1NPQA

Structure of a rhodamine-labeled n-domain troponin c mutant (ca2+ saturated) in complex with skeletal troponin i 115-131
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
90
structure length
90
Chain Sequence
ASMTDQQAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKCELDAIICEVDEDGSGTIDFEEFLVMMVRQMKEDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Troponin C
publication title NMR Structure of a Bifunctional Rhodamine Labeled N-Domain of Troponin C Complexed with the Regulatory "Switch" Peptide from Troponin I: Implications for in Situ Fluorescence Studies in Muscle Fibers
pubmed doi rcsb
source organism Gallus gallus
total genus 18
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2003-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1npqA00
1DT7B 1SL9A 2KYCA 2LM5A 2LE9B 2LVJA 2KYFA 1K9KA 1ZOTB 5FYXA 3EK4A 2LLSA 2PALA 4ORCB 4DRWA 3HX4A 3LK0A 1JC2A 3TS5C 2LMVA 3SG5A 2MBXA 1MF8B 4OCIA 4QJ5B 1KWOB 4NDDA 1CDMA 2ZRTA 3EK7A 1NUBA 4U8DA 2RGIA 3FIAA 1F55A 1F4QA 4PHJA 2CCMA 3PLFB 4MN0A 1EG3A 1K95A 1S5GZ 1UHKA 1YVHA 1QLKA 2E30A 2MHHA 1IRJA 2R2IA 3BXKA 2BCBA 2HETA 5G08A 4D1EA 5JJGA 1UWOA 1F8HA 1HQVA 1TTXA 1RFJA 1DGVA 1D1OA 2G9BA 2JC2A 3C1VA 1L2OC 1XFWO 1KSMA 1GGWA 1WRKA 4BY4A 2BE6A 1CFPA 2L4HA 2PASA 5D69A 1ZFSA 3PN7B 1WLZA 1AP4A 2LAPA 1CLBA 1QX7A 1MQ1A 3BYAA 3DF0A 1XFZO 2H2KA 5AERA 4WQ3A 4NDBA 2EGDA 2F33A 1DTLA 2K2AA 2ZN8A 3EK8A 3PFVA 4ICBA 1IKUA 3BUXB 3NSLA 1XFXO 2KGBC 1KFXS 1BU3A 4FQOA 3PATA 3RM1A 3WXAA 2WCBA 1SKTA 4MZLA 2GGZA 2HF5A 2EHBA 3KF9A 3VROA 1QX2A 1TNPA 2M97A 1PULA 1F4OA 1EJ3A 1UHIA 3BOWA 1J1DA 2JRFA 3JTDB 5J3XA 4N1GA 3SIBA 1BMOA 2DOQA 1W7IB 2JQ6A 4XJKA 4GGFA 1R6PA 4YI8A 1WRZA 1YRUB 2JNFA 2K7BA 2MJWB 1BODA 1J7OA 2KI4B 1RWYA 4DS7A 2F8PA 4CIDA 1DJZA 1XK4A 4L9MA 1RROA 3CR4X 3H4SE 1KK7Z 1NIWA 5CSFA 1C7VA 3PSRA 1IGVA 1YUTA 4YGEB 1CMFA 3EVVA 3GOFA 1OMRA 4CPVA 2LMTA 1EH2A 2LVIA 1SNLA 2ZNEA 1QTXA 2Y5IA 5AEQA 3JVTB 3BUWB 1FW4A 2I94A 1RK9A 3SG6A 1SPYA 4USLA 3GK2A 1A75A 2BBNA 2LP3A 2L2EA 4OR9B 1DF0A 1R2UA 1B1GA 4C0KA 2KI6C 5DKQA 4PE4A 2AUCA 2JPTA 2K7OA 4M2OA 1PVBA 1PSRA 4AQJA 1PVAA 3CS1A 1CFFA 3VRRA 3MSEB 1J1EA 1KQMB 1MR8A 1CKKA 2L5XB 1YX7A 5I2LA 5HKYA 1AUIB 1TCFA 1LKJA 3BQ3A 1B8RA 2H61C 3F45A 4WRIA 1SL8A 4C0LA 3TDZA 1CDNA 1NX0A 2OTGC 3I5HB 2KAXA 3OB1B 3TUYB 1CDLA 1M46A 1S6CA 2JXLA 3DVJA 4QJ3B 4AOMA 4PHNA 1JBAA 3M0WA 2Q91A 1K9PA 1J55A 2M1UA 1NYAA 3NXAA 1TRFA 1QVIY 5I2QA 1CNPA 2SASA 2Y4QA 1Q80A 2L0PA 2ZNDA 2LVVA 1PRWA 2HQ8A 1BOCA 3I5IC 1XO5A 2OS8B 3FWCA 5I8NA 1LINA 3WHTB 1KCYA 1S26D 3BUMB 5PALA 2FJUB 2NCOA 4HRGA 3TZ1A 1CLMA 1Y6WA 1E8AA 1ZMZA 4YI9A 1NX1A 1JFKA 2WORA 2LANA 1SW8A 2CNPA 1WLMA 2D8NA 3A8RA 4GUKA 4P2YB 4PHMA 4WQ2A 2NLNA 1J7QA 3IF7A 2M7LA 3QRXA 4MLWA 1KWOC 3EKJA 4YBHB 2L50A 4DCKA 2BBMA 2KNEA 4PE0A 1YURA 3O78A 4ZCUA 4GPLB 4A4BA 2Y1NA 4M2QA 3O6BA 3K21A 4PE7A 3LL8B 4MBEA 3FS7A 2V53A 1S6IA 3GK1A 2I2RE 1IWQA 1OZOA 1TN4A 2G2BA 2M3WA 2SCPA 4AQIA 2P6BB 3I5FC 1PSBA 2WCEA 4OKHA 3SJSA 4C0JA 2HPSA 2JNXA 1QS7A 3VRNA 1G4YR 1DMOA 3PM8A 5I2OA 2LMUA 1KQVA 1TNWA 5ER4X 2EC6B 2MLFC 1DJYA 1BF5A 5KSZA 2WNDA 3AKBA 1AJ5A 1IG5A 3PN7C 2JXCA 1B4CA 1N65A 4CFRA 5IBWA 5AFPA 3D0YA 1MXEA 1ODBA 2AAOA 4PE1A 5CSNA 4IL1A 3VGOA 2M9GA 3O4YA 1QV1A 1U5IB 4PCWA 4ZCVA 1OE9B 1MUXA 1IH0A 4I5KA 2Q4UA 1NX3A 3EVRA 1IQ3A 1N2DA 2LCPA 2M0RA 1IQ5A 3ZWHA 2JT8A 2F3YA 1TOPA 2H61A 4MZJA 1NSHA 2BCXA 1CTRA 1SCMB 3CTNA 1UHNA 4F0ZB 2BL0C 4MRXA 2KBMA 1OSAA 4NQGA 2B1UA 3DF0B 1SR6C 1CFDA 1KFXL 2O5GA 2M49B 1KSOA 1CDPA 1M31A 2F2OA 4P5OE 2O60A 4HREE 5KTYA 3I5GB 4MVFA 2FCDA 3NSOA 4FTGA 1EG4A 2JULA 2M8UA 1S5GY 2M1KB 2F3ZA 2KI4C 1BR4B 1IJ5A 1C7WA 1RECA 3WHUB 2MAZA 1LA0A 1SRAA 1SYMA 4MRYA 2KFHA 4Q04A 3O2PA 1PALA 1SCVA 3ICBA 1KFUS 3LCPC 1SBJA 3CZTX 1IJ6A 4GAOA 3OHMB 4GFTA 2LVKA 3DD4A 3BUOB 3JVTC 1DJXA 1LA3A 1RJVA 3CR5X 2ISDA 3A4UB 1A29A 4JPZB 3CGAA 1S3PA 4N1FA 1JSAA 1J7PA 2PRUA 1CM4A 1UHHA 3DVEA 1CFCA 1QIWA 4XYNA 2K2FA 1YR5A 1QJTA 4DIRA 4GBAA 3WNXB 1KFUL 1Y1XA 1YTZC 2BKIB 1BLQA 5CPVA 3KEVA 3D0YB 4HSZA 1KQMC 1XFUO 5F6TA 1KK8B 1MXLC 1NPQA 2M29A 3AAKA 2KFFA 4GGNA 1V1GA 1MHOA 1B47A 2LUXA 3IQOA 4MEWA 3LK1A 3I5HC 3TUYC 1ZACA 3E3RA 2Y1MA 4PDZA 1OOJA 1NCYA 1F54A 1YX8A 4BY5A 1M63B 2JZIA 4I5JA 1F71A 1OMDA 1CB1A 1XFVO 1W7JB 1AK8A 3BOWB 1UURA 1DVIA 3AKAA 3OB2B 1JWDA 2I18A 3DVKA 1FBVA 2L98A 4XJKB 1CMGA 2OPOA 5KU1A 1KK7Y 2NXQA 2JTZA 3SG3A 1S1EA 2OS8C 1NX2A 1QIVA 1QX5B 3D10A 5B8IB 1SL7A 1DJWA 2KAVA 1SY9A 5JOLA 2NZ0A 5TNCA 2E6WA 2K61A 2LHIA 2WOSA 1AVSA 4ORBB 5GQQC 5AXIA 1WDCB 2GV5A 1JFJA 1DGUA 4YRUA 4YGDB 1QASA 1XFYO 1B7TY 2PVBA 1TNXA 3DVMA 1UUSA 1N0YA 1NP8A 1TCOB 3EKHA 4OVNF 3SIAA 3TS5B 1A4PA 2KFGA 2F2PA 1A75B 5ER5A 2JU0A 2LV7A 1L7ZA 2LC5A 5HLOA 1G8IA 4JWQA 5HKWA 1DF0B 2CT9A 2KHNA 1DJHA 3GK4X 1FI6A 1S36A 3SG4A 3BUNB 1MWNA 2JOJA 1GGZA 2LLUA 3SG7A 2LUCA 1EL4A 2EC6C 1K90D 1BG1A 1L2OB 3EVUA 4YGAA 3I5FB 1YRTB 4UPGA 2GGMA 1WY9A 5DKNA 2BKHB 2KSPA 1SMGA 2AMIA 3OX6A 5HLVA 2KAYA 1C07A 1EXRA 2K8MB 1CLLA 2QPTA 3OP0A 1UHJA 2LHLA 4CFQA 2BE4A 2MRDA 5D7FA 2QACA 2JWWA 1K8UA 1NCZA 5CSIA 3RLZA 2K7CA 1A2XA 2BCAA 1AJ4A 3JTDC 1SCMC 4R1EA 3SG2A 1OQPA 4ETOA 3PALA 1B8LA 4DUQA 2PSRA 2M7NA 1ALVA 1AHRA 2K7DA 1SK6D 4E68A 5HKZA 5CSJA 5AANA 1DJIA 3TDUA 3I5GC 4GNKB 1CM1A 1QV0A 1B8CA 2BL0B 2VRGA 1SR6B 3FWBA 1DJGA 2KI6D 1B9AA 4HRHA 1FF1A 1Y1AA 4I5NB 4PALA 2ZKMX 3CR2A 4NDCA 1QVIZ 4MZKA 1M39A 2KDHA 2KQ6A 2HQWA 1TNQA 1M45A 2ZRSA 2KBIA 2L4IA 1FI5A 1Y1UA 2CBLA 2PMYA 4A4CA 2KGRA 4JQ0D 2MA2A 2CTNA 2LLTA 4ORAB 1H8BA 4N5XA 3HCMA 5BPJA 2ZFDA 3KHEA 3TDIA 2KQYA 1LVCD 2L51A 2LNKA 3AAJA 3LLEA 1K93D 1QATA 1XVJA 3NSIA 1HT9A 2JT3A 4M2PA 5HYDA 3VRPA 1ZUZA 1YUSA 3KO0A 3NSKA 1QXPA 1V1FA 2BECA 2COLB 1B7TZ 2JTTA 1YVLA 1KK8C 1VRKA 2CXJA 2WCFA 1K94A 3IQQA 3CLNA 1YUUA 2ZN9A 1UP5A 3VRQA 4QJ4B 2FOTA 1J7RA 2WC8A 1S6JA 1H4BA 2IS9A 1GJYA 4MSPA 1JUOA 1BT6A 3ZNIA 2I7AA 1GQMA 1BJFA 2OTGB 5K89A 1K96A 3KPXA 1TIZA 4YGCB 1K2HA 1A03A 4TNCA 2LP2A 1Y0VH 2TN4A 2FCEA 1WRLA 1XYDA 1QLSA 2NCPA 4GGFC 1G33A 1U5IA 4PHKA 3CWGA 1PK0D 4I5LB 5DKRA 2KOTA 1FPWA 1BR1B 4YGBB 1OZSA 2K0JA 4CLNA 1LXFC 3I5IB 1XA5A 1ALWA 1XK4C 1OMVA 4OV2A 1JF2A 1K9UA 1NWDA 1F70A 1RTP1 1X02A 2A4JA 1NCXA 2MLEC 1JF0A 2JT0A 3OX5A 1WDCC
chains in the Genus database with same CATH superfamily
1DT7B 1SL9A 2KYCA 2LM5A 2LE9B 1T14A 2LVJA 2KYFA 1K9KA 1ZOTB 2JPOA 5FYXA 3EK4A 2LLSA 2PALA 4ORCB 4DRWA 3HX4A 3LK0A 3B88A 1JC2A 3TS5C 2LMVA 3SG5A 2MBXA 5FI7A 1MF8B 1TWOA 4OCIA 1P28A 1KWOB 4QJ5B 4NDDA 1CDMA 2ZRTA 3EK7A 1NUBA 4U8DA 2RGIA 3FIAA 1F55A 1F4QA 1TUJA 2CCMA 3PLFB 4PHJA 4MN0A 1EG3A 1K95A 1S5GZ 1UHKA 1YVHA 1QLKA 2E30A 2MHHA 1IRJA 2R2IA 3BXKA 2BCBA 2HETA 5G08A 4D1EA 5JJGA 1UWOA 1C3YA 1HQVA 1TTXA 1F8HA 1RFJA 1DGVA 1D1OA 2G9BA 2JC2A 3C1VA 1L2OC 1XFWO 1KSMA 1GGWA 1WRKA 4BY4A 2BE6A 3N7HA 1CFPA 2L4HA 2PASA 1QWVA 5D69A 1ZFSA 3PN7B 1WLZA 1AP4A 2LAPA 1CLBA 1QX7A 1MQ1A 3BYAA 3DF0A 1XFZO 3R1OA 2H2KA 5AERA 4WQ3A 3DZTA 2WCMA 4NDBA 2EGDA 2F33A 1DTLA 2K2AA 2ZN8A 3EK8A 3PFVA 4ICBA 1IKUA 3BUXB 3NSLA 1XFXO 2KGBC 1KFXS 1BU3A 4FQOA 3PATA 3RM1A 3WXAA 4FQTA 1Z4HA 2WCBA 1SKTA 4MZLA 2GGZA 2HF5A 2EHBA 3KF9A 3VROA 4INXA 1QX2A 1TNPA 2M97A 1PULA 1F4OA 1EJ3A 1UHIA 2WC5A 3BOWA 1J1DA 2JRFA 3B86A 3JTDB 5J3XA 4N1GA 3SIBA 1BMOA 2DOQA 1W7IB 2JQ6A 4XJKA 4GGFA 1R6PA 4YI8A 3QMEA 1WRZA 2WCLA 1YRUB 2JNFA 2K7BA 2MJWB 1BODA 2BAPA 1J7OA 2KI4B 1RWYA 4DS7A 2F8PA 4CIDA 1DJZA 1XK4A 4L9MA 1RROA 3CR4X 3H4SE 1KK7Z 1NIWA 5CSFA 1C7VA 3PSRA 1IGVA 1YUTA 4YGEB 1CMFA 2L5YA 3EVVA 3GOFA 1OMRA 4IJ7A 2LMTA 4CPVA 1EH2A 2LVIA 1SNLA 2ZNEA 3S0FA 1QTXA 2Y5IA 5AEQA 3V2LA 3JVTB 3BUWB 1FW4A 2I94A 1RK9A 3SG6A 1SPYA 4USLA 3GK2A 1A75A 2BBNA 2LP3A 4JD9A 2L2EA 4OR9B 1DF0A 1R2UA 1B1GA 4C0KA 2KI6C 5DKQA 4PE4A 3S0AA 2AUCA 2JPTA 2K7OA 2P70A 4M2OA 1PVBA 1PSRA 3SS5A 4AQJA 3D74A 1PVAA 3CS1A 1CFFA 3VRRA 1OOFA 3MSEB 1J1EA 1KQMB 1MR8A 1CKKA 2L5XB 1YX7A 5I2LA 1DQEA 5HKYA 1AUIB 1TCFA 1LKJA 3BQ3A 1B8RA 2H61C 1Z2CB 3F45A 4WRIA 1SL8A 4C0LA 3TDZA 1CDNA 1NX0A 2OTGC 4PT1A 3I5HB 2KAXA 3OB1B 3TUYB 1CDLA 1M46A 1S6CA 2JXLA 3B7AA 3DVJA 4QJ3B 4AOMA 4PHNA 1JBAA 3M0WA 2Q91A 1K9PA 1J55A 2M1UA 1NYAA 3S0GA 3NXAA 1TRFA 1QVIY 5I2QA 1CNPA 2SASA 2Y4QA 1Q80A 2L0PA 1XFRA 2ZNDA 2LVVA 1PRWA 2HQ8A 3BJHA 3I5IC 1XO5A 1BOCA 2OS8B 3FWCA 5I8NA 5EL2A 1LINA 3DY9A 3WHTB 1KCYA 1S26D 3BUMB 5PALA 2FJUB 2NCOA 4HRGA 3TZ1A 1CLMA 1Y6WA 1E8AA 1W9ZA 1ZMZA 4YI9A 1OOGA 1NX1A 1JFKA 2WORA 2LANA 1SW8A 2GTEA 2CNPA 1WLMA 2D8NA 2P71A 3A8RA 3Q8IA 4GUKA 4P2YB 2NLNA 4PHMA 4WQ2A 3IF7A 1J7QA 2M7LA 3DYEA 3QRXA 4MLWA 1KWOC 3EKJA 4YBHB 2L50A 2WCJA 4DCKA 2BBMA 2KNEA 4PE0A 1YURA 3O78A 4ZCUA 4GPLB 4A4BA 2Y1NA 4M2QA 3O6BA 3K21A 3OGNA 2KLEA 4PE7A 3LL8B 4MBEA 3FS7A 2V53A 1S6IA 3GK1A 2I2RE 1IWQA 1OZOA 1TN4A 2G2BA 2M3WA 2SCPA 3SS4A 2P6BB 3I5FC 4AQIA 1PSBA 2WCEA 1DC1A 4OKHA 3SJSA 3NHTA 4C0JA 3CYZA 2HPSA 2JNXA 1QS7A 3VRNA 1G4YR 1DMOA 3PM8A 5I2OA 2LMUA 1KQVA 1TNWA 5ER4X 2EC6B 2MLFC 2QEBA 1OOIX 1DJYA 1BF5A 5KSZA 2WNDA 3AKBA 1AJ5A 1IG5A 3PN7C 2JXCA 1B4CA 1N65A 4CFRA 3CZ0A 5IBWA 5AFPA 3D0YA 1GM0A 1MXEA 1ODBA 2AAOA 4PE1A 5CSNA 4IL1A 5FI6A 3VGOA 2M9GA 3O4YA 3B6XA 1QV1A 3D77A 1U5IB 4PCWA 4ZCVA 1OE9B 2ERBA 1MUXA 1IH0A 4I5KA 2Q4UA 1NX3A 1LS8A 3EVRA 3L47A 1IQ3A 1N2DA 2LCPA 2M0RA 2KPHA 1IQ5A 3ZWHA 2JT8A 2F3YA 1TOPA 2H61A 4MZJA 1NSHA 2BCXA 1CTRA 1SCMB 3CTNA 1UHNA 4F0ZB 2BL0C 4MRXA 2KBMA 1OSAA 3PM2A 4NQGA 2B1UA 3DF0B 1SR6C 1CFDA 1KFXL 2O5GA 2M49B 1KSOA 1CDPA 1M31A 2F2OA 4P5OE 2O60A 4HREE 5KTYA 3I5GB 4MVFA 2FCDA 3NSOA 4FTGA 1EG4A 2JULA 2M8UA 1S5GY 2M1KB 2F3ZA 2KI4C 1BR4B 1IJ5A 1C7WA 3PJIA 5FI2A 1RECA 3WHUB 2MAZA 1LA0A 1SRAA 1SYMA 4MRYA 2KFHA 4Q04A 3O2PA 1PALA 1SCVA 2WC6A 3ICBA 3D76A 3B87A 1KFUS 3LCPC 1SBJA 3CZTX 1IJ6A 4GAOA 3OHMB 4GFTA 2LVKA 3DD4A 3BUOB 3JVTC 1DJXA 1LA3A 1RJVA 3CR5X 2ISDA 3A4UB 1A29A 4JPZB 3CGAA 1S3PA 4N1FA 1JSAA 3UNWA 1J7PA 3K1EA 2PRUA 1CM4A 1UHHA 1OOHA 3DVEA 1CFCA 1QIWA 4XYNA 2K2FA 1YR5A 1QJTA 4DIRA 3CZ1A 4GBAA 3WNXB 1KFUL 1Y1XA 1YTZC 2BKIB 1BLQA 5CPVA 3KEVA 3D0YB 4HSZA 1KQMC 1XFUO 5F6TA 1KK8B 1MXLC 1NPQA 2M29A 3AAKA 2KFFA 4GGNA 1V1GA 1MHOA 3EG5B 1B47A 3FE9A 2LUXA 3IQOA 4MEWA 3LK1A 2QEOA 3I5HC 3TUYC 1ZACA 3E3RA 3DXLA 2Y1MA 4PDZA 1OOJA 1NCYA 1F54A 1YX8A 4BY5A 1M63B 2JZIA 4I5JA 1F71A 1OMDA 1CB1A 1XFVO 1W7JB 1AK8A 3BOWB 3D78A 1UURA 3NGVA 1DVIA 3AKAA 3OB2B 1JWDA 2I18A 3DVKA 1FBVA 3FE8A 2L98A 4INWA 4XJKB 1CMGA 2OPOA 5KU1A 3R1VA 3SS3A 1KK7Y 2NXQA 2JTZA 3SG3A 1S1EA 2OS8C 1NX2A 1QIVA 1QX5B 3D10A 5B8IB 1IIOA 1SL7A 1DJWA 2KAVA 1SY9A 5JOLA 2NZ0A 5TNCA 2E6WA 5HL1A 2K61A 2LHIA 2WOSA 3OBVA 1AVSA 4ORBB 5GQQC 3R1PA 5AXIA 5D3OA 1WDCB 2GV5A 1JFJA 1DGUA 4YRUA 4YGDB 1QASA 1XFYO 1B7TY 2PVBA 3CABA 1TNXA 3DVMA 1UUSA 1N0YA 1NP8A 1TCOB 3EKHA 3VB1A 4OVNF 3SIAA 3TS5B 1A4PA 3BFBA 2KFGA 2F2PA 1A75B 5ER5A 2JU0A 2LV7A 2QDIA 1L7ZA 2LC5A 5HLOA 1G8IA 4JWQA 5HKWA 1DF0B 2CT9A 2KHNA 1DJHA 3GK4X 1FI6A 1S36A 3SG4A 3BUNB 3IVTA 1MWNA 2JOJA 1GGZA 2LLUA 2KLDA 3SG7A 2LUCA 1EL4A 2EC6C 2QEVA 3BFHA 1K90D 1BG1A 4OZDA 1L2OB 3EVUA 4YGAA 3I5FB 1YRTB 4UPGA 5I94A 2GGMA 3D75A 1WY9A 5DKNA 2BKHB 2KSPA 1SMGA 2AMIA 3OX6A 4F7FA 1DEKA 5HLVA 2KAYA 1C07A 1EXRA 3D73A 2K8MB 1CLLA 2QPTA 3OP0A 1UHJA 2LHLA 4CFQA 2BE4A 2MRDA 3CZ2A 5D7FA 2QACA 2JWWA 1K8UA 1NCZA 3FE6A 3NHIA 5CSIA 3RLZA 2K7CA 2K60A 1A2XA 2BCAA 1AJ4A 3JTDC 1SCMC 4R1EA 3SG2A 1OQPA 4ETOA 1OW4A 3PALA 1TUZA 1B8LA 4JKTA 4DUQA 2PSRA 2M7NA 1ALVA 1AHRA 2K7DA 1SK6D 4E68A 5HKZA 5CSJA 5AANA 1DJIA 3TDUA 3I5GC 4GNKB 1CM1A 1QV0A 1B8CA 2BL0B 2VRGA 1DELA 1SR6B 3FWBA 3L4LA 1DJGA 2KI6D 1B9AA 4HRHA 1FF1A 1Y1AA 4I5NB 4PALA 3CDNA 2ZKMX 3CR2A 4NDCA 1QVIZ 4MZKA 1M39A 2KDHA 2KQ6A 2HQWA 2H8VA 1TNQA 1M45A 2WCKA 3S0BA 2ZRSA 2KBIA 2L4IA 1FI5A 1Y1UA 3BFAA 2CBLA 2PMYA 4A4CA 3S0EA 2KGRA 4JQ0D 2MA2A 2CTNA 2L2CA 2LLTA 4ORAB 1H8BA 4N5XA 3HCMA 5BPJA 2ZFDA 3R72A 3KHEA 1ORGA 2KQYA 1LVCD 2L51A 2LNKA 3AAJA 3LLEA 3TDIA 1K93D 1QATA 1XVJA 3NSIA 1HT9A 2JT3A 4M2PA 3RZSA 5HYDA 3VRPA 1ZUZA 1SSEB 1YUSA 3KO0A 3NSKA 1QXPA 2PYQA 1V1FA 2BECA 2COLB 1B7TZ 2JTTA 1YVLA 3UO9A 1KK8C 1VRKA 2CXJA 2WCFA 1K94A 3IQQA 3CLNA 1YUUA 2ZN9A 1UP5A 3VRQA 4QJ4B 3L4AA 3O4XA 2FOTA 1J7RA 2WC8A 1S6JA 1H4BA 2IS9A 1GJYA 4MSPA 1JUOA 1BT6A 3ZNIA 2I7AA 1GQMA 1BJFA 2OTGB 5K89A 1K96A 1C3ZA 3KPXA 1TIZA 4YGCB 1K2HA 1A03A 4TNCA 2WCHA 2LP2A 1Y0VH 2TN4A 2FCEA 1WRLA 1XYDA 1QLSA 2NCPA 4GGFC 1G33A 1U5IA 4PHKA 2QEHA 3CWGA 1PK0D 4I5LB 5DKRA 2BNXA 2PQLA 5DICA 2KOTA 1FPWA 1BR1B 4YGBB 1OZSA 2K0JA 4CLNA 1LXFC 3I5IB 1XA5A 1ALWA 1XK4C 1OMVA 2YGUA 4OV2A 1JF2A 1K9UA 1NWDA 1F70A 1RTP1 4KYNA 1X02A 2A4JA 1NCXA 3S0DA 2MLEC 1JF0A 2FJYA 2JT0A 3OX5A 1WDCC
chains in the Genus database with same CATH topology
1DT7B 1SL9A 2KYCA 2LM5A 2LE9B 2LVJA 2KYFA 1K9KA 1ZOTB 5FYXA 3EK4A 2LLSA 2PALA 4ORCB 4DRWA 3HX4A 3LK0A 1JC2A 3TS5C 2LMVA 3SG5A 2MBXA 1MF8B 4OCIA 4QJ5B 1KWOB 4NDDA 1CDMA 2ZRTA 3EK7A 1NUBA 4U8DA 2RGIA 3FIAA 1F55A 1F4QA 4PHJA 2CCMA 3PLFB 4MN0A 1EG3A 1K95A 1S5GZ 1UHKA 1YVHA 1QLKA 2E30A 2MHHA 1IRJA 2R2IA 3BXKA 2BCBA 2HETA 5G08A 4D1EA 5JJGA 1UWOA 1F8HA 1HQVA 1TTXA 1RFJA 1DGVA 1D1OA 2G9BA 2JC2A 3C1VA 1L2OC 1XFWO 1KSMA 1GGWA 1WRKA 4BY4A 2BE6A 1CFPA 2L4HA 2PASA 5D69A 1ZFSA 3PN7B 1WLZA 1AP4A 2LAPA 1CLBA 1QX7A 1MQ1A 3BYAA 3DF0A 1XFZO 2H2KA 5AERA 4WQ3A 4NDBA 2EGDA 2F33A 1DTLA 2K2AA 2ZN8A 3EK8A 3PFVA 4ICBA 1IKUA 3BUXB 3NSLA 1XFXO 2KGBC 1KFXS 1BU3A 4FQOA 3PATA 3RM1A 3WXAA 2WCBA 1SKTA 4MZLA 2GGZA 2HF5A 2EHBA 3KF9A 3VROA 1QX2A 1TNPA 2M97A 1PULA 1F4OA 1EJ3A 1UHIA 3BOWA 1J1DA 2JRFA 3JTDB 5J3XA 4N1GA 3SIBA 1BMOA 2DOQA 1W7IB 2JQ6A 4XJKA 4GGFA 1R6PA 4YI8A 1WRZA 1YRUB 2JNFA 2K7BA 2MJWB 1BODA 1J7OA 2KI4B 1RWYA 4DS7A 2F8PA 4CIDA 1DJZA 1XK4A 4L9MA 1RROA 3CR4X 3H4SE 1KK7Z 1NIWA 5CSFA 1C7VA 3PSRA 1IGVA 1YUTA 4YGEB 1CMFA 3EVVA 3GOFA 1OMRA 4CPVA 2LMTA 1EH2A 2LVIA 1SNLA 2ZNEA 1QTXA 2Y5IA 5AEQA 3JVTB 3BUWB 1FW4A 2I94A 1RK9A 3SG6A 1SPYA 4USLA 3GK2A 1A75A 2BBNA 2LP3A 2L2EA 4OR9B 1DF0A 1R2UA 1B1GA 4C0KA 2KI6C 5DKQA 4PE4A 2AUCA 2JPTA 2K7OA 4M2OA 1PVBA 1PSRA 4AQJA 1PVAA 3CS1A 1CFFA 3VRRA 3MSEB 1J1EA 1KQMB 1MR8A 1CKKA 2L5XB 1YX7A 5I2LA 5HKYA 1AUIB 1TCFA 1LKJA 3BQ3A 1B8RA 2H61C 3F45A 4WRIA 1SL8A 4C0LA 3TDZA 1CDNA 1NX0A 2OTGC 3I5HB 2KAXA 3OB1B 3TUYB 1CDLA 1M46A 1S6CA 2JXLA 3DVJA 4QJ3B 4AOMA 4PHNA 1JBAA 3M0WA 2Q91A 1K9PA 1J55A 2M1UA 1NYAA 3NXAA 1TRFA 1QVIY 5I2QA 1CNPA 2SASA 2Y4QA 1Q80A 2L0PA 2ZNDA 2LVVA 1PRWA 2HQ8A 1BOCA 3I5IC 1XO5A 2OS8B 3FWCA 5I8NA 1LINA 3WHTB 1KCYA 1S26D 3BUMB 5PALA 2FJUB 2NCOA 4HRGA 3TZ1A 1CLMA 1Y6WA 1E8AA 1ZMZA 4YI9A 1NX1A 1JFKA 2WORA 2LANA 1SW8A 2CNPA 1WLMA 2D8NA 3A8RA 4GUKA 4P2YB 4PHMA 4WQ2A 2NLNA 1J7QA 3IF7A 2M7LA 3QRXA 4MLWA 1KWOC 3EKJA 4YBHB 2L50A 4DCKA 2BBMA 2KNEA 4PE0A 1YURA 3O78A 4ZCUA 4GPLB 4A4BA 2Y1NA 4M2QA 3O6BA 3K21A 4PE7A 3LL8B 4MBEA 3FS7A 2V53A 1S6IA 3GK1A 2I2RE 1IWQA 1OZOA 1TN4A 2G2BA 2M3WA 2SCPA 4AQIA 2P6BB 3I5FC 1PSBA 2WCEA 4OKHA 3SJSA 4C0JA 2HPSA 2JNXA 1QS7A 3VRNA 1G4YR 1DMOA 3PM8A 5I2OA 2LMUA 1KQVA 1TNWA 5ER4X 2EC6B 2MLFC 1DJYA 1BF5A 5KSZA 2WNDA 3AKBA 1AJ5A 1IG5A 3PN7C 2JXCA 1B4CA 1N65A 4CFRA 5IBWA 5AFPA 3D0YA 1MXEA 1ODBA 2AAOA 4PE1A 5CSNA 4IL1A 3VGOA 2M9GA 3O4YA 1QV1A 1U5IB 4PCWA 4ZCVA 1OE9B 1MUXA 1IH0A 4I5KA 2Q4UA 1NX3A 3EVRA 1IQ3A 1N2DA 2LCPA 2M0RA 1IQ5A 3ZWHA 2JT8A 2F3YA 1TOPA 2H61A 4MZJA 1NSHA 2BCXA 1CTRA 1SCMB 3CTNA 1UHNA 4F0ZB 2BL0C 4MRXA 2KBMA 1OSAA 4NQGA 2B1UA 3DF0B 1SR6C 1CFDA 1KFXL 2O5GA 2M49B 1KSOA 1CDPA 1M31A 2F2OA 4P5OE 2O60A 4HREE 5KTYA 3I5GB 4MVFA 2FCDA 3NSOA 4FTGA 1EG4A 2JULA 2M8UA 1S5GY 2M1KB 2F3ZA 2KI4C 1BR4B 1IJ5A 1C7WA 1RECA 3WHUB 2MAZA 1LA0A 1SRAA 1SYMA 4MRYA 2KFHA 4Q04A 3O2PA 1PALA 1SCVA 3ICBA 1KFUS 3LCPC 1SBJA 3CZTX 1IJ6A 4GAOA 3OHMB 4GFTA 2LVKA 3DD4A 3BUOB 3JVTC 1DJXA 1LA3A 1RJVA 3CR5X 2ISDA 3A4UB 1A29A 4JPZB 3CGAA 1S3PA 4N1FA 1JSAA 1J7PA 2PRUA 1CM4A 1UHHA 3DVEA 1CFCA 1QIWA 4XYNA 2K2FA 1YR5A 1QJTA 4DIRA 4GBAA 3WNXB 1KFUL 1Y1XA 1YTZC 2BKIB 1BLQA 5CPVA 3KEVA 3D0YB 4HSZA 1KQMC 1XFUO 5F6TA 1KK8B 1MXLC 1NPQA 2M29A 3AAKA 2KFFA 4GGNA 1V1GA 1MHOA 1B47A 2LUXA 3IQOA 4MEWA 3LK1A 3I5HC 3TUYC 1ZACA 3E3RA 2Y1MA 4PDZA 1OOJA 1NCYA 1F54A 1YX8A 4BY5A 1M63B 2JZIA 4I5JA 1F71A 1OMDA 1CB1A 1XFVO 1W7JB 1AK8A 3BOWB 1UURA 1DVIA 3AKAA 3OB2B 1JWDA 2I18A 3DVKA 1FBVA 2L98A 4XJKB 1CMGA 2OPOA 5KU1A 1KK7Y 2NXQA 2JTZA 3SG3A 1S1EA 2OS8C 1NX2A 1QIVA 1QX5B 3D10A 5B8IB 1SL7A 1DJWA 2KAVA 1SY9A 5JOLA 2NZ0A 5TNCA 2E6WA 2K61A 2LHIA 2WOSA 1AVSA 4ORBB 5GQQC 5AXIA 1WDCB 2GV5A 1JFJA 1DGUA 4YRUA 4YGDB 1QASA 1XFYO 1B7TY 2PVBA 1TNXA 3DVMA 1UUSA 1N0YA 1NP8A 1TCOB 3EKHA 4OVNF 3SIAA 3TS5B 1A4PA 2KFGA 2F2PA 1A75B 5ER5A 2JU0A 2LV7A 1L7ZA 2LC5A 5HLOA 1G8IA 4JWQA 5HKWA 1DF0B 2CT9A 2KHNA 1DJHA 3GK4X 1FI6A 1S36A 3SG4A 3BUNB 1MWNA 2JOJA 1GGZA 2LLUA 3SG7A 2LUCA 1EL4A 2EC6C 1K90D 1BG1A 1L2OB 3EVUA 4YGAA 3I5FB 1YRTB 4UPGA 2GGMA 1WY9A 5DKNA 2BKHB 2KSPA 1SMGA 2AMIA 3OX6A 5HLVA 2KAYA 1C07A 1EXRA 2K8MB 1CLLA 2QPTA 3OP0A 1UHJA 2LHLA 4CFQA 2BE4A 2MRDA 5D7FA 2QACA 2JWWA 1K8UA 1NCZA 5CSIA 3RLZA 2K7CA 1A2XA 2BCAA 1AJ4A 3JTDC 1SCMC 4R1EA 3SG2A 1OQPA 4ETOA 3PALA 1B8LA 4DUQA 2PSRA 2M7NA 1ALVA 1AHRA 2K7DA 1SK6D 4E68A 5HKZA 5CSJA 5AANA 1DJIA 3TDUA 3I5GC 4GNKB 1CM1A 1QV0A 1B8CA 2BL0B 2VRGA 1SR6B 3FWBA 1DJGA 2KI6D 1B9AA 4HRHA 1FF1A 1Y1AA 4I5NB 4PALA 2ZKMX 3CR2A 4NDCA 1QVIZ 4MZKA 1M39A 2KDHA 2KQ6A 2HQWA 1TNQA 1M45A 2ZRSA 2KBIA 2L4IA 1FI5A 1Y1UA 2CBLA 2PMYA 4A4CA 2KGRA 4JQ0D 2MA2A 2CTNA 2LLTA 4ORAB 1H8BA 4N5XA 3HCMA 5BPJA 2ZFDA 3KHEA 3TDIA 2KQYA 1LVCD 2L51A 2LNKA 3AAJA 3LLEA 1K93D 1QATA 1XVJA 3NSIA 1HT9A 2JT3A 4M2PA 5HYDA 3VRPA 1ZUZA 1YUSA 3KO0A 3NSKA 1QXPA 1V1FA 2BECA 2COLB 1B7TZ 2JTTA 1YVLA 1KK8C 1VRKA 2CXJA 2WCFA 1K94A 3IQQA 3CLNA 1YUUA 2ZN9A 1UP5A 3VRQA 4QJ4B 2FOTA 1J7RA 2WC8A 1S6JA 1H4BA 2IS9A 1GJYA 4MSPA 1JUOA 1BT6A 3ZNIA 2I7AA 1GQMA 1BJFA 2OTGB 5K89A 1K96A 3KPXA 1TIZA 4YGCB 1K2HA 1A03A 4TNCA 2LP2A 1Y0VH 2TN4A 2FCEA 1WRLA 1XYDA 1QLSA 2NCPA 4GGFC 1G33A 1U5IA 4PHKA 3CWGA 1PK0D 4I5LB 5DKRA 2KOTA 1FPWA 1BR1B 4YGBB 1OZSA 2K0JA 4CLNA 1LXFC 3I5IB 1XA5A 1ALWA 1XK4C 1OMVA 4OV2A 1JF2A 1K9UA 1NWDA 1F70A 1RTP1 1X02A 2A4JA 1NCXA 2MLEC 1JF0A 2JT0A 3OX5A 1WDCC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DT7 B;  1SL9 A;  2KYC A;  2LM5 A;  2LE9 B;  2LVJ A;  2KYF A;  1K9K A;  1ZOT B;  5FYX A;  3EK4 A;  2LLS A;  2PAL A;  4ORC B;  4DRW A;  3HX4 A;  3LK0 A;  1JC2 A;  3TS5 C;  2LMV A;  3SG5 A;  2MBX A;  1MF8 B;  4OCI A;  4QJ5 B;  1KWO B;  4NDD A;  1CDM A;  2ZRT A;  3EK7 A;  1NUB A;  4U8D A;  2RGI A;  3FIA A;  1F55 A;  1F4Q A;  4PHJ A;  2CCM A;  3PLF B;  4MN0 A;  1EG3 A;  1K95 A;  1S5G Z;  1UHK A;  1YVH A;  1QLK A;  2E30 A;  2MHH A;  1IRJ A;  2R2I A;  3BXK A;  2BCB A;  2HET A;  5G08 A;  4D1E A;  5JJG A;  1UWO A;  1F8H A;  1HQV A;  1TTX A;  1RFJ A;  1DGV A;  1D1O A;  2G9B A;  2JC2 A;  3C1V A;  1L2O C;  1XFW O;  1KSM A;  1GGW A;  1WRK A;  4BY4 A;  2BE6 A;  1CFP A;  2L4H A;  2PAS A;  5D69 A;  1ZFS A;  3PN7 B;  1WLZ A;  1AP4 A;  2LAP A;  1CLB A;  1QX7 A;  1MQ1 A;  3BYA A;  3DF0 A;  1XFZ O;  2H2K A;  5AER A;  4WQ3 A;  4NDB A;  2EGD A;  2F33 A;  1DTL A;  2K2A A;  2ZN8 A;  3EK8 A;  3PFV A;  4ICB A;  1IKU A;  3BUX B;  3NSL A;  1XFX O;  2KGB C;  1KFX S;  1BU3 A;  4FQO A;  3PAT A;  3RM1 A;  3WXA A;  2WCB A;  1SKT A;  4MZL A;  2GGZ A;  2HF5 A;  2EHB A;  3KF9 A;  3VRO A;  1QX2 A;  1TNP A;  2M97 A;  1PUL A;  1F4O A;  1EJ3 A;  1UHI A;  3BOW A;  1J1D A;  2JRF A;  3JTD B;  5J3X A;  4N1G A;  3SIB A;  1BMO A;  2DOQ A;  1W7I B;  2JQ6 A;  4XJK A;  4GGF A;  1R6P A;  4YI8 A;  1WRZ A;  1YRU B;  2JNF A;  2K7B A;  2MJW B;  1BOD A;  1J7O A;  2KI4 B;  1RWY A;  4DS7 A;  2F8P A;  4CID A;  1DJZ A;  1XK4 A;  4L9M A;  1RRO A;  3CR4 X;  3H4S E;  1KK7 Z;  1NIW A;  5CSF A;  1C7V A;  3PSR A;  1IGV A;  1YUT A;  4YGE B;  1CMF A;  3EVV A;  3GOF A;  1OMR A;  4CPV A;  2LMT A;  1EH2 A;  2LVI A;  1SNL A;  2ZNE A;  1QTX A;  2Y5I A;  5AEQ A;  3JVT B;  3BUW B;  1FW4 A;  2I94 A;  1RK9 A;  3SG6 A;  1SPY A;  4USL A;  3GK2 A;  1A75 A;  2BBN A;  2LP3 A;  2L2E A;  4OR9 B;  1DF0 A;  1R2U A;  1B1G A;  4C0K A;  2KI6 C;  5DKQ A;  4PE4 A;  2AUC A;  2JPT A;  2K7O A;  4M2O A;  1PVB A;  1PSR A;  4AQJ A;  1PVA A;  3CS1 A;  1CFF A;  3VRR A;  3MSE B;  1J1E A;  1KQM B;  1MR8 A;  1CKK A;  2L5X B;  1YX7 A;  5I2L A;  5HKY A;  1AUI B;  1TCF A;  1LKJ A;  3BQ3 A;  1B8R A;  2H61 C;  3F45 A;  4WRI A;  1SL8 A;  4C0L A;  3TDZ A;  1CDN A;  1NX0 A;  2OTG C;  3I5H B;  2KAX A;  3OB1 B;  3TUY B;  1CDL A;  1M46 A;  1S6C A;  2JXL A;  3DVJ A;  4QJ3 B;  4AOM A;  4PHN A;  1JBA A;  3M0W A;  2Q91 A;  1K9P A;  1J55 A;  2M1U A;  1NYA A;  3NXA A;  1TRF A;  1QVI Y;  5I2Q A;  1CNP A;  2SAS A;  2Y4Q A;  1Q80 A;  2L0P A;  2ZND A;  2LVV A;  1PRW A;  2HQ8 A;  1BOC A;  3I5I C;  1XO5 A;  2OS8 B;  3FWC A;  5I8N A;  1LIN A;  3WHT B;  1KCY A;  1S26 D;  3BUM B;  5PAL A;  2FJU B;  2NCO A;  4HRG A;  3TZ1 A;  1CLM A;  1Y6W A;  1E8A A;  1ZMZ A;  4YI9 A;  1NX1 A;  1JFK A;  2WOR A;  2LAN A;  1SW8 A;  2CNP A;  1WLM A;  2D8N A;  3A8R A;  4GUK A;  4P2Y B;  4PHM A;  4WQ2 A;  2NLN A;  1J7Q A;  3IF7 A;  2M7L A;  3QRX A;  4MLW A;  1KWO C;  3EKJ A;  4YBH B;  2L50 A;  4DCK A;  2BBM A;  2KNE A;  4PE0 A;  1YUR A;  3O78 A;  4ZCU A;  4GPL B;  4A4B A;  2Y1N A;  4M2Q A;  3O6B A;  3K21 A;  4PE7 A;  3LL8 B;  4MBE A;  3FS7 A;  2V53 A;  1S6I A;  3GK1 A;  2I2R E;  1IWQ A;  1OZO A;  1TN4 A;  2G2B A;  2M3W A;  2SCP A;  4AQI A;  2P6B B;  3I5F C;  1PSB A;  2WCE A;  4OKH A;  3SJS A;  4C0J A;  2HPS A;  2JNX A;  1QS7 A;  3VRN A;  1G4Y R;  1DMO A;  3PM8 A;  5I2O A;  2LMU A;  1KQV A;  1TNW A;  5ER4 X;  2EC6 B;  2MLF C;  1DJY A;  1BF5 A;  5KSZ A;  2WND A;  3AKB A;  1AJ5 A;  1IG5 A;  3PN7 C;  2JXC A;  1B4C A;  1N65 A;  4CFR A;  5IBW A;  5AFP A;  3D0Y A;  1MXE A;  1ODB A;  2AAO A;  4PE1 A;  5CSN A;  4IL1 A;  3VGO A;  2M9G A;  3O4Y A;  1QV1 A;  1U5I B;  4PCW A;  4ZCV A;  1OE9 B;  1MUX A;  1IH0 A;  4I5K A;  2Q4U A;  1NX3 A;  3EVR A;  1IQ3 A;  1N2D A;  2LCP A;  2M0R A;  1IQ5 A;  3ZWH A;  2JT8 A;  2F3Y A;  1TOP A;  2H61 A;  4MZJ A;  1NSH A;  2BCX A;  1CTR A;  1SCM B;  3CTN A;  1UHN A;  4F0Z B;  2BL0 C;  4MRX A;  2KBM A;  1OSA A;  4NQG A;  2B1U A;  3DF0 B;  1SR6 C;  1CFD A;  1KFX L;  2O5G A;  2M49 B;  1KSO A;  1CDP A;  1M31 A;  2F2O A;  4P5O E;  2O60 A;  4HRE E;  5KTY A;  3I5G B;  4MVF A;  2FCD A;  3NSO A;  4FTG A;  1EG4 A;  2JUL A;  2M8U A;  1S5G Y;  2M1K B;  2F3Z A;  2KI4 C;  1BR4 B;  1IJ5 A;  1C7W A;  1REC A;  3WHU B;  2MAZ A;  1LA0 A;  1SRA A;  1SYM A;  4MRY A;  2KFH A;  4Q04 A;  3O2P A;  1PAL A;  1SCV A;  3ICB A;  1KFU S;  3LCP C;  1SBJ A;  3CZT X;  1IJ6 A;  4GAO A;  3OHM B;  4GFT A;  2LVK A;  3DD4 A;  3BUO B;  3JVT C;  1DJX A;  1LA3 A;  1RJV A;  3CR5 X;  2ISD A;  3A4U B;  1A29 A;  4JPZ B;  3CGA A;  1S3P A;  4N1F A;  1JSA A;  1J7P A;  2PRU A;  1CM4 A;  1UHH A;  3DVE A;  1CFC A;  1QIW A;  4XYN A;  2K2F A;  1YR5 A;  1QJT A;  4DIR A;  4GBA A;  3WNX B;  1KFU L;  1Y1X A;  1YTZ C;  2BKI B;  1BLQ A;  5CPV A;  3KEV A;  3D0Y B;  4HSZ A;  1KQM C;  1XFU O;  5F6T A;  1KK8 B;  1MXL C;  1NPQ A;  2M29 A;  3AAK A;  2KFF A;  4GGN A;  1V1G A;  1MHO A;  1B47 A;  2LUX A;  3IQO A;  4MEW A;  3LK1 A;  3I5H C;  3TUY C;  1ZAC A;  3E3R A;  2Y1M A;  4PDZ A;  1OOJ A;  1NCY A;  1F54 A;  1YX8 A;  4BY5 A;  1M63 B;  2JZI A;  4I5J A;  1F71 A;  1OMD A;  1CB1 A;  1XFV O;  1W7J B;  1AK8 A;  3BOW B;  1UUR A;  1DVI A;  3AKA A;  3OB2 B;  1JWD A;  2I18 A;  3DVK A;  1FBV A;  2L98 A;  4XJK B;  1CMG A;  2OPO A;  5KU1 A;  1KK7 Y;  2NXQ A;  2JTZ A;  3SG3 A;  1S1E A;  2OS8 C;  1NX2 A;  1QIV A;  1QX5 B;  3D10 A;  5B8I B;  1SL7 A;  1DJW A;  2KAV A;  1SY9 A;  5JOL A;  2NZ0 A;  5TNC A;  2E6W A;  2K61 A;  2LHI A;  2WOS A;  1AVS A;  4ORB B;  5GQQ C;  5AXI A;  1WDC B;  2GV5 A;  1JFJ A;  1DGU A;  4YRU A;  4YGD B;  1QAS A;  1XFY O;  1B7T Y;  2PVB A;  1TNX A;  3DVM A;  1UUS A;  1N0Y A;  1NP8 A;  1TCO B;  3EKH A;  4OVN F;  3SIA A;  3TS5 B;  1A4P A;  2KFG A;  2F2P A;  1A75 B;  5ER5 A;  2JU0 A;  2LV7 A;  1L7Z A;  2LC5 A;  5HLO A;  1G8I A;  4JWQ A;  5HKW A;  1DF0 B;  2CT9 A;  2KHN A;  1DJH A;  3GK4 X;  1FI6 A;  1S36 A;  3SG4 A;  3BUN B;  1MWN A;  2JOJ A;  1GGZ A;  2LLU A;  3SG7 A;  2LUC A;  1EL4 A;  2EC6 C;  1K90 D;  1BG1 A;  1L2O B;  3EVU A;  4YGA A;  3I5F B;  1YRT B;  4UPG A;  2GGM A;  1WY9 A;  5DKN A;  2BKH B;  2KSP A;  1SMG A;  2AMI A;  3OX6 A;  5HLV A;  2KAY A;  1C07 A;  1EXR A;  2K8M B;  1CLL A;  2QPT A;  3OP0 A;  1UHJ A;  2LHL A;  4CFQ A;  2BE4 A;  2MRD A;  5D7F A;  2QAC A;  2JWW A;  1K8U A;  1NCZ A;  5CSI A;  3RLZ A;  2K7C A;  1A2X A;  2BCA A;  1AJ4 A;  3JTD C;  1SCM C;  4R1E A;  3SG2 A;  1OQP A;  4ETO A;  3PAL A;  1B8L A;  4DUQ A;  2PSR A;  2M7N A;  1ALV A;  1AHR A;  2K7D A;  1SK6 D;  4E68 A;  5HKZ A;  5CSJ A;  5AAN A;  1DJI A;  3TDU A;  3I5G C;  4GNK B;  1CM1 A;  1QV0 A;  1B8C A;  2BL0 B;  2VRG A;  1SR6 B;  3FWB A;  1DJG A;  2KI6 D;  1B9A A;  4HRH A;  1FF1 A;  1Y1A A;  4I5N B;  4PAL A;  2ZKM X;  3CR2 A;  4NDC A;  1QVI Z;  4MZK A;  1M39 A;  2KDH A;  2KQ6 A;  2HQW A;  1TNQ A;  1M45 A;  2ZRS A;  2KBI A;  2L4I A;  1FI5 A;  1Y1U A;  2CBL A;  2PMY A;  4A4C A;  2KGR A;  4JQ0 D;  2MA2 A;  2CTN A;  2LLT A;  4ORA B;  1H8B A;  4N5X A;  3HCM A;  5BPJ A;  2ZFD A;  3KHE A;  3TDI A;  2KQY A;  1LVC D;  2L51 A;  2LNK A;  3AAJ A;  3LLE A;  1K93 D;  1QAT A;  1XVJ A;  3NSI A;  1HT9 A;  2JT3 A;  4M2P A;  5HYD A;  3VRP A;  1ZUZ A;  1YUS A;  3KO0 A;  3NSK A;  1QXP A;  1V1F A;  2BEC A;  2COL B;  1B7T Z;  2JTT A;  1YVL A;  1KK8 C;  1VRK A;  2CXJ A;  2WCF A;  1K94 A;  3IQQ A;  3CLN A;  1YUU A;  2ZN9 A;  1UP5 A;  3VRQ A;  4QJ4 B;  2FOT A;  1J7R A;  2WC8 A;  1S6J A;  1H4B A;  2IS9 A;  1GJY A;  4MSP A;  1JUO A;  1BT6 A;  3ZNI A;  2I7A A;  1GQM A;  1BJF A;  2OTG B;  5K89 A;  1K96 A;  3KPX A;  1TIZ A;  4YGC B;  1K2H A;  1A03 A;  4TNC A;  2LP2 A;  1Y0V H;  2TN4 A;  2FCE A;  1WRL A;  1XYD A;  1QLS A;  2NCP A;  4GGF C;  1G33 A;  1U5I A;  4PHK A;  3CWG A;  1PK0 D;  4I5L B;  5DKR A;  2KOT A;  1FPW A;  1BR1 B;  4YGB B;  1OZS A;  2K0J A;  4CLN A;  1LXF C;  3I5I B;  1XA5 A;  1ALW A;  1XK4 C;  1OMV A;  4OV2 A;  1JF2 A;  1K9U A;  1NWD A;  1F70 A;  1RTP 1;  1X02 A;  2A4J A;  1NCX A;  2MLE C;  1JF0 A;  2JT0 A;  3OX5 A;  1WDC C; 
#chains in the Genus database with same CATH topology
 1DT7 B;  1SL9 A;  2KYC A;  2LM5 A;  2LE9 B;  1T14 A;  2LVJ A;  2KYF A;  1K9K A;  1ZOT B;  2JPO A;  5FYX A;  3EK4 A;  2LLS A;  2PAL A;  4ORC B;  4DRW A;  3HX4 A;  3LK0 A;  3B88 A;  1JC2 A;  3TS5 C;  2LMV A;  3SG5 A;  2MBX A;  5FI7 A;  1MF8 B;  1TWO A;  4OCI A;  1P28 A;  1KWO B;  4QJ5 B;  4NDD A;  1CDM A;  2ZRT A;  3EK7 A;  1NUB A;  4U8D A;  2RGI A;  3FIA A;  1F55 A;  1F4Q A;  1TUJ A;  2CCM A;  3PLF B;  4PHJ A;  4MN0 A;  1EG3 A;  1K95 A;  1S5G Z;  1UHK A;  1YVH A;  1QLK A;  2E30 A;  2MHH A;  1IRJ A;  2R2I A;  3BXK A;  2BCB A;  2HET A;  5G08 A;  4D1E A;  5JJG A;  1UWO A;  1C3Y A;  1HQV A;  1TTX A;  1F8H A;  1RFJ A;  1DGV A;  1D1O A;  2G9B A;  2JC2 A;  3C1V A;  1L2O C;  1XFW O;  1KSM A;  1GGW A;  1WRK A;  4BY4 A;  2BE6 A;  3N7H A;  1CFP A;  2L4H A;  2PAS A;  1QWV A;  5D69 A;  1ZFS A;  3PN7 B;  1WLZ A;  1AP4 A;  2LAP A;  1CLB A;  1QX7 A;  1MQ1 A;  3BYA A;  3DF0 A;  1XFZ O;  3R1O A;  2H2K A;  5AER A;  4WQ3 A;  3DZT A;  2WCM A;  4NDB A;  2EGD A;  2F33 A;  1DTL A;  2K2A A;  2ZN8 A;  3EK8 A;  3PFV A;  4ICB A;  1IKU A;  3BUX B;  3NSL A;  1XFX O;  2KGB C;  1KFX S;  1BU3 A;  4FQO A;  3PAT A;  3RM1 A;  3WXA A;  4FQT A;  1Z4H A;  2WCB A;  1SKT A;  4MZL A;  2GGZ A;  2HF5 A;  2EHB A;  3KF9 A;  3VRO A;  4INX A;  1QX2 A;  1TNP A;  2M97 A;  1PUL A;  1F4O A;  1EJ3 A;  1UHI A;  2WC5 A;  3BOW A;  1J1D A;  2JRF A;  3B86 A;  3JTD B;  5J3X A;  4N1G A;  3SIB A;  1BMO A;  2DOQ A;  1W7I B;  2JQ6 A;  4XJK A;  4GGF A;  1R6P A;  4YI8 A;  3QME A;  1WRZ A;  2WCL A;  1YRU B;  2JNF A;  2K7B A;  2MJW B;  1BOD A;  2BAP A;  1J7O A;  2KI4 B;  1RWY A;  4DS7 A;  2F8P A;  4CID A;  1DJZ A;  1XK4 A;  4L9M A;  1RRO A;  3CR4 X;  3H4S E;  1KK7 Z;  1NIW A;  5CSF A;  1C7V A;  3PSR A;  1IGV A;  1YUT A;  4YGE B;  1CMF A;  2L5Y A;  3EVV A;  3GOF A;  1OMR A;  4IJ7 A;  2LMT A;  4CPV A;  1EH2 A;  2LVI A;  1SNL A;  2ZNE A;  3S0F A;  1QTX A;  2Y5I A;  5AEQ A;  3V2L A;  3JVT B;  3BUW B;  1FW4 A;  2I94 A;  1RK9 A;  3SG6 A;  1SPY A;  4USL A;  3GK2 A;  1A75 A;  2BBN A;  2LP3 A;  4JD9 A;  2L2E A;  4OR9 B;  1DF0 A;  1R2U A;  1B1G A;  4C0K A;  2KI6 C;  5DKQ A;  4PE4 A;  3S0A A;  2AUC A;  2JPT A;  2K7O A;  2P70 A;  4M2O A;  1PVB A;  1PSR A;  3SS5 A;  4AQJ A;  3D74 A;  1PVA A;  3CS1 A;  1CFF A;  3VRR A;  1OOF A;  3MSE B;  1J1E A;  1KQM B;  1MR8 A;  1CKK A;  2L5X B;  1YX7 A;  5I2L A;  1DQE A;  5HKY A;  1AUI B;  1TCF A;  1LKJ A;  3BQ3 A;  1B8R A;  2H61 C;  1Z2C B;  3F45 A;  4WRI A;  1SL8 A;  4C0L A;  3TDZ A;  1CDN A;  1NX0 A;  2OTG C;  4PT1 A;  3I5H B;  2KAX A;  3OB1 B;  3TUY B;  1CDL A;  1M46 A;  1S6C A;  2JXL A;  3B7A A;  3DVJ A;  4QJ3 B;  4AOM A;  4PHN A;  1JBA A;  3M0W A;  2Q91 A;  1K9P A;  1J55 A;  2M1U A;  1NYA A;  3S0G A;  3NXA A;  1TRF A;  1QVI Y;  5I2Q A;  1CNP A;  2SAS A;  2Y4Q A;  1Q80 A;  2L0P A;  1XFR A;  2ZND A;  2LVV A;  1PRW A;  2HQ8 A;  3BJH A;  3I5I C;  1XO5 A;  1BOC A;  2OS8 B;  3FWC A;  5I8N A;  5EL2 A;  1LIN A;  3DY9 A;  3WHT B;  1KCY A;  1S26 D;  3BUM B;  5PAL A;  2FJU B;  2NCO A;  4HRG A;  3TZ1 A;  1CLM A;  1Y6W A;  1E8A A;  1W9Z A;  1ZMZ A;  4YI9 A;  1OOG A;  1NX1 A;  1JFK A;  2WOR A;  2LAN A;  1SW8 A;  2GTE A;  2CNP A;  1WLM A;  2D8N A;  2P71 A;  3A8R A;  3Q8I A;  4GUK A;  4P2Y B;  2NLN A;  4PHM A;  4WQ2 A;  3IF7 A;  1J7Q A;  2M7L A;  3DYE A;  3QRX A;  4MLW A;  1KWO C;  3EKJ A;  4YBH B;  2L50 A;  2WCJ A;  4DCK A;  2BBM A;  2KNE A;  4PE0 A;  1YUR A;  3O78 A;  4ZCU A;  4GPL B;  4A4B A;  2Y1N A;  4M2Q A;  3O6B A;  3K21 A;  3OGN A;  2KLE A;  4PE7 A;  3LL8 B;  4MBE A;  3FS7 A;  2V53 A;  1S6I A;  3GK1 A;  2I2R E;  1IWQ A;  1OZO A;  1TN4 A;  2G2B A;  2M3W A;  2SCP A;  3SS4 A;  2P6B B;  3I5F C;  4AQI A;  1PSB A;  2WCE A;  1DC1 A;  4OKH A;  3SJS A;  3NHT A;  4C0J A;  3CYZ A;  2HPS A;  2JNX A;  1QS7 A;  3VRN A;  1G4Y R;  1DMO A;  3PM8 A;  5I2O A;  2LMU A;  1KQV A;  1TNW A;  5ER4 X;  2EC6 B;  2MLF C;  2QEB A;  1OOI X;  1DJY A;  1BF5 A;  5KSZ A;  2WND A;  3AKB A;  1AJ5 A;  1IG5 A;  3PN7 C;  2JXC A;  1B4C A;  1N65 A;  4CFR A;  3CZ0 A;  5IBW A;  5AFP A;  3D0Y A;  1GM0 A;  1MXE A;  1ODB A;  2AAO A;  4PE1 A;  5CSN A;  4IL1 A;  5FI6 A;  3VGO A;  2M9G A;  3O4Y A;  3B6X A;  1QV1 A;  3D77 A;  1U5I B;  4PCW A;  4ZCV A;  1OE9 B;  2ERB A;  1MUX A;  1IH0 A;  4I5K A;  2Q4U A;  1NX3 A;  1LS8 A;  3EVR A;  3L47 A;  1IQ3 A;  1N2D A;  2LCP A;  2M0R A;  2KPH A;  1IQ5 A;  3ZWH A;  2JT8 A;  2F3Y A;  1TOP A;  2H61 A;  4MZJ A;  1NSH A;  2BCX A;  1CTR A;  1SCM B;  3CTN A;  1UHN A;  4F0Z B;  2BL0 C;  4MRX A;  2KBM A;  1OSA A;  3PM2 A;  4NQG A;  2B1U A;  3DF0 B;  1SR6 C;  1CFD A;  1KFX L;  2O5G A;  2M49 B;  1KSO A;  1CDP A;  1M31 A;  2F2O A;  4P5O E;  2O60 A;  4HRE E;  5KTY A;  3I5G B;  4MVF A;  2FCD A;  3NSO A;  4FTG A;  1EG4 A;  2JUL A;  2M8U A;  1S5G Y;  2M1K B;  2F3Z A;  2KI4 C;  1BR4 B;  1IJ5 A;  1C7W A;  3PJI A;  5FI2 A;  1REC A;  3WHU B;  2MAZ A;  1LA0 A;  1SRA A;  1SYM A;  4MRY A;  2KFH A;  4Q04 A;  3O2P A;  1PAL A;  1SCV A;  2WC6 A;  3ICB A;  3D76 A;  3B87 A;  1KFU S;  3LCP C;  1SBJ A;  3CZT X;  1IJ6 A;  4GAO A;  3OHM B;  4GFT A;  2LVK A;  3DD4 A;  3BUO B;  3JVT C;  1DJX A;  1LA3 A;  1RJV A;  3CR5 X;  2ISD A;  3A4U B;  1A29 A;  4JPZ B;  3CGA A;  1S3P A;  4N1F A;  1JSA A;  3UNW A;  1J7P A;  3K1E A;  2PRU A;  1CM4 A;  1UHH A;  1OOH A;  3DVE A;  1CFC A;  1QIW A;  4XYN A;  2K2F A;  1YR5 A;  1QJT A;  4DIR A;  3CZ1 A;  4GBA A;  3WNX B;  1KFU L;  1Y1X A;  1YTZ C;  2BKI B;  1BLQ A;  5CPV A;  3KEV A;  3D0Y B;  4HSZ A;  1KQM C;  1XFU O;  5F6T A;  1KK8 B;  1MXL C;  1NPQ A;  2M29 A;  3AAK A;  2KFF A;  4GGN A;  1V1G A;  1MHO A;  3EG5 B;  1B47 A;  3FE9 A;  2LUX A;  3IQO A;  4MEW A;  3LK1 A;  2QEO A;  3I5H C;  3TUY C;  1ZAC A;  3E3R A;  3DXL A;  2Y1M A;  4PDZ A;  1OOJ A;  1NCY A;  1F54 A;  1YX8 A;  4BY5 A;  1M63 B;  2JZI A;  4I5J A;  1F71 A;  1OMD A;  1CB1 A;  1XFV O;  1W7J B;  1AK8 A;  3BOW B;  3D78 A;  1UUR A;  3NGV A;  1DVI A;  3AKA A;  3OB2 B;  1JWD A;  2I18 A;  3DVK A;  1FBV A;  3FE8 A;  2L98 A;  4INW A;  4XJK B;  1CMG A;  2OPO A;  5KU1 A;  3R1V A;  3SS3 A;  1KK7 Y;  2NXQ A;  2JTZ A;  3SG3 A;  1S1E A;  2OS8 C;  1NX2 A;  1QIV A;  1QX5 B;  3D10 A;  5B8I B;  1IIO A;  1SL7 A;  1DJW A;  2KAV A;  1SY9 A;  5JOL A;  2NZ0 A;  5TNC A;  2E6W A;  5HL1 A;  2K61 A;  2LHI A;  2WOS A;  3OBV A;  1AVS A;  4ORB B;  5GQQ C;  3R1P A;  5AXI A;  5D3O A;  1WDC B;  2GV5 A;  1JFJ A;  1DGU A;  4YRU A;  4YGD B;  1QAS A;  1XFY O;  1B7T Y;  2PVB A;  3CAB A;  1TNX A;  3DVM A;  1UUS A;  1N0Y A;  1NP8 A;  1TCO B;  3EKH A;  3VB1 A;  4OVN F;  3SIA A;  3TS5 B;  1A4P A;  3BFB A;  2KFG A;  2F2P A;  1A75 B;  5ER5 A;  2JU0 A;  2LV7 A;  2QDI A;  1L7Z A;  2LC5 A;  5HLO A;  1G8I A;  4JWQ A;  5HKW A;  1DF0 B;  2CT9 A;  2KHN A;  1DJH A;  3GK4 X;  1FI6 A;  1S36 A;  3SG4 A;  3BUN B;  3IVT A;  1MWN A;  2JOJ A;  1GGZ A;  2LLU A;  2KLD A;  3SG7 A;  2LUC A;  1EL4 A;  2EC6 C;  2QEV A;  3BFH A;  1K90 D;  1BG1 A;  4OZD A;  1L2O B;  3EVU A;  4YGA A;  3I5F B;  1YRT B;  4UPG A;  5I94 A;  2GGM A;  3D75 A;  1WY9 A;  5DKN A;  2BKH B;  2KSP A;  1SMG A;  2AMI A;  3OX6 A;  4F7F A;  1DEK A;  5HLV A;  2KAY A;  1C07 A;  1EXR A;  3D73 A;  2K8M B;  1CLL A;  2QPT A;  3OP0 A;  1UHJ A;  2LHL A;  4CFQ A;  2BE4 A;  2MRD A;  3CZ2 A;  5D7F A;  2QAC A;  2JWW A;  1K8U A;  1NCZ A;  3FE6 A;  3NHI A;  5CSI A;  3RLZ A;  2K7C A;  2K60 A;  1A2X A;  2BCA A;  1AJ4 A;  3JTD C;  1SCM C;  4R1E A;  3SG2 A;  1OQP A;  4ETO A;  1OW4 A;  3PAL A;  1TUZ A;  1B8L A;  4JKT A;  4DUQ A;  2PSR A;  2M7N A;  1ALV A;  1AHR A;  2K7D A;  1SK6 D;  4E68 A;  5HKZ A;  5CSJ A;  5AAN A;  1DJI A;  3TDU A;  3I5G C;  4GNK B;  1CM1 A;  1QV0 A;  1B8C A;  2BL0 B;  2VRG A;  1DEL A;  1SR6 B;  3FWB A;  3L4L A;  1DJG A;  2KI6 D;  1B9A A;  4HRH A;  1FF1 A;  1Y1A A;  4I5N B;  4PAL A;  3CDN A;  2ZKM X;  3CR2 A;  4NDC A;  1QVI Z;  4MZK A;  1M39 A;  2KDH A;  2KQ6 A;  2HQW A;  2H8V A;  1TNQ A;  1M45 A;  2WCK A;  3S0B A;  2ZRS A;  2KBI A;  2L4I A;  1FI5 A;  1Y1U A;  3BFA A;  2CBL A;  2PMY A;  4A4C A;  3S0E A;  2KGR A;  4JQ0 D;  2MA2 A;  2CTN A;  2L2C A;  2LLT A;  4ORA B;  1H8B A;  4N5X A;  3HCM A;  5BPJ A;  2ZFD A;  3R72 A;  3KHE A;  1ORG A;  2KQY A;  1LVC D;  2L51 A;  2LNK A;  3AAJ A;  3LLE A;  3TDI A;  1K93 D;  1QAT A;  1XVJ A;  3NSI A;  1HT9 A;  2JT3 A;  4M2P A;  3RZS A;  5HYD A;  3VRP A;  1ZUZ A;  1SSE B;  1YUS A;  3KO0 A;  3NSK A;  1QXP A;  2PYQ A;  1V1F A;  2BEC A;  2COL B;  1B7T Z;  2JTT A;  1YVL A;  3UO9 A;  1KK8 C;  1VRK A;  2CXJ A;  2WCF A;  1K94 A;  3IQQ A;  3CLN A;  1YUU A;  2ZN9 A;  1UP5 A;  3VRQ A;  4QJ4 B;  3L4A A;  3O4X A;  2FOT A;  1J7R A;  2WC8 A;  1S6J A;  1H4B A;  2IS9 A;  1GJY A;  4MSP A;  1JUO A;  1BT6 A;  3ZNI A;  2I7A A;  1GQM A;  1BJF A;  2OTG B;  5K89 A;  1K96 A;  1C3Z A;  3KPX A;  1TIZ A;  4YGC B;  1K2H A;  1A03 A;  4TNC A;  2WCH A;  2LP2 A;  1Y0V H;  2TN4 A;  2FCE A;  1WRL A;  1XYD A;  1QLS A;  2NCP A;  4GGF C;  1G33 A;  1U5I A;  4PHK A;  2QEH A;  3CWG A;  1PK0 D;  4I5L B;  5DKR A;  2BNX A;  2PQL A;  5DIC A;  2KOT A;  1FPW A;  1BR1 B;  4YGB B;  1OZS A;  2K0J A;  4CLN A;  1LXF C;  3I5I B;  1XA5 A;  1ALW A;  1XK4 C;  1OMV A;  2YGU A;  4OV2 A;  1JF2 A;  1K9U A;  1NWD A;  1F70 A;  1RTP 1;  4KYN A;  1X02 A;  2A4J A;  1NCX A;  3S0D A;  2MLE C;  1JF0 A;  2FJY A;  2JT0 A;  3OX5 A;  1WDC C; 
#chains in the Genus database with same CATH homology
 1DT7 B;  1SL9 A;  2KYC A;  2LM5 A;  2LE9 B;  2LVJ A;  2KYF A;  1K9K A;  1ZOT B;  5FYX A;  3EK4 A;  2LLS A;  2PAL A;  4ORC B;  4DRW A;  3HX4 A;  3LK0 A;  1JC2 A;  3TS5 C;  2LMV A;  3SG5 A;  2MBX A;  1MF8 B;  4OCI A;  4QJ5 B;  1KWO B;  4NDD A;  1CDM A;  2ZRT A;  3EK7 A;  1NUB A;  4U8D A;  2RGI A;  3FIA A;  1F55 A;  1F4Q A;  4PHJ A;  2CCM A;  3PLF B;  4MN0 A;  1EG3 A;  1K95 A;  1S5G Z;  1UHK A;  1YVH A;  1QLK A;  2E30 A;  2MHH A;  1IRJ A;  2R2I A;  3BXK A;  2BCB A;  2HET A;  5G08 A;  4D1E A;  5JJG A;  1UWO A;  1F8H A;  1HQV A;  1TTX A;  1RFJ A;  1DGV A;  1D1O A;  2G9B A;  2JC2 A;  3C1V A;  1L2O C;  1XFW O;  1KSM A;  1GGW A;  1WRK A;  4BY4 A;  2BE6 A;  1CFP A;  2L4H A;  2PAS A;  5D69 A;  1ZFS A;  3PN7 B;  1WLZ A;  1AP4 A;  2LAP A;  1CLB A;  1QX7 A;  1MQ1 A;  3BYA A;  3DF0 A;  1XFZ O;  2H2K A;  5AER A;  4WQ3 A;  4NDB A;  2EGD A;  2F33 A;  1DTL A;  2K2A A;  2ZN8 A;  3EK8 A;  3PFV A;  4ICB A;  1IKU A;  3BUX B;  3NSL A;  1XFX O;  2KGB C;  1KFX S;  1BU3 A;  4FQO A;  3PAT A;  3RM1 A;  3WXA A;  2WCB A;  1SKT A;  4MZL A;  2GGZ A;  2HF5 A;  2EHB A;  3KF9 A;  3VRO A;  1QX2 A;  1TNP A;  2M97 A;  1PUL A;  1F4O A;  1EJ3 A;  1UHI A;  3BOW A;  1J1D A;  2JRF A;  3JTD B;  5J3X A;  4N1G A;  3SIB A;  1BMO A;  2DOQ A;  1W7I B;  2JQ6 A;  4XJK A;  4GGF A;  1R6P A;  4YI8 A;  1WRZ A;  1YRU B;  2JNF A;  2K7B A;  2MJW B;  1BOD A;  1J7O A;  2KI4 B;  1RWY A;  4DS7 A;  2F8P A;  4CID A;  1DJZ A;  1XK4 A;  4L9M A;  1RRO A;  3CR4 X;  3H4S E;  1KK7 Z;  1NIW A;  5CSF A;  1C7V A;  3PSR A;  1IGV A;  1YUT A;  4YGE B;  1CMF A;  3EVV A;  3GOF A;  1OMR A;  4CPV A;  2LMT A;  1EH2 A;  2LVI A;  1SNL A;  2ZNE A;  1QTX A;  2Y5I A;  5AEQ A;  3JVT B;  3BUW B;  1FW4 A;  2I94 A;  1RK9 A;  3SG6 A;  1SPY A;  4USL A;  3GK2 A;  1A75 A;  2BBN A;  2LP3 A;  2L2E A;  4OR9 B;  1DF0 A;  1R2U A;  1B1G A;  4C0K A;  2KI6 C;  5DKQ A;  4PE4 A;  2AUC A;  2JPT A;  2K7O A;  4M2O A;  1PVB A;  1PSR A;  4AQJ A;  1PVA A;  3CS1 A;  1CFF A;  3VRR A;  3MSE B;  1J1E A;  1KQM B;  1MR8 A;  1CKK A;  2L5X B;  1YX7 A;  5I2L A;  5HKY A;  1AUI B;  1TCF A;  1LKJ A;  3BQ3 A;  1B8R A;  2H61 C;  3F45 A;  4WRI A;  1SL8 A;  4C0L A;  3TDZ A;  1CDN A;  1NX0 A;  2OTG C;  3I5H B;  2KAX A;  3OB1 B;  3TUY B;  1CDL A;  1M46 A;  1S6C A;  2JXL A;  3DVJ A;  4QJ3 B;  4AOM A;  4PHN A;  1JBA A;  3M0W A;  2Q91 A;  1K9P A;  1J55 A;  2M1U A;  1NYA A;  3NXA A;  1TRF A;  1QVI Y;  5I2Q A;  1CNP A;  2SAS A;  2Y4Q A;  1Q80 A;  2L0P A;  2ZND A;  2LVV A;  1PRW A;  2HQ8 A;  1BOC A;  3I5I C;  1XO5 A;  2OS8 B;  3FWC A;  5I8N A;  1LIN A;  3WHT B;  1KCY A;  1S26 D;  3BUM B;  5PAL A;  2FJU B;  2NCO A;  4HRG A;  3TZ1 A;  1CLM A;  1Y6W A;  1E8A A;  1ZMZ A;  4YI9 A;  1NX1 A;  1JFK A;  2WOR A;  2LAN A;  1SW8 A;  2CNP A;  1WLM A;  2D8N A;  3A8R A;  4GUK A;  4P2Y B;  4PHM A;  4WQ2 A;  2NLN A;  1J7Q A;  3IF7 A;  2M7L A;  3QRX A;  4MLW A;  1KWO C;  3EKJ A;  4YBH B;  2L50 A;  4DCK A;  2BBM A;  2KNE A;  4PE0 A;  1YUR A;  3O78 A;  4ZCU A;  4GPL B;  4A4B A;  2Y1N A;  4M2Q A;  3O6B A;  3K21 A;  4PE7 A;  3LL8 B;  4MBE A;  3FS7 A;  2V53 A;  1S6I A;  3GK1 A;  2I2R E;  1IWQ A;  1OZO A;  1TN4 A;  2G2B A;  2M3W A;  2SCP A;  4AQI A;  2P6B B;  3I5F C;  1PSB A;  2WCE A;  4OKH A;  3SJS A;  4C0J A;  2HPS A;  2JNX A;  1QS7 A;  3VRN A;  1G4Y R;  1DMO A;  3PM8 A;  5I2O A;  2LMU A;  1KQV A;  1TNW A;  5ER4 X;  2EC6 B;  2MLF C;  1DJY A;  1BF5 A;  5KSZ A;  2WND A;  3AKB A;  1AJ5 A;  1IG5 A;  3PN7 C;  2JXC A;  1B4C A;  1N65 A;  4CFR A;  5IBW A;  5AFP A;  3D0Y A;  1MXE A;  1ODB A;  2AAO A;  4PE1 A;  5CSN A;  4IL1 A;  3VGO A;  2M9G A;  3O4Y A;  1QV1 A;  1U5I B;  4PCW A;  4ZCV A;  1OE9 B;  1MUX A;  1IH0 A;  4I5K A;  2Q4U A;  1NX3 A;  3EVR A;  1IQ3 A;  1N2D A;  2LCP A;  2M0R A;  1IQ5 A;  3ZWH A;  2JT8 A;  2F3Y A;  1TOP A;  2H61 A;  4MZJ A;  1NSH A;  2BCX A;  1CTR A;  1SCM B;  3CTN A;  1UHN A;  4F0Z B;  2BL0 C;  4MRX A;  2KBM A;  1OSA A;  4NQG A;  2B1U A;  3DF0 B;  1SR6 C;  1CFD A;  1KFX L;  2O5G A;  2M49 B;  1KSO A;  1CDP A;  1M31 A;  2F2O A;  4P5O E;  2O60 A;  4HRE E;  5KTY A;  3I5G B;  4MVF A;  2FCD A;  3NSO A;  4FTG A;  1EG4 A;  2JUL A;  2M8U A;  1S5G Y;  2M1K B;  2F3Z A;  2KI4 C;  1BR4 B;  1IJ5 A;  1C7W A;  1REC A;  3WHU B;  2MAZ A;  1LA0 A;  1SRA A;  1SYM A;  4MRY A;  2KFH A;  4Q04 A;  3O2P A;  1PAL A;  1SCV A;  3ICB A;  1KFU S;  3LCP C;  1SBJ A;  3CZT X;  1IJ6 A;  4GAO A;  3OHM B;  4GFT A;  2LVK A;  3DD4 A;  3BUO B;  3JVT C;  1DJX A;  1LA3 A;  1RJV A;  3CR5 X;  2ISD A;  3A4U B;  1A29 A;  4JPZ B;  3CGA A;  1S3P A;  4N1F A;  1JSA A;  1J7P A;  2PRU A;  1CM4 A;  1UHH A;  3DVE A;  1CFC A;  1QIW A;  4XYN A;  2K2F A;  1YR5 A;  1QJT A;  4DIR A;  4GBA A;  3WNX B;  1KFU L;  1Y1X A;  1YTZ C;  2BKI B;  1BLQ A;  5CPV A;  3KEV A;  3D0Y B;  4HSZ A;  1KQM C;  1XFU O;  5F6T A;  1KK8 B;  1MXL C;  1NPQ A;  2M29 A;  3AAK A;  2KFF A;  4GGN A;  1V1G A;  1MHO A;  1B47 A;  2LUX A;  3IQO A;  4MEW A;  3LK1 A;  3I5H C;  3TUY C;  1ZAC A;  3E3R A;  2Y1M A;  4PDZ A;  1OOJ A;  1NCY A;  1F54 A;  1YX8 A;  4BY5 A;  1M63 B;  2JZI A;  4I5J A;  1F71 A;  1OMD A;  1CB1 A;  1XFV O;  1W7J B;  1AK8 A;  3BOW B;  1UUR A;  1DVI A;  3AKA A;  3OB2 B;  1JWD A;  2I18 A;  3DVK A;  1FBV A;  2L98 A;  4XJK B;  1CMG A;  2OPO A;  5KU1 A;  1KK7 Y;  2NXQ A;  2JTZ A;  3SG3 A;  1S1E A;  2OS8 C;  1NX2 A;  1QIV A;  1QX5 B;  3D10 A;  5B8I B;  1SL7 A;  1DJW A;  2KAV A;  1SY9 A;  5JOL A;  2NZ0 A;  5TNC A;  2E6W A;  2K61 A;  2LHI A;  2WOS A;  1AVS A;  4ORB B;  5GQQ C;  5AXI A;  1WDC B;  2GV5 A;  1JFJ A;  1DGU A;  4YRU A;  4YGD B;  1QAS A;  1XFY O;  1B7T Y;  2PVB A;  1TNX A;  3DVM A;  1UUS A;  1N0Y A;  1NP8 A;  1TCO B;  3EKH A;  4OVN F;  3SIA A;  3TS5 B;  1A4P A;  2KFG A;  2F2P A;  1A75 B;  5ER5 A;  2JU0 A;  2LV7 A;  1L7Z A;  2LC5 A;  5HLO A;  1G8I A;  4JWQ A;  5HKW A;  1DF0 B;  2CT9 A;  2KHN A;  1DJH A;  3GK4 X;  1FI6 A;  1S36 A;  3SG4 A;  3BUN B;  1MWN A;  2JOJ A;  1GGZ A;  2LLU A;  3SG7 A;  2LUC A;  1EL4 A;  2EC6 C;  1K90 D;  1BG1 A;  1L2O B;  3EVU A;  4YGA A;  3I5F B;  1YRT B;  4UPG A;  2GGM A;  1WY9 A;  5DKN A;  2BKH B;  2KSP A;  1SMG A;  2AMI A;  3OX6 A;  5HLV A;  2KAY A;  1C07 A;  1EXR A;  2K8M B;  1CLL A;  2QPT A;  3OP0 A;  1UHJ A;  2LHL A;  4CFQ A;  2BE4 A;  2MRD A;  5D7F A;  2QAC A;  2JWW A;  1K8U A;  1NCZ A;  5CSI A;  3RLZ A;  2K7C A;  1A2X A;  2BCA A;  1AJ4 A;  3JTD C;  1SCM C;  4R1E A;  3SG2 A;  1OQP A;  4ETO A;  3PAL A;  1B8L A;  4DUQ A;  2PSR A;  2M7N A;  1ALV A;  1AHR A;  2K7D A;  1SK6 D;  4E68 A;  5HKZ A;  5CSJ A;  5AAN A;  1DJI A;  3TDU A;  3I5G C;  4GNK B;  1CM1 A;  1QV0 A;  1B8C A;  2BL0 B;  2VRG A;  1SR6 B;  3FWB A;  1DJG A;  2KI6 D;  1B9A A;  4HRH A;  1FF1 A;  1Y1A A;  4I5N B;  4PAL A;  2ZKM X;  3CR2 A;  4NDC A;  1QVI Z;  4MZK A;  1M39 A;  2KDH A;  2KQ6 A;  2HQW A;  1TNQ A;  1M45 A;  2ZRS A;  2KBI A;  2L4I A;  1FI5 A;  1Y1U A;  2CBL A;  2PMY A;  4A4C A;  2KGR A;  4JQ0 D;  2MA2 A;  2CTN A;  2LLT A;  4ORA B;  1H8B A;  4N5X A;  3HCM A;  5BPJ A;  2ZFD A;  3KHE A;  3TDI A;  2KQY A;  1LVC D;  2L51 A;  2LNK A;  3AAJ A;  3LLE A;  1K93 D;  1QAT A;  1XVJ A;  3NSI A;  1HT9 A;  2JT3 A;  4M2P A;  5HYD A;  3VRP A;  1ZUZ A;  1YUS A;  3KO0 A;  3NSK A;  1QXP A;  1V1F A;  2BEC A;  2COL B;  1B7T Z;  2JTT A;  1YVL A;  1KK8 C;  1VRK A;  2CXJ A;  2WCF A;  1K94 A;  3IQQ A;  3CLN A;  1YUU A;  2ZN9 A;  1UP5 A;  3VRQ A;  4QJ4 B;  2FOT A;  1J7R A;  2WC8 A;  1S6J A;  1H4B A;  2IS9 A;  1GJY A;  4MSP A;  1JUO A;  1BT6 A;  3ZNI A;  2I7A A;  1GQM A;  1BJF A;  2OTG B;  5K89 A;  1K96 A;  3KPX A;  1TIZ A;  4YGC B;  1K2H A;  1A03 A;  4TNC A;  2LP2 A;  1Y0V H;  2TN4 A;  2FCE A;  1WRL A;  1XYD A;  1QLS A;  2NCP A;  4GGF C;  1G33 A;  1U5I A;  4PHK A;  3CWG A;  1PK0 D;  4I5L B;  5DKR A;  2KOT A;  1FPW A;  1BR1 B;  4YGB B;  1OZS A;  2K0J A;  4CLN A;  1LXF C;  3I5I B;  1XA5 A;  1ALW A;  1XK4 C;  1OMV A;  4OV2 A;  1JF2 A;  1K9U A;  1NWD A;  1F70 A;  1RTP 1;  1X02 A;  2A4J A;  1NCX A;  2MLE C;  1JF0 A;  2JT0 A;  3OX5 A;  1WDC C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...