;  2WCJ A;  3BOW A;  1C3Z A;  2LNK A;  1BR1 B;  1TIZ A;  2F2O A;  2LCP A;  4KYN A;  5JJG A;  1QV0 A;  1SRA A;  1QJT A;  1UHN A;  3BUX B;  3I5H C;  2H61 A;  3PAL A;  1OOG A;  3VRO A;  5I2L A;  3S0A A;  2GGZ A;  2HF5 A;  2JTT A;  5CSI A;  2F3Y A;  1N0Y A;  1QS7 A;  3VB1 A;  4AQI A;  1P28 A;  1K90 D;  1PSR A;  2A4J A;  1KFU S;  4PDZ A;  1XVJ A;  2AAO A;  1AHR A;  1MR8 A;  4DUQ A;  1B8C A;  5CSJ A;  2L51 A;  1DGU A;  1TUZ A;  1BG1 A;  1WY9 A;  4MZK A;  1UWO A;  2CNP A;  2M7L A;  4CFQ A;  2BAP A;  1HQV A;  2JT0 A;  1F4Q A;  1QXP A;  1XK4 C;  5EL2 A;  1NP8 A;  1IQ5 A;  1ODB A;  2BBM A;  1NCY A;  1CFP A;  1KQV A;  1JF2 A;  4MRY A;  1FF1 A;  1RWY A;  2NCP A;  2NXQ A;  3BOW B;  3PJI A;  5KU1 A;  3SIB A;  4AOM A;  4D1E A;  4MLW A;  1UHH A;  1K95 A;  2M7N A;  5FI7 A;  2ISD A;  2LHL A;  4JPZ B;  2HPS A;  1YX7 A;  3KHE A;  1KK8 B;  3WXA A;  1L7Z A;  1M46 A;  2FCE A;  3I5G B;  4QJ4 B;  4OVN F;  1A75 B;  1BR4 B;  3EVV A;  1DGV A;  4IL1 A;  2K2A A;  1FW4 A;  1IKU A;  1S3P A;  1QLS A;  1XFR A;  5GQQ C;  4N5X A;  2CBL A;  1SSE B;  1IWQ A;  1K96 A;  1K2H A;  1CLL A;  2M9G A;  1BLQ A;  3GOF A;  1JFJ A;  4C0J A;  1F4O A;  1KFX S;  1YX8 A;  2PVB A;  1NUB A;  4N1F A;  4JQ0 D;  3SG4 A;  2KI6 C;  3DF0 A;  3I5I B;  2LMU A;  1RRO A;  1WDC C;  2WCB A;  1S26 D;  1C7V A;  1CB1 A;  3DYE A;  4WRI A;  1A75 A;  1K8U A;  2WC8 A;  1QX2 A;  2F33 A;  2Y1N A;  1OMR A;  1XA5 A;  1EG3 A;  1AJ5 A;  1MXE A;  1SL8 A;  3V2L A;  1F71 A;  4PHK A;  4CPV A;  1U5I B;  3MSE B;  2KAV A;  3GK2 A;  2L4H A;  1AVS A;  3PLF B;  1W7J B;  1ZMZ A;  3RZS A;  4L9M A;  2BKI B;  1OMD A;  1UUS A;  1AK8 A;  1IJ5 A;  1B4C A;  3H4S E;  2KFG A; 
#chains in the Genus database with same CATH homology
 1QX5 B;  2PSR A;  3GK1 A;  3ICB A;  5HKZ A;  2COL B;  1BF5 A;  3OB2 B;  1S5G Y;  5HKW A;  1VRK A;  4PCW A;  3WHU B;  2R2I A;  2K7O A;  3VRP A;  1K9U A;  2EGD A;  1QVI Z;  4C0L A;  2B1U A;  3CTN A;  2JNX A;  2H61 C;  1UHI A;  1CLM A;  1LXF C;  1BOC A;  2JUL A;  1KWO B;  2LLU A;  1BT6 A;  3KF9 A;  1NCX A;  1MUX A;  4CID A;  1MXL C;  3EVU A;  4BY4 A;  1RFJ A;  2JC2 A;  3EK7 A;  4QJ5 B;  1KK7 Z;  1Q80 A;  4P2Y B;  4M2P A;  1Y6W A;  1C7W A;  1RK9 A;  1TCF A;  1OE9 B;  2FOT A;  2KYC A;  1OOJ A;  3BUN B;  3DVK A;  1A03 A;  3VRR A;  3RLZ A;  3CGA A;  1DJZ A;  1BMO A;  1MQ1 A;  2L4I A;  2BEC A;  1QAT A;  4OCI A;  3KPX A;  1QIV A;  2JTZ A;  2MAZ A;  1EXR A;  1V1G A;  2LMT A;  1CDN A;  1DTL A;  1KCY A;  2KFH A;  1XO5 A;  2KSP A;  2M49 B;  2KDH A;  4BY5 A;  5KSZ A;  4YRU A;  2O5G A;  1XFU O;  3AAK A;  2IS9 A;  4CLN A;  3CLN A;  1AP4 A;  1Y1X A;  2I2R E;  2JT8 A;  3I5F B;  2FCD A;  1L2O B;  3PAT A;  1PSB A;  1NX3 A;  2F2P A;  1YUS A;  4FQO A;  2HQW A;  2L98 A;  4GAO A;  1AUI B;  1SNL A;  3CR4 X;  2Y5I A;  4XJK A;  2BCA A;  1PVA A;  3PSR A;  2OTG B;  2LVV A;  2BL0 C;  1B7T Y;  4GUK A;  1CNP A;  2E6W A;  1GGZ A;  2AUC A;  2O60 A;  5IBW A;  1W7I B;  1E8A A;  1SYM A;  3VGO A;  3TUY C;  2ZFD A;  2LUC A;  2M1K B;  4ICB A;  1JF0 A;  1UP5 A;  2EC6 C;  3DVM A;  3OB1 B;  1SCM C;  2H2K A;  2JT3 A;  4MBE A;  1PVB A;  4PHN A;  4PE4 A;  5I2O A;  1Y0V H;  3RM1 A;  2PRU A;  1QX7 A;  1D1O A;  3K21 A;  2LAP A;  1ZAC A;  4GBA A;  3TZ1 A;  2CXJ A;  2KQY A;  4GGF A;  1N2D A;  3OP0 A;  2ZRT A;  1SW8 A;  2I94 A;  3TDZ A;  2KFF A;  1F55 A;  2KI4 B;  1DJY A;  1SK6 D;  1S5G Z;  5KTY A;  1TCO B;  3BUO B;  3PFV A;  4GNK B;  1B8R A;  1KSO A;  1NWD A;  4HSZ A;  4MEW A;  2Q91 A;  5J3X A;  1AJ4 A;  1XFX O;  1SCV A;  1M39 A;  1CFD A;  1S1E A;  4PE0 A;  2MJW B;  2OS8 C;  1SR6 B;  2M29 A;  1XFY O;  1HT9 A;  2BBN A;  4NDB A;  1TRF A;  2M3W A;  1FBV A;  2D8N A;  5HLV A;  3OX5 A;  4WQ2 A;  2BE6 A;  2JWW A;  3D0Y B;  1PUL A;  2M0R A;  1KQM C;  1J55 A;  1CFF A;  4UPG A;  1OMV A;  3TDU A;  2NLN A;  1WRZ A;  4NQG A;  2TN4 A;  4ZCU A;  1WRL A;  3TS5 B;  1B7T Z;  3GK4 X;  1ZUZ A;  1ALV A;  1SR6 C;  1MF8 B;  2OS8 B;  2LVI A;  3BUM B;  3SJS A;  3JVT B;  1IH0 A;  2OPO A;  1CDP A;  4FTG A;  4YGD B;  1LIN A;  3C1V A;  1REC A;  4M2O A;  5JOL A;  2KI4 C;  1J7O A;  1BU3 A;  4A4B A;  3LK1 A;  2BCB A;  1K9P A;  1DMO A;  1CM4 A;  1CKK A;  5HYD A;  1OZO A;  5CSF A;  1NX0 A;  4M2Q A;  4YGE B;  1S6C A;  5I2Q A;  3OHM B;  3FWB A;  3AKA A;  3FWC A;  4MVF A;  5G08 A;  5AFP A;  1Y1A A;  1J7Q A;  1DJW A;  3EK4 A;  1OSA A;  5D69 A;  1H8B A;  2EC6 B;  2M97 A;  2PAS A;  1NX1 A;  3FS7 A;  1FI5 A;  1GJY A;  1XK4 A;  4OKH A;  4YGA A;  1TTX A;  3CR2 A;  3ZNI A;  1JBA A;  1G8I A;  2MRD A;  2E30 A;  1J1D A;  2BL0 B;  2NCO A;  4ORA B;  2ZKM X;  2JPT A;  2Q4U A;  2M1U A;  2MLF C;  1SPY A;  1RTP 1;  2GV5 A;  3SG7 A;  2ZND A;  2LE9 B;  1DJI A;  2CT9 A;  1L2O C;  1NYA A;  1FI6 A;  2KNE A;  2MA2 A;  1IRJ A;  1QLK A;  2JNF A;  4PHM A;  1QAS A;  4PE7 A;  1H4B A;  3NSK A;  4HRG A;  4ORC B;  1DJH A;  1TNX A;  2LUX A;  4CFR A;  1DT7 B;  3DD4 A;  3VRN A;  2K7D A;  1LKJ A;  2I18 A;  2RGI A;  4AQJ A;  1J7P A;  1MHO A;  1LVC D;  1TN4 A;  1TNW A;  2M8U A;  3D0Y A;  3PN7 C;  1ZFS A;  1CDL A;  4DCK A;  1J7R A;  2MBX A;  4TNC A;  3AKB A;  2G2B A;  2MLE C;  1M63 B;  1G4Y R;  3O78 A;  2JXC A;  2LV7 A;  4U8D A;  4XYN A;  2CCM A;  2AMI A;  3BYA A;  3TDI A;  5PAL A;  1B9A A;  2JRF A;  2LVK A;  3PN7 B;  1KWO C;  1TOP A;  1CFC A;  1GQM A;  2CTN A;  5K89 A;  5ER5 A;  1QIW A;  2SCP A;  4I5J A;  2V53 A;  3EK8 A;  4MN0 A;  5CSN A;  2LVJ A;  2BKH B;  4PAL A;  1F54 A;  1TNQ A;  2KGR A;  4MRX A;  3KEV A;  1K93 D;  1LA3 A;  4ORB B;  3EKH A;  2K0J A;  4OR9 B;  3EVR A;  4NDD A;  5DKQ A;  1R6P A;  1QVI Y;  2LP3 A;  1DF0 A;  2PMY A;  2LLS A;  2MHH A;  1NX2 A;  1A4P A;  1DF0 B;  3D10 A;  1BJF A;  1M45 A;  4YI9 A;  2JXL A;  1S36 A;  5B8I B;  2JZI A;  2NZ0 A;  1JSA A;  1NCZ A;  2KI6 D;  1ZOT B;  4ZCV A;  1NPQ A;  5CPV A;  4I5K A;  1CMG A;  1CLB A;  1B47 A;  3AAJ A;  3LCP C;  1ALW A;  1CDM A;  2G9B A;  2GGM A;  3M0W A;  4GGF C;  1B8L A;  1WLM A;  4MZJ A;  4MSP A;  5ER4 X;  1KK7 Y;  1CMF A;  1J1E A;  1MWN A;  1FPW A;  5TNC A;  5FYX A;  3QRX A;  2Y1M A;  4HRE E;  1WDC B;  1SL7 A;  3I5I C;  3SIA A;  1JC2 A;  1EG4 A;  1JWD A;  3NSI A;  1CTR A;  2WCF A;  4JWQ A;  1S6I A;  5HKY A;  1DJX A;  4YBH B;  2KOT A;  3A4U B;  4ETO A;  1SL9 A;  3BQ3 A;  1YUU A;  1F8H A;  1DJG A;  2ZNE A;  2K2F A;  3JVT C;  2QAC A;  1Y1U A;  2LLT A;  2LAN A;  2WCE A;  3A8R A;  1R2U A;  4PHJ A;  1V1F A;  4E68 A;  1IGV A;  3I5G C;  1RJV A;  2KAY A;  4A4C A;  4QJ3 B;  1KK8 C;  1KSM A;  2K8M B;  3TS5 C;  1NIW A;  2WND A;  3KO0 A;  3DF0 B;  3IQQ A;  5HLO A;  1QTX A;  2KBM A;  3NSO A;  1KQM B;  3SG3 A;  2WOS A;  1KFX L;  4HRH A;  2K7C A;  2I7A A;  1SKT A;  1LA0 A;  1IQ3 A;  2JU0 A;  2HQ8 A;  3O4Y A;  3LLE A;  4GPL B;  1K9K A;  1A2X A;  2BE4 A;  2K7B A;  1YUT A;  3CR5 X;  1C07 A;  3NSL A;  3WHT B;  1TNP A;  3CWG A;  1OZS A;  1K94 A;  3ZWH A;  2Y4Q A;  4DS7 A;  3OX6 A;  1IJ6 A;  2LHI A;  1YUR A;  5I8N A;  4YI8 A;  3BUW B;  3I5H B;  1M31 A;  2VRG A;  3E3R A;  3VRQ A;  3WNX B;  3EKJ A;  1F70 A;  2KAX A;  1S6J A;  3O6B A;  3BXK A;  4N1G A;  2JOJ A;  2DOQ A;  2QPT A;  3IQO A;  1BOD A;  1WRK A;  1YRU B;  2ZRS A;  1XYD A;  3O2P A;  1DVI A;  3CZT X;  4XJK B;  4DIR A;  2L50 A;  3SG5 A;  5AAN A;  2F3Z A;  4I5L B;  4OV2 A;  1EH2 A;  2LM5 A;  2SAS A;  1PAL A;  1XFW O;  1NSH A;  3LK0 A;  1SCM B;  1KFU L;  3PM8 A;  3FIA A;  3DVJ A;  1YVH A;  5D7F A;  1YRT B;  5BPJ A;  4MZL A;  3TUY B;  1UHJ A;  2WOR A;  1IG5 A;  1EL4 A;  1PRW A;  1YVL A;  2EHB A;  4NDC A;  5DKN A;  2LMV A;  2P6B B;  4YGB B;  2OTG C;  1JUO A;  1SBJ A;  3CS1 A;  4GGN A;  1X02 A;  1YR5 A;  1WLZ A;  4R1E A;  2ZN8 A;  4USL A;  3JTD B;  3NXA A;  4I5N B;  4PE1 A;  3JTD C;  3I5F C;  2F8P A;  2L0P A;  1XFV O;  1G33 A;  5AER A;  5AXI A;  3SG2 A;  4Q04 A;  1CM1 A;  2LP2 A;  2KYF A;  1A29 A;  1OQP A;  2HET A;  1B1G A;  1EJ3 A;  3HCM A;  2BCX A;  1UUR A;  4C0K A;  2L5X B;  4WQ3 A;  2JQ6 A;  4F0Z B;  3HX4 A;  5AEQ A;  1N65 A;  1XFZ O;  4GFT A;  2ZN9 A;  1SY9 A;  2K61 A;  1JFK A;  2KQ6 A;  1PK0 D;  5DKR A;  2PAL A;  3IF7 A;  2LC5 A;  5F6T A;  1QV1 A;  2KHN A;  4DRW A;  3F45 A;  2KGB C;  3DVE A;  4YGC B;  1GGW A;  2L2E A;  1SMG A;  2KBI A;  2FJU B;  1U5I A;  1YTZ C;  4P5O E;  3LL8 B;  3SG6 A;  1UHK A;  3BOW A;  2LNK A;  1BR1 B;  1TIZ A;  2F2O A;  2LCP A;  5JJG A;  1QV0 A;  1SRA A;  1QJT A;  1UHN A;  3BUX B;  3I5H C;  2H61 A;  3PAL A;  3VRO A;  5I2L A;  2GGZ A;  2HF5 A;  2JTT A;  5CSI A;  2F3Y A;  1N0Y A;  1QS7 A;  4AQI A;  1K90 D;  1PSR A;  2A4J A;  1KFU S;  4PDZ A;  1XVJ A;  2AAO A;  1AHR A;  1MR8 A;  4DUQ A;  1B8C A;  5CSJ A;  2L51 A;  1DGU A;  1BG1 A;  1WY9 A;  4MZK A;  1UWO A;  2CNP A;  2M7L A;  4CFQ A;  1HQV A;  2JT0 A;  1F4Q A;  1QXP A;  1XK4 C;  1NP8 A;  1IQ5 A;  1ODB A;  2BBM A;  1NCY A;  1CFP A;  1KQV A;  1JF2 A;  4MRY A;  1FF1 A;  1RWY A;  2NCP A;  2NXQ A;  3BOW B;  5KU1 A;  3SIB A;  4AOM A;  4D1E A;  4MLW A;  1UHH A;  1K95 A;  2M7N A;  2ISD A;  2LHL A;  4JPZ B;  2HPS A;  1YX7 A;  3KHE A;  1KK8 B;  3WXA A;  1L7Z A;  1M46 A;  2FCE A;  3I5G B;  4QJ4 B;  4OVN F;  1A75 B;  1BR4 B;  3EVV A;  1DGV A;  4IL1 A;  2K2A A;  1FW4 A;  1IKU A;  1S3P A;  1QLS A;  5GQQ C;  4N5X A;  2CBL A;  1K96 A;  1IWQ A;  1K2H A;  1CLL A;  2M9G A;  1BLQ A;  3GOF A;  1JFJ A;  4C0J A;  1F4O A;  1KFX S;  1YX8 A;  2PVB A;  1NUB A;  4N1F A;  4JQ0 D;  3SG4 A;  2KI6 C;  3DF0 A;  3I5I B;  2LMU A;  1RRO A;  1WDC C;  2WCB A;  1S26 D;  1C7V A;  1CB1 A;  4WRI A;  1A75 A;  1K8U A;  2WC8 A;  1QX2 A;  2F33 A;  2Y1N A;  1OMR A;  1XA5 A;  1EG3 A;  1AJ5 A;  1MXE A;  1SL8 A;  1F71 A;  4PHK A;  4CPV A;  1U5I B;  3MSE B;  2KAV A;  3GK2 A;  2L4H A;  1AVS A;  3PLF B;  1W7J B;  1ZMZ A;  4L9M A;  2BKI B;  1OMD A;  1UUS A;  1AK8 A;  1IJ5 A;  1B4C A;  3H4S E;  2KFG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...