1NPQA

Structure of a rhodamine-labeled n-domain troponin c mutant (ca2+ saturated) in complex with skeletal troponin i 115-131
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
90
structure length
90
Chain Sequence
ASMTDQQAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKCELDAIICEVDEDGSGTIDFEEFLVMMVRQMKEDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Troponin C
publication title NMR Structure of a Bifunctional Rhodamine Labeled N-Domain of Troponin C Complexed with the Regulatory "Switch" Peptide from Troponin I: Implications for in Situ Fluorescence Studies in Muscle Fibers
pubmed doi rcsb
source organism Gallus gallus
molecule tags Structural protein
total genus 18
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2003-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1npqA00
1GJYA 2K61A 3GOFA 2SCPA 4GUKA 4YI9A 2KI4C 1OSAA 1AUIB 1DT7B 3NSIA 3LL8B 3MSEB 2JU0A 3GK4X 1M31A 2SASA 4AQJA 1MXLC 4PE1A 4MVFA 1NX2A 2L0PA 2TN4A 4MEWA 4GFTA 2NCPA 2OTGB 1DJWA 1KK8C 4PE7A 4A4BA 5DKRA 3CR5X 3O4YA 3DVMA 1Y1XA 4C0KA 1H4BA 1J7RA 2Q4UA 3BUMB 4IL1A 1BMOA 2LAPA 1U5IA 2KBIA 2K7CA 1K2HA 3A4UB 3VRPA 5DKNA 4CIDA 5I8NA 2LLTA 2NLNA 4YGDB 1UHJA 1RWYA 1C7WA 2LHIA 4OCIA 1PSBA 4YGBB 2AUCA 1CM1A 1DGUA 1YR5A 4M2PA 3VRNA 3O6BA 4HSZA 3CS1A 1DF0A 1UHIA 1JUOA 1SL8A 1DVIA 1WRZA 2NXQA 5D69A 5ER5A 1OMRA 2JULA 2QPTA 2ZRSA 4QJ5B 1RJVA 1TNQA 3LLEA 1NWDA 2MJWB 1CFDA 4GPLB 3WHUB 2QACA 1IJ5A 1W7JB 2LMTA 1BODA 1F71A 4PHNA 4WRIA 1NX3A 1YVLA 3PSRA 2JXCA 2AMIA 4TNCA 2WCEA 2K7OA 2LLSA 4JQ0D 3JTDC 4DCKA 1K9PA 2BBNA 3O78A 2KFHA 1PVAA 2BL0C 2H61A 1G33A 5AFPA 2LANA 4E68A 1CFCA 1RROA 2V53A 1KK8B 2KGRA 1XO5A 1SY9A 3JVTC 5CSIA 5B8IB 1F8HA 1V1FA 1NIWA 2L50A 3OP0A 2M3WA 2KQ6A 5CPVA 2JRFA 2LNKA 2ZKMX 4GGNA 2LM5A 3SG2A 2O5GA 4YI8A 1IQ3A 1NCYA 2L98A 1PALA 3C1VA 1OMVA 1OQPA 1S5GY 1QIVA 2A4JA 1TIZA 3KHEA 3VGOA 4DIRA 1SCMB 3I5HC 1BT6A 4MZLA 1EL4A 1KQVA 1MR8A 4BY4A 2LV7A 3WNXB 1YX8A 3CWGA 3SG3A 3TDUA 2JC2A 1UP5A 3ICBA 3VRQA 3AKBA 1B7TY 3NSKA 1NCZA 2CCMA 4MSPA 1CLMA 3I5IC 5HYDA 1PULA 1DJXA 1A75B 5HKWA 4USLA 2VRGA 4M2QA 1A03A 4MLWA 4ZCVA 5JOLA 4PDZA 4MRXA 1KFXL 1OOJA 4WQ2A 1DTLA 1S1EA 4MZJA 4I5KA 5KTYA 1MF8B 4ORAB 4ZCUA 1Q80A 4DUQA 1KCYA 4JWQA 1DMOA 2PVBA 1H8BA 4NDBA 3JTDB 1QLSA 1XFWO 2M8UA 2K0JA 1QV1A 3D10A 4YBHB 2BL0B 2JOJA 1FI5A 2BE4A 1CTRA 2FCDA 3BUOB 1LINA 1SBJA 1AHRA 1JF2A 2IS9A 3PFVA 5AEQA 1J7PA 2PASA 1KSMA 1B9AA 1DJGA 4R1EA 1KWOC 3DVKA 2AAOA 2LMUA 3KPXA 1DGVA 1KFXS 1M63B 3JVTB 4MZKA 1MQ1A 1CB1A 4I5LB 1S26D 2GGZA 5ER4X 4N1GA 5AANA 1TNWA 2Y4QA 1QX5B 2KI6C 4OKHA 2K2AA 2JT8A 2JNXA 1A75A 5I2LA 1CMFA 1SPYA 1YURA 2KYFA 3LCPC 1FW4A 2KQYA 3BUWB 2K7DA 3I5HB 5PALA 1LVCD 2LP3A 5CSFA 1CM4A 1CKKA 3KF9A 1QX2A 1ALWA 5HLOA 1SCVA 3HCMA 4XJKB 1XYDA 1QATA 1Y1AA 2L2EA 3I5IB 1IGVA 1Y0VH 2MRDA 2G9BA 1GGWA 1MXEA 1YX7A 1JSAA 1XVJA 4YGEB 3EK8A 1XK4C 4MRYA 2KBMA 4GBAA 1DJZA 1K93D 1S5GZ 2I18A 3OB1B 4MBEA 4JPZB 4FQOA 5J3XA 2E30A 4NDDA 1J55A 2M7NA 2HQ8A 1S6JA 1TTXA 1GQMA 2FOTA 4I5JA 3NXAA 2JWWA 1KK7Y 2O60A 2EHBA 4F0ZB 1QS7A 4C0JA 2JPTA 1PSRA 1YUUA 5CSJA 1BLQA 1PVBA 4FTGA 1KFUL 1N0YA 1CDLA 1JFKA 1NYAA 1W7IB 3KO0A 1CDPA 2CTNA 4XJKA 1NX0A 3GK2A 3PN7C 1F70A 4OR9B 4GGFA 2Y5IA 2M97A 1SL9A 4NDCA 3PM8A 4U8DA 2KI4B 1OZSA 2BKIB 1S6IA 2HPSA 2LUCA 2F2PA 1F55A 1SNLA 2ZNEA 3TZ1A 2KGBC 1A4PA 1KFUS 2BCBA 3SIBA 2LLUA 3A8RA 3LK1A 1TCFA 4CFRA 1TN4A 1UHHA 2MBXA 3RM1A 1QVIY 4HRHA 1CNPA 2F33A 1CDNA 1BR1B 1B47A 5KSZA 3M0WA 5DKQA 2LCPA 3I5GC 2BE6A 2LP2A 1K96A 1CMGA 1L7ZA 2M1KB 5G08A 1QLKA 2BECA 1XFZO 2ZRTA 5TNCA 1OE9B 2KAXA 1K9KA 2F8PA 2KAYA 5AXIA 1FF1A 1G8IA 1S36A 1B8RA 3SG7A 2MHHA 1VRKA 3KEVA 1J7QA 1RK9A 3WXAA 2MLEC 3SG5A 4PHKA 1MWNA 1RFJA 3FIAA 3H4SE 2NCOA 3CR2A 1SYMA 3RLZA 5I2QA 5JJGA 1YUSA 2Y1MA 1KQMC 1B1GA 1WLZA 1AVSA 3TDIA 3TUYC 3K21A 1NP8A 1V1GA 1YRTB 1K94A 2K2FA 1ZACA 2BKHB 2LE9B 1HT9A 1M45A 2KFGA 2F3ZA 2LVJA 1EJ3A 1KK7Z 5IBWA 2EC6C 1WY9A 3IQQA 2EGDA 1NSHA 1ZFSA 4ORCB 2JXLA 2NZ0A 4ICBA 2I2RE 1KSOA 2H61C 1WLMA 1PRWA 1IKUA 1AJ4A 2WCFA 1R6PA 2JTZA 2JNFA 3IF7A 4ORBB 1UURA 1C07A 3BUNB 1AJ5A 1YRUB 4HRGA 3I5GB 1UHKA 2RGIA 1QJTA 2PMYA 3BOWB 1RTP1 2HF5A 1NX1A 2OS8C 1XFUO 3OB2B 2I94A 2KNEA 2M9GA 2ZFDA 1EXRA 1B8CA 3BUXB 1AK8A 1DJYA 1CLLA 2WC8A 1IJ6A 2ISDA 4A4CA 3PALA 4M2OA 1WDCC 2CBLA 1K90D 3BQ3A 2WNDA 2KHNA 1XA5A 2K8MB 3PATA 2L4HA 4P2YB 4YRUA 1ZMZA 1QVIZ 1LXFC 1FPWA 1NCXA 2M49B 1RECA 1M39A 3AAJA 3EK4A 3IQOA 5K89A 5AERA 5FYXA 2PRUA 2OPOA 3O2PA 2MLFC 3WHTB 1EH2A 1DF0B 1SRAA 2BCXA 1LA3A 3SG6A 1K9UA 1KQMB 2Y1NA 4XYNA 1UWOA 1LKJA 3OHMB 1SK6D 4PHJA 3TUYB 3ZWHA 5I2OA 1SMGA 1G4YR 4C0LA 3DVEA 2HETA 4OVNF 1JF0A 1QTXA 2COLB 4PCWA 4GAOA 1TRFA 3I5FC 4QJ4B 2JQ6A 3EVUA 1TCOB 2JZIA 3EK7A 1B7TZ 2FJUB 3BOWA 3AKAA 2EC6B 3LK0A 2L4IA 4BY5A 2M7LA 1KWOB 1IQ5A 2KAVA 1QX7A 1UUSA 2CXJA 4ETOA 3OX6A 3F45A 2P6BB 1SCMC 2L51A 1SR6C 1B8LA 3TS5C 2LVVA 1IH0A 4CLNA 1S6CA 1NPQA 2MAZA 1A29A 1PK0D 3TDZA 2GV5A 5D7FA 4Q04A 2OS8B 5CSNA 2B1UA 1BOCA 1CFPA 5KU1A 3DD4A 2JT0A 1JWDA 1XFXO 2CNPA 2BBMA 1J7OA 1CLBA 4OV2A 1WRLA 1R2UA 1A2XA 5BPJA 4PALA 1WDCB 1LA0A 3EVVA 1Y1UA 4DRWA 5HLVA 1HQVA 5F6TA 1F4QA 2KI6D 2KOTA 4L9MA 2LHLA 2M1UA 4N5XA 3SG4A 4AQIA 1BU3A 2HQWA 3DF0B 1OMDA 2CT9A 2ZN9A 3SJSA 4CPVA 3QRXA 1M46A 3NSOA 2F2OA 2MA2A 2H2KA 3SIAA 4D1EA 2LMVA 1JFJA 2L5XB 1BR4B 3BXKA 1QXPA 2BCAA 1L2OC 2PALA 3EKJA 1ZUZA 3I5FB 4I5NB 1OZOA 3FWBA 1MUXA 5HKZA 2JT3A 1BJFA 2KSPA 3OX5A 1XFVO 2F3YA 1S3PA 1IRJA 1QASA 2K7BA 1DJHA 4WQ3A 2M29A 2I7AA 1N65A 1X02A 4DS7A 1C7VA 2WORA 3D0YB 1SR6B 3PN7B 3VRRA 3TS5B 1AP4A 1J1DA 3CZTX 2WOSA 1QIWA 1CFFA 2OTGC 3FS7A 3CR4X 1EG3A 1K8UA 1YUTA 2JTTA 3DVJA 4HREE 1XK4A 2LC5A 4GGFC 1XFYO 2LVIA 4NQGA 1J1EA 1YVHA 3DF0A 1Y6WA 1D1OA 1QV0A 3PLFB 4CFQA 3CTNA 1TNPA 1B4CA 1FI6A 1TNXA 2KDHA 1SL7A 5GQQC 3CLNA 4PHMA 3EKHA 2KYCA 1DJIA 3GK1A 3HX4A 2Q91A 4PE0A 3FWCA 1NUBA 1JC2A 1IG5A 2DOQA 2FCEA 4YGAA 3ZNIA 3NSLA 1JBAA 1SW8A 4YGCB 3CGAA 5HKYA 1ZOTB 1YTZC 1ODBA 1U5IB 2R2IA 2E6WA 4MN0A 4PE4A 1N2DA 4QJ3B 4N1FA 1SKTA 1UHNA 3D0YA 1E8AA 3AAKA 2G2BA 1EG4A 1L2OB 1IWQA 1MHOA 2LUXA 1ALVA 3BYAA 2ZNDA 1BG1A 1F4OA 4P5OE 2D8NA 4AOMA 2ZN8A 1K95A 2WCBA 3EVRA 2PSRA 3E3RA 1GGZA 2GGMA 1FBVA 2LVKA 4GNKB 1CDMA 1TOPA 1F54A 1WRKA 2M0RA 3VROA 1BF5A 4UPGA 2KFFA
chains in the Genus database with same CATH superfamily
1GJYA 2K61A 3GOFA 2SCPA 4GUKA 4YI9A 2KI4C 1OSAA 2P70A 3D77A 1AUIB 3S0GA 1DT7B 3NSIA 3LL8B 3MSEB 2QEVA 2JU0A 3GK4X 1M31A 2SASA 4AQJA 3BFAA 1MXLC 4PE1A 4MVFA 1NX2A 2L0PA 2TN4A 4MEWA 4GFTA 2NCPA 2OTGB 1DJWA 1XFRA 1KK8C 4PE7A 4A4BA 5DKRA 3CR5X 3O4YA 3DVMA 1Y1XA 4C0KA 1H4BA 1J7RA 2Q4UA 3BUMB 4IL1A 1BMOA 2LAPA 1U5IA 2KBIA 4F7FA 3FE8A 2K7CA 1K2HA 3A4UB 3VRPA 5DKNA 4CIDA 5I8NA 2LLTA 2NLNA 4YGDB 3DY9A 1UHJA 1RWYA 1C7WA 2LHIA 4OCIA 3S0DA 1PSBA 2WCHA 4YGBB 2AUCA 1CM1A 1DGUA 1YR5A 4M2PA 3VRNA 3O6BA 4HSZA 2FJYA 3CS1A 1DF0A 1UHIA 1JUOA 1SL8A 1DVIA 1WRZA 2NXQA 5D69A 5ER5A 1OMRA 2JULA 2QPTA 2ZRSA 4QJ5B 1RJVA 1TNQA 3LLEA 1NWDA 2MJWB 1CFDA 4GPLB 3WHUB 2QACA 2ERBA 1IJ5A 1W7JB 2LMTA 1BODA 1F71A 4PHNA 4WRIA 1BG1A 1NX3A 1YVLA 3PSRA 2JXCA 2AMIA 4TNCA 2WCEA 2K7OA 2LLSA 4JQ0D 3JTDC 4DCKA 1K9PA 2BBNA 3O78A 3DZTA 2KFHA 1PVAA 2BL0C 2H61A 1G33A 5AFPA 2LANA 4E68A 1DC1A 1CFCA 1RROA 2V53A 1KK8B 2KGRA 1XO5A 1SY9A 3JVTC 5CSIA 5B8IB 1F8HA 1V1FA 1NIWA 2L50A 3OP0A 2M3WA 2JPOA 2KQ6A 2JRFA 2LNKA 2ZKMX 4GGNA 2LM5A 5CPVA 3SG2A 2O5GA 4YI8A 1IQ3A 1NCYA 2L98A 1PALA 3C1VA 1OMVA 1OQPA 3K1EA 1S5GY 1QIVA 2A4JA 1TIZA 3KHEA 3VGOA 4DIRA 1SCMB 3BFHA 3I5HC 1BT6A 4MZLA 1EL4A 1KQVA 1MR8A 4BY4A 2LV7A 3WNXB 2YGUA 1YX8A 3CWGA 3SG3A 3TDUA 2JC2A 1UP5A 3ICBA 3VRQA 3AKBA 1B7TY 3NSKA 1NCZA 2CCMA 4MSPA 1CLMA 3I5IC 5HYDA 1PULA 1DJXA 1A75B 5HKWA 4USLA 2VRGA 4M2QA 1A03A 4MLWA 4ZCVA 5JOLA 4PDZA 4MRXA 1KFXL 1OOJA 4WQ2A 5FI6A 1DTLA 1S1EA 5HL1A 4MZJA 4I5KA 5KTYA 1MF8B 4ORAB 4ZCUA 1Q80A 4DUQA 1KCYA 4JWQA 1DEKA 1DMOA 2PVBA 1OOGA 2BAPA 1H8BA 4NDBA 3JTDB 1QLSA 1XFWO 1OOIX 2M8UA 2K0JA 1QV1A 3D10A 4YBHB 2BL0B 2JOJA 1FI5A 2BE4A 1CTRA 2FCDA 3BUOB 1LINA 1SBJA 1AHRA 1JF2A 1QWVA 2IS9A 3PFVA 5AEQA 2PASA 1KSMA 1J7PA 1B9AA 1DJGA 2QEOA 4R1EA 1KWOC 3DVKA 2AAOA 2LMUA 3KPXA 1DGVA 1KFXS 1M63B 3JVTB 4MZKA 5I94A 1MQ1A 1CB1A 4I5LB 1S26D 2GGZA 5ER4X 4N1GA 5AANA 1TNWA 2Y4QA 1QX5B 2KI6C 4OKHA 2K2AA 2JT8A 2JNXA 1A75A 5I2LA 1CMFA 1SPYA 1YURA 2KYFA 3LCPC 1FW4A 2KQYA 1OW4A 3BUWB 2K7DA 3I5HB 5PALA 1LVCD 2L5YA 2LP3A 5CSFA 1CM4A 1CKKA 3KF9A 3S0EA 1QX2A 1ALWA 5HLOA 1SCVA 2WCKA 3HCMA 4XJKB 1TUZA 1TWOA 1XYDA 1QATA 4IJ7A 1Y1AA 2L2EA 3I5IB 1IGVA 1Y0VH 2MRDA 2G9BA 1GGWA 1MXEA 1YX7A 1JSAA 1XVJA 4YGEB 3B88A 3EK8A 1XK4C 4MRYA 2KBMA 4GBAA 1DJZA 3V2LA 1K93D 1S5GZ 2I18A 3OB1B 4MBEA 4JPZB 4FQOA 5J3XA 2E30A 4NDDA 1T14A 1J55A 2M7NA 2HQ8A 1S6JA 1TTXA 1GQMA 2FOTA 4I5JA 3NXAA 2JWWA 3B87A 1KK7Y 2O60A 2EHBA 4F0ZB 1QS7A 4C0JA 2JPTA 1PSRA 1YUUA 5CSJA 1BLQA 1PVBA 4FTGA 1KFUL 1N0YA 1CDLA 1DELA 1JFKA 4OZDA 3S0BA 1NYAA 4FQTA 2L2CA 1W7IB 3KO0A 1CDPA 2CTNA 3NGVA 4XJKA 1NX0A 3UNWA 3GK2A 3PN7C 1F70A 4OR9B 4GGFA 2Y5IA 2M97A 1SL9A 4NDCA 3R1OA 3PM8A 4U8DA 2KI4B 1OZSA 2BKIB 1S6IA 2HPSA 2LUCA 2F2PA 1F55A 1SNLA 2ZNEA 3TZ1A 2KGBC 2PQLA 1A4PA 1KFUS 2BCBA 3SIBA 3SS3A 2LLUA 3A8RA 3LK1A 4AOMA 1TCFA 4CFRA 1TN4A 1UHHA 2MBXA 3RM1A 1QVIY 4HRHA 1CNPA 2F33A 1CDNA 3D73A 1BR1B 1B47A 3OGNA 5KSZA 3R1VA 3M0WA 5DKQA 2WC5A 2LCPA 3I5GC 2BE6A 2LP2A 1K96A 1CMGA 1L7ZA 2M1KB 5G08A 1QLKA 1GM0A 3R72A 2BECA 3PM2A 1XFZO 2ZRTA 5TNCA 4JD9A 1OE9B 2BNXA 2KAXA 1K9KA 2F8PA 2KAYA 5AXIA 1FF1A 1G8IA 1S36A 1B8RA 3SG7A 2MHHA 1VRKA 3KEVA 1J7QA 1RK9A 3WXAA 3EK7A 2MLEC 3SG5A 3VB1A 1C3YA 4PHKA 1MWNA 1RFJA 3FIAA 3CYZA 3H4SE 2NCOA 3CR2A 1SYMA 2P71A 3NHTA 3RLZA 5I2QA 5JJGA 3CABA 1YUSA 2Y1MA 1KQMC 1B1GA 2WCLA 1WLZA 1AVSA 3TDIA 3TUYC 4JKTA 3K21A 1W9ZA 1NP8A 1SSEB 1V1GA 1YRTB 1K94A 2K2FA 1ZACA 2BKHB 2LE9B 1HT9A 1M45A 2KFGA 2F3ZA 2LVJA 1EJ3A 1KK7Z 5IBWA 3FE9A 1LS8A 3RZSA 2EC6C 1WY9A 3IQQA 2EGDA 1NSHA 3B7AA 1ZFSA 3FE6A 3PJIA 4ORCB 2JXLA 2NZ0A 4ICBA 2I2RE 1KSOA 2H61C 1WLMA 1PRWA 1IKUA 1AJ4A 2WCFA 1R6PA 2JTZA 4PT1A 2JNFA 4KYNA 3IF7A 4ORBB 1UURA 1C07A 3BUNB 1AJ5A 1YRUB 4HRGA 3L4LA 5D3OA 3CZ2A 3I5GB 1UHKA 2RGIA 1QJTA 2PMYA 3BOWB 1RTP1 2HF5A 1NX1A 2OS8C 1XFUO 3OB2B 2I94A 2KNEA 2M9GA 2ZFDA 1EXRA 1B8CA 3BUXB 1AK8A 1DJYA 1CLLA 2WC8A 1IJ6A 2ISDA 3D76A 4A4CA 3PALA 2WC6A 4M2OA 1WDCC 2CBLA 1K90D 3BQ3A 2WNDA 2KHNA 1XA5A 2K8MB 3PATA 2L4HA 4P2YB 4YRUA 1ZMZA 1QVIZ 1LXFC 1OOFA 2WCJA 3OBVA 1NCXA 2M49B 1FPWA 1RECA 1DQEA 1M39A 3AAJA 3EK4A 3IQOA 3SS5A 5AERA 5K89A 5FYXA 2PRUA 2OPOA 3O2PA 2MLFC 3WHTB 1EH2A 1DF0B 1SRAA 2BCXA 1LA3A 3SG6A 3L4AA 1K9UA 1KQMB 2Y1NA 4XYNA 1UWOA 3B6XA 1LKJA 3OHMB 1SK6D 4PHJA 3TUYB 3ZWHA 5I2OA 1SMGA 1G4YR 4C0LA 3DVEA 2HETA 4OVNF 1JF0A 1QTXA 2COLB 4PCWA 4GAOA 1TRFA 3I5FC 3BJHA 4QJ4B 2JQ6A 3EVUA 2KLDA 1TCOB 2JZIA 3DXLA 1B7TZ 1C3ZA 1OOHA 2FJUB 3AKAA 2EC6B 3BOWA 3LK0A 5FI2A 2L4IA 1Z2CB 4BY5A 2M7LA 1KWOB 1IQ5A 2KAVA 1QX7A 3QMEA 1UUSA 1ORGA 2CXJA 3OX6A 3IVTA 4ETOA 3F45A 2P6BB 4INWA 1SCMC 2L51A 2QDIA 1SR6C 1B8LA 3TS5C 2LVVA 1IH0A 4CLNA 1S6CA 1NPQA 2MAZA 1A29A 2PYQA 1PK0D 3TDZA 2GV5A 5D7FA 4Q04A 2OS8B 5CSNA 2B1UA 1BOCA 1CFPA 5KU1A 3DD4A 2KPHA 2JT0A 1JWDA 1XFXO 2CNPA 2GTEA 2BBMA 1J7OA 1CLBA 4OV2A 1WRLA 1R2UA 1A2XA 5BPJA 4PALA 1WDCB 3CDNA 1LA0A 3EVVA 1Y1UA 4DRWA 5HLVA 1HQVA 5F6TA 1F4QA 3B86A 2KI6D 3S0AA 2KOTA 4L9MA 2LHLA 2M1UA 3Q8IA 4N5XA 3SG4A 1BU3A 4AQIA 2HQWA 3DF0B 1P28A 1OMDA 2CT9A 2ZN9A 3SJSA 4CPVA 3QRXA 1M46A 3NSOA 2F2OA 2MA2A 2H2KA 3CZ0A 3SIAA 2LMVA 4D1EA 1JFJA 2L5XB 1BR4B 3BXKA 1QXPA 1TUJA 2BCAA 3L47A 1L2OC 2PALA 3D74A 1IIOA 3O4XA 3EKJA 1ZUZA 3I5FB 4I5NB 3D75A 1OZOA 3FWBA 3N7HA 1MUXA 5HKZA 2JT3A 5DICA 1BJFA 2KSPA 3OX5A 1XFVO 2F3YA 1S3PA 1IRJA 1QASA 2K7BA 1DJHA 3NHIA 4WQ3A 2M29A 2I7AA 1Z4HA 1N65A 1X02A 4DS7A 1C7VA 2WORA 3D0YB 1SR6B 3PN7B 3VRRA 3TS5B 3UO9A 1AP4A 1J1DA 3CZTX 2WOSA 1QIWA 3S0FA 1CFFA 3BFBA 2OTGC 3FS7A 3CR4X 1EG3A 1K8UA 1YUTA 2JTTA 3DVJA 2H8VA 4HREE 1XK4A 2LC5A 4GGFC 1XFYO 2LVIA 4NQGA 1J1EA 1YVHA 3DF0A 1Y6WA 1D1OA 1QV0A 3PLFB 2QEBA 4CFQA 3CTNA 1TNPA 1B4CA 1FI6A 1TNXA 2KDHA 4INXA 1SL7A 5GQQC 3CLNA 4PHMA 3EKHA 2KYCA 3SS4A 1DJIA 3GK1A 3HX4A 2Q91A 4PE0A 3FWCA 1NUBA 1JC2A 1IG5A 3R1PA 2DOQA 2FCEA 4YGAA 2K60A 3ZNIA 3NSLA 1JBAA 2KLEA 1SW8A 4YGCB 3CGAA 5HKYA 1ZOTB 1YTZC 1ODBA 1U5IB 2R2IA 2E6WA 4MN0A 4PE4A 1N2DA 4QJ3B 4N1FA 1SKTA 2QEHA 1UHNA 3D0YA 1E8AA 3AAKA 2G2BA 1EG4A 1L2OB 1IWQA 1MHOA 2LUXA 1ALVA 3BYAA 2ZNDA 3EG5B 1F4OA 3D78A 2D8NA 4P5OE 2ZN8A 1K95A 2WCBA 3EVRA 5EL2A 2PSRA 3E3RA 5FI7A 1GGZA 2GGMA 1FBVA 2LVKA 4GNKB 1CDMA 2WCMA 1TOPA 3CZ1A 3DYEA 1F54A 1WRKA 2M0RA 3VROA 1BF5A 4UPGA 2KFFA
chains in the Genus database with same CATH topology
1GJYA 2K61A 3GOFA 2SCPA 4GUKA 4YI9A 2KI4C 1OSAA 1AUIB 1DT7B 3NSIA 3LL8B 3MSEB 2JU0A 3GK4X 1M31A 2SASA 4AQJA 1MXLC 4PE1A 4MVFA 1NX2A 2L0PA 2TN4A 4MEWA 4GFTA 2NCPA 2OTGB 1DJWA 1KK8C 4PE7A 4A4BA 5DKRA 3CR5X 3O4YA 3DVMA 1Y1XA 4C0KA 1H4BA 1J7RA 2Q4UA 3BUMB 4IL1A 1BMOA 2LAPA 1U5IA 2KBIA 2K7CA 1K2HA 3A4UB 3VRPA 5DKNA 4CIDA 5I8NA 2LLTA 2NLNA 4YGDB 1UHJA 1RWYA 1C7WA 2LHIA 4OCIA 1PSBA 4YGBB 2AUCA 1CM1A 1DGUA 1YR5A 4M2PA 3VRNA 3O6BA 4HSZA 3CS1A 1DF0A 1UHIA 1JUOA 1SL8A 1DVIA 1WRZA 2NXQA 5D69A 5ER5A 1OMRA 2JULA 2QPTA 2ZRSA 4QJ5B 1RJVA 1TNQA 3LLEA 1NWDA 2MJWB 1CFDA 4GPLB 3WHUB 2QACA 1IJ5A 1W7JB 2LMTA 1BODA 1F71A 4PHNA 4WRIA 1NX3A 1YVLA 3PSRA 2JXCA 2AMIA 4TNCA 2WCEA 2K7OA 2LLSA 4JQ0D 3JTDC 4DCKA 1K9PA 2BBNA 3O78A 2KFHA 1PVAA 2BL0C 2H61A 1G33A 5AFPA 2LANA 4E68A 1CFCA 1RROA 2V53A 1KK8B 2KGRA 1XO5A 1SY9A 3JVTC 5CSIA 5B8IB 1F8HA 1V1FA 1NIWA 2L50A 3OP0A 2M3WA 2KQ6A 5CPVA 2JRFA 2LNKA 2ZKMX 4GGNA 2LM5A 3SG2A 2O5GA 4YI8A 1IQ3A 1NCYA 2L98A 1PALA 3C1VA 1OMVA 1OQPA 1S5GY 1QIVA 2A4JA 1TIZA 3KHEA 3VGOA 4DIRA 1SCMB 3I5HC 1BT6A 4MZLA 1EL4A 1KQVA 1MR8A 4BY4A 2LV7A 3WNXB 1YX8A 3CWGA 3SG3A 3TDUA 2JC2A 1UP5A 3ICBA 3VRQA 3AKBA 1B7TY 3NSKA 1NCZA 2CCMA 4MSPA 1CLMA 3I5IC 5HYDA 1PULA 1DJXA 1A75B 5HKWA 4USLA 2VRGA 4M2QA 1A03A 4MLWA 4ZCVA 5JOLA 4PDZA 4MRXA 1KFXL 1OOJA 4WQ2A 1DTLA 1S1EA 4MZJA 4I5KA 5KTYA 1MF8B 4ORAB 4ZCUA 1Q80A 4DUQA 1KCYA 4JWQA 1DMOA 2PVBA 1H8BA 4NDBA 3JTDB 1QLSA 1XFWO 2M8UA 2K0JA 1QV1A 3D10A 4YBHB 2BL0B 2JOJA 1FI5A 2BE4A 1CTRA 2FCDA 3BUOB 1LINA 1SBJA 1AHRA 1JF2A 2IS9A 3PFVA 5AEQA 1J7PA 2PASA 1KSMA 1B9AA 1DJGA 4R1EA 1KWOC 3DVKA 2AAOA 2LMUA 3KPXA 1DGVA 1KFXS 1M63B 3JVTB 4MZKA 1MQ1A 1CB1A 4I5LB 1S26D 2GGZA 5ER4X 4N1GA 5AANA 1TNWA 2Y4QA 1QX5B 2KI6C 4OKHA 2K2AA 2JT8A 2JNXA 1A75A 5I2LA 1CMFA 1SPYA 1YURA 2KYFA 3LCPC 1FW4A 2KQYA 3BUWB 2K7DA 3I5HB 5PALA 1LVCD 2LP3A 5CSFA 1CM4A 1CKKA 3KF9A 1QX2A 1ALWA 5HLOA 1SCVA 3HCMA 4XJKB 1XYDA 1QATA 1Y1AA 2L2EA 3I5IB 1IGVA 1Y0VH 2MRDA 2G9BA 1GGWA 1MXEA 1YX7A 1JSAA 1XVJA 4YGEB 3EK8A 1XK4C 4MRYA 2KBMA 4GBAA 1DJZA 1K93D 1S5GZ 2I18A 3OB1B 4MBEA 4JPZB 4FQOA 5J3XA 2E30A 4NDDA 1J55A 2M7NA 2HQ8A 1S6JA 1TTXA 1GQMA 2FOTA 4I5JA 3NXAA 2JWWA 1KK7Y 2O60A 2EHBA 4F0ZB 1QS7A 4C0JA 2JPTA 1PSRA 1YUUA 5CSJA 1BLQA 1PVBA 4FTGA 1KFUL 1N0YA 1CDLA 1JFKA 1NYAA 1W7IB 3KO0A 1CDPA 2CTNA 4XJKA 1NX0A 3GK2A 3PN7C 1F70A 4OR9B 4GGFA 2Y5IA 2M97A 1SL9A 4NDCA 3PM8A 4U8DA 2KI4B 1OZSA 2BKIB 1S6IA 2HPSA 2LUCA 2F2PA 1F55A 1SNLA 2ZNEA 3TZ1A 2KGBC 1A4PA 1KFUS 2BCBA 3SIBA 2LLUA 3A8RA 3LK1A 1TCFA 4CFRA 1TN4A 1UHHA 2MBXA 3RM1A 1QVIY 4HRHA 1CNPA 2F33A 1CDNA 1BR1B 1B47A 5KSZA 3M0WA 5DKQA 2LCPA 3I5GC 2BE6A 2LP2A 1K96A 1CMGA 1L7ZA 2M1KB 5G08A 1QLKA 2BECA 1XFZO 2ZRTA 5TNCA 1OE9B 2KAXA 1K9KA 2F8PA 2KAYA 5AXIA 1FF1A 1G8IA 1S36A 1B8RA 3SG7A 2MHHA 1VRKA 3KEVA 1J7QA 1RK9A 3WXAA 2MLEC 3SG5A 4PHKA 1MWNA 1RFJA 3FIAA 3H4SE 2NCOA 3CR2A 1SYMA 3RLZA 5I2QA 5JJGA 1YUSA 2Y1MA 1KQMC 1B1GA 1WLZA 1AVSA 3TDIA 3TUYC 3K21A 1NP8A 1V1GA 1YRTB 1K94A 2K2FA 1ZACA 2BKHB 2LE9B 1HT9A 1M45A 2KFGA 2F3ZA 2LVJA 1EJ3A 1KK7Z 5IBWA 2EC6C 1WY9A 3IQQA 2EGDA 1NSHA 1ZFSA 4ORCB 2JXLA 2NZ0A 4ICBA 2I2RE 1KSOA 2H61C 1WLMA 1PRWA 1IKUA 1AJ4A 2WCFA 1R6PA 2JTZA 2JNFA 3IF7A 4ORBB 1UURA 1C07A 3BUNB 1AJ5A 1YRUB 4HRGA 3I5GB 1UHKA 2RGIA 1QJTA 2PMYA 3BOWB 1RTP1 2HF5A 1NX1A 2OS8C 1XFUO 3OB2B 2I94A 2KNEA 2M9GA 2ZFDA 1EXRA 1B8CA 3BUXB 1AK8A 1DJYA 1CLLA 2WC8A 1IJ6A 2ISDA 4A4CA 3PALA 4M2OA 1WDCC 2CBLA 1K90D 3BQ3A 2WNDA 2KHNA 1XA5A 2K8MB 3PATA 2L4HA 4P2YB 4YRUA 1ZMZA 1QVIZ 1LXFC 1FPWA 1NCXA 2M49B 1RECA 1M39A 3AAJA 3EK4A 3IQOA 5K89A 5AERA 5FYXA 2PRUA 2OPOA 3O2PA 2MLFC 3WHTB 1EH2A 1DF0B 1SRAA 2BCXA 1LA3A 3SG6A 1K9UA 1KQMB 2Y1NA 4XYNA 1UWOA 1LKJA 3OHMB 1SK6D 4PHJA 3TUYB 3ZWHA 5I2OA 1SMGA 1G4YR 4C0LA 3DVEA 2HETA 4OVNF 1JF0A 1QTXA 2COLB 4PCWA 4GAOA 1TRFA 3I5FC 4QJ4B 2JQ6A 3EVUA 1TCOB 2JZIA 3EK7A 1B7TZ 2FJUB 3BOWA 3AKAA 2EC6B 3LK0A 2L4IA 4BY5A 2M7LA 1KWOB 1IQ5A 2KAVA 1QX7A 1UUSA 2CXJA 4ETOA 3OX6A 3F45A 2P6BB 1SCMC 2L51A 1SR6C 1B8LA 3TS5C 2LVVA 1IH0A 4CLNA 1S6CA 1NPQA 2MAZA 1A29A 1PK0D 3TDZA 2GV5A 5D7FA 4Q04A 2OS8B 5CSNA 2B1UA 1BOCA 1CFPA 5KU1A 3DD4A 2JT0A 1JWDA 1XFXO 2CNPA 2BBMA 1J7OA 1CLBA 4OV2A 1WRLA 1R2UA 1A2XA 5BPJA 4PALA 1WDCB 1LA0A 3EVVA 1Y1UA 4DRWA 5HLVA 1HQVA 5F6TA 1F4QA 2KI6D 2KOTA 4L9MA 2LHLA 2M1UA 4N5XA 3SG4A 4AQIA 1BU3A 2HQWA 3DF0B 1OMDA 2CT9A 2ZN9A 3SJSA 4CPVA 3QRXA 1M46A 3NSOA 2F2OA 2MA2A 2H2KA 3SIAA 4D1EA 2LMVA 1JFJA 2L5XB 1BR4B 3BXKA 1QXPA 2BCAA 1L2OC 2PALA 3EKJA 1ZUZA 3I5FB 4I5NB 1OZOA 3FWBA 1MUXA 5HKZA 2JT3A 1BJFA 2KSPA 3OX5A 1XFVO 2F3YA 1S3PA 1IRJA 1QASA 2K7BA 1DJHA 4WQ3A 2M29A 2I7AA 1N65A 1X02A 4DS7A 1C7VA 2WORA 3D0YB 1SR6B 3PN7B 3VRRA 3TS5B 1AP4A 1J1DA 3CZTX 2WOSA 1QIWA 1CFFA 2OTGC 3FS7A 3CR4X 1EG3A 1K8UA 1YUTA 2JTTA 3DVJA 4HREE 1XK4A 2LC5A 4GGFC 1XFYO 2LVIA 4NQGA 1J1EA 1YVHA 3DF0A 1Y6WA 1D1OA 1QV0A 3PLFB 4CFQA 3CTNA 1TNPA 1B4CA 1FI6A 1TNXA 2KDHA 1SL7A 5GQQC 3CLNA 4PHMA 3EKHA 2KYCA 1DJIA 3GK1A 3HX4A 2Q91A 4PE0A 3FWCA 1NUBA 1JC2A 1IG5A 2DOQA 2FCEA 4YGAA 3ZNIA 3NSLA 1JBAA 1SW8A 4YGCB 3CGAA 5HKYA 1ZOTB 1YTZC 1ODBA 1U5IB 2R2IA 2E6WA 4MN0A 4PE4A 1N2DA 4QJ3B 4N1FA 1SKTA 1UHNA 3D0YA 1E8AA 3AAKA 2G2BA 1EG4A 1L2OB 1IWQA 1MHOA 2LUXA 1ALVA 3BYAA 2ZNDA 1BG1A 1F4OA 4P5OE 2D8NA 4AOMA 2ZN8A 1K95A 2WCBA 3EVRA 2PSRA 3E3RA 1GGZA 2GGMA 1FBVA 2LVKA 4GNKB 1CDMA 1TOPA 1F54A 1WRKA 2M0RA 3VROA 1BF5A 4UPGA 2KFFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GJY A;  2K61 A;  3GOF A;  2SCP A;  4GUK A;  4YI9 A;  2KI4 C;  1OSA A;  1AUI B;  1DT7 B;  3NSI A;  3LL8 B;  3MSE B;  2JU0 A;  3GK4 X;  1M31 A;  2SAS A;  4AQJ A;  1MXL C;  4PE1 A;  4MVF A;  1NX2 A;  2L0P A;  2TN4 A;  4MEW A;  4GFT A;  2NCP A;  2OTG B;  1DJW A;  1KK8 C;  4PE7 A;  4A4B A;  5DKR A;  3CR5 X;  3O4Y A;  3DVM A;  1Y1X A;  4C0K A;  1H4B A;  1J7R A;  2Q4U A;  3BUM B;  4IL1 A;  1BMO A;  2LAP A;  1U5I A;  2KBI A;  2K7C A;  1K2H A;  3A4U B;  3VRP A;  5DKN A;  4CID A;  5I8N A;  2LLT A;  2NLN A;  4YGD B;  1UHJ A;  1RWY A;  1C7W A;  2LHI A;  4OCI A;  1PSB A;  4YGB B;  2AUC A;  1CM1 A;  1DGU A;  1YR5 A;  4M2P A;  3VRN A;  3O6B A;  4HSZ A;  3CS1 A;  1DF0 A;  1UHI A;  1JUO A;  1SL8 A;  1DVI A;  1WRZ A;  2NXQ A;  5D69 A;  5ER5 A;  1OMR A;  2JUL A;  2QPT A;  2ZRS A;  4QJ5 B;  1RJV A;  1TNQ A;  3LLE A;  1NWD A;  2MJW B;  1CFD A;  4GPL B;  3WHU B;  2QAC A;  1IJ5 A;  1W7J B;  2LMT A;  1BOD A;  1F71 A;  4PHN A;  4WRI A;  1NX3 A;  1YVL A;  3PSR A;  2JXC A;  2AMI A;  4TNC A;  2WCE A;  2K7O A;  2LLS A;  4JQ0 D;  3JTD C;  4DCK A;  1K9P A;  2BBN A;  3O78 A;  2KFH A;  1PVA A;  2BL0 C;  2H61 A;  1G33 A;  5AFP A;  2LAN A;  4E68 A;  1CFC A;  1RRO A;  2V53 A;  1KK8 B;  2KGR A;  1XO5 A;  1SY9 A;  3JVT C;  5CSI A;  5B8I B;  1F8H A;  1V1F A;  1NIW A;  2L50 A;  3OP0 A;  2M3W A;  2KQ6 A;  5CPV A;  2JRF A;  2LNK A;  2ZKM X;  4GGN A;  2LM5 A;  3SG2 A;  2O5G A;  4YI8 A;  1IQ3 A;  1NCY A;  2L98 A;  1PAL A;  3C1V A;  1OMV A;  1OQP A;  1S5G Y;  1QIV A;  2A4J A;  1TIZ A;  3KHE A;  3VGO A;  4DIR A;  1SCM B;  3I5H C;  1BT6 A;  4MZL A;  1EL4 A;  1KQV A;  1MR8 A;  4BY4 A;  2LV7 A;  3WNX B;  1YX8 A;  3CWG A;  3SG3 A;  3TDU A;  2JC2 A;  1UP5 A;  3ICB A;  3VRQ A;  3AKB A;  1B7T Y;  3NSK A;  1NCZ A;  2CCM A;  4MSP A;  1CLM A;  3I5I C;  5HYD A;  1PUL A;  1DJX A;  1A75 B;  5HKW A;  4USL A;  2VRG A;  4M2Q A;  1A03 A;  4MLW A;  4ZCV A;  5JOL A;  4PDZ A;  4MRX A;  1KFX L;  1OOJ A;  4WQ2 A;  1DTL A;  1S1E A;  4MZJ A;  4I5K A;  5KTY A;  1MF8 B;  4ORA B;  4ZCU A;  1Q80 A;  4DUQ A;  1KCY A;  4JWQ A;  1DMO A;  2PVB A;  1H8B A;  4NDB A;  3JTD B;  1QLS A;  1XFW O;  2M8U A;  2K0J A;  1QV1 A;  3D10 A;  4YBH B;  2BL0 B;  2JOJ A;  1FI5 A;  2BE4 A;  1CTR A;  2FCD A;  3BUO B;  1LIN A;  1SBJ A;  1AHR A;  1JF2 A;  2IS9 A;  3PFV A;  5AEQ A;  1J7P A;  2PAS A;  1KSM A;  1B9A A;  1DJG A;  4R1E A;  1KWO C;  3DVK A;  2AAO A;  2LMU A;  3KPX A;  1DGV A;  1KFX S;  1M63 B;  3JVT B;  4MZK A;  1MQ1 A;  1CB1 A;  4I5L B;  1S26 D;  2GGZ A;  5ER4 X;  4N1G A;  5AAN A;  1TNW A;  2Y4Q A;  1QX5 B;  2KI6 C;  4OKH A;  2K2A A;  2JT8 A;  2JNX A;  1A75 A;  5I2L A;  1CMF A;  1SPY A;  1YUR A;  2KYF A;  3LCP C;  1FW4 A;  2KQY A;  3BUW B;  2K7D A;  3I5H B;  5PAL A;  1LVC D;  2LP3 A;  5CSF A;  1CM4 A;  1CKK A;  3KF9 A;  1QX2 A;  1ALW A;  5HLO A;  1SCV A;  3HCM A;  4XJK B;  1XYD A;  1QAT A;  1Y1A A;  2L2E A;  3I5I B;  1IGV A;  1Y0V H;  2MRD A;  2G9B A;  1GGW A;  1MXE A;  1YX7 A;  1JSA A;  1XVJ A;  4YGE B;  3EK8 A;  1XK4 C;  4MRY A;  2KBM A;  4GBA A;  1DJZ A;  1K93 D;  1S5G Z;  2I18 A;  3OB1 B;  4MBE A;  4JPZ B;  4FQO A;  5J3X A;  2E30 A;  4NDD A;  1J55 A;  2M7N A;  2HQ8 A;  1S6J A;  1TTX A;  1GQM A;  2FOT A;  4I5J A;  3NXA A;  2JWW A;  1KK7 Y;  2O60 A;  2EHB A;  4F0Z B;  1QS7 A;  4C0J A;  2JPT A;  1PSR A;  1YUU A;  5CSJ A;  1BLQ A;  1PVB A;  4FTG A;  1KFU L;  1N0Y A;  1CDL A;  1JFK A;  1NYA A;  1W7I B;  3KO0 A;  1CDP A;  2CTN A;  4XJK A;  1NX0 A;  3GK2 A;  3PN7 C;  1F70 A;  4OR9 B;  4GGF A;  2Y5I A;  2M97 A;  1SL9 A;  4NDC A;  3PM8 A;  4U8D A;  2KI4 B;  1OZS A;  2BKI B;  1S6I A;  2HPS A;  2LUC A;  2F2P A;  1F55 A;  1SNL A;  2ZNE A;  3TZ1 A;  2KGB C;  1A4P A;  1KFU S;  2BCB A;  3SIB A;  2LLU A;  3A8R A;  3LK1 A;  1TCF A;  4CFR A;  1TN4 A;  1UHH A;  2MBX A;  3RM1 A;  1QVI Y;  4HRH A;  1CNP A;  2F33 A;  1CDN A;  1BR1 B;  1B47 A;  5KSZ A;  3M0W A;  5DKQ A;  2LCP A;  3I5G C;  2BE6 A;  2LP2 A;  1K96 A;  1CMG A;  1L7Z A;  2M1K B;  5G08 A;  1QLK A;  2BEC A;  1XFZ O;  2ZRT A;  5TNC A;  1OE9 B;  2KAX A;  1K9K A;  2F8P A;  2KAY A;  5AXI A;  1FF1 A;  1G8I A;  1S36 A;  1B8R A;  3SG7 A;  2MHH A;  1VRK A;  3KEV A;  1J7Q A;  1RK9 A;  3WXA A;  2MLE C;  3SG5 A;  4PHK A;  1MWN A;  1RFJ A;  3FIA A;  3H4S E;  2NCO A;  3CR2 A;  1SYM A;  3RLZ A;  5I2Q A;  5JJG A;  1YUS A;  2Y1M A;  1KQM C;  1B1G A;  1WLZ A;  1AVS A;  3TDI A;  3TUY C;  3K21 A;  1NP8 A;  1V1G A;  1YRT B;  1K94 A;  2K2F A;  1ZAC A;  2BKH B;  2LE9 B;  1HT9 A;  1M45 A;  2KFG A;  2F3Z A;  2LVJ A;  1EJ3 A;  1KK7 Z;  5IBW A;  2EC6 C;  1WY9 A;  3IQQ A;  2EGD A;  1NSH A;  1ZFS A;  4ORC B;  2JXL A;  2NZ0 A;  4ICB A;  2I2R E;  1KSO A;  2H61 C;  1WLM A;  1PRW A;  1IKU A;  1AJ4 A;  2WCF A;  1R6P A;  2JTZ A;  2JNF A;  3IF7 A;  4ORB B;  1UUR A;  1C07 A;  3BUN B;  1AJ5 A;  1YRU B;  4HRG A;  3I5G B;  1UHK A;  2RGI A;  1QJT A;  2PMY A;  3BOW B;  1RTP 1;  2HF5 A;  1NX1 A;  2OS8 C;  1XFU O;  3OB2 B;  2I94 A;  2KNE A;  2M9G A;  2ZFD A;  1EXR A;  1B8C A;  3BUX B;  1AK8 A;  1DJY A;  1CLL A;  2WC8 A;  1IJ6 A;  2ISD A;  4A4C A;  3PAL A;  4M2O A;  1WDC C;  2CBL A;  1K90 D;  3BQ3 A;  2WND A;  2KHN A;  1XA5 A;  2K8M B;  3PAT A;  2L4H A;  4P2Y B;  4YRU A;  1ZMZ A;  1QVI Z;  1LXF C;  1FPW A;  1NCX A;  2M49 B;  1REC A;  1M39 A;  3AAJ A;  3EK4 A;  3IQO A;  5K89 A;  5AER A;  5FYX A;  2PRU A;  2OPO A;  3O2P A;  2MLF C;  3WHT B;  1EH2 A;  1DF0 B;  1SRA A;  2BCX A;  1LA3 A;  3SG6 A;  1K9U A;  1KQM B;  2Y1N A;  4XYN A;  1UWO A;  1LKJ A;  3OHM B;  1SK6 D;  4PHJ A;  3TUY B;  3ZWH A;  5I2O A;  1SMG A;  1G4Y R;  4C0L A;  3DVE A;  2HET A;  4OVN F;  1JF0 A;  1QTX A;  2COL B;  4PCW A;  4GAO A;  1TRF A;  3I5F C;  4QJ4 B;  2JQ6 A;  3EVU A;  1TCO B;  2JZI A;  3EK7 A;  1B7T Z;  2FJU B;  3BOW A;  3AKA A;  2EC6 B;  3LK0 A;  2L4I A;  4BY5 A;  2M7L A;  1KWO B;  1IQ5 A;  2KAV A;  1QX7 A;  1UUS A;  2CXJ A;  4ETO A;  3OX6 A;  3F45 A;  2P6B B;  1SCM C;  2L51 A;  1SR6 C;  1B8L A;  3TS5 C;  2LVV A;  1IH0 A;  4CLN A;  1S6C A;  1NPQ A;  2MAZ A;  1A29 A;  1PK0 D;  3TDZ A;  2GV5 A;  5D7F A;  4Q04 A;  2OS8 B;  5CSN A;  2B1U A;  1BOC A;  1CFP A;  5KU1 A;  3DD4 A;  2JT0 A;  1JWD A;  1XFX O;  2CNP A;  2BBM A;  1J7O A;  1CLB A;  4OV2 A;  1WRL A;  1R2U A;  1A2X A;  5BPJ A;  4PAL A;  1WDC B;  1LA0 A;  3EVV A;  1Y1U A;  4DRW A;  5HLV A;  1HQV A;  5F6T A;  1F4Q A;  2KI6 D;  2KOT A;  4L9M A;  2LHL A;  2M1U A;  4N5X A;  3SG4 A;  4AQI A;  1BU3 A;  2HQW A;  3DF0 B;  1OMD A;  2CT9 A;  2ZN9 A;  3SJS A;  4CPV A;  3QRX A;  1M46 A;  3NSO A;  2F2O A;  2MA2 A;  2H2K A;  3SIA A;  4D1E A;  2LMV A;  1JFJ A;  2L5X B;  1BR4 B;  3BXK A;  1QXP A;  2BCA A;  1L2O C;  2PAL A;  3EKJ A;  1ZUZ A;  3I5F B;  4I5N B;  1OZO A;  3FWB A;  1MUX A;  5HKZ A;  2JT3 A;  1BJF A;  2KSP A;  3OX5 A;  1XFV O;  2F3Y A;  1S3P A;  1IRJ A;  1QAS A;  2K7B A;  1DJH A;  4WQ3 A;  2M29 A;  2I7A A;  1N65 A;  1X02 A;  4DS7 A;  1C7V A;  2WOR A;  3D0Y B;  1SR6 B;  3PN7 B;  3VRR A;  3TS5 B;  1AP4 A;  1J1D A;  3CZT X;  2WOS A;  1QIW A;  1CFF A;  2OTG C;  3FS7 A;  3CR4 X;  1EG3 A;  1K8U A;  1YUT A;  2JTT A;  3DVJ A;  4HRE E;  1XK4 A;  2LC5 A;  4GGF C;  1XFY O;  2LVI A;  4NQG A;  1J1E A;  1YVH A;  3DF0 A;  1Y6W A;  1D1O A;  1QV0 A;  3PLF B;  4CFQ A;  3CTN A;  1TNP A;  1B4C A;  1FI6 A;  1TNX A;  2KDH A;  1SL7 A;  5GQQ C;  3CLN A;  4PHM A;  3EKH A;  2KYC A;  1DJI A;  3GK1 A;  3HX4 A;  2Q91 A;  4PE0 A;  3FWC A;  1NUB A;  1JC2 A;  1IG5 A;  2DOQ A;  2FCE A;  4YGA A;  3ZNI A;  3NSL A;  1JBA A;  1SW8 A;  4YGC B;  3CGA A;  5HKY A;  1ZOT B;  1YTZ C;  1ODB A;  1U5I B;  2R2I A;  2E6W A;  4MN0 A;  4PE4 A;  1N2D A;  4QJ3 B;  4N1F A;  1SKT A;  1UHN A;  3D0Y A;  1E8A A;  3AAK A;  2G2B A;  1EG4 A;  1L2O B;  1IWQ A;  1MHO A;  2LUX A;  1ALV A;  3BYA A;  2ZND A;  1BG1 A;  1F4O A;  4P5O E;  2D8N A;  4AOM A;  2ZN8 A;  1K95 A;  2WCB A;  3EVR A;  2PSR A;  3E3R A;  1GGZ A;  2GGM A;  1FBV A;  2LVK A;  4GNK B;  1CDM A;  1TOP A;  1F54 A;  1WRK A;  2M0R A;  3VRO A;  1BF5 A;  4UPG A;  2KFF A; 
#chains in the Genus database with same CATH topology
 1GJY A;  2K61 A;  3GOF A;  2SCP A;  4GUK A;  4YI9 A;  2KI4 C;  1OSA A;  2P70 A;  3D77 A;  1AUI B;  3S0G A;  1DT7 B;  3NSI A;  3LL8 B;  3MSE B;  2QEV A;  2JU0 A;  3GK4 X;  1M31 A;  2SAS A;  4AQJ A;  3BFA A;  1MXL C;  4PE1 A;  4MVF A;  1NX2 A;  2L0P A;  2TN4 A;  4MEW A;  4GFT A;  2NCP A;  2OTG B;  1DJW A;  1XFR A;  1KK8 C;  4PE7 A;  4A4B A;  5DKR A;  3CR5 X;  3O4Y A;  3DVM A;  1Y1X A;  4C0K A;  1H4B A;  1J7R A;  2Q4U A;  3BUM B;  4IL1 A;  1BMO A;  2LAP A;  1U5I A;  2KBI A;  4F7F A;  3FE8 A;  2K7C A;  1K2H A;  3A4U B;  3VRP A;  5DKN A;  4CID A;  5I8N A;  2LLT A;  2NLN A;  4YGD B;  3DY9 A;  1UHJ A;  1RWY A;  1C7W A;  2LHI A;  4OCI A;  3S0D A;  1PSB A;  2WCH A;  4YGB B;  2AUC A;  1CM1 A;  1DGU A;  1YR5 A;  4M2P A;  3VRN A;  3O6B A;  4HSZ A;  2FJY A;  3CS1 A;  1DF0 A;  1UHI A;  1JUO A;  1SL8 A;  1DVI A;  1WRZ A;  2NXQ A;  5D69 A;  5ER5 A;  1OMR A;  2JUL A;  2QPT A;  2ZRS A;  4QJ5 B;  1RJV A;  1TNQ A;  3LLE A;  1NWD A;  2MJW B;  1CFD A;  4GPL B;  3WHU B;  2QAC A;  2ERB A;  1IJ5 A;  1W7J B;  2LMT A;  1BOD A;  1F71 A;  4PHN A;  4WRI A;  1BG1 A;  1NX3 A;  1YVL A;  3PSR A;  2JXC A;  2AMI A;  4TNC A;  2WCE A;  2K7O A;  2LLS A;  4JQ0 D;  3JTD C;  4DCK A;  1K9P A;  2BBN A;  3O78 A;  3DZT A;  2KFH A;  1PVA A;  2BL0 C;  2H61 A;  1G33 A;  5AFP A;  2LAN A;  4E68 A;  1DC1 A;  1CFC A;  1RRO A;  2V53 A;  1KK8 B;  2KGR A;  1XO5 A;  1SY9 A;  3JVT C;  5CSI A;  5B8I B;  1F8H A;  1V1F A;  1NIW A;  2L50 A;  3OP0 A;  2M3W A;  2JPO A;  2KQ6 A;  2JRF A;  2LNK A;  2ZKM X;  4GGN A;  2LM5 A;  5CPV A;  3SG2 A;  2O5G A;  4YI8 A;  1IQ3 A;  1NCY A;  2L98 A;  1PAL A;  3C1V A;  1OMV A;  1OQP A;  3K1E A;  1S5G Y;  1QIV A;  2A4J A;  1TIZ A;  3KHE A;  3VGO A;  4DIR A;  1SCM B;  3BFH A;  3I5H C;  1BT6 A;  4MZL A;  1EL4 A;  1KQV A;  1MR8 A;  4BY4 A;  2LV7 A;  3WNX B;  2YGU A;  1YX8 A;  3CWG A;  3SG3 A;  3TDU A;  2JC2 A;  1UP5 A;  3ICB A;  3VRQ A;  3AKB A;  1B7T Y;  3NSK A;  1NCZ A;  2CCM A;  4MSP A;  1CLM A;  3I5I C;  5HYD A;  1PUL A;  1DJX A;  1A75 B;  5HKW A;  4USL A;  2VRG A;  4M2Q A;  1A03 A;  4MLW A;  4ZCV A;  5JOL A;  4PDZ A;  4MRX A;  1KFX L;  1OOJ A;  4WQ2 A;  5FI6 A;  1DTL A;  1S1E A;  5HL1 A;  4MZJ A;  4I5K A;  5KTY A;  1MF8 B;  4ORA B;  4ZCU A;  1Q80 A;  4DUQ A;  1KCY A;  4JWQ A;  1DEK A;  1DMO A;  2PVB A;  1OOG A;  2BAP A;  1H8B A;  4NDB A;  3JTD B;  1QLS A;  1XFW O;  1OOI X;  2M8U A;  2K0J A;  1QV1 A;  3D10 A;  4YBH B;  2BL0 B;  2JOJ A;  1FI5 A;  2BE4 A;  1CTR A;  2FCD A;  3BUO B;  1LIN A;  1SBJ A;  1AHR A;  1JF2 A;  1QWV A;  2IS9 A;  3PFV A;  5AEQ A;  2PAS A;  1KSM A;  1J7P A;  1B9A A;  1DJG A;  2QEO A;  4R1E A;  1KWO C;  3DVK A;  2AAO A;  2LMU A;  3KPX A;  1DGV A;  1KFX S;  1M63 B;  3JVT B;  4MZK A;  5I94 A;  1MQ1 A;  1CB1 A;  4I5L B;  1S26 D;  2GGZ A;  5ER4 X;  4N1G A;  5AAN A;  1TNW A;  2Y4Q A;  1QX5 B;  2KI6 C;  4OKH A;  2K2A A;  2JT8 A;  2JNX A;  1A75 A;  5I2L A;  1CMF A;  1SPY A;  1YUR A;  2KYF A;  3LCP C;  1FW4 A;  2KQY A;  1OW4 A;  3BUW B;  2K7D A;  3I5H B;  5PAL A;  1LVC D;  2L5Y A;  2LP3 A;  5CSF A;  1CM4 A;  1CKK A;  3KF9 A;  3S0E A;  1QX2 A;  1ALW A;  5HLO A;  1SCV A;  2WCK A;  3HCM A;  4XJK B;  1TUZ A;  1TWO A;  1XYD A;  1QAT A;  4IJ7 A;  1Y1A A;  2L2E A;  3I5I B;  1IGV A;  1Y0V H;  2MRD A;  2G9B A;  1GGW A;  1MXE A;  1YX7 A;  1JSA A;  1XVJ A;  4YGE B;  3B88 A;  3EK8 A;  1XK4 C;  4MRY A;  2KBM A;  4GBA A;  1DJZ A;  3V2L A;  1K93 D;  1S5G Z;  2I18 A;  3OB1 B;  4MBE A;  4JPZ B;  4FQO A;  5J3X A;  2E30 A;  4NDD A;  1T14 A;  1J55 A;  2M7N A;  2HQ8 A;  1S6J A;  1TTX A;  1GQM A;  2FOT A;  4I5J A;  3NXA A;  2JWW A;  3B87 A;  1KK7 Y;  2O60 A;  2EHB A;  4F0Z B;  1QS7 A;  4C0J A;  2JPT A;  1PSR A;  1YUU A;  5CSJ A;  1BLQ A;  1PVB A;  4FTG A;  1KFU L;  1N0Y A;  1CDL A;  1DEL A;  1JFK A;  4OZD A;  3S0B A;  1NYA A;  4FQT A;  2L2C A;  1W7I B;  3KO0 A;  1CDP A;  2CTN A;  3NGV A;  4XJK A;  1NX0 A;  3UNW A;  3GK2 A;  3PN7 C;  1F70 A;  4OR9 B;  4GGF A;  2Y5I A;  2M97 A;  1SL9 A;  4NDC A;  3R1O A;  3PM8 A;  4U8D A;  2KI4 B;  1OZS A;  2BKI B;  1S6I A;  2HPS A;  2LUC A;  2F2P A;  1F55 A;  1SNL A;  2ZNE A;  3TZ1 A;  2KGB C;  2PQL A;  1A4P A;  1KFU S;  2BCB A;  3SIB A;  3SS3 A;  2LLU A;  3A8R A;  3LK1 A;  4AOM A;  1TCF A;  4CFR A;  1TN4 A;  1UHH A;  2MBX A;  3RM1 A;  1QVI Y;  4HRH A;  1CNP A;  2F33 A;  1CDN A;  3D73 A;  1BR1 B;  1B47 A;  3OGN A;  5KSZ A;  3R1V A;  3M0W A;  5DKQ A;  2WC5 A;  2LCP A;  3I5G C;  2BE6 A;  2LP2 A;  1K96 A;  1CMG A;  1L7Z A;  2M1K B;  5G08 A;  1QLK A;  1GM0 A;  3R72 A;  2BEC A;  3PM2 A;  1XFZ O;  2ZRT A;  5TNC A;  4JD9 A;  1OE9 B;  2BNX A;  2KAX A;  1K9K A;  2F8P A;  2KAY A;  5AXI A;  1FF1 A;  1G8I A;  1S36 A;  1B8R A;  3SG7 A;  2MHH A;  1VRK A;  3KEV A;  1J7Q A;  1RK9 A;  3WXA A;  3EK7 A;  2MLE C;  3SG5 A;  3VB1 A;  1C3Y A;  4PHK A;  1MWN A;  1RFJ A;  3FIA A;  3CYZ A;  3H4S E;  2NCO A;  3CR2 A;  1SYM A;  2P71 A;  3NHT A;  3RLZ A;  5I2Q A;  5JJG A;  3CAB A;  1YUS A;  2Y1M A;  1KQM C;  1B1G A;  2WCL A;  1WLZ A;  1AVS A;  3TDI A;  3TUY C;  4JKT A;  3K21 A;  1W9Z A;  1NP8 A;  1SSE B;  1V1G A;  1YRT B;  1K94 A;  2K2F A;  1ZAC A;  2BKH B;  2LE9 B;  1HT9 A;  1M45 A;  2KFG A;  2F3Z A;  2LVJ A;  1EJ3 A;  1KK7 Z;  5IBW A;  3FE9 A;  1LS8 A;  3RZS A;  2EC6 C;  1WY9 A;  3IQQ A;  2EGD A;  1NSH A;  3B7A A;  1ZFS A;  3FE6 A;  3PJI A;  4ORC B;  2JXL A;  2NZ0 A;  4ICB A;  2I2R E;  1KSO A;  2H61 C;  1WLM A;  1PRW A;  1IKU A;  1AJ4 A;  2WCF A;  1R6P A;  2JTZ A;  4PT1 A;  2JNF A;  4KYN A;  3IF7 A;  4ORB B;  1UUR A;  1C07 A;  3BUN B;  1AJ5 A;  1YRU B;  4HRG A;  3L4L A;  5D3O A;  3CZ2 A;  3I5G B;  1UHK A;  2RGI A;  1QJT A;  2PMY A;  3BOW B;  1RTP 1;  2HF5 A;  1NX1 A;  2OS8 C;  1XFU O;  3OB2 B;  2I94 A;  2KNE A;  2M9G A;  2ZFD A;  1EXR A;  1B8C A;  3BUX B;  1AK8 A;  1DJY A;  1CLL A;  2WC8 A;  1IJ6 A;  2ISD A;  3D76 A;  4A4C A;  3PAL A;  2WC6 A;  4M2O A;  1WDC C;  2CBL A;  1K90 D;  3BQ3 A;  2WND A;  2KHN A;  1XA5 A;  2K8M B;  3PAT A;  2L4H A;  4P2Y B;  4YRU A;  1ZMZ A;  1QVI Z;  1LXF C;  1OOF A;  2WCJ A;  3OBV A;  1NCX A;  2M49 B;  1FPW A;  1REC A;  1DQE A;  1M39 A;  3AAJ A;  3EK4 A;  3IQO A;  3SS5 A;  5AER A;  5K89 A;  5FYX A;  2PRU A;  2OPO A;  3O2P A;  2MLF C;  3WHT B;  1EH2 A;  1DF0 B;  1SRA A;  2BCX A;  1LA3 A;  3SG6 A;  3L4A A;  1K9U A;  1KQM B;  2Y1N A;  4XYN A;  1UWO A;  3B6X A;  1LKJ A;  3OHM B;  1SK6 D;  4PHJ A;  3TUY B;  3ZWH A;  5I2O A;  1SMG A;  1G4Y R;  4C0L A;  3DVE A;  2HET A;  4OVN F;  1JF0 A;  1QTX A;  2COL B;  4PCW A;  4GAO A;  1TRF A;  3I5F C;  3BJH A;  4QJ4 B;  2JQ6 A;  3EVU A;  2KLD A;  1TCO B;  2JZI A;  3DXL A;  1B7T Z;  1C3Z A;  1OOH A;  2FJU B;  3AKA A;  2EC6 B;  3BOW A;  3LK0 A;  5FI2 A;  2L4I A;  1Z2C B;  4BY5 A;  2M7L A;  1KWO B;  1IQ5 A;  2KAV A;  1QX7 A;  3QME A;  1UUS A;  1ORG A;  2CXJ A;  3OX6 A;  3IVT A;  4ETO A;  3F45 A;  2P6B B;  4INW A;  1SCM C;  2L51 A;  2QDI A;  1SR6 C;  1B8L A;  3TS5 C;  2LVV A;  1IH0 A;  4CLN A;  1S6C A;  1NPQ A;  2MAZ A;  1A29 A;  2PYQ A;  1PK0 D;  3TDZ A;  2GV5 A;  5D7F A;  4Q04 A;  2OS8 B;  5CSN A;  2B1U A;  1BOC A;  1CFP A;  5KU1 A;  3DD4 A;  2KPH A;  2JT0 A;  1JWD A;  1XFX O;  2CNP A;  2GTE A;  2BBM A;  1J7O A;  1CLB A;  4OV2 A;  1WRL A;  1R2U A;  1A2X A;  5BPJ A;  4PAL A;  1WDC B;  3CDN A;  1LA0 A;  3EVV A;  1Y1U A;  4DRW A;  5HLV A;  1HQV A;  5F6T A;  1F4Q A;  3B86 A;  2KI6 D;  3S0A A;  2KOT A;  4L9M A;  2LHL A;  2M1U A;  3Q8I A;  4N5X A;  3SG4 A;  1BU3 A;  4AQI A;  2HQW A;  3DF0 B;  1P28 A;  1OMD A;  2CT9 A;  2ZN9 A;  3SJS A;  4CPV A;  3QRX A;  1M46 A;  3NSO A;  2F2O A;  2MA2 A;  2H2K A;  3CZ0 A;  3SIA A;  2LMV A;  4D1E A;  1JFJ A;  2L5X B;  1BR4 B;  3BXK A;  1QXP A;  1TUJ A;  2BCA A;  3L47 A;  1L2O C;  2PAL A;  3D74 A;  1IIO A;  3O4X A;  3EKJ A;  1ZUZ A;  3I5F B;  4I5N B;  3D75 A;  1OZO A;  3FWB A;  3N7H A;  1MUX A;  5HKZ A;  2JT3 A;  5DIC A;  1BJF A;  2KSP A;  3OX5 A;  1XFV O;  2F3Y A;  1S3P A;  1IRJ A;  1QAS A;  2K7B A;  1DJH A;  3NHI A;  4WQ3 A;  2M29 A;  2I7A A;  1Z4H A;  1N65 A;  1X02 A;  4DS7 A;  1C7V A;  2WOR A;  3D0Y B;  1SR6 B;  3PN7 B;  3VRR A;  3TS5 B;  3UO9 A;  1AP4 A;  1J1D A;  3CZT X;  2WOS A;  1QIW A;  3S0F A;  1CFF A;  3BFB A;  2OTG C;  3FS7 A;  3CR4 X;  1EG3 A;  1K8U A;  1YUT A;  2JTT A;  3DVJ A;  2H8V A;  4HRE E;  1XK4 A;  2LC5 A;  4GGF C;  1XFY O;  2LVI A;  4NQG A;  1J1E A;  1YVH A;  3DF0 A;  1Y6W A;  1D1O A;  1QV0 A;  3PLF B;  2QEB A;  4CFQ A;  3CTN A;  1TNP A;  1B4C A;  1FI6 A;  1TNX A;  2KDH A;  4INX A;  1SL7 A;  5GQQ C;  3CLN A;  4PHM A;  3EKH A;  2KYC A;  3SS4 A;  1DJI A;  3GK1 A;  3HX4 A;  2Q91 A;  4PE0 A;  3FWC A;  1NUB A;  1JC2 A;  1IG5 A;  3R1P A;  2DOQ A;  2FCE A;  4YGA A;  2K60 A;  3ZNI A;  3NSL A;  1JBA A;  2KLE A;  1SW8 A;  4YGC B;  3CGA A;  5HKY A;  1ZOT B;  1YTZ C;  1ODB A;  1U5I B;  2R2I A;  2E6W A;  4MN0 A;  4PE4 A;  1N2D A;  4QJ3 B;  4N1F A;  1SKT A;  2QEH A;  1UHN A;  3D0Y A;  1E8A A;  3AAK A;  2G2B A;  1EG4 A;  1L2O B;  1IWQ A;  1MHO A;  2LUX A;  1ALV A;  3BYA A;  2ZND A;  3EG5 B;  1F4O A;  3D78 A;  2D8N A;  4P5O E;  2ZN8 A;  1K95 A;  2WCB A;  3EVR A;  5EL2 A;  2PSR A;  3E3R A;  5FI7 A;  1GGZ A;  2GGM A;  1FBV A;  2LVK A;  4GNK B;  1CDM A;  2WCM A;  1TOP A;  3CZ1 A;  3DYE A;  1F54 A;  1WRK A;  2M0R A;  3VRO A;  1BF5 A;  4UPG A;  2KFF A; 
#chains in the Genus database with same CATH homology
 1GJY A;  2K61 A;  3GOF A;  2SCP A;  4GUK A;  4YI9 A;  2KI4 C;  1OSA A;  1AUI B;  1DT7 B;  3NSI A;  3LL8 B;  3MSE B;  2JU0 A;  3GK4 X;  1M31 A;  2SAS A;  4AQJ A;  1MXL C;  4PE1 A;  4MVF A;  1NX2 A;  2L0P A;  2TN4 A;  4MEW A;  4GFT A;  2NCP A;  2OTG B;  1DJW A;  1KK8 C;  4PE7 A;  4A4B A;  5DKR A;  3CR5 X;  3O4Y A;  3DVM A;  1Y1X A;  4C0K A;  1H4B A;  1J7R A;  2Q4U A;  3BUM B;  4IL1 A;  1BMO A;  2LAP A;  1U5I A;  2KBI A;  2K7C A;  1K2H A;  3A4U B;  3VRP A;  5DKN A;  4CID A;  5I8N A;  2LLT A;  2NLN A;  4YGD B;  1UHJ A;  1RWY A;  1C7W A;  2LHI A;  4OCI A;  1PSB A;  4YGB B;  2AUC A;  1CM1 A;  1DGU A;  1YR5 A;  4M2P A;  3VRN A;  3O6B A;  4HSZ A;  3CS1 A;  1DF0 A;  1UHI A;  1JUO A;  1SL8 A;  1DVI A;  1WRZ A;  2NXQ A;  5D69 A;  5ER5 A;  1OMR A;  2JUL A;  2QPT A;  2ZRS A;  4QJ5 B;  1RJV A;  1TNQ A;  3LLE A;  1NWD A;  2MJW B;  1CFD A;  4GPL B;  3WHU B;  2QAC A;  1IJ5 A;  1W7J B;  2LMT A;  1BOD A;  1F71 A;  4PHN A;  4WRI A;  1NX3 A;  1YVL A;  3PSR A;  2JXC A;  2AMI A;  4TNC A;  2WCE A;  2K7O A;  2LLS A;  4JQ0 D;  3JTD C;  4DCK A;  1K9P A;  2BBN A;  3O78 A;  2KFH A;  1PVA A;  2BL0 C;  2H61 A;  1G33 A;  5AFP A;  2LAN A;  4E68 A;  1CFC A;  1RRO A;  2V53 A;  1KK8 B;  2KGR A;  1XO5 A;  1SY9 A;  3JVT C;  5CSI A;  5B8I B;  1F8H A;  1V1F A;  1NIW A;  2L50 A;  3OP0 A;  2M3W A;  2KQ6 A;  5CPV A;  2JRF A;  2LNK A;  2ZKM X;  4GGN A;  2LM5 A;  3SG2 A;  2O5G A;  4YI8 A;  1IQ3 A;  1NCY A;  2L98 A;  1PAL A;  3C1V A;  1OMV A;  1OQP A;  1S5G Y;  1QIV A;  2A4J A;  1TIZ A;  3KHE A;  3VGO A;  4DIR A;  1SCM B;  3I5H C;  1BT6 A;  4MZL A;  1EL4 A;  1KQV A;  1MR8 A;  4BY4 A;  2LV7 A;  3WNX B;  1YX8 A;  3CWG A;  3SG3 A;  3TDU A;  2JC2 A;  1UP5 A;  3ICB A;  3VRQ A;  3AKB A;  1B7T Y;  3NSK A;  1NCZ A;  2CCM A;  4MSP A;  1CLM A;  3I5I C;  5HYD A;  1PUL A;  1DJX A;  1A75 B;  5HKW A;  4USL A;  2VRG A;  4M2Q A;  1A03 A;  4MLW A;  4ZCV A;  5JOL A;  4PDZ A;  4MRX A;  1KFX L;  1OOJ A;  4WQ2 A;  1DTL A;  1S1E A;  4MZJ A;  4I5K A;  5KTY A;  1MF8 B;  4ORA B;  4ZCU A;  1Q80 A;  4DUQ A;  1KCY A;  4JWQ A;  1DMO A;  2PVB A;  1H8B A;  4NDB A;  3JTD B;  1QLS A;  1XFW O;  2M8U A;  2K0J A;  1QV1 A;  3D10 A;  4YBH B;  2BL0 B;  2JOJ A;  1FI5 A;  2BE4 A;  1CTR A;  2FCD A;  3BUO B;  1LIN A;  1SBJ A;  1AHR A;  1JF2 A;  2IS9 A;  3PFV A;  5AEQ A;  1J7P A;  2PAS A;  1KSM A;  1B9A A;  1DJG A;  4R1E A;  1KWO C;  3DVK A;  2AAO A;  2LMU A;  3KPX A;  1DGV A;  1KFX S;  1M63 B;  3JVT B;  4MZK A;  1MQ1 A;  1CB1 A;  4I5L B;  1S26 D;  2GGZ A;  5ER4 X;  4N1G A;  5AAN A;  1TNW A;  2Y4Q A;  1QX5 B;  2KI6 C;  4OKH A;  2K2A A;  2JT8 A;  2JNX A;  1A75 A;  5I2L A;  1CMF A;  1SPY A;  1YUR A;  2KYF A;  3LCP C;  1FW4 A;  2KQY A;  3BUW B;  2K7D A;  3I5H B;  5PAL A;  1LVC D;  2LP3 A;  5CSF A;  1CM4 A;  1CKK A;  3KF9 A;  1QX2 A;  1ALW A;  5HLO A;  1SCV A;  3HCM A;  4XJK B;  1XYD A;  1QAT A;  1Y1A A;  2L2E A;  3I5I B;  1IGV A;  1Y0V H;  2MRD A;  2G9B A;  1GGW A;  1MXE A;  1YX7 A;  1JSA A;  1XVJ A;  4YGE B;  3EK8 A;  1XK4 C;  4MRY A;  2KBM A;  4GBA A;  1DJZ A;  1K93 D;  1S5G Z;  2I18 A;  3OB1 B;  4MBE A;  4JPZ B;  4FQO A;  5J3X A;  2E30 A;  4NDD A;  1J55 A;  2M7N A;  2HQ8 A;  1S6J A;  1TTX A;  1GQM A;  2FOT A;  4I5J A;  3NXA A;  2JWW A;  1KK7 Y;  2O60 A;  2EHB A;  4F0Z B;  1QS7 A;  4C0J A;  2JPT A;  1PSR A;  1YUU A;  5CSJ A;  1BLQ A;  1PVB A;  4FTG A;  1KFU L;  1N0Y A;  1CDL A;  1JFK A;  1NYA A;  1W7I B;  3KO0 A;  1CDP A;  2CTN A;  4XJK A;  1NX0 A;  3GK2 A;  3PN7 C;  1F70 A;  4OR9 B;  4GGF A;  2Y5I A;  2M97 A;  1SL9 A;  4NDC A;  3PM8 A;  4U8D A;  2KI4 B;  1OZS A;  2BKI B;  1S6I A;  2HPS A;  2LUC A;  2F2P A;  1F55 A;  1SNL A;  2ZNE A;  3TZ1 A;  2KGB C;  1A4P A;  1KFU S;  2BCB A;  3SIB A;  2LLU A;  3A8R A;  3LK1 A;  1TCF A;  4CFR A;  1TN4 A;  1UHH A;  2MBX A;  3RM1 A;  1QVI Y;  4HRH A;  1CNP A;  2F33 A;  1CDN A;  1BR1 B;  1B47 A;  5KSZ A;  3M0W A;  5DKQ A;  2LCP A;  3I5G C;  2BE6 A;  2LP2 A;  1K96 A;  1CMG A;  1L7Z A;  2M1K B;  5G08 A;  1QLK A;  2BEC A;  1XFZ O;  2ZRT A;  5TNC A;  1OE9 B;  2KAX A;  1K9K A;  2F8P A;  2KAY A;  5AXI A;  1FF1 A;  1G8I A;  1S36 A;  1B8R A;  3SG7 A;  2MHH A;  1VRK A;  3KEV A;  1J7Q A;  1RK9 A;  3WXA A;  2MLE C;  3SG5 A;  4PHK A;  1MWN A;  1RFJ A;  3FIA A;  3H4S E;  2NCO A;  3CR2 A;  1SYM A;  3RLZ A;  5I2Q A;  5JJG A;  1YUS A;  2Y1M A;  1KQM C;  1B1G A;  1WLZ A;  1AVS A;  3TDI A;  3TUY C;  3K21 A;  1NP8 A;  1V1G A;  1YRT B;  1K94 A;  2K2F A;  1ZAC A;  2BKH B;  2LE9 B;  1HT9 A;  1M45 A;  2KFG A;  2F3Z A;  2LVJ A;  1EJ3 A;  1KK7 Z;  5IBW A;  2EC6 C;  1WY9 A;  3IQQ A;  2EGD A;  1NSH A;  1ZFS A;  4ORC B;  2JXL A;  2NZ0 A;  4ICB A;  2I2R E;  1KSO A;  2H61 C;  1WLM A;  1PRW A;  1IKU A;  1AJ4 A;  2WCF A;  1R6P A;  2JTZ A;  2JNF A;  3IF7 A;  4ORB B;  1UUR A;  1C07 A;  3BUN B;  1AJ5 A;  1YRU B;  4HRG A;  3I5G B;  1UHK A;  2RGI A;  1QJT A;  2PMY A;  3BOW B;  1RTP 1;  2HF5 A;  1NX1 A;  2OS8 C;  1XFU O;  3OB2 B;  2I94 A;  2KNE A;  2M9G A;  2ZFD A;  1EXR A;  1B8C A;  3BUX B;  1AK8 A;  1DJY A;  1CLL A;  2WC8 A;  1IJ6 A;  2ISD A;  4A4C A;  3PAL A;  4M2O A;  1WDC C;  2CBL A;  1K90 D;  3BQ3 A;  2WND A;  2KHN A;  1XA5 A;  2K8M B;  3PAT A;  2L4H A;  4P2Y B;  4YRU A;  1ZMZ A;  1QVI Z;  1LXF C;  1FPW A;  1NCX A;  2M49 B;  1REC A;  1M39 A;  3AAJ A;  3EK4 A;  3IQO A;  5K89 A;  5AER A;  5FYX A;  2PRU A;  2OPO A;  3O2P A;  2MLF C;  3WHT B;  1EH2 A;  1DF0 B;  1SRA A;  2BCX A;  1LA3 A;  3SG6 A;  1K9U A;  1KQM B;  2Y1N A;  4XYN A;  1UWO A;  1LKJ A;  3OHM B;  1SK6 D;  4PHJ A;  3TUY B;  3ZWH A;  5I2O A;  1SMG A;  1G4Y R;  4C0L A;  3DVE A;  2HET A;  4OVN F;  1JF0 A;  1QTX A;  2COL B;  4PCW A;  4GAO A;  1TRF A;  3I5F C;  4QJ4 B;  2JQ6 A;  3EVU A;  1TCO B;  2JZI A;  3EK7 A;  1B7T Z;  2FJU B;  3BOW A;  3AKA A;  2EC6 B;  3LK0 A;  2L4I A;  4BY5 A;  2M7L A;  1KWO B;  1IQ5 A;  2KAV A;  1QX7 A;  1UUS A;  2CXJ A;  4ETO A;  3OX6 A;  3F45 A;  2P6B B;  1SCM C;  2L51 A;  1SR6 C;  1B8L A;  3TS5 C;  2LVV A;  1IH0 A;  4CLN A;  1S6C A;  1NPQ A;  2MAZ A;  1A29 A;  1PK0 D;  3TDZ A;  2GV5 A;  5D7F A;  4Q04 A;  2OS8 B;  5CSN A;  2B1U A;  1BOC A;  1CFP A;  5KU1 A;  3DD4 A;  2JT0 A;  1JWD A;  1XFX O;  2CNP A;  2BBM A;  1J7O A;  1CLB A;  4OV2 A;  1WRL A;  1R2U A;  1A2X A;  5BPJ A;  4PAL A;  1WDC B;  1LA0 A;  3EVV A;  1Y1U A;  4DRW A;  5HLV A;  1HQV A;  5F6T A;  1F4Q A;  2KI6 D;  2KOT A;  4L9M A;  2LHL A;  2M1U A;  4N5X A;  3SG4 A;  4AQI A;  1BU3 A;  2HQW A;  3DF0 B;  1OMD A;  2CT9 A;  2ZN9 A;  3SJS A;  4CPV A;  3QRX A;  1M46 A;  3NSO A;  2F2O A;  2MA2 A;  2H2K A;  3SIA A;  4D1E A;  2LMV A;  1JFJ A;  2L5X B;  1BR4 B;  3BXK A;  1QXP A;  2BCA A;  1L2O C;  2PAL A;  3EKJ A;  1ZUZ A;  3I5F B;  4I5N B;  1OZO A;  3FWB A;  1MUX A;  5HKZ A;  2JT3 A;  1BJF A;  2KSP A;  3OX5 A;  1XFV O;  2F3Y A;  1S3P A;  1IRJ A;  1QAS A;  2K7B A;  1DJH A;  4WQ3 A;  2M29 A;  2I7A A;  1N65 A;  1X02 A;  4DS7 A;  1C7V A;  2WOR A;  3D0Y B;  1SR6 B;  3PN7 B;  3VRR A;  3TS5 B;  1AP4 A;  1J1D A;  3CZT X;  2WOS A;  1QIW A;  1CFF A;  2OTG C;  3FS7 A;  3CR4 X;  1EG3 A;  1K8U A;  1YUT A;  2JTT A;  3DVJ A;  4HRE E;  1XK4 A;  2LC5 A;  4GGF C;  1XFY O;  2LVI A;  4NQG A;  1J1E A;  1YVH A;  3DF0 A;  1Y6W A;  1D1O A;  1QV0 A;  3PLF B;  4CFQ A;  3CTN A;  1TNP A;  1B4C A;  1FI6 A;  1TNX A;  2KDH A;  1SL7 A;  5GQQ C;  3CLN A;  4PHM A;  3EKH A;  2KYC A;  1DJI A;  3GK1 A;  3HX4 A;  2Q91 A;  4PE0 A;  3FWC A;  1NUB A;  1JC2 A;  1IG5 A;  2DOQ A;  2FCE A;  4YGA A;  3ZNI A;  3NSL A;  1JBA A;  1SW8 A;  4YGC B;  3CGA A;  5HKY A;  1ZOT B;  1YTZ C;  1ODB A;  1U5I B;  2R2I A;  2E6W A;  4MN0 A;  4PE4 A;  1N2D A;  4QJ3 B;  4N1F A;  1SKT A;  1UHN A;  3D0Y A;  1E8A A;  3AAK A;  2G2B A;  1EG4 A;  1L2O B;  1IWQ A;  1MHO A;  2LUX A;  1ALV A;  3BYA A;  2ZND A;  1BG1 A;  1F4O A;  4P5O E;  2D8N A;  4AOM A;  2ZN8 A;  1K95 A;  2WCB A;  3EVR A;  2PSR A;  3E3R A;  1GGZ A;  2GGM A;  1FBV A;  2LVK A;  4GNK B;  1CDM A;  1TOP A;  1F54 A;  1WRK A;  2M0R A;  3VRO A;  1BF5 A;  4UPG A;  2KFF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...