1NPQA

Structure of a rhodamine-labeled n-domain troponin c mutant (ca2+ saturated) in complex with skeletal troponin i 115-131
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
90
structure length
90
Chain Sequence
ASMTDQQAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKCELDAIICEVDEDGSGTIDFEEFLVMMVRQMKEDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Troponin C
publication title NMR Structure of a Bifunctional Rhodamine Labeled N-Domain of Troponin C Complexed with the Regulatory "Switch" Peptide from Troponin I: Implications for in Situ Fluorescence Studies in Muscle Fibers
pubmed doi rcsb
source organism Gallus gallus
molecule tags Structural protein
total genus 18
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2003-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1npqA00
1BMOA 1UURA 2MHHA 4UPGA 1BU3A 3JTDB 2NZ0A 5CSFA 1UP5A 1ZFSA 2D8NA 4MLWA 5AERA 1ZACA 1M63B 1TNXA 2L4IA 3AKAA 4MZKA 1S26D 1CLBA 2BL0B 4CPVA 1TTXA 2KGBC 2MA2A 2QPTA 2FOTA 2BCBA 2K7DA 2M1KB 4FTGA 1DTLA 1SCMC 1TRFA 2JPTA 1KFUS 4L9MA 3EK7A 1QXPA 1CLLA 1K9UA 1QLKA 1DJZA 3EKJA 4GUKA 1QX5B 1BLQA 1WDCB 2M49B 1R6PA 3CR2A 3PLFB 1RROA 2L98A 1Q80A 1M46A 3DVKA 2HF5A 4USLA 1SL8A 2NLNA 4GGNA 1SL9A 2F3ZA 2L2EA 1GGZA 1YUUA 4I5NB 1S3PA 1GGWA 2E6WA 3RM1A 3DD4A 4DIRA 2JNXA 4ORAB 5CSNA 1TCOB 2JWWA 4Q04A 3SJSA 1UHHA 5G08A 3EK8A 3CWGA 1KFUL 4DCKA 2COLB 1IJ5A 1F55A 1NPQA 2CBLA 1K9PA 1SMGA 2LM5A 1DF0B 1TNWA 2JOJA 4QJ4B 3I5GB 1J1DA 2F8PA 3ZWHA 1B4CA 1K9KA 2EC6C 1NX0A 1Y0VH 2SASA 3BQ3A 4N1GA 1YVLA 3TUYC 2KAVA 2LE9B 1FW4A 2LVKA 3EKHA 3TS5C 3VGOA 1AJ5A 3M0WA 3D0YA 5I2QA 1JC2A 1YRUB 2BKHB 1KQVA 4C0KA 1F8HA 1UUSA 1W7IB 1SRAA 2KI4B 1KWOB 1OMVA 4CIDA 2JQ6A 3LK0A 1DJIA 1XK4A 3BYAA 1CM1A 5D69A 3NXAA 3BUNB 1SW8A 2EGDA 2KFHA 2ZKMX 4OR9B 2K7BA 3SG5A 1J1EA 1DJYA 2KGRA 2ZFDA 4QJ5B 1ALVA 3VRQA 2BL0C 2L5XB 2P6BB 3KO0A 1CB1A 1CTRA 1DF0A 1L2OB 2PMYA 5FYXA 3TDIA 1SBJA 2BKIB 2NCPA 4YI9A 1PSRA 1TIZA 5B8IB 2LLTA 1CDMA 1JFKA 1V1FA 5CPVA 4C0LA 2WCBA 3I5IB 3IF7A 2OPOA 4DRWA 2WCFA 3BUXB 4HREE 1WDCC 2HQWA 4ORBB 1DGVA 4CFRA 2LP3A 1M39A 2ZRSA 3AAKA 4GGFA 1A75B 1F4QA 2M29A 1H8BA 3CZTX 3OX5A 4NQGA 1AHRA 3TDZA 1N2DA 2KNEA 1NP8A 2JT8A 1KK7Y 1OQPA 1N0YA 5KTYA 1XK4C 1K8UA 2JC2A 4MVFA 2BCXA 5CSJA 3PALA 2Q91A 3HCMA 2JT0A 1K95A 1MXEA 1YR5A 1KK7Z 5I2OA 2BCAA 2K7OA 1PULA 1YUTA 2KQ6A 3LLEA 4I5KA 1LXFC 4ORCB 1QATA 1CDPA 1EL4A 2LHLA 5K89A 1QASA 2KSPA 1RWYA 1MWNA 3IQOA 1YUSA 3SG4A 2LMTA 3NSIA 1BR4B 4YGBB 5ER5A 3WHUB 1ODBA 1CMGA 1M31A 1WLMA 1PALA 4HSZA 4M2PA 4BY5A 4F0ZB 2FJUB 1FBVA 2OTGB 2ZNEA 1YVHA 4PHJA 2JNFA 4R1EA 2KBIA 3A8RA 1A75A 1S36A 1NIWA 3OB2B 3ZNIA 5AFPA 1QLSA 2KI4C 4GGFC 4GPLB 1KWOC 2LVVA 1ZOTB 2JU0A 1B8CA 2M3WA 4PE0A 2KI6C 1GJYA 2M9GA 1PRWA 4AQJA 1YRTB 2TN4A 1UHKA 3KPXA 4P5OE 2CT9A 4NDCA 1QV1A 5BPJA 2JT3A 1F54A 5HLOA 1NCYA 2JZIA 2MLFC 3GK1A 1L2OC 2JXCA 2ZNDA 1KFXS 1VRKA 1FF1A 3NSKA 5ER4X 3BUMB 3SG7A 4C0JA 2IS9A 2F2PA 3OP0A 4MZJA 3I5IC 2FCDA 3I5HB 2K61A 2WORA 1IQ5A 4MN0A 4OV2A 2EHBA 1BJFA 1SY9A 2LLSA 2MJWB 1CFCA 2B1UA 3D0YB 3KHEA 4GAOA 1RECA 2I7AA 5AEQA 1WRLA 2NCOA 5DKNA 1LA0A 1W7JB 3HX4A 3DF0B 1PK0D 4YGEB 1S1EA 1CFDA 2LAPA 4MZLA 1K90D 1A29A 1TCFA 3LK1A 4M2QA 1C07A 4GFTA 1CFFA 1NCXA 1B1GA 1MR8A 1K2HA 1U5IA 4XJKB 2F33A 1C7VA 2K7CA 4NDBA 2I94A 4YBHB 2ZN9A 1M45A 2MBXA 5IBWA 1WY9A 3O6BA 5HKZA 5HKWA 5KSZA 3FIAA 2LVJA 2OTGC 2PVBA 1QTXA 3EVUA 4HRHA 3EVVA 1WRZA 3F45A 3E3RA 2BE6A 3PM8A 2LMVA 4HRGA 1A03A 1K93D 2KYCA 3JTDC 3DF0A 4PHMA 1IKUA 1B7TZ 2JULA 4BY4A 1WRKA 1JBAA 1DT7B 1UWOA 1J7OA 2K2FA 3NSLA 1OSAA 5AANA 1PVAA 2PRUA 4MSPA 2O5GA 1E8AA 1RFJA 3I5FB 1F71A 2KFFA 2M8UA 2KYFA 4XJKA 3BXKA 2A4JA 1MQ1A 3A4UB 1XYDA 1AJ4A 1NUBA 2H61A 3SG6A 5J3XA 4I5JA 5HLVA 1SK6D 2L50A 2Y5IA 1NX1A 3I5HC 3KEVA 1J55A 1A4PA 2K0JA 1HT9A 3TZ1A 4WQ2A 1DJGA 1G4YR 1NX3A 2OS8B 3QRXA 1ZUZA 3WHTB 2LV7A 4ZCUA 1SCMB 1LINA 2G2BA 1BT6A 1OOJA 3WNXB 5AXIA 1B8RA 1Y1XA 1SPYA 2O60A 3OB1B 3OHMB 3VRNA 2L0PA 2JRFA 1KK8B 2LC5A 4JWQA 1HQVA 3BUWB 1BG1A 1DJWA 1RJVA 2KQYA 1MUXA 1JF0A 2HQ8A 3O78A 2HETA 2PSRA 3C1VA 1KCYA 4PCWA 2M7NA 3I5GC 3VROA 1DJXA 3SG2A 1OZSA 4PE4A 1XVJA 4D1EA 1CFPA 1RTP1 2LP2A 4FQOA 1OE9B 2E30A 4OVNF 1PVBA 1JWDA 4P2YB 1S5GY 2BBMA 1S6IA 1A2XA 2BECA 1B47A 1B8LA 1X02A 4DS7A 1EG3A 4MRXA 2SCPA 2I2RE 2KFGA 1KSOA 1S5GZ 1Y1AA 1SR6B 4CFQA 2GGMA 3FWCA 1DMOA 1Y6WA 1PSBA 1EH2A 3DVJA 1LVCD 1IH0A 2G9BA 4GNKB 4AQIA 3CR4X 3I5FC 1AVSA 2M1UA 3CLNA 2PALA 1U5IB 5JOLA 1MHOA 1TOPA 1IGVA 1OZOA 2LUXA 1MF8B 2Q4UA 4A4BA 1DJHA 4WQ3A 2M0RA 1SL7A 5KU1A 1DGUA 1NCZA 2QACA 2Y1NA 5F6TA 3SG3A 1BR1B 1SCVA 2WOSA 4YGCB 1BOCA 1QVIY 2OS8C 1FPWA 4MEWA 1UHNA 1F70A 4TNCA 3BOWA 1D1OA 1NYAA 2LANA 2MAZA 2H2KA 2AMIA 4YI8A 1CNPA 4ZCVA 1N65A 1XFWO 1G8IA 1QVIZ 1RK9A 4ETOA 1NX2A 3K21A 1SYMA 1EG4A 1KK8C 1KFXL 1C7WA 4YGDB 1BF5A 3PFVA 2JXLA 1CDNA 1EJ3A 2K2AA 1AUIB 4MRYA 1H4BA 4N5XA 4OKHA 1UHJA 2CNPA 1B9AA 4NDDA 3DVEA 4A4CA 1SKTA 2GGZA 4E68A 2LCPA 1FI6A 1CDLA 1Y1UA 4U8DA 1IWQA 4PDZA 1B7TY 4PE1A 5JJGA 1ZMZA 1XFXO 3SIAA 2PASA 1YX8A 1UHIA 2AAOA 1IQ3A 3VRRA 2ISDA 3CGAA 3LL8B 5I8NA 1YX7A 5DKRA 4PHNA 2LVIA 2KBMA 2Y4QA 2DOQA 2M7LA 4AOMA 1CKKA 1QX2A 2CTNA 2KAXA 3JVTB 2KDHA 4WRIA 1J7RA 4DUQA 1QX7A 1QV0A 1XO5A 3EK4A 3H4SE 2F2OA 3NSOA 1NWDA 4YGAA 5TNCA 2M97A 1KQMB 1J7PA 3SIBA 1AP4A 1SR6C 2BE4A 1DVIA 2KOTA 2L51A 3PN7B 3PSRA 1L7ZA 1XA5A 5DKQA 2MRDA 1QIWA 2K8MB 1QIVA 3KF9A 3D10A 1TNQA 2KHNA 3TDUA 1MXLC 4GBAA 3O4YA 1CMFA 1XFYO 4OCIA 2LMUA 5PALA 1BODA 4N1FA 1G33A 1K96A 4PALA 3VRPA 3MSEB 4PHKA 1CM4A 2CXJA 2V53A 1XFZO 3GOFA 2AUCA 4JQ0D 1KSMA 1IJ6A 4CLNA 1FI5A 2I18A 4PE7A 4IL1A 4M2OA 1CLMA 2L4HA 3DVMA 3GK4X 3AAJA 2LUCA 2CCMA 3O2PA 1WLZA 2RGIA 2ZRTA 2BBNA 3AKBA 1AK8A 1S6JA 2WNDA 1F4OA 3LCPC 1S6CA 2JTTA 1V1GA 2F3YA 2ZN8A 1JSAA 3PATA 5CSIA 1OMRA 1XFVO 1K94A 2KAYA 1TN4A 3GK2A 2GV5A 2WC8A 1QS7A 1J7QA 1R2UA 1IG5A 1LA3A 2H61C 2NXQA 2R2IA 2Y1MA 2LNKA 3CTNA 4XYNA 2LHIA 2KI6D 1YURA 2FCEA 4YRUA 2VRGA 1IRJA 3WXAA 2MLEC 3BUOB 1EXRA 3FS7A 4ICBA 4QJ3B 3IQQA 3CS1A 1TNPA 3EVRA 5I2LA 4JPZB 1SNLA 1NSHA 1YTZC 3BOWB 3RLZA 2EC6B 5HKYA 1LKJA 1OMDA 3JVTC 3TUYB 1XFUO 1GQMA 1QJTA 2WCEA 3FWBA 2LLUA 4I5LB 5GQQC 3TS5B 1JFJA 1KQMC 1JUOA 2HPSA 3OX6A 4MBEA 3PN7C 5D7FA 1JF2A 2JTZA 3ICBA 5HYDA 3CR5X 1ALWA
chains in the Genus database with same CATH superfamily
1BMOA 1UURA 2MHHA 3B88A 4UPGA 1BU3A 3JTDB 2NZ0A 5CSFA 4INWA 1UP5A 1ZFSA 2D8NA 4MLWA 5AERA 1ZACA 1M63B 1TNXA 2L4IA 3AKAA 4MZKA 1S26D 1CLBA 2BL0B 4CPVA 1TTXA 2KGBC 2MA2A 2QPTA 2FOTA 2BCBA 2K7DA 2M1KB 4FTGA 1DTLA 1SCMC 1TRFA 2JPTA 1KFUS 4L9MA 3EK7A 3SS3A 1T14A 5FI6A 1QXPA 1DC1A 1CLLA 1K9UA 1QLKA 3BFBA 1DJZA 3EKJA 4GUKA 1QX5B 1ORGA 1BLQA 1WDCB 2M49B 1R6PA 3CR2A 3PLFB 1RROA 2L98A 1Q80A 1M46A 3DVKA 2HF5A 4USLA 1SL8A 2NLNA 4GGNA 1SL9A 2F3ZA 1QWVA 4F7FA 2L2EA 1GGZA 1YUUA 3BFHA 4I5NB 1S3PA 1GGWA 2E6WA 3RM1A 3DD4A 4DIRA 3NHTA 2JNXA 4ORAB 5CSNA 1TCOB 2JWWA 4Q04A 3SJSA 1UHHA 5G08A 3EK8A 1TUJA 3CWGA 1KFUL 4DCKA 2COLB 1IJ5A 1F55A 1NPQA 2CBLA 1K9PA 1SMGA 2LM5A 1DF0B 1TNWA 1OW4A 2JOJA 4QJ4B 3I5GB 3EG5B 1J1DA 2F8PA 3ZWHA 1B4CA 1K9KA 2EC6C 1NX0A 1Y0VH 2SASA 3BQ3A 4N1GA 1YVLA 4INXA 3TUYC 2KAVA 2LE9B 1FW4A 2LVKA 3EKHA 3TS5C 3VGOA 1AJ5A 3M0WA 3D0YA 2ERBA 5I2QA 1JC2A 1YRUB 2BKHB 1KQVA 4C0KA 1F8HA 1UUSA 1W7IB 1SRAA 2KI4B 1KWOB 1OMVA 4CIDA 2JQ6A 3LK0A 1DJIA 1XK4A 3BYAA 1CM1A 5D69A 3L47A 3BUNB 1SW8A 3NXAA 2EGDA 3FE6A 5HL1A 2KFHA 2ZKMX 4OR9B 2K7BA 3SG5A 1J1EA 1DJYA 2KGRA 2ZFDA 4QJ5B 1ALVA 3VRQA 2BL0C 2L5XB 2P6BB 3KO0A 1CB1A 1SSEB 1CTRA 1DF0A 1L2OB 2PMYA 5FYXA 3TDIA 1SBJA 2BKIB 2WCKA 3PM2A 2NCPA 4YI9A 1PSRA 1TIZA 5B8IB 2LLTA 1CDMA 1JFKA 1V1FA 2QEVA 5CPVA 1OOFA 3NHIA 3UNWA 3UO9A 2WCBA 3I5IB 3IF7A 4C0LA 2OPOA 3S0AA 3QMEA 4DRWA 2JPOA 2WCFA 3BUXB 4HREE 1WDCC 2HQWA 4ORBB 1DGVA 4CFRA 2LP3A 1M39A 2ZRSA 3AAKA 4GGFA 1A75B 1F4QA 3CZ2A 2M29A 1H8BA 3CZTX 3OX5A 4NQGA 1AHRA 3TDZA 1N2DA 2KNEA 3CDNA 1NP8A 2JT8A 1KK7Y 1OQPA 1N0YA 5KTYA 1XK4C 1K8UA 2JC2A 4MVFA 2BCXA 5CSJA 3PALA 2Q91A 3HCMA 2JT0A 1K95A 1MXEA 1YR5A 1KK7Z 4JKTA 5I2OA 2BCAA 2K7OA 1PULA 5DICA 1YUTA 2KQ6A 3LLEA 4I5KA 1LXFC 2K60A 4ORCB 1QATA 1CDPA 1EL4A 2LHLA 5K89A 1QASA 2KSPA 1RWYA 1MWNA 3IQOA 1YUSA 3SG4A 2LMTA 3NSIA 1BR4B 4YGBB 5ER5A 3WHUB 1ODBA 1CMGA 1M31A 1WLMA 1PALA 4HSZA 4M2PA 4BY5A 4F0ZB 2FJUB 1FBVA 2OTGB 2ZNEA 1YVHA 4PHJA 2JNFA 4R1EA 2KBIA 3A8RA 1A75A 1S36A 1NIWA 3OB2B 3ZNIA 5AFPA 1LS8A 1QLSA 2KI4C 4GGFC 4GPLB 1KWOC 2LVVA 3CYZA 1ZOTB 2JU0A 1B8CA 2M3WA 4PE0A 2KI6C 1GJYA 2M9GA 1PRWA 4AQJA 1YRTB 2TN4A 1UHKA 3KPXA 4P5OE 2CT9A 4NDCA 1QV1A 5BPJA 2JT3A 1F54A 5HLOA 1NCYA 2JZIA 2MLFC 3GK1A 1L2OC 2JXCA 2ZNDA 1KFXS 1VRKA 4PT1A 1FF1A 3NSKA 5ER4X 3BUMB 3SG7A 4C0JA 3N7HA 2IS9A 2F2PA 3OP0A 4MZJA 3I5IC 2FCDA 3I5HB 1OOIX 2K61A 2WORA 1IQ5A 3FE9A 4MN0A 2EHBA 1BJFA 1SY9A 1TUZA 2LLSA 2MJWB 2B1UA 4OV2A 3D0YB 2WC6A 3KHEA 3D78A 4GAOA 1RECA 2I7AA 5AEQA 1WRLA 2NCOA 5DKNA 1LA0A 1W7JB 3BJHA 3HX4A 3DF0B 1PK0D 4YGEB 1S1EA 3R1PA 2L5YA 1CFDA 2LAPA 4MZLA 1K90D 1A29A 1TCFA 3LK1A 4M2QA 1C07A 4GFTA 1CFFA 1NCXA 1B1GA 1MR8A 1P28A 1GM0A 1K2HA 1U5IA 4XJKB 2F33A 1C7VA 2BNXA 2K7CA 4NDBA 2I94A 3CZ1A 4YBHB 2ZN9A 1M45A 2MBXA 5IBWA 1WY9A 3O6BA 5HKZA 5HKWA 5KSZA 1CFCA 1C3ZA 3FIAA 2LVJA 2OTGC 2PVBA 1QTXA 2WCMA 3EVUA 4HRHA 3EVVA 1WRZA 3F45A 3E3RA 2BE6A 3PM8A 2LMVA 4HRGA 1A03A 1K93D 2KYCA 3JTDC 3DF0A 4PHMA 1IKUA 1B7TZ 2JULA 2QEHA 1WRKA 4BY4A 1JBAA 1DT7B 1UWOA 1J7OA 2K2FA 3NSLA 1OSAA 5AANA 2QEOA 1PVAA 2PRUA 4MSPA 2FJYA 1E8AA 1RFJA 2O5GA 3I5FB 1F71A 3DXLA 2KFFA 2M8UA 3VB1A 2KYFA 4XJKA 4IJ7A 3BXKA 2A4JA 1MQ1A 3A4UB 1TWOA 1XYDA 1OOHA 1AJ4A 1NUBA 2H61A 3SG6A 2QDIA 5J3XA 4I5JA 5HLVA 1SK6D 2L50A 2Y5IA 1NX1A 3I5HC 3KEVA 1J55A 1A4PA 2K0JA 1HT9A 3TZ1A 4WQ2A 1DJGA 1G4YR 1NX3A 2OS8B 3QRXA 1ZUZA 3WHTB 2LV7A 4ZCUA 1SCMB 1LINA 2G2BA 3D74A 1BT6A 1OOJA 4KYNA 1DQEA 3WNXB 5AXIA 1B8RA 1Y1XA 1SPYA 2O60A 3OB1B 3OHMB 2KLEA 2L0PA 3VRNA 2JRFA 1KK8B 3IVTA 2WCJA 2LC5A 4JWQA 1HQVA 3BUWB 1BG1A 1DJWA 1RJVA 2GTEA 2BAPA 2KQYA 1MUXA 1JF0A 2HQ8A 3O78A 2HETA 2PSRA 3C1VA 1KCYA 4PCWA 2M7NA 3I5GC 3VROA 1DJXA 2WCLA 3SG2A 1OZSA 4PE4A 1XVJA 4D1EA 1CFPA 1RTP1 2LP2A 4FQOA 1OE9B 3R72A 2E30A 2QEBA 1PVBA 4OVNF 1JWDA 4P2YB 1S5GY 2BBMA 1DELA 1S6IA 1A2XA 2BECA 3CABA 3S0BA 1B47A 1B8LA 1X02A 4DS7A 1EG3A 3L4AA 4MRXA 2SCPA 3DZTA 3B86A 2KLDA 3B7AA 2I2RE 3OGNA 2KFGA 1KSOA 1S5GZ 1Y1AA 1SR6B 4CFQA 2GGMA 3FWCA 1DMOA 1Y6WA 1PSBA 1EH2A 3DVJA 5EL2A 1LVCD 1IH0A 3D73A 2G9BA 4GNKB 4AQIA 3CR4X 3I5FC 1AVSA 3NGVA 2M1UA 3CLNA 2P70A 2PALA 1U5IB 5JOLA 1MHOA 1TOPA 1IGVA 1OZOA 2H8VA 1MF8B 2LUXA 2Q4UA 3S0EA 4A4BA 1DJHA 1XFRA 4WQ3A 2M0RA 1SL7A 5KU1A 1DGUA 1NCZA 2QACA 2Y1NA 3D75A 5F6TA 3B6XA 3SG3A 3RZSA 1BR1B 1SCVA 2WOSA 4YGCB 1BOCA 2L2CA 3D76A 1QVIY 2OS8C 1FPWA 4MEWA 2KPHA 1UHNA 1F70A 4TNCA 3BOWA 1D1OA 1NYAA 2LANA 2MAZA 2H2KA 2AMIA 4YI8A 3V2LA 1CNPA 4ZCVA 3FE8A 1N65A 1XFWO 1G8IA 1QVIZ 1RK9A 3O4XA 1NX2A 4ETOA 3K21A 1SYMA 1EG4A 1KK8C 1KFXL 5FI2A 1C7WA 4YGDB 1BF5A 3PFVA 2JXLA 1CDNA 1DEKA 1EJ3A 2K2AA 3OBVA 1AUIB 4MRYA 1H4BA 4N5XA 4OKHA 1UHJA 1Z4HA 2CNPA 1B9AA 4NDDA 3DVEA 4A4CA 1SKTA 2GGZA 4E68A 2LCPA 1FI6A 1CDLA 1Y1UA 4U8DA 1IWQA 4PDZA 3PJIA 3S0GA 5D3OA 3D77A 1B7TY 4PE1A 5JJGA 1ZMZA 2P71A 1OOGA 1XFXO 4FQTA 3SIAA 2PASA 1YX8A 1UHIA 2AAOA 1IQ3A 3VRRA 5I94A 2ISDA 3CGAA 3LL8B 5I8NA 1YX7A 5DKRA 3K1EA 4OZDA 4PHNA 2LVIA 2KBMA 2Y4QA 2DOQA 2M7LA 4AOMA 1CKKA 1QX2A 2CTNA 2KAXA 3JVTB 2KDHA 3DYEA 1J7RA 4WRIA 1QX7A 3CZ0A 4DUQA 1QV0A 1XO5A 3EK4A 3H4SE 2F2OA 2WC5A 1NWDA 3NSOA 4YGAA 2M97A 5TNCA 1KQMB 1C3YA 1J7PA 3SIBA 1AP4A 1SR6C 2BE4A 1DVIA 2KOTA 2L51A 3PN7B 3PSRA 1L7ZA 1XA5A 5DKQA 2MRDA 1QIWA 2K8MB 1QIVA 3KF9A 3D10A 1TNQA 2KHNA 3TDUA 1MXLC 4GBAA 3O4YA 5FI7A 1CMFA 1Z2CB 3SS5A 1XFYO 4OCIA 2LMUA 5PALA 4JD9A 3BFAA 4N1FA 1BODA 1G33A 1K96A 4PALA 3VRPA 3MSEB 4PHKA 3S0FA 1CM4A 2CXJA 2V53A 1XFZO 3GOFA 2AUCA 4JQ0D 1KSMA 1IJ6A 4CLNA 1FI5A 2I18A 4PE7A 4IL1A 4M2OA 1CLMA 2L4HA 3DVMA 3GK4X 3AAJA 2LUCA 1IIOA 2CCMA 3O2PA 1WLZA 2RGIA 2ZRTA 2BBNA 3AKBA 3L4LA 1S6JA 1AK8A 3Q8IA 2WNDA 1F4OA 3R1VA 3LCPC 3DY9A 1S6CA 2JTTA 1V1GA 2F3YA 2ZN8A 1JSAA 3PATA 5CSIA 1OMRA 1XFVO 1K94A 3SS4A 2KAYA 1TN4A 3R1OA 3GK2A 2GV5A 3S0DA 2WC8A 1W9ZA 1QS7A 1J7QA 1R2UA 1IG5A 1LA3A 2H61C 2NXQA 2R2IA 2Y1MA 2LNKA 3CTNA 4XYNA 2LHIA 2KI6D 1YURA 2FCEA 4YRUA 2WCHA 2VRGA 1IRJA 3WXAA 2MLEC 3BUOB 1EXRA 3FS7A 4ICBA 4QJ3B 3IQQA 3CS1A 1TNPA 3EVRA 5I2LA 4JPZB 1SNLA 1NSHA 1YTZC 3BOWB 3RLZA 2EC6B 5HKYA 2PQLA 1LKJA 1OMDA 3JVTC 3TUYB 1XFUO 1GQMA 1QJTA 2WCEA 3FWBA 2LLUA 3B87A 4I5LB 5GQQC 3TS5B 1JFJA 1KQMC 1JUOA 2HPSA 3OX6A 4MBEA 3PN7C 5D7FA 1JF2A 2JTZA 3ICBA 5HYDA 2YGUA 3CR5X 2PYQA 1ALWA
chains in the Genus database with same CATH topology
1BMOA 1UURA 2MHHA 4UPGA 1BU3A 3JTDB 2NZ0A 5CSFA 1UP5A 1ZFSA 2D8NA 4MLWA 5AERA 1ZACA 1M63B 1TNXA 2L4IA 3AKAA 4MZKA 1S26D 1CLBA 2BL0B 4CPVA 1TTXA 2KGBC 2MA2A 2QPTA 2FOTA 2BCBA 2K7DA 2M1KB 4FTGA 1DTLA 1SCMC 1TRFA 2JPTA 1KFUS 4L9MA 3EK7A 1QXPA 1CLLA 1K9UA 1QLKA 1DJZA 3EKJA 4GUKA 1QX5B 1BLQA 1WDCB 2M49B 1R6PA 3CR2A 3PLFB 1RROA 2L98A 1Q80A 1M46A 3DVKA 2HF5A 4USLA 1SL8A 2NLNA 4GGNA 1SL9A 2F3ZA 2L2EA 1GGZA 1YUUA 4I5NB 1S3PA 1GGWA 2E6WA 3RM1A 3DD4A 4DIRA 2JNXA 4ORAB 5CSNA 1TCOB 2JWWA 4Q04A 3SJSA 1UHHA 5G08A 3EK8A 3CWGA 1KFUL 4DCKA 2COLB 1IJ5A 1F55A 1NPQA 2CBLA 1K9PA 1SMGA 2LM5A 1DF0B 1TNWA 2JOJA 4QJ4B 3I5GB 1J1DA 2F8PA 3ZWHA 1B4CA 1K9KA 2EC6C 1NX0A 1Y0VH 2SASA 3BQ3A 4N1GA 1YVLA 3TUYC 2KAVA 2LE9B 1FW4A 2LVKA 3EKHA 3TS5C 3VGOA 1AJ5A 3M0WA 3D0YA 5I2QA 1JC2A 1YRUB 2BKHB 1KQVA 4C0KA 1F8HA 1UUSA 1W7IB 1SRAA 2KI4B 1KWOB 1OMVA 4CIDA 2JQ6A 3LK0A 1DJIA 1XK4A 3BYAA 1CM1A 5D69A 3NXAA 3BUNB 1SW8A 2EGDA 2KFHA 2ZKMX 4OR9B 2K7BA 3SG5A 1J1EA 1DJYA 2KGRA 2ZFDA 4QJ5B 1ALVA 3VRQA 2BL0C 2L5XB 2P6BB 3KO0A 1CB1A 1CTRA 1DF0A 1L2OB 2PMYA 5FYXA 3TDIA 1SBJA 2BKIB 2NCPA 4YI9A 1PSRA 1TIZA 5B8IB 2LLTA 1CDMA 1JFKA 1V1FA 5CPVA 4C0LA 2WCBA 3I5IB 3IF7A 2OPOA 4DRWA 2WCFA 3BUXB 4HREE 1WDCC 2HQWA 4ORBB 1DGVA 4CFRA 2LP3A 1M39A 2ZRSA 3AAKA 4GGFA 1A75B 1F4QA 2M29A 1H8BA 3CZTX 3OX5A 4NQGA 1AHRA 3TDZA 1N2DA 2KNEA 1NP8A 2JT8A 1KK7Y 1OQPA 1N0YA 5KTYA 1XK4C 1K8UA 2JC2A 4MVFA 2BCXA 5CSJA 3PALA 2Q91A 3HCMA 2JT0A 1K95A 1MXEA 1YR5A 1KK7Z 5I2OA 2BCAA 2K7OA 1PULA 1YUTA 2KQ6A 3LLEA 4I5KA 1LXFC 4ORCB 1QATA 1CDPA 1EL4A 2LHLA 5K89A 1QASA 2KSPA 1RWYA 1MWNA 3IQOA 1YUSA 3SG4A 2LMTA 3NSIA 1BR4B 4YGBB 5ER5A 3WHUB 1ODBA 1CMGA 1M31A 1WLMA 1PALA 4HSZA 4M2PA 4BY5A 4F0ZB 2FJUB 1FBVA 2OTGB 2ZNEA 1YVHA 4PHJA 2JNFA 4R1EA 2KBIA 3A8RA 1A75A 1S36A 1NIWA 3OB2B 3ZNIA 5AFPA 1QLSA 2KI4C 4GGFC 4GPLB 1KWOC 2LVVA 1ZOTB 2JU0A 1B8CA 2M3WA 4PE0A 2KI6C 1GJYA 2M9GA 1PRWA 4AQJA 1YRTB 2TN4A 1UHKA 3KPXA 4P5OE 2CT9A 4NDCA 1QV1A 5BPJA 2JT3A 1F54A 5HLOA 1NCYA 2JZIA 2MLFC 3GK1A 1L2OC 2JXCA 2ZNDA 1KFXS 1VRKA 1FF1A 3NSKA 5ER4X 3BUMB 3SG7A 4C0JA 2IS9A 2F2PA 3OP0A 4MZJA 3I5IC 2FCDA 3I5HB 2K61A 2WORA 1IQ5A 4MN0A 4OV2A 2EHBA 1BJFA 1SY9A 2LLSA 2MJWB 1CFCA 2B1UA 3D0YB 3KHEA 4GAOA 1RECA 2I7AA 5AEQA 1WRLA 2NCOA 5DKNA 1LA0A 1W7JB 3HX4A 3DF0B 1PK0D 4YGEB 1S1EA 1CFDA 2LAPA 4MZLA 1K90D 1A29A 1TCFA 3LK1A 4M2QA 1C07A 4GFTA 1CFFA 1NCXA 1B1GA 1MR8A 1K2HA 1U5IA 4XJKB 2F33A 1C7VA 2K7CA 4NDBA 2I94A 4YBHB 2ZN9A 1M45A 2MBXA 5IBWA 1WY9A 3O6BA 5HKZA 5HKWA 5KSZA 3FIAA 2LVJA 2OTGC 2PVBA 1QTXA 3EVUA 4HRHA 3EVVA 1WRZA 3F45A 3E3RA 2BE6A 3PM8A 2LMVA 4HRGA 1A03A 1K93D 2KYCA 3JTDC 3DF0A 4PHMA 1IKUA 1B7TZ 2JULA 4BY4A 1WRKA 1JBAA 1DT7B 1UWOA 1J7OA 2K2FA 3NSLA 1OSAA 5AANA 1PVAA 2PRUA 4MSPA 2O5GA 1E8AA 1RFJA 3I5FB 1F71A 2KFFA 2M8UA 2KYFA 4XJKA 3BXKA 2A4JA 1MQ1A 3A4UB 1XYDA 1AJ4A 1NUBA 2H61A 3SG6A 5J3XA 4I5JA 5HLVA 1SK6D 2L50A 2Y5IA 1NX1A 3I5HC 3KEVA 1J55A 1A4PA 2K0JA 1HT9A 3TZ1A 4WQ2A 1DJGA 1G4YR 1NX3A 2OS8B 3QRXA 1ZUZA 3WHTB 2LV7A 4ZCUA 1SCMB 1LINA 2G2BA 1BT6A 1OOJA 3WNXB 5AXIA 1B8RA 1Y1XA 1SPYA 2O60A 3OB1B 3OHMB 3VRNA 2L0PA 2JRFA 1KK8B 2LC5A 4JWQA 1HQVA 3BUWB 1BG1A 1DJWA 1RJVA 2KQYA 1MUXA 1JF0A 2HQ8A 3O78A 2HETA 2PSRA 3C1VA 1KCYA 4PCWA 2M7NA 3I5GC 3VROA 1DJXA 3SG2A 1OZSA 4PE4A 1XVJA 4D1EA 1CFPA 1RTP1 2LP2A 4FQOA 1OE9B 2E30A 4OVNF 1PVBA 1JWDA 4P2YB 1S5GY 2BBMA 1S6IA 1A2XA 2BECA 1B47A 1B8LA 1X02A 4DS7A 1EG3A 4MRXA 2SCPA 2I2RE 2KFGA 1KSOA 1S5GZ 1Y1AA 1SR6B 4CFQA 2GGMA 3FWCA 1DMOA 1Y6WA 1PSBA 1EH2A 3DVJA 1LVCD 1IH0A 2G9BA 4GNKB 4AQIA 3CR4X 3I5FC 1AVSA 2M1UA 3CLNA 2PALA 1U5IB 5JOLA 1MHOA 1TOPA 1IGVA 1OZOA 2LUXA 1MF8B 2Q4UA 4A4BA 1DJHA 4WQ3A 2M0RA 1SL7A 5KU1A 1DGUA 1NCZA 2QACA 2Y1NA 5F6TA 3SG3A 1BR1B 1SCVA 2WOSA 4YGCB 1BOCA 1QVIY 2OS8C 1FPWA 4MEWA 1UHNA 1F70A 4TNCA 3BOWA 1D1OA 1NYAA 2LANA 2MAZA 2H2KA 2AMIA 4YI8A 1CNPA 4ZCVA 1N65A 1XFWO 1G8IA 1QVIZ 1RK9A 4ETOA 1NX2A 3K21A 1SYMA 1EG4A 1KK8C 1KFXL 1C7WA 4YGDB 1BF5A 3PFVA 2JXLA 1CDNA 1EJ3A 2K2AA 1AUIB 4MRYA 1H4BA 4N5XA 4OKHA 1UHJA 2CNPA 1B9AA 4NDDA 3DVEA 4A4CA 1SKTA 2GGZA 4E68A 2LCPA 1FI6A 1CDLA 1Y1UA 4U8DA 1IWQA 4PDZA 1B7TY 4PE1A 5JJGA 1ZMZA 1XFXO 3SIAA 2PASA 1YX8A 1UHIA 2AAOA 1IQ3A 3VRRA 2ISDA 3CGAA 3LL8B 5I8NA 1YX7A 5DKRA 4PHNA 2LVIA 2KBMA 2Y4QA 2DOQA 2M7LA 4AOMA 1CKKA 1QX2A 2CTNA 2KAXA 3JVTB 2KDHA 4WRIA 1J7RA 4DUQA 1QX7A 1QV0A 1XO5A 3EK4A 3H4SE 2F2OA 3NSOA 1NWDA 4YGAA 5TNCA 2M97A 1KQMB 1J7PA 3SIBA 1AP4A 1SR6C 2BE4A 1DVIA 2KOTA 2L51A 3PN7B 3PSRA 1L7ZA 1XA5A 5DKQA 2MRDA 1QIWA 2K8MB 1QIVA 3KF9A 3D10A 1TNQA 2KHNA 3TDUA 1MXLC 4GBAA 3O4YA 1CMFA 1XFYO 4OCIA 2LMUA 5PALA 1BODA 4N1FA 1G33A 1K96A 4PALA 3VRPA 3MSEB 4PHKA 1CM4A 2CXJA 2V53A 1XFZO 3GOFA 2AUCA 4JQ0D 1KSMA 1IJ6A 4CLNA 1FI5A 2I18A 4PE7A 4IL1A 4M2OA 1CLMA 2L4HA 3DVMA 3GK4X 3AAJA 2LUCA 2CCMA 3O2PA 1WLZA 2RGIA 2ZRTA 2BBNA 3AKBA 1AK8A 1S6JA 2WNDA 1F4OA 3LCPC 1S6CA 2JTTA 1V1GA 2F3YA 2ZN8A 1JSAA 3PATA 5CSIA 1OMRA 1XFVO 1K94A 2KAYA 1TN4A 3GK2A 2GV5A 2WC8A 1QS7A 1J7QA 1R2UA 1IG5A 1LA3A 2H61C 2NXQA 2R2IA 2Y1MA 2LNKA 3CTNA 4XYNA 2LHIA 2KI6D 1YURA 2FCEA 4YRUA 2VRGA 1IRJA 3WXAA 2MLEC 3BUOB 1EXRA 3FS7A 4ICBA 4QJ3B 3IQQA 3CS1A 1TNPA 3EVRA 5I2LA 4JPZB 1SNLA 1NSHA 1YTZC 3BOWB 3RLZA 2EC6B 5HKYA 1LKJA 1OMDA 3JVTC 3TUYB 1XFUO 1GQMA 1QJTA 2WCEA 3FWBA 2LLUA 4I5LB 5GQQC 3TS5B 1JFJA 1KQMC 1JUOA 2HPSA 3OX6A 4MBEA 3PN7C 5D7FA 1JF2A 2JTZA 3ICBA 5HYDA 3CR5X 1ALWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BMO A;  1UUR A;  2MHH A;  4UPG A;  1BU3 A;  3JTD B;  2NZ0 A;  5CSF A;  1UP5 A;  1ZFS A;  2D8N A;  4MLW A;  5AER A;  1ZAC A;  1M63 B;  1TNX A;  2L4I A;  3AKA A;  4MZK A;  1S26 D;  1CLB A;  2BL0 B;  4CPV A;  1TTX A;  2KGB C;  2MA2 A;  2QPT A;  2FOT A;  2BCB A;  2K7D A;  2M1K B;  4FTG A;  1DTL A;  1SCM C;  1TRF A;  2JPT A;  1KFU S;  4L9M A;  3EK7 A;  1QXP A;  1CLL A;  1K9U A;  1QLK A;  1DJZ A;  3EKJ A;  4GUK A;  1QX5 B;  1BLQ A;  1WDC B;  2M49 B;  1R6P A;  3CR2 A;  3PLF B;  1RRO A;  2L98 A;  1Q80 A;  1M46 A;  3DVK A;  2HF5 A;  4USL A;  1SL8 A;  2NLN A;  4GGN A;  1SL9 A;  2F3Z A;  2L2E A;  1GGZ A;  1YUU A;  4I5N B;  1S3P A;  1GGW A;  2E6W A;  3RM1 A;  3DD4 A;  4DIR A;  2JNX A;  4ORA B;  5CSN A;  1TCO B;  2JWW A;  4Q04 A;  3SJS A;  1UHH A;  5G08 A;  3EK8 A;  3CWG A;  1KFU L;  4DCK A;  2COL B;  1IJ5 A;  1F55 A;  1NPQ A;  2CBL A;  1K9P A;  1SMG A;  2LM5 A;  1DF0 B;  1TNW A;  2JOJ A;  4QJ4 B;  3I5G B;  1J1D A;  2F8P A;  3ZWH A;  1B4C A;  1K9K A;  2EC6 C;  1NX0 A;  1Y0V H;  2SAS A;  3BQ3 A;  4N1G A;  1YVL A;  3TUY C;  2KAV A;  2LE9 B;  1FW4 A;  2LVK A;  3EKH A;  3TS5 C;  3VGO A;  1AJ5 A;  3M0W A;  3D0Y A;  5I2Q A;  1JC2 A;  1YRU B;  2BKH B;  1KQV A;  4C0K A;  1F8H A;  1UUS A;  1W7I B;  1SRA A;  2KI4 B;  1KWO B;  1OMV A;  4CID A;  2JQ6 A;  3LK0 A;  1DJI A;  1XK4 A;  3BYA A;  1CM1 A;  5D69 A;  3NXA A;  3BUN B;  1SW8 A;  2EGD A;  2KFH A;  2ZKM X;  4OR9 B;  2K7B A;  3SG5 A;  1J1E A;  1DJY A;  2KGR A;  2ZFD A;  4QJ5 B;  1ALV A;  3VRQ A;  2BL0 C;  2L5X B;  2P6B B;  3KO0 A;  1CB1 A;  1CTR A;  1DF0 A;  1L2O B;  2PMY A;  5FYX A;  3TDI A;  1SBJ A;  2BKI B;  2NCP A;  4YI9 A;  1PSR A;  1TIZ A;  5B8I B;  2LLT A;  1CDM A;  1JFK A;  1V1F A;  5CPV A;  4C0L A;  2WCB A;  3I5I B;  3IF7 A;  2OPO A;  4DRW A;  2WCF A;  3BUX B;  4HRE E;  1WDC C;  2HQW A;  4ORB B;  1DGV A;  4CFR A;  2LP3 A;  1M39 A;  2ZRS A;  3AAK A;  4GGF A;  1A75 B;  1F4Q A;  2M29 A;  1H8B A;  3CZT X;  3OX5 A;  4NQG A;  1AHR A;  3TDZ A;  1N2D A;  2KNE A;  1NP8 A;  2JT8 A;  1KK7 Y;  1OQP A;  1N0Y A;  5KTY A;  1XK4 C;  1K8U A;  2JC2 A;  4MVF A;  2BCX A;  5CSJ A;  3PAL A;  2Q91 A;  3HCM A;  2JT0 A;  1K95 A;  1MXE A;  1YR5 A;  1KK7 Z;  5I2O A;  2BCA A;  2K7O A;  1PUL A;  1YUT A;  2KQ6 A;  3LLE A;  4I5K A;  1LXF C;  4ORC B;  1QAT A;  1CDP A;  1EL4 A;  2LHL A;  5K89 A;  1QAS A;  2KSP A;  1RWY A;  1MWN A;  3IQO A;  1YUS A;  3SG4 A;  2LMT A;  3NSI A;  1BR4 B;  4YGB B;  5ER5 A;  3WHU B;  1ODB A;  1CMG A;  1M31 A;  1WLM A;  1PAL A;  4HSZ A;  4M2P A;  4BY5 A;  4F0Z B;  2FJU B;  1FBV A;  2OTG B;  2ZNE A;  1YVH A;  4PHJ A;  2JNF A;  4R1E A;  2KBI A;  3A8R A;  1A75 A;  1S36 A;  1NIW A;  3OB2 B;  3ZNI A;  5AFP A;  1QLS A;  2KI4 C;  4GGF C;  4GPL B;  1KWO C;  2LVV A;  1ZOT B;  2JU0 A;  1B8C A;  2M3W A;  4PE0 A;  2KI6 C;  1GJY A;  2M9G A;  1PRW A;  4AQJ A;  1YRT B;  2TN4 A;  1UHK A;  3KPX A;  4P5O E;  2CT9 A;  4NDC A;  1QV1 A;  5BPJ A;  2JT3 A;  1F54 A;  5HLO A;  1NCY A;  2JZI A;  2MLF C;  3GK1 A;  1L2O C;  2JXC A;  2ZND A;  1KFX S;  1VRK A;  1FF1 A;  3NSK A;  5ER4 X;  3BUM B;  3SG7 A;  4C0J A;  2IS9 A;  2F2P A;  3OP0 A;  4MZJ A;  3I5I C;  2FCD A;  3I5H B;  2K61 A;  2WOR A;  1IQ5 A;  4MN0 A;  4OV2 A;  2EHB A;  1BJF A;  1SY9 A;  2LLS A;  2MJW B;  1CFC A;  2B1U A;  3D0Y B;  3KHE A;  4GAO A;  1REC A;  2I7A A;  5AEQ A;  1WRL A;  2NCO A;  5DKN A;  1LA0 A;  1W7J B;  3HX4 A;  3DF0 B;  1PK0 D;  4YGE B;  1S1E A;  1CFD A;  2LAP A;  4MZL A;  1K90 D;  1A29 A;  1TCF A;  3LK1 A;  4M2Q A;  1C07 A;  4GFT A;  1CFF A;  1NCX A;  1B1G A;  1MR8 A;  1K2H A;  1U5I A;  4XJK B;  2F33 A;  1C7V A;  2K7C A;  4NDB A;  2I94 A;  4YBH B;  2ZN9 A;  1M45 A;  2MBX A;  5IBW A;  1WY9 A;  3O6B A;  5HKZ A;  5HKW A;  5KSZ A;  3FIA A;  2LVJ A;  2OTG C;  2PVB A;  1QTX A;  3EVU A;  4HRH A;  3EVV A;  1WRZ A;  3F45 A;  3E3R A;  2BE6 A;  3PM8 A;  2LMV A;  4HRG A;  1A03 A;  1K93 D;  2KYC A;  3JTD C;  3DF0 A;  4PHM A;  1IKU A;  1B7T Z;  2JUL A;  4BY4 A;  1WRK A;  1JBA A;  1DT7 B;  1UWO A;  1J7O A;  2K2F A;  3NSL A;  1OSA A;  5AAN A;  1PVA A;  2PRU A;  4MSP A;  2O5G A;  1E8A A;  1RFJ A;  3I5F B;  1F71 A;  2KFF A;  2M8U A;  2KYF A;  4XJK A;  3BXK A;  2A4J A;  1MQ1 A;  3A4U B;  1XYD A;  1AJ4 A;  1NUB A;  2H61 A;  3SG6 A;  5J3X A;  4I5J A;  5HLV A;  1SK6 D;  2L50 A;  2Y5I A;  1NX1 A;  3I5H C;  3KEV A;  1J55 A;  1A4P A;  2K0J A;  1HT9 A;  3TZ1 A;  4WQ2 A;  1DJG A;  1G4Y R;  1NX3 A;  2OS8 B;  3QRX A;  1ZUZ A;  3WHT B;  2LV7 A;  4ZCU A;  1SCM B;  1LIN A;  2G2B A;  1BT6 A;  1OOJ A;  3WNX B;  5AXI A;  1B8R A;  1Y1X A;  1SPY A;  2O60 A;  3OB1 B;  3OHM B;  3VRN A;  2L0P A;  2JRF A;  1KK8 B;  2LC5 A;  4JWQ A;  1HQV A;  3BUW B;  1BG1 A;  1DJW A;  1RJV A;  2KQY A;  1MUX A;  1JF0 A;  2HQ8 A;  3O78 A;  2HET A;  2PSR A;  3C1V A;  1KCY A;  4PCW A;  2M7N A;  3I5G C;  3VRO A;  1DJX A;  3SG2 A;  1OZS A;  4PE4 A;  1XVJ A;  4D1E A;  1CFP A;  1RTP 1;  2LP2 A;  4FQO A;  1OE9 B;  2E30 A;  4OVN F;  1PVB A;  1JWD A;  4P2Y B;  1S5G Y;  2BBM A;  1S6I A;  1A2X A;  2BEC A;  1B47 A;  1B8L A;  1X02 A;  4DS7 A;  1EG3 A;  4MRX A;  2SCP A;  2I2R E;  2KFG A;  1KSO A;  1S5G Z;  1Y1A A;  1SR6 B;  4CFQ A;  2GGM A;  3FWC A;  1DMO A;  1Y6W A;  1PSB A;  1EH2 A;  3DVJ A;  1LVC D;  1IH0 A;  2G9B A;  4GNK B;  4AQI A;  3CR4 X;  3I5F C;  1AVS A;  2M1U A;  3CLN A;  2PAL A;  1U5I B;  5JOL A;  1MHO A;  1TOP A;  1IGV A;  1OZO A;  2LUX A;  1MF8 B;  2Q4U A;  4A4B A;  1DJH A;  4WQ3 A;  2M0R A;  1SL7 A;  5KU1 A;  1DGU A;  1NCZ A;  2QAC A;  2Y1N A;  5F6T A;  3SG3 A;  1BR1 B;  1SCV A;  2WOS A;  4YGC B;  1BOC A;  1QVI Y;  2OS8 C;  1FPW A;  4MEW A;  1UHN A;  1F70 A;  4TNC A;  3BOW A;  1D1O A;  1NYA A;  2LAN A;  2MAZ A;  2H2K A;  2AMI A;  4YI8 A;  1CNP A;  4ZCV A;  1N65 A;  1XFW O;  1G8I A;  1QVI Z;  1RK9 A;  4ETO A;  1NX2 A;  3K21 A;  1SYM A;  1EG4 A;  1KK8 C;  1KFX L;  1C7W A;  4YGD B;  1BF5 A;  3PFV A;  2JXL A;  1CDN A;  1EJ3 A;  2K2A A;  1AUI B;  4MRY A;  1H4B A;  4N5X A;  4OKH A;  1UHJ A;  2CNP A;  1B9A A;  4NDD A;  3DVE A;  4A4C A;  1SKT A;  2GGZ A;  4E68 A;  2LCP A;  1FI6 A;  1CDL A;  1Y1U A;  4U8D A;  1IWQ A;  4PDZ A;  1B7T Y;  4PE1 A;  5JJG A;  1ZMZ A;  1XFX O;  3SIA A;  2PAS A;  1YX8 A;  1UHI A;  2AAO A;  1IQ3 A;  3VRR A;  2ISD A;  3CGA A;  3LL8 B;  5I8N A;  1YX7 A;  5DKR A;  4PHN A;  2LVI A;  2KBM A;  2Y4Q A;  2DOQ A;  2M7L A;  4AOM A;  1CKK A;  1QX2 A;  2CTN A;  2KAX A;  3JVT B;  2KDH A;  4WRI A;  1J7R A;  4DUQ A;  1QX7 A;  1QV0 A;  1XO5 A;  3EK4 A;  3H4S E;  2F2O A;  3NSO A;  1NWD A;  4YGA A;  5TNC A;  2M97 A;  1KQM B;  1J7P A;  3SIB A;  1AP4 A;  1SR6 C;  2BE4 A;  1DVI A;  2KOT A;  2L51 A;  3PN7 B;  3PSR A;  1L7Z A;  1XA5 A;  5DKQ A;  2MRD A;  1QIW A;  2K8M B;  1QIV A;  3KF9 A;  3D10 A;  1TNQ A;  2KHN A;  3TDU A;  1MXL C;  4GBA A;  3O4Y A;  1CMF A;  1XFY O;  4OCI A;  2LMU A;  5PAL A;  1BOD A;  4N1F A;  1G33 A;  1K96 A;  4PAL A;  3VRP A;  3MSE B;  4PHK A;  1CM4 A;  2CXJ A;  2V53 A;  1XFZ O;  3GOF A;  2AUC A;  4JQ0 D;  1KSM A;  1IJ6 A;  4CLN A;  1FI5 A;  2I18 A;  4PE7 A;  4IL1 A;  4M2O A;  1CLM A;  2L4H A;  3DVM A;  3GK4 X;  3AAJ A;  2LUC A;  2CCM A;  3O2P A;  1WLZ A;  2RGI A;  2ZRT A;  2BBN A;  3AKB A;  1AK8 A;  1S6J A;  2WND A;  1F4O A;  3LCP C;  1S6C A;  2JTT A;  1V1G A;  2F3Y A;  2ZN8 A;  1JSA A;  3PAT A;  5CSI A;  1OMR A;  1XFV O;  1K94 A;  2KAY A;  1TN4 A;  3GK2 A;  2GV5 A;  2WC8 A;  1QS7 A;  1J7Q A;  1R2U A;  1IG5 A;  1LA3 A;  2H61 C;  2NXQ A;  2R2I A;  2Y1M A;  2LNK A;  3CTN A;  4XYN A;  2LHI A;  2KI6 D;  1YUR A;  2FCE A;  4YRU A;  2VRG A;  1IRJ A;  3WXA A;  2MLE C;  3BUO B;  1EXR A;  3FS7 A;  4ICB A;  4QJ3 B;  3IQQ A;  3CS1 A;  1TNP A;  3EVR A;  5I2L A;  4JPZ B;  1SNL A;  1NSH A;  1YTZ C;  3BOW B;  3RLZ A;  2EC6 B;  5HKY A;  1LKJ A;  1OMD A;  3JVT C;  3TUY B;  1XFU O;  1GQM A;  1QJT A;  2WCE A;  3FWB A;  2LLU A;  4I5L B;  5GQQ C;  3TS5 B;  1JFJ A;  1KQM C;  1JUO A;  2HPS A;  3OX6 A;  4MBE A;  3PN7 C;  5D7F A;  1JF2 A;  2JTZ A;  3ICB A;  5HYD A;  3CR5 X;  1ALW A; 
#chains in the Genus database with same CATH topology
 1BMO A;  1UUR A;  2MHH A;  3B88 A;  4UPG A;  1BU3 A;  3JTD B;  2NZ0 A;  5CSF A;  4INW A;  1UP5 A;  1ZFS A;  2D8N A;  4MLW A;  5AER A;  1ZAC A;  1M63 B;  1TNX A;  2L4I A;  3AKA A;  4MZK A;  1S26 D;  1CLB A;  2BL0 B;  4CPV A;  1TTX A;  2KGB C;  2MA2 A;  2QPT A;  2FOT A;  2BCB A;  2K7D A;  2M1K B;  4FTG A;  1DTL A;  1SCM C;  1TRF A;  2JPT A;  1KFU S;  4L9M A;  3EK7 A;  3SS3 A;  1T14 A;  5FI6 A;  1QXP A;  1DC1 A;  1CLL A;  1K9U A;  1QLK A;  3BFB A;  1DJZ A;  3EKJ A;  4GUK A;  1QX5 B;  1ORG A;  1BLQ A;  1WDC B;  2M49 B;  1R6P A;  3CR2 A;  3PLF B;  1RRO A;  2L98 A;  1Q80 A;  1M46 A;  3DVK A;  2HF5 A;  4USL A;  1SL8 A;  2NLN A;  4GGN A;  1SL9 A;  2F3Z A;  1QWV A;  4F7F A;  2L2E A;  1GGZ A;  1YUU A;  3BFH A;  4I5N B;  1S3P A;  1GGW A;  2E6W A;  3RM1 A;  3DD4 A;  4DIR A;  3NHT A;  2JNX A;  4ORA B;  5CSN A;  1TCO B;  2JWW A;  4Q04 A;  3SJS A;  1UHH A;  5G08 A;  3EK8 A;  1TUJ A;  3CWG A;  1KFU L;  4DCK A;  2COL B;  1IJ5 A;  1F55 A;  1NPQ A;  2CBL A;  1K9P A;  1SMG A;  2LM5 A;  1DF0 B;  1TNW A;  1OW4 A;  2JOJ A;  4QJ4 B;  3I5G B;  3EG5 B;  1J1D A;  2F8P A;  3ZWH A;  1B4C A;  1K9K A;  2EC6 C;  1NX0 A;  1Y0V H;  2SAS A;  3BQ3 A;  4N1G A;  1YVL A;  4INX A;  3TUY C;  2KAV A;  2LE9 B;  1FW4 A;  2LVK A;  3EKH A;  3TS5 C;  3VGO A;  1AJ5 A;  3M0W A;  3D0Y A;  2ERB A;  5I2Q A;  1JC2 A;  1YRU B;  2BKH B;  1KQV A;  4C0K A;  1F8H A;  1UUS A;  1W7I B;  1SRA A;  2KI4 B;  1KWO B;  1OMV A;  4CID A;  2JQ6 A;  3LK0 A;  1DJI A;  1XK4 A;  3BYA A;  1CM1 A;  5D69 A;  3L47 A;  3BUN B;  1SW8 A;  3NXA A;  2EGD A;  3FE6 A;  5HL1 A;  2KFH A;  2ZKM X;  4OR9 B;  2K7B A;  3SG5 A;  1J1E A;  1DJY A;  2KGR A;  2ZFD A;  4QJ5 B;  1ALV A;  3VRQ A;  2BL0 C;  2L5X B;  2P6B B;  3KO0 A;  1CB1 A;  1SSE B;  1CTR A;  1DF0 A;  1L2O B;  2PMY A;  5FYX A;  3TDI A;  1SBJ A;  2BKI B;  2WCK A;  3PM2 A;  2NCP A;  4YI9 A;  1PSR A;  1TIZ A;  5B8I B;  2LLT A;  1CDM A;  1JFK A;  1V1F A;  2QEV A;  5CPV A;  1OOF A;  3NHI A;  3UNW A;  3UO9 A;  2WCB A;  3I5I B;  3IF7 A;  4C0L A;  2OPO A;  3S0A A;  3QME A;  4DRW A;  2JPO A;  2WCF A;  3BUX B;  4HRE E;  1WDC C;  2HQW A;  4ORB B;  1DGV A;  4CFR A;  2LP3 A;  1M39 A;  2ZRS A;  3AAK A;  4GGF A;  1A75 B;  1F4Q A;  3CZ2 A;  2M29 A;  1H8B A;  3CZT X;  3OX5 A;  4NQG A;  1AHR A;  3TDZ A;  1N2D A;  2KNE A;  3CDN A;  1NP8 A;  2JT8 A;  1KK7 Y;  1OQP A;  1N0Y A;  5KTY A;  1XK4 C;  1K8U A;  2JC2 A;  4MVF A;  2BCX A;  5CSJ A;  3PAL A;  2Q91 A;  3HCM A;  2JT0 A;  1K95 A;  1MXE A;  1YR5 A;  1KK7 Z;  4JKT A;  5I2O A;  2BCA A;  2K7O A;  1PUL A;  5DIC A;  1YUT A;  2KQ6 A;  3LLE A;  4I5K A;  1LXF C;  2K60 A;  4ORC B;  1QAT A;  1CDP A;  1EL4 A;  2LHL A;  5K89 A;  1QAS A;  2KSP A;  1RWY A;  1MWN A;  3IQO A;  1YUS A;  3SG4 A;  2LMT A;  3NSI A;  1BR4 B;  4YGB B;  5ER5 A;  3WHU B;  1ODB A;  1CMG A;  1M31 A;  1WLM A;  1PAL A;  4HSZ A;  4M2P A;  4BY5 A;  4F0Z B;  2FJU B;  1FBV A;  2OTG B;  2ZNE A;  1YVH A;  4PHJ A;  2JNF A;  4R1E A;  2KBI A;  3A8R A;  1A75 A;  1S36 A;  1NIW A;  3OB2 B;  3ZNI A;  5AFP A;  1LS8 A;  1QLS A;  2KI4 C;  4GGF C;  4GPL B;  1KWO C;  2LVV A;  3CYZ A;  1ZOT B;  2JU0 A;  1B8C A;  2M3W A;  4PE0 A;  2KI6 C;  1GJY A;  2M9G A;  1PRW A;  4AQJ A;  1YRT B;  2TN4 A;  1UHK A;  3KPX A;  4P5O E;  2CT9 A;  4NDC A;  1QV1 A;  5BPJ A;  2JT3 A;  1F54 A;  5HLO A;  1NCY A;  2JZI A;  2MLF C;  3GK1 A;  1L2O C;  2JXC A;  2ZND A;  1KFX S;  1VRK A;  4PT1 A;  1FF1 A;  3NSK A;  5ER4 X;  3BUM B;  3SG7 A;  4C0J A;  3N7H A;  2IS9 A;  2F2P A;  3OP0 A;  4MZJ A;  3I5I C;  2FCD A;  3I5H B;  1OOI X;  2K61 A;  2WOR A;  1IQ5 A;  3FE9 A;  4MN0 A;  2EHB A;  1BJF A;  1SY9 A;  1TUZ A;  2LLS A;  2MJW B;  2B1U A;  4OV2 A;  3D0Y B;  2WC6 A;  3KHE A;  3D78 A;  4GAO A;  1REC A;  2I7A A;  5AEQ A;  1WRL A;  2NCO A;  5DKN A;  1LA0 A;  1W7J B;  3BJH A;  3HX4 A;  3DF0 B;  1PK0 D;  4YGE B;  1S1E A;  3R1P A;  2L5Y A;  1CFD A;  2LAP A;  4MZL A;  1K90 D;  1A29 A;  1TCF A;  3LK1 A;  4M2Q A;  1C07 A;  4GFT A;  1CFF A;  1NCX A;  1B1G A;  1MR8 A;  1P28 A;  1GM0 A;  1K2H A;  1U5I A;  4XJK B;  2F33 A;  1C7V A;  2BNX A;  2K7C A;  4NDB A;  2I94 A;  3CZ1 A;  4YBH B;  2ZN9 A;  1M45 A;  2MBX A;  5IBW A;  1WY9 A;  3O6B A;  5HKZ A;  5HKW A;  5KSZ A;  1CFC A;  1C3Z A;  3FIA A;  2LVJ A;  2OTG C;  2PVB A;  1QTX A;  2WCM A;  3EVU A;  4HRH A;  3EVV A;  1WRZ A;  3F45 A;  3E3R A;  2BE6 A;  3PM8 A;  2LMV A;  4HRG A;  1A03 A;  1K93 D;  2KYC A;  3JTD C;  3DF0 A;  4PHM A;  1IKU A;  1B7T Z;  2JUL A;  2QEH A;  1WRK A;  4BY4 A;  1JBA A;  1DT7 B;  1UWO A;  1J7O A;  2K2F A;  3NSL A;  1OSA A;  5AAN A;  2QEO A;  1PVA A;  2PRU A;  4MSP A;  2FJY A;  1E8A A;  1RFJ A;  2O5G A;  3I5F B;  1F71 A;  3DXL A;  2KFF A;  2M8U A;  3VB1 A;  2KYF A;  4XJK A;  4IJ7 A;  3BXK A;  2A4J A;  1MQ1 A;  3A4U B;  1TWO A;  1XYD A;  1OOH A;  1AJ4 A;  1NUB A;  2H61 A;  3SG6 A;  2QDI A;  5J3X A;  4I5J A;  5HLV A;  1SK6 D;  2L50 A;  2Y5I A;  1NX1 A;  3I5H C;  3KEV A;  1J55 A;  1A4P A;  2K0J A;  1HT9 A;  3TZ1 A;  4WQ2 A;  1DJG A;  1G4Y R;  1NX3 A;  2OS8 B;  3QRX A;  1ZUZ A;  3WHT B;  2LV7 A;  4ZCU A;  1SCM B;  1LIN A;  2G2B A;  3D74 A;  1BT6 A;  1OOJ A;  4KYN A;  1DQE A;  3WNX B;  5AXI A;  1B8R A;  1Y1X A;  1SPY A;  2O60 A;  3OB1 B;  3OHM B;  2KLE A;  2L0P A;  3VRN A;  2JRF A;  1KK8 B;  3IVT A;  2WCJ A;  2LC5 A;  4JWQ A;  1HQV A;  3BUW B;  1BG1 A;  1DJW A;  1RJV A;  2GTE A;  2BAP A;  2KQY A;  1MUX A;  1JF0 A;  2HQ8 A;  3O78 A;  2HET A;  2PSR A;  3C1V A;  1KCY A;  4PCW A;  2M7N A;  3I5G C;  3VRO A;  1DJX A;  2WCL A;  3SG2 A;  1OZS A;  4PE4 A;  1XVJ A;  4D1E A;  1CFP A;  1RTP 1;  2LP2 A;  4FQO A;  1OE9 B;  3R72 A;  2E30 A;  2QEB A;  1PVB A;  4OVN F;  1JWD A;  4P2Y B;  1S5G Y;  2BBM A;  1DEL A;  1S6I A;  1A2X A;  2BEC A;  3CAB A;  3S0B A;  1B47 A;  1B8L A;  1X02 A;  4DS7 A;  1EG3 A;  3L4A A;  4MRX A;  2SCP A;  3DZT A;  3B86 A;  2KLD A;  3B7A A;  2I2R E;  3OGN A;  2KFG A;  1KSO A;  1S5G Z;  1Y1A A;  1SR6 B;  4CFQ A;  2GGM A;  3FWC A;  1DMO A;  1Y6W A;  1PSB A;  1EH2 A;  3DVJ A;  5EL2 A;  1LVC D;  1IH0 A;  3D73 A;  2G9B A;  4GNK B;  4AQI A;  3CR4 X;  3I5F C;  1AVS A;  3NGV A;  2M1U A;  3CLN A;  2P70 A;  2PAL A;  1U5I B;  5JOL A;  1MHO A;  1TOP A;  1IGV A;  1OZO A;  2H8V A;  1MF8 B;  2LUX A;  2Q4U A;  3S0E A;  4A4B A;  1DJH A;  1XFR A;  4WQ3 A;  2M0R A;  1SL7 A;  5KU1 A;  1DGU A;  1NCZ A;  2QAC A;  2Y1N A;  3D75 A;  5F6T A;  3B6X A;  3SG3 A;  3RZS A;  1BR1 B;  1SCV A;  2WOS A;  4YGC B;  1BOC A;  2L2C A;  3D76 A;  1QVI Y;  2OS8 C;  1FPW A;  4MEW A;  2KPH A;  1UHN A;  1F70 A;  4TNC A;  3BOW A;  1D1O A;  1NYA A;  2LAN A;  2MAZ A;  2H2K A;  2AMI A;  4YI8 A;  3V2L A;  1CNP A;  4ZCV A;  3FE8 A;  1N65 A;  1XFW O;  1G8I A;  1QVI Z;  1RK9 A;  3O4X A;  1NX2 A;  4ETO A;  3K21 A;  1SYM A;  1EG4 A;  1KK8 C;  1KFX L;  5FI2 A;  1C7W A;  4YGD B;  1BF5 A;  3PFV A;  2JXL A;  1CDN A;  1DEK A;  1EJ3 A;  2K2A A;  3OBV A;  1AUI B;  4MRY A;  1H4B A;  4N5X A;  4OKH A;  1UHJ A;  1Z4H A;  2CNP A;  1B9A A;  4NDD A;  3DVE A;  4A4C A;  1SKT A;  2GGZ A;  4E68 A;  2LCP A;  1FI6 A;  1CDL A;  1Y1U A;  4U8D A;  1IWQ A;  4PDZ A;  3PJI A;  3S0G A;  5D3O A;  3D77 A;  1B7T Y;  4PE1 A;  5JJG A;  1ZMZ A;  2P71 A;  1OOG A;  1XFX O;  4FQT A;  3SIA A;  2PAS A;  1YX8 A;  1UHI A;  2AAO A;  1IQ3 A;  3VRR A;  5I94 A;  2ISD A;  3CGA A;  3LL8 B;  5I8N A;  1YX7 A;  5DKR A;  3K1E A;  4OZD A;  4PHN A;  2LVI A;  2KBM A;  2Y4Q A;  2DOQ A;  2M7L A;  4AOM A;  1CKK A;  1QX2 A;  2CTN A;  2KAX A;  3JVT B;  2KDH A;  3DYE A;  1J7R A;  4WRI A;  1QX7 A;  3CZ0 A;  4DUQ A;  1QV0 A;  1XO5 A;  3EK4 A;  3H4S E;  2F2O A;  2WC5 A;  1NWD A;  3NSO A;  4YGA A;  2M97 A;  5TNC A;  1KQM B;  1C3Y A;  1J7P A;  3SIB A;  1AP4 A;  1SR6 C;  2BE4 A;  1DVI A;  2KOT A;  2L51 A;  3PN7 B;  3PSR A;  1L7Z A;  1XA5 A;  5DKQ A;  2MRD A;  1QIW A;  2K8M B;  1QIV A;  3KF9 A;  3D10 A;  1TNQ A;  2KHN A;  3TDU A;  1MXL C;  4GBA A;  3O4Y A;  5FI7 A;  1CMF A;  1Z2C B;  3SS5 A;  1XFY O;  4OCI A;  2LMU A;  5PAL A;  4JD9 A;  3BFA A;  4N1F A;  1BOD A;  1G33 A;  1K96 A;  4PAL A;  3VRP A;  3MSE B;  4PHK A;  3S0F A;  1CM4 A;  2CXJ A;  2V53 A;  1XFZ O;  3GOF A;  2AUC A;  4JQ0 D;  1KSM A;  1IJ6 A;  4CLN A;  1FI5 A;  2I18 A;  4PE7 A;  4IL1 A;  4M2O A;  1CLM A;  2L4H A;  3DVM A;  3GK4 X;  3AAJ A;  2LUC A;  1IIO A;  2CCM A;  3O2P A;  1WLZ A;  2RGI A;  2ZRT A;  2BBN A;  3AKB A;  3L4L A;  1S6J A;  1AK8 A;  3Q8I A;  2WND A;  1F4O A;  3R1V A;  3LCP C;  3DY9 A;  1S6C A;  2JTT A;  1V1G A;  2F3Y A;  2ZN8 A;  1JSA A;  3PAT A;  5CSI A;  1OMR A;  1XFV O;  1K94 A;  3SS4 A;  2KAY A;  1TN4 A;  3R1O A;  3GK2 A;  2GV5 A;  3S0D A;  2WC8 A;  1W9Z A;  1QS7 A;  1J7Q A;  1R2U A;  1IG5 A;  1LA3 A;  2H61 C;  2NXQ A;  2R2I A;  2Y1M A;  2LNK A;  3CTN A;  4XYN A;  2LHI A;  2KI6 D;  1YUR A;  2FCE A;  4YRU A;  2WCH A;  2VRG A;  1IRJ A;  3WXA A;  2MLE C;  3BUO B;  1EXR A;  3FS7 A;  4ICB A;  4QJ3 B;  3IQQ A;  3CS1 A;  1TNP A;  3EVR A;  5I2L A;  4JPZ B;  1SNL A;  1NSH A;  1YTZ C;  3BOW B;  3RLZ A;  2EC6 B;  5HKY A;  2PQL A;  1LKJ A;  1OMD A;  3JVT C;  3TUY B;  1XFU O;  1GQM A;  1QJT A;  2WCE A;  3FWB A;  2LLU A;  3B87 A;  4I5L B;  5GQQ C;  3TS5 B;  1JFJ A;  1KQM C;  1JUO A;  2HPS A;  3OX6 A;  4MBE A;  3PN7 C;  5D7F A;  1JF2 A;  2JTZ A;  3ICB A;  5HYD A;  2YGU A;  3CR5 X;  2PYQ A;  1ALW A; 
#chains in the Genus database with same CATH homology
 1BMO A;  1UUR A;  2MHH A;  4UPG A;  1BU3 A;  3JTD B;  2NZ0 A;  5CSF A;  1UP5 A;  1ZFS A;  2D8N A;  4MLW A;  5AER A;  1ZAC A;  1M63 B;  1TNX A;  2L4I A;  3AKA A;  4MZK A;  1S26 D;  1CLB A;  2BL0 B;  4CPV A;  1TTX A;  2KGB C;  2MA2 A;  2QPT A;  2FOT A;  2BCB A;  2K7D A;  2M1K B;  4FTG A;  1DTL A;  1SCM C;  1TRF A;  2JPT A;  1KFU S;  4L9M A;  3EK7 A;  1QXP A;  1CLL A;  1K9U A;  1QLK A;  1DJZ A;  3EKJ A;  4GUK A;  1QX5 B;  1BLQ A;  1WDC B;  2M49 B;  1R6P A;  3CR2 A;  3PLF B;  1RRO A;  2L98 A;  1Q80 A;  1M46 A;  3DVK A;  2HF5 A;  4USL A;  1SL8 A;  2NLN A;  4GGN A;  1SL9 A;  2F3Z A;  2L2E A;  1GGZ A;  1YUU A;  4I5N B;  1S3P A;  1GGW A;  2E6W A;  3RM1 A;  3DD4 A;  4DIR A;  2JNX A;  4ORA B;  5CSN A;  1TCO B;  2JWW A;  4Q04 A;  3SJS A;  1UHH A;  5G08 A;  3EK8 A;  3CWG A;  1KFU L;  4DCK A;  2COL B;  1IJ5 A;  1F55 A;  1NPQ A;  2CBL A;  1K9P A;  1SMG A;  2LM5 A;  1DF0 B;  1TNW A;  2JOJ A;  4QJ4 B;  3I5G B;  1J1D A;  2F8P A;  3ZWH A;  1B4C A;  1K9K A;  2EC6 C;  1NX0 A;  1Y0V H;  2SAS A;  3BQ3 A;  4N1G A;  1YVL A;  3TUY C;  2KAV A;  2LE9 B;  1FW4 A;  2LVK A;  3EKH A;  3TS5 C;  3VGO A;  1AJ5 A;  3M0W A;  3D0Y A;  5I2Q A;  1JC2 A;  1YRU B;  2BKH B;  1KQV A;  4C0K A;  1F8H A;  1UUS A;  1W7I B;  1SRA A;  2KI4 B;  1KWO B;  1OMV A;  4CID A;  2JQ6 A;  3LK0 A;  1DJI A;  1XK4 A;  3BYA A;  1CM1 A;  5D69 A;  3NXA A;  3BUN B;  1SW8 A;  2EGD A;  2KFH A;  2ZKM X;  4OR9 B;  2K7B A;  3SG5 A;  1J1E A;  1DJY A;  2KGR A;  2ZFD A;  4QJ5 B;  1ALV A;  3VRQ A;  2BL0 C;  2L5X B;  2P6B B;  3KO0 A;  1CB1 A;  1CTR A;  1DF0 A;  1L2O B;  2PMY A;  5FYX A;  3TDI A;  1SBJ A;  2BKI B;  2NCP A;  4YI9 A;  1PSR A;  1TIZ A;  5B8I B;  2LLT A;  1CDM A;  1JFK A;  1V1F A;  5CPV A;  4C0L A;  2WCB A;  3I5I B;  3IF7 A;  2OPO A;  4DRW A;  2WCF A;  3BUX B;  4HRE E;  1WDC C;  2HQW A;  4ORB B;  1DGV A;  4CFR A;  2LP3 A;  1M39 A;  2ZRS A;  3AAK A;  4GGF A;  1A75 B;  1F4Q A;  2M29 A;  1H8B A;  3CZT X;  3OX5 A;  4NQG A;  1AHR A;  3TDZ A;  1N2D A;  2KNE A;  1NP8 A;  2JT8 A;  1KK7 Y;  1OQP A;  1N0Y A;  5KTY A;  1XK4 C;  1K8U A;  2JC2 A;  4MVF A;  2BCX A;  5CSJ A;  3PAL A;  2Q91 A;  3HCM A;  2JT0 A;  1K95 A;  1MXE A;  1YR5 A;  1KK7 Z;  5I2O A;  2BCA A;  2K7O A;  1PUL A;  1YUT A;  2KQ6 A;  3LLE A;  4I5K A;  1LXF C;  4ORC B;  1QAT A;  1CDP A;  1EL4 A;  2LHL A;  5K89 A;  1QAS A;  2KSP A;  1RWY A;  1MWN A;  3IQO A;  1YUS A;  3SG4 A;  2LMT A;  3NSI A;  1BR4 B;  4YGB B;  5ER5 A;  3WHU B;  1ODB A;  1CMG A;  1M31 A;  1WLM A;  1PAL A;  4HSZ A;  4M2P A;  4BY5 A;  4F0Z B;  2FJU B;  1FBV A;  2OTG B;  2ZNE A;  1YVH A;  4PHJ A;  2JNF A;  4R1E A;  2KBI A;  3A8R A;  1A75 A;  1S36 A;  1NIW A;  3OB2 B;  3ZNI A;  5AFP A;  1QLS A;  2KI4 C;  4GGF C;  4GPL B;  1KWO C;  2LVV A;  1ZOT B;  2JU0 A;  1B8C A;  2M3W A;  4PE0 A;  2KI6 C;  1GJY A;  2M9G A;  1PRW A;  4AQJ A;  1YRT B;  2TN4 A;  1UHK A;  3KPX A;  4P5O E;  2CT9 A;  4NDC A;  1QV1 A;  5BPJ A;  2JT3 A;  1F54 A;  5HLO A;  1NCY A;  2JZI A;  2MLF C;  3GK1 A;  1L2O C;  2JXC A;  2ZND A;  1KFX S;  1VRK A;  1FF1 A;  3NSK A;  5ER4 X;  3BUM B;  3SG7 A;  4C0J A;  2IS9 A;  2F2P A;  3OP0 A;  4MZJ A;  3I5I C;  2FCD A;  3I5H B;  2K61 A;  2WOR A;  1IQ5 A;  4MN0 A;  4OV2 A;  2EHB A;  1BJF A;  1SY9 A;  2LLS A;  2MJW B;  1CFC A;  2B1U A;  3D0Y B;  3KHE A;  4GAO A;  1REC A;  2I7A A;  5AEQ A;  1WRL A;  2NCO A;  5DKN A;  1LA0 A;  1W7J B;  3HX4 A;  3DF0 B;  1PK0 D;  4YGE B;  1S1E A;  1CFD A;  2LAP A;  4MZL A;  1K90 D;  1A29 A;  1TCF A;  3LK1 A;  4M2Q A;  1C07 A;  4GFT A;  1CFF A;  1NCX A;  1B1G A;  1MR8 A;  1K2H A;  1U5I A;  4XJK B;  2F33 A;  1C7V A;  2K7C A;  4NDB A;  2I94 A;  4YBH B;  2ZN9 A;  1M45 A;  2MBX A;  5IBW A;  1WY9 A;  3O6B A;  5HKZ A;  5HKW A;  5KSZ A;  3FIA A;  2LVJ A;  2OTG C;  2PVB A;  1QTX A;  3EVU A;  4HRH A;  3EVV A;  1WRZ A;  3F45 A;  3E3R A;  2BE6 A;  3PM8 A;  2LMV A;  4HRG A;  1A03 A;  1K93 D;  2KYC A;  3JTD C;  3DF0 A;  4PHM A;  1IKU A;  1B7T Z;  2JUL A;  4BY4 A;  1WRK A;  1JBA A;  1DT7 B;  1UWO A;  1J7O A;  2K2F A;  3NSL A;  1OSA A;  5AAN A;  1PVA A;  2PRU A;  4MSP A;  2O5G A;  1E8A A;  1RFJ A;  3I5F B;  1F71 A;  2KFF A;  2M8U A;  2KYF A;  4XJK A;  3BXK A;  2A4J A;  1MQ1 A;  3A4U B;  1XYD A;  1AJ4 A;  1NUB A;  2H61 A;  3SG6 A;  5J3X A;  4I5J A;  5HLV A;  1SK6 D;  2L50 A;  2Y5I A;  1NX1 A;  3I5H C;  3KEV A;  1J55 A;  1A4P A;  2K0J A;  1HT9 A;  3TZ1 A;  4WQ2 A;  1DJG A;  1G4Y R;  1NX3 A;  2OS8 B;  3QRX A;  1ZUZ A;  3WHT B;  2LV7 A;  4ZCU A;  1SCM B;  1LIN A;  2G2B A;  1BT6 A;  1OOJ A;  3WNX B;  5AXI A;  1B8R A;  1Y1X A;  1SPY A;  2O60 A;  3OB1 B;  3OHM B;  3VRN A;  2L0P A;  2JRF A;  1KK8 B;  2LC5 A;  4JWQ A;  1HQV A;  3BUW B;  1BG1 A;  1DJW A;  1RJV A;  2KQY A;  1MUX A;  1JF0 A;  2HQ8 A;  3O78 A;  2HET A;  2PSR A;  3C1V A;  1KCY A;  4PCW A;  2M7N A;  3I5G C;  3VRO A;  1DJX A;  3SG2 A;  1OZS A;  4PE4 A;  1XVJ A;  4D1E A;  1CFP A;  1RTP 1;  2LP2 A;  4FQO A;  1OE9 B;  2E30 A;  4OVN F;  1PVB A;  1JWD A;  4P2Y B;  1S5G Y;  2BBM A;  1S6I A;  1A2X A;  2BEC A;  1B47 A;  1B8L A;  1X02 A;  4DS7 A;  1EG3 A;  4MRX A;  2SCP A;  2I2R E;  2KFG A;  1KSO A;  1S5G Z;  1Y1A A;  1SR6 B;  4CFQ A;  2GGM A;  3FWC A;  1DMO A;  1Y6W A;  1PSB A;  1EH2 A;  3DVJ A;  1LVC D;  1IH0 A;  2G9B A;  4GNK B;  4AQI A;  3CR4 X;  3I5F C;  1AVS A;  2M1U A;  3CLN A;  2PAL A;  1U5I B;  5JOL A;  1MHO A;  1TOP A;  1IGV A;  1OZO A;  2LUX A;  1MF8 B;  2Q4U A;  4A4B A;  1DJH A;  4WQ3 A;  2M0R A;  1SL7 A;  5KU1 A;  1DGU A;  1NCZ A;  2QAC A;  2Y1N A;  5F6T A;  3SG3 A;  1BR1 B;  1SCV A;  2WOS A;  4YGC B;  1BOC A;  1QVI Y;  2OS8 C;  1FPW A;  4MEW A;  1UHN A;  1F70 A;  4TNC A;  3BOW A;  1D1O A;  1NYA A;  2LAN A;  2MAZ A;  2H2K A;  2AMI A;  4YI8 A;  1CNP A;  4ZCV A;  1N65 A;  1XFW O;  1G8I A;  1QVI Z;  1RK9 A;  4ETO A;  1NX2 A;  3K21 A;  1SYM A;  1EG4 A;  1KK8 C;  1KFX L;  1C7W A;  4YGD B;  1BF5 A;  3PFV A;  2JXL A;  1CDN A;  1EJ3 A;  2K2A A;  1AUI B;  4MRY A;  1H4B A;  4N5X A;  4OKH A;  1UHJ A;  2CNP A;  1B9A A;  4NDD A;  3DVE A;  4A4C A;  1SKT A;  2GGZ A;  4E68 A;  2LCP A;  1FI6 A;  1CDL A;  1Y1U A;  4U8D A;  1IWQ A;  4PDZ A;  1B7T Y;  4PE1 A;  5JJG A;  1ZMZ A;  1XFX O;  3SIA A;  2PAS A;  1YX8 A;  1UHI A;  2AAO A;  1IQ3 A;  3VRR A;  2ISD A;  3CGA A;  3LL8 B;  5I8N A;  1YX7 A;  5DKR A;  4PHN A;  2LVI A;  2KBM A;  2Y4Q A;  2DOQ A;  2M7L A;  4AOM A;  1CKK A;  1QX2 A;  2CTN A;  2KAX A;  3JVT B;  2KDH A;  4WRI A;  1J7R A;  4DUQ A;  1QX7 A;  1QV0 A;  1XO5 A;  3EK4 A;  3H4S E;  2F2O A;  3NSO A;  1NWD A;  4YGA A;  5TNC A;  2M97 A;  1KQM B;  1J7P A;  3SIB A;  1AP4 A;  1SR6 C;  2BE4 A;  1DVI A;  2KOT A;  2L51 A;  3PN7 B;  3PSR A;  1L7Z A;  1XA5 A;  5DKQ A;  2MRD A;  1QIW A;  2K8M B;  1QIV A;  3KF9 A;  3D10 A;  1TNQ A;  2KHN A;  3TDU A;  1MXL C;  4GBA A;  3O4Y A;  1CMF A;  1XFY O;  4OCI A;  2LMU A;  5PAL A;  1BOD A;  4N1F A;  1G33 A;  1K96 A;  4PAL A;  3VRP A;  3MSE B;  4PHK A;  1CM4 A;  2CXJ A;  2V53 A;  1XFZ O;  3GOF A;  2AUC A;  4JQ0 D;  1KSM A;  1IJ6 A;  4CLN A;  1FI5 A;  2I18 A;  4PE7 A;  4IL1 A;  4M2O A;  1CLM A;  2L4H A;  3DVM A;  3GK4 X;  3AAJ A;  2LUC A;  2CCM A;  3O2P A;  1WLZ A;  2RGI A;  2ZRT A;  2BBN A;  3AKB A;  1AK8 A;  1S6J A;  2WND A;  1F4O A;  3LCP C;  1S6C A;  2JTT A;  1V1G A;  2F3Y A;  2ZN8 A;  1JSA A;  3PAT A;  5CSI A;  1OMR A;  1XFV O;  1K94 A;  2KAY A;  1TN4 A;  3GK2 A;  2GV5 A;  2WC8 A;  1QS7 A;  1J7Q A;  1R2U A;  1IG5 A;  1LA3 A;  2H61 C;  2NXQ A;  2R2I A;  2Y1M A;  2LNK A;  3CTN A;  4XYN A;  2LHI A;  2KI6 D;  1YUR A;  2FCE A;  4YRU A;  2VRG A;  1IRJ A;  3WXA A;  2MLE C;  3BUO B;  1EXR A;  3FS7 A;  4ICB A;  4QJ3 B;  3IQQ A;  3CS1 A;  1TNP A;  3EVR A;  5I2L A;  4JPZ B;  1SNL A;  1NSH A;  1YTZ C;  3BOW B;  3RLZ A;  2EC6 B;  5HKY A;  1LKJ A;  1OMD A;  3JVT C;  3TUY B;  1XFU O;  1GQM A;  1QJT A;  2WCE A;  3FWB A;  2LLU A;  4I5L B;  5GQQ C;  3TS5 B;  1JFJ A;  1KQM C;  1JUO A;  2HPS A;  3OX6 A;  4MBE A;  3PN7 C;  5D7F A;  1JF2 A;  2JTZ A;  3ICB A;  5HYD A;  3CR5 X;  1ALW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...