1AUIB

Human calcineurin heterodimer
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
165
structure length
165
Chain Sequence
SYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE PHOSPHATASE 2B
publication title Crystal structures of human calcineurin and the human FKBP12-FK506-calcineurin complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 60
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 1997-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00036 EF-hand_1 EF hand
B PF13202 EF-hand_5 EF hand
B PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1auiB00
3VRRA 1XYDA 1NIWA 4MZLA 2GGMA 2Y1MA 5AFPA 2SASA 1FI6A 3K21A 3SG6A 3PALA 1SCMB 2WCEA 1DF0B 1M39A 1AVSA 4PDZA 1CMFA 2JULA 4HREE 1AJ4A 3JVTC 1SL7A 3I5GB 4DIRA 1JC2A 2CXJA 1C7VA 1F55A 1A29A 1QS7A 2TN4A 1OE9B 3RLZA 1S26D 1NSHA 2BBNA 1GJYA 4PE7A 3TDIA 4NQGA 1SRAA 1V1FA 1B47A 3EVUA 1UHNA 3HCMA 5CSJA 3OX6A 2DOQA 2L4HA 1SYMA 3EK8A 1B7TZ 2LVKA 1OMRA 2BE4A 1MHOA 2KOTA 2OPOA 1YRTB 1IWQA 4NDCA 4AOMA 1S1EA 3IQQA 3WHTB 2WNDA 3AKBA 3D0YA 3SIAA 2LP3A 4F0ZB 5B8IB 4YI8A 2EHBA 4A4BA 2ZRTA 1YVHA 3PN7B 2RGIA 1RK9A 3NSIA 1B7TY 5HKYA 2ZNDA 2WC8A 5HYDA 2MAZA 1SR6C 2PASA 2LLSA 3DVJA 4PHNA 2I2RE 1NUBA 5IBWA 1KK8C 5DKNA 1M45A 2LANA 4WQ2A 2Y5IA 1CLBA 3VRPA 2KI6C 1AHRA 1CDLA 1NWDA 1A75B 1DJZA 1QATA 2D8NA 1ZACA 1S6IA 4N5XA 5PALA 2M7LA 2WCBA 1YUUA 2K2FA 3PSRA 4GGFC 4MZJA 2LV7A 2NCOA 1V1GA 3AKAA 1GGWA 3KHEA 5CSNA 1QXPA 2P6BB 4FQOA 5DKQA 1IH0A 1JSAA 1A4PA 2ZRSA 1TTXA 1PK0D 2COLB 1PVAA 1K94A 4YBHB 1UHHA 5GQQC 1PULA 3PATA 1QVIY 4MVFA 5JJGA 2JZIA 2JT0A 2K7DA 1B4CA 3LK0A 3EVVA 1SK6D 2LC5A 5CSFA 1S6CA 3A4UB 1CNPA 3SG5A 4A4CA 4MBEA 1CDNA 1BU3A 1NP8A 1L2OB 1N65A 2ZN8A 1WRZA 1YR5A 1OMVA 2K2AA 3O78A 3MSEB 1S5GZ 1NCXA 2H61C 1Y6WA 2M3WA 3WNXB 1GGZA 1U5IB 1NX2A 1RECA 1TN4A 4C0KA 5KU1A 2K7OA 3VRQA 1KFUL 4E68A 4OCIA 4PE0A 3TZ1A 1FPWA 2IS9A 3TDUA 1TCOB 2LUCA 1XO5A 3VGOA 4OVNF 3CZTX 3CS1A 1DJYA 1BR4B 2ZN9A 1HT9A 2H61A 5F6TA 1BLQA 1S5GY 1DJGA 2HETA 2GGZA 3I5FB 3GK1A 5I8NA 1R6PA 2M49B 3DVEA 1JF2A 1F71A 2BL0B 2K7BA 4BY4A 4N1FA 3I5GC 4YRUA 2LP2A 1XFZO 4MLWA 1CB1A 2HPSA 1KCYA 3CR5X 3NSOA 1XA5A 1DF0A 2MRDA 3KO0A 3NXAA 4AQIA 1XVJA 2FJUB 2EC6C 4HSZA 2CCMA 2F2OA 1B9AA 4WRIA 1QV1A 1B8RA 5G08A 1BOCA 1DMOA 4GUKA 1E8AA 3OX5A 1AP4A 1K9UA 1N0YA 3SG3A 1MXLC 1X02A 4YGAA 3I5IC 2BBMA 1QX7A 5K89A 1LVCD 1K9KA 3LLEA 3QRXA 2LHIA 4DRWA 4QJ5B 1HQVA 2PSRA 2KGBC 2LVVA 4UPGA 1ALWA 1IQ5A 5JOLA 2LMUA 3TDZA 3EKJA 4HRGA 1Y0VH 1YTZC 3FWCA 3BOWB 1W7IB 1YUTA 2L50A 1XFYO 1CDMA 2M8UA 1TNXA 4U8DA 4M2OA 3BUOB 2I7AA 1TNQA 2AMIA 3PN7C 2M1KB 3ICBA 2LHLA 4PHJA 2KFGA 3I5HB 4MEWA 1MUXA 4TNCA 1PVBA 1UURA 1DJXA 1EH2A 2OS8B 1WDCB 2HQWA 1QJTA 4MN0A 1UHIA 2M29A 3OB2B 3SG7A 1TCFA 4GAOA 1PRWA 4GFTA 1QX2A 5ER5A 3BUMB 2Q4UA 2BE6A 2L98A 2F3ZA 1CLLA 5D69A 3IF7A 3E3RA 1C07A 3HX4A 1GQMA 1MXEA 1F4QA 1QTXA 4L9MA 5AERA 1KQMB 4Q04A 2M7NA 3DF0B 1NX1A 4OV2A 4CLNA 1A75A 3LL8B 2KI4B 2PMYA 3BXKA 1IGVA 1QIVA 3BUWB 1J55A 4PHMA 1BMOA 1QVIZ 4PHKA 1CDPA 1MR8A 2L0PA 4MRXA 1BR1B 1WRLA 1F54A 4DUQA 1ODBA 1A03A 1KFUS 1L2OC 2JQ6A 1NCYA 2LAPA 3EK4A 3TUYC 4PE4A 1Y1UA 1QV0A 2I18A 1R2UA 5AEQA 4BY5A 2NZ0A 2MLFC 4XYNA 1XFWO 4CFRA 1LXFC 3CR2A 4GGNA 1WLZA 3SG4A 2KI6D 2LVIA 2KYCA 4OR9B 1G4YR 1SMGA 2E30A 4XJKB 2BKHB 3EK7A 1W7JB 2JT8A 3CLNA 1KQVA 3RM1A 1C7WA 5FYXA 1FBVA 3FIAA 1J1EA 1J7RA 3CGAA 3LCPC 4N1GA 2BECA 3KPXA 1B8LA 2QPTA 1U5IA 2NLNA 1LA0A 4FTGA 1KFXL 3DVKA 5D7FA 1TNPA 2KYFA 2LMVA 2BL0C 2KSPA 1PSBA 5AXIA 4JQ0D 3TS5B 1XK4A 2R2IA 1K90D 1EL4A 1CFFA 3JTDC 4USLA 4DCKA 1YUSA 2AUCA 1K9PA 1SR6B 1ZFSA 2LNKA 5BPJA 1QLSA 1S36A 1KK8B 4CIDA 3SJSA 1J7OA 1WRKA 2KFFA 4NDBA 1EG3A 1FW4A 1TOPA 1DVIA 2OTGC 1CTRA 4QJ4B 1UWOA 1A2XA 1SBJA 1BODA 2FOTA 1D1OA 1Y1XA 1K2HA 1CFCA 1NPQA 2JRFA 1SCMC 2JWWA 3PLFB 2K61A 4M2PA 1JUOA 3CTNA 1ZUZA 5HLOA 2JT3A 4I5KA 1YX8A 1K93D 1YURA 1FF1A 4DS7A 1BG1A 4YGDB 1CFDA 1JBAA 4ORBB 1KSMA 2M9GA 1M31A 2L51A 1J7PA 2O5GA 1IRJA 1OSAA 1BJFA 1B8CA 4MRYA 3I5HC 1ZOTB 4GPLB 1S3PA 1CMGA 1DJIA 1QX5B 2OS8C 4WQ3A 3BOWA 1EXRA 5HLVA 1OMDA 2KBMA 1YX7A 2VRGA 2K0JA 1JFKA 4OKHA 3LK1A 2LMTA 2F8PA 1MWNA 4ORAB 2CNPA 2AAOA 1KWOB 2ISDA 4I5NB 4NDDA 1KQMC 1LA3A 2KBIA 3VRNA 1WY9A 1QIWA 3NSLA 1IQ3A 3KEVA 1IJ5A 3AAJA 1IG5A 1EG4A 5I2LA 2KI4C 2ZKMX 2KNEA 2BCAA 2JXLA 1H8BA 1UHJA 2CBLA 5KTYA 2KAYA 2LUXA 2F2PA 3CWGA 1MF8B 2FCEA 3EVRA 3OP0A 4YGCB 3VROA 2BCXA 3PFVA 3WHUB 4CPVA 3DF0A 1ALVA 2O60A 1CLMA 1LINA 5TNCA 2HF5A 1EJ3A 2LVJA 2Q91A 1SPYA 4QJ3B 2M1UA 2H2KA 1UHKA 4ORCB 2EC6B 1K95A 2JU0A 5HKZA 3FWBA 4P2YB 1KSOA 1DJHA 1DJWA 2ZFDA 4HRHA 1SL9A 1Q80A 5ER4X 4AQJA 5I2OA 1DT7B 1S6JA 1OZSA 1M46A 1KFXS 1AJ5A 4ICBA 2MHHA 1B1GA 2HQ8A 3I5IB 2LLUA 1UUSA 3D10A 2MLEC 1N2DA 2LCPA 4YGEB 2PRUA 3BUXB 1TNWA 3JVTB 1NCZA 4ZCVA 2MA2A 1M63B 3ZNIA 2KAVA 4M2QA 1QASA 1SKTA 2JTZA 2KFHA 2L4IA 3BQ3A 2NCPA 3O6BA 3OHMB 1PALA 4D1EA 1MQ1A 2KGRA 3TS5C 4XJKA 2ZNEA 1IKUA 1H4BA 3PM8A 3D0YB 1Y1AA 1FI5A 1QLKA 2Y4QA 1RWYA 2K7CA 4PCWA 2L2EA 2WOSA 1K96A 1L7ZA 3EKHA 3GK4X 3GOFA 4GNKB 1JF0A 1PSRA 2FCDA 1XK4C 1SNLA 1J7QA 4P5OE 1IJ6A 1WLMA 4PE1A 2JNXA 2Y1NA 4JPZB 2F3YA 2SCPA 1K8UA 2F33A 5KSZA 1F4OA 3I5FC 4MZKA 1OQPA 2A4JA 3IQOA 2KQ6A 1VRKA 3BUNB 1DTLA 2EGDA 4MSPA 5J3XA 2V53A 2G9BA 4I5JA 1NX3A 1NYAA 2MJWB 2NXQA 2GV5A 1BF5A 1J1DA 4GGFA 2G2BA 1XFXO 4JWQA 2KDHA 2M97A 4R1EA 4C0JA 1YVLA 1F70A 4C0LA 1RTP1 1XFUO 2JC2A 3CR4X 2CTNA 2B1UA 3NSKA 2E6WA 2JPTA 3GK2A 1SCVA 4YGBB 3H4SE 1JWDA 1G8IA 3FS7A 1TRFA 1YRUB 2L5XB 1CM4A 2LLTA 2MBXA 1KK7Z 3F45A 3TUYB 3AAKA 1RROA 3WXAA 4ZCUA 1LKJA 1TIZA 1OOJA 1UP5A 5DKRA 1NX0A 3DD4A 2PVBA 3SG2A 3SIBA 4PALA 5CSIA 1DGUA 1KWOC 4IL1A 4ETOA 4I5LB 1JFJA 2KHNA 2JNFA 1SL8A 1RFJA 2I94A 1ZMZA 4CFQA 2JOJA 2PALA 5HKWA 2QACA 3BYAA 1KK7Y 5I2QA 3O4YA 1OZOA 5CPVA 2WORA 1RJVA 2CT9A 3OB1B 1SW8A 1WDCC 1AK8A 2LM5A 4GBAA 2JTTA 3O2PA 3DVMA 1G33A 3C1VA 3JTDB 1SY9A 4YI9A 3ZWHA 3A8RA 1DGVA 1CFPA 2WCFA 2BCBA 2BKIB 3KF9A 5AANA 2K8MB 2JXCA 1CKKA 1F8HA 2KQYA 1XFVO 3M0WA 2M0RA 1BT6A 2OTGB 1CM1A 2KAXA 1AUIB 2LE9B
chains in the Genus database with same CATH superfamily
3VRRA 1XYDA 1NIWA 2KLEA 2GGMA 2Y1MA 4MZLA 5AFPA 2SASA 1FI6A 3K21A 3SG6A 3PALA 1SCMB 2WCEA 1DF0B 1M39A 1OOFA 1AVSA 3D74A 4PDZA 1CMFA 2JULA 4HREE 1AJ4A 3JVTC 1SL7A 1ORGA 3S0DA 3I5GB 4DIRA 1JC2A 2CXJA 2QEHA 1C7VA 1F55A 1A29A 1QS7A 2TN4A 1OE9B 3RLZA 1S26D 1NSHA 3OBVA 2BBNA 1GJYA 4PE7A 3TDIA 4NQGA 1SRAA 1TUZA 3BJHA 1V1FA 1B47A 3EVUA 1UHNA 3HCMA 5CSJA 3OX6A 2DOQA 2L4HA 1SYMA 3EK8A 1B7TZ 2WCHA 2LVKA 1OMRA 2BE4A 1MHOA 3NHTA 2KOTA 2OPOA 1YRTB 1IWQA 3QMEA 4NDCA 4AOMA 1S1EA 3IQQA 3WHTB 2ERBA 2WNDA 3AKBA 3CDNA 2QEVA 3D0YA 3L47A 3SIAA 2LP3A 4F0ZB 5B8IB 1SSEB 4YI8A 2EHBA 4A4BA 2ZRTA 1YVHA 3R1PA 3PN7B 2RGIA 1RK9A 3NSIA 1B7TY 5HKYA 2ZNDA 2WC8A 5HYDA 2MAZA 1SR6C 3SS4A 2PASA 2LLSA 3DVJA 4PHNA 2I2RE 1NUBA 5IBWA 1KK8C 5DKNA 1M45A 2LANA 4WQ2A 1DC1A 2Y5IA 3EG5B 1CLBA 3VRPA 2KI6C 1AHRA 1CDLA 2P71A 1NWDA 5FI7A 1A75B 1DJZA 1QATA 2D8NA 1ZACA 1S6IA 3D75A 4N5XA 5PALA 2M7LA 1TUJA 2WCBA 1YUUA 2K2FA 3PSRA 4GGFC 1XFRA 4MZJA 2LV7A 2NCOA 1V1GA 3AKAA 1GGWA 3KHEA 5CSNA 1QXPA 2P6BB 4FQOA 5DKQA 1IH0A 3DY9A 3V2LA 1JSAA 1A4PA 2ZRSA 1TTXA 1PK0D 2COLB 1PVAA 1K94A 4YBHB 1UHHA 3NHIA 5GQQC 1PULA 3PATA 1QVIY 4MVFA 5JJGA 2JZIA 3B86A 2JT0A 2K7DA 2QDIA 1B4CA 3LK0A 3EVVA 1SK6D 2LC5A 5CSFA 1S6CA 3A4UB 4F7FA 1CNPA 3SG5A 4A4CA 4MBEA 1CDNA 1BU3A 1NP8A 1L2OB 3R1OA 1N65A 2ZN8A 3BFAA 1WRZA 1YR5A 1OMVA 2K2AA 3O78A 3MSEB 1S5GZ 1NCXA 2PQLA 5D3OA 2H61C 1Y6WA 2M3WA 3WNXB 1GGZA 1U5IB 3B7AA 1NX2A 1RECA 1TN4A 4C0KA 5KU1A 1C3YA 2K7OA 3VRQA 1KFUL 4E68A 4OCIA 4PE0A 3TZ1A 1FPWA 2IS9A 3TDUA 1TCOB 2LUCA 1XO5A 3FE6A 4OVNF 3VGOA 3CZTX 3CS1A 1DJYA 1BR4B 2ZN9A 1HT9A 2H61A 5F6TA 1BLQA 1S5GY 3SS5A 1DJGA 2HETA 3NGVA 2GGZA 3I5FB 3GK1A 5I8NA 1R6PA 2M49B 3DVEA 1JF2A 1F71A 2BL0B 2K7BA 4BY4A 4N1FA 3I5GC 4YRUA 2LP2A 1XFZO 4MLWA 1CB1A 2HPSA 3BFBA 1KCYA 3CR5X 3NSOA 1XA5A 1DF0A 2MRDA 3KO0A 3NXAA 4AQIA 1XVJA 2FJUB 1DEKA 2EC6C 2CCMA 2F2OA 1B9AA 4HSZA 1QV1A 1B8RA 4WRIA 5G08A 1BOCA 1DMOA 4GUKA 1E8AA 3OX5A 1AP4A 1K9UA 1N0YA 2BNXA 1MXLC 3SG3A 1X02A 3FE9A 4YGAA 3I5IC 2BBMA 1QX7A 1TWOA 5K89A 1LVCD 1K9KA 3LLEA 3QRXA 2LHIA 4DRWA 4QJ5B 1HQVA 2H8VA 2PSRA 2KGBC 2LVVA 4UPGA 1ALWA 2JPOA 1IQ5A 5JOLA 2LMUA 3TDZA 3EKJA 4HRGA 1Y0VH 1YTZC 3FWCA 3BOWB 1W7IB 3CABA 1YUTA 3S0AA 2L50A 1XFYO 1CDMA 2M8UA 1TNXA 4U8DA 4M2OA 3BUOB 2I7AA 1TNQA 2AMIA 3PN7C 2M1KB 3ICBA 4INXA 2LHLA 1OOGA 4FQTA 4PHJA 2KFGA 3B87A 3I5HB 4MEWA 1MUXA 4TNCA 1PVBA 1UURA 1DJXA 1EH2A 4OZDA 2K60A 2OS8B 1WDCB 2HQWA 3D78A 1QJTA 4MN0A 1UHIA 2M29A 3OB2B 3SG7A 1TCFA 4GAOA 1PRWA 4GFTA 1QX2A 5ER5A 3BUMB 3IVTA 2Q4UA 2BE6A 2L98A 2F3ZA 1CLLA 5D69A 2FJYA 3IF7A 3E3RA 1C07A 3HX4A 1GQMA 1MXEA 1F4QA 1QTXA 4L9MA 5AERA 1KQMB 4Q04A 3B6XA 2M7NA 3DF0B 1NX1A 3DYEA 4OV2A 4CLNA 1A75A 3LL8B 2KI4B 2PMYA 3BXKA 1IGVA 1QIVA 3BUWB 1J55A 4PHMA 1BMOA 1QVIZ 2L5YA 1CDPA 1MR8A 2L0PA 4MRXA 4PHKA 1BR1B 1WRLA 2WCLA 1F54A 4DUQA 1ODBA 1A03A 1KFUS 1L2OC 2JQ6A 1NCYA 2LAPA 3EK4A 3TUYC 4PE4A 1Y1UA 1QV0A 2I18A 3RZSA 1R2UA 5AEQA 4BY5A 2NZ0A 2MLFC 4XYNA 3UNWA 1XFWO 2WC6A 4CFRA 1LXFC 3CR2A 4GGNA 1WLZA 3S0GA 3SG4A 2KI6D 2LVIA 2KYCA 4INWA 1QWVA 4OR9B 1G4YR 1SMGA 2E30A 4XJKB 2BKHB 5EL2A 3EK7A 1W7JB 2JT8A 3CLNA 1KQVA 2P70A 1W9ZA 3L4AA 3RM1A 1C7WA 5FYXA 1FBVA 3FIAA 1J1EA 1J7RA 3CGAA 3LCPC 4N1GA 2BECA 3KPXA 1B8LA 2QPTA 1U5IA 2NLNA 1LA0A 4FTGA 1KFXL 3DVKA 5D7FA 1TNPA 2KYFA 2LMVA 2BL0C 2KSPA 1PSBA 5AXIA 1IIOA 4JQ0D 3TS5B 1XK4A 1OW4A 2R2IA 1K90D 1EL4A 1CFFA 3JTDC 1OOHA 4USLA 4DCKA 1YUSA 2AUCA 1T14A 1K9PA 1SR6B 1ZFSA 2LNKA 5BPJA 1QLSA 1S36A 1KK8B 4CIDA 3K1EA 3SJSA 1WRKA 2KFFA 4NDBA 1EG3A 1J7OA 1FW4A 1TOPA 1DVIA 2OTGC 1CTRA 4QJ4B 1UWOA 1A2XA 1SBJA 3CZ2A 1BODA 2FOTA 1D1OA 1Y1XA 1K2HA 3D77A 1CFCA 1NPQA 2JRFA 1SCMC 2JWWA 3PLFB 2K61A 4M2PA 1JUOA 3CTNA 1ZUZA 3D73A 5HLOA 2JT3A 4I5KA 1YX8A 1K93D 1YURA 1FF1A 4DS7A 1BG1A 4YGDB 1CFDA 1JBAA 3S0EA 4ORBB 1KSMA 2WCJA 2M9GA 1M31A 2L51A 1J7PA 2O5GA 1IRJA 1Z2CB 1OSAA 1BJFA 1B8CA 4MRYA 3I5HC 1ZOTB 2WCKA 2YGUA 4GPLB 1S3PA 1CMGA 1DJIA 1QX5B 2OS8C 4WQ3A 3BOWA 1EXRA 1LS8A 5HLVA 1OMDA 2KBMA 1YX7A 2VRGA 2K0JA 1JFKA 4OKHA 3LK1A 2LMTA 2F8PA 1MWNA 4ORAB 2CNPA 3CYZA 2AAOA 1KWOB 3S0FA 2ISDA 3S0BA 4I5NB 4NDDA 1KQMC 5HL1A 1LA3A 2KBIA 3VRNA 1WY9A 1QIWA 3NSLA 1IQ3A 3KEVA 1IJ5A 2GTEA 3AAJA 1IG5A 1EG4A 5I2LA 2KI4C 2WC5A 2ZKMX 2KNEA 2BCAA 2JXLA 1H8BA 1UHJA 2CBLA 5KTYA 2KAYA 2LUXA 2F2PA 3CWGA 3R1VA 1MF8B 5FI6A 2FCEA 3EVRA 3OP0A 3O4XA 4YGCB 2BCXA 3VROA 3PFVA 3WHUB 4CPVA 3DF0A 1ALVA 2O60A 1CLMA 1GM0A 1LINA 5TNCA 2HF5A 1EJ3A 2LVJA 2Q91A 1P28A 1SPYA 2BAPA 4QJ3B 2PYQA 2M1UA 2H2KA 1UHKA 5I94A 4ORCB 2EC6B 1K95A 2JU0A 5HKZA 3FWBA 4P2YB 1KSOA 1DJHA 1DJWA 2ZFDA 4HRHA 1SL9A 1Q80A 5ER4X 4AQJA 5I2OA 2QEBA 1DT7B 1S6JA 1OZSA 1M46A 3DXLA 1KFXS 1AJ5A 4ICBA 2MHHA 1B1GA 2HQ8A 3I5IB 2LLUA 1UUSA 3D10A 2MLEC 1N2DA 2LCPA 3R72A 4YGEB 2PRUA 3BUXB 1TNWA 3JVTB 3Q8IA 1NCZA 4ZCVA 2MA2A 1M63B 3ZNIA 2KAVA 4M2QA 1QASA 1SKTA 2JTZA 2KFHA 2L4IA 3BQ3A 2NCPA 2KLDA 3O6BA 3OHMB 1PALA 4D1EA 1MQ1A 3BFHA 2KGRA 3TS5C 4XJKA 2ZNEA 1IKUA 3CZ1A 3PM8A 1H4BA 1DELA 3D0YB 1Y1AA 3PJIA 1FI5A 1QLKA 2Y4QA 1RWYA 2K7CA 4PCWA 2L2EA 2WOSA 1K96A 1L7ZA 3EKHA 3GK4X 3GOFA 4GNKB 1JF0A 1PSRA 2FCDA 1XK4C 1SNLA 1J7QA 4P5OE 1IJ6A 1WLMA 4PE1A 2JNXA 2Y1NA 4JPZB 2F3YA 2SCPA 1K8UA 2F33A 5KSZA 1F4OA 3I5FC 4MZKA 1OQPA 2A4JA 3IQOA 2KQ6A 1VRKA 3BUNB 1DTLA 2EGDA 4MSPA 4JD9A 2V53A 2G9BA 5J3XA 4I5JA 1NX3A 1NYAA 2KPHA 3CZ0A 2MJWB 2WCMA 2NXQA 2GV5A 1BF5A 3VB1A 1J1DA 4GGFA 2G2BA 1XFXO 4JWQA 2KDHA 2M97A 4R1EA 4C0JA 1YVLA 1F70A 5FI2A 4C0LA 1RTP1 1XFUO 2JC2A 3CR4X 2CTNA 2B1UA 3NSKA 1C3ZA 2E6WA 2JPTA 1SCVA 3GK2A 3H4SE 4YGBB 1JWDA 1G8IA 3FS7A 1TRFA 1YRUB 2L5XB 1CM4A 2LLTA 2MBXA 1KK7Z 3F45A 3TUYB 3AAKA 1RROA 1Z4HA 4ZCUA 1LKJA 1TIZA 3WXAA 1OOJA 1UP5A 4JKTA 3OGNA 1NX0A 5DKRA 3DD4A 2PVBA 3SG2A 3SIBA 4PALA 5CSIA 1DGUA 1KWOC 4IL1A 4ETOA 4I5LB 1JFJA 2KHNA 2JNFA 1SL8A 1RFJA 2I94A 1ZMZA 4CFQA 3PM2A 4PT1A 2JOJA 2PALA 5HKWA 2QACA 3BYAA 2QEOA 5DICA 1KK7Y 5I2QA 3FE8A 1DQEA 4KYNA 3O4YA 1OZOA 2L2CA 2WORA 5CPVA 1RJVA 2CT9A 3OB1B 1OOIX 1SW8A 1WDCC 1AK8A 2LM5A 4GBAA 2JTTA 4IJ7A 3O2PA 3DVMA 1G33A 3N7HA 3C1VA 3JTDB 1SY9A 4YI9A 3L4LA 3ZWHA 3D76A 3A8RA 1DGVA 1CFPA 2WCFA 2BCBA 2BKIB 3KF9A 5AANA 2K8MB 2JXCA 3DZTA 1CKKA 1F8HA 2KQYA 1XFVO 3M0WA 2M0RA 1BT6A 3UO9A 2OTGB 1CM1A 2KAXA 3SS3A 1AUIB 2LE9B 3B88A
chains in the Genus database with same CATH topology
3VRRA 1XYDA 1NIWA 4MZLA 2GGMA 2Y1MA 5AFPA 2SASA 1FI6A 3K21A 3SG6A 3PALA 1SCMB 2WCEA 1DF0B 1M39A 1AVSA 4PDZA 1CMFA 2JULA 4HREE 1AJ4A 3JVTC 1SL7A 3I5GB 4DIRA 1JC2A 2CXJA 1C7VA 1F55A 1A29A 1QS7A 2TN4A 1OE9B 3RLZA 1S26D 1NSHA 2BBNA 1GJYA 4PE7A 3TDIA 4NQGA 1SRAA 1V1FA 1B47A 3EVUA 1UHNA 3HCMA 5CSJA 3OX6A 2DOQA 2L4HA 1SYMA 3EK8A 1B7TZ 2LVKA 1OMRA 2BE4A 1MHOA 2KOTA 2OPOA 1YRTB 1IWQA 4NDCA 4AOMA 1S1EA 3IQQA 3WHTB 2WNDA 3AKBA 3D0YA 3SIAA 2LP3A 4F0ZB 5B8IB 4YI8A 2EHBA 4A4BA 2ZRTA 1YVHA 3PN7B 2RGIA 1RK9A 3NSIA 1B7TY 5HKYA 2ZNDA 2WC8A 5HYDA 2MAZA 1SR6C 2PASA 2LLSA 3DVJA 4PHNA 2I2RE 1NUBA 5IBWA 1KK8C 5DKNA 1M45A 2LANA 4WQ2A 2Y5IA 1CLBA 3VRPA 2KI6C 1AHRA 1CDLA 1NWDA 1A75B 1DJZA 1QATA 2D8NA 1ZACA 1S6IA 4N5XA 5PALA 2M7LA 2WCBA 1YUUA 2K2FA 3PSRA 4GGFC 4MZJA 2LV7A 2NCOA 1V1GA 3AKAA 1GGWA 3KHEA 5CSNA 1QXPA 2P6BB 4FQOA 5DKQA 1IH0A 1JSAA 1A4PA 2ZRSA 1TTXA 1PK0D 2COLB 1PVAA 1K94A 4YBHB 1UHHA 5GQQC 1PULA 3PATA 1QVIY 4MVFA 5JJGA 2JZIA 2JT0A 2K7DA 1B4CA 3LK0A 3EVVA 1SK6D 2LC5A 5CSFA 1S6CA 3A4UB 1CNPA 3SG5A 4A4CA 4MBEA 1CDNA 1BU3A 1NP8A 1L2OB 1N65A 2ZN8A 1WRZA 1YR5A 1OMVA 2K2AA 3O78A 3MSEB 1S5GZ 1NCXA 2H61C 1Y6WA 2M3WA 3WNXB 1GGZA 1U5IB 1NX2A 1RECA 1TN4A 4C0KA 5KU1A 2K7OA 3VRQA 1KFUL 4E68A 4OCIA 4PE0A 3TZ1A 1FPWA 2IS9A 3TDUA 1TCOB 2LUCA 1XO5A 3VGOA 4OVNF 3CZTX 3CS1A 1DJYA 1BR4B 2ZN9A 1HT9A 2H61A 5F6TA 1BLQA 1S5GY 1DJGA 2HETA 2GGZA 3I5FB 3GK1A 5I8NA 1R6PA 2M49B 3DVEA 1JF2A 1F71A 2BL0B 2K7BA 4BY4A 4N1FA 3I5GC 4YRUA 2LP2A 1XFZO 4MLWA 1CB1A 2HPSA 1KCYA 3CR5X 3NSOA 1XA5A 1DF0A 2MRDA 3KO0A 3NXAA 4AQIA 1XVJA 2FJUB 2EC6C 4HSZA 2CCMA 2F2OA 1B9AA 4WRIA 1QV1A 1B8RA 5G08A 1BOCA 1DMOA 4GUKA 1E8AA 3OX5A 1AP4A 1K9UA 1N0YA 3SG3A 1MXLC 1X02A 4YGAA 3I5IC 2BBMA 1QX7A 5K89A 1LVCD 1K9KA 3LLEA 3QRXA 2LHIA 4DRWA 4QJ5B 1HQVA 2PSRA 2KGBC 2LVVA 4UPGA 1ALWA 1IQ5A 5JOLA 2LMUA 3TDZA 3EKJA 4HRGA 1Y0VH 1YTZC 3FWCA 3BOWB 1W7IB 1YUTA 2L50A 1XFYO 1CDMA 2M8UA 1TNXA 4U8DA 4M2OA 3BUOB 2I7AA 1TNQA 2AMIA 3PN7C 2M1KB 3ICBA 2LHLA 4PHJA 2KFGA 3I5HB 4MEWA 1MUXA 4TNCA 1PVBA 1UURA 1DJXA 1EH2A 2OS8B 1WDCB 2HQWA 1QJTA 4MN0A 1UHIA 2M29A 3OB2B 3SG7A 1TCFA 4GAOA 1PRWA 4GFTA 1QX2A 5ER5A 3BUMB 2Q4UA 2BE6A 2L98A 2F3ZA 1CLLA 5D69A 3IF7A 3E3RA 1C07A 3HX4A 1GQMA 1MXEA 1F4QA 1QTXA 4L9MA 5AERA 1KQMB 4Q04A 2M7NA 3DF0B 1NX1A 4OV2A 4CLNA 1A75A 3LL8B 2KI4B 2PMYA 3BXKA 1IGVA 1QIVA 3BUWB 1J55A 4PHMA 1BMOA 1QVIZ 4PHKA 1CDPA 1MR8A 2L0PA 4MRXA 1BR1B 1WRLA 1F54A 4DUQA 1ODBA 1A03A 1KFUS 1L2OC 2JQ6A 1NCYA 2LAPA 3EK4A 3TUYC 4PE4A 1Y1UA 1QV0A 2I18A 1R2UA 5AEQA 4BY5A 2NZ0A 2MLFC 4XYNA 1XFWO 4CFRA 1LXFC 3CR2A 4GGNA 1WLZA 3SG4A 2KI6D 2LVIA 2KYCA 4OR9B 1G4YR 1SMGA 2E30A 4XJKB 2BKHB 3EK7A 1W7JB 2JT8A 3CLNA 1KQVA 3RM1A 1C7WA 5FYXA 1FBVA 3FIAA 1J1EA 1J7RA 3CGAA 3LCPC 4N1GA 2BECA 3KPXA 1B8LA 2QPTA 1U5IA 2NLNA 1LA0A 4FTGA 1KFXL 3DVKA 5D7FA 1TNPA 2KYFA 2LMVA 2BL0C 2KSPA 1PSBA 5AXIA 4JQ0D 3TS5B 1XK4A 2R2IA 1K90D 1EL4A 1CFFA 3JTDC 4USLA 4DCKA 1YUSA 2AUCA 1K9PA 1SR6B 1ZFSA 2LNKA 5BPJA 1QLSA 1S36A 1KK8B 4CIDA 3SJSA 1J7OA 1WRKA 2KFFA 4NDBA 1EG3A 1FW4A 1TOPA 1DVIA 2OTGC 1CTRA 4QJ4B 1UWOA 1A2XA 1SBJA 1BODA 2FOTA 1D1OA 1Y1XA 1K2HA 1CFCA 1NPQA 2JRFA 1SCMC 2JWWA 3PLFB 2K61A 4M2PA 1JUOA 3CTNA 1ZUZA 5HLOA 2JT3A 4I5KA 1YX8A 1K93D 1YURA 1FF1A 4DS7A 1BG1A 4YGDB 1CFDA 1JBAA 4ORBB 1KSMA 2M9GA 1M31A 2L51A 1J7PA 2O5GA 1IRJA 1OSAA 1BJFA 1B8CA 4MRYA 3I5HC 1ZOTB 4GPLB 1S3PA 1CMGA 1DJIA 1QX5B 2OS8C 4WQ3A 3BOWA 1EXRA 5HLVA 1OMDA 2KBMA 1YX7A 2VRGA 2K0JA 1JFKA 4OKHA 3LK1A 2LMTA 2F8PA 1MWNA 4ORAB 2CNPA 2AAOA 1KWOB 2ISDA 4I5NB 4NDDA 1KQMC 1LA3A 2KBIA 3VRNA 1WY9A 1QIWA 3NSLA 1IQ3A 3KEVA 1IJ5A 3AAJA 1IG5A 1EG4A 5I2LA 2KI4C 2ZKMX 2KNEA 2BCAA 2JXLA 1H8BA 1UHJA 2CBLA 5KTYA 2KAYA 2LUXA 2F2PA 3CWGA 1MF8B 2FCEA 3EVRA 3OP0A 4YGCB 3VROA 2BCXA 3PFVA 3WHUB 4CPVA 3DF0A 1ALVA 2O60A 1CLMA 1LINA 5TNCA 2HF5A 1EJ3A 2LVJA 2Q91A 1SPYA 4QJ3B 2M1UA 2H2KA 1UHKA 4ORCB 2EC6B 1K95A 2JU0A 5HKZA 3FWBA 4P2YB 1KSOA 1DJHA 1DJWA 2ZFDA 4HRHA 1SL9A 1Q80A 5ER4X 4AQJA 5I2OA 1DT7B 1S6JA 1OZSA 1M46A 1KFXS 1AJ5A 4ICBA 2MHHA 1B1GA 2HQ8A 3I5IB 2LLUA 1UUSA 3D10A 2MLEC 1N2DA 2LCPA 4YGEB 2PRUA 3BUXB 1TNWA 3JVTB 1NCZA 4ZCVA 2MA2A 1M63B 3ZNIA 2KAVA 4M2QA 1QASA 1SKTA 2JTZA 2KFHA 2L4IA 3BQ3A 2NCPA 3O6BA 3OHMB 1PALA 4D1EA 1MQ1A 2KGRA 3TS5C 4XJKA 2ZNEA 1IKUA 1H4BA 3PM8A 3D0YB 1Y1AA 1FI5A 1QLKA 2Y4QA 1RWYA 2K7CA 4PCWA 2L2EA 2WOSA 1K96A 1L7ZA 3EKHA 3GK4X 3GOFA 4GNKB 1JF0A 1PSRA 2FCDA 1XK4C 1SNLA 1J7QA 4P5OE 1IJ6A 1WLMA 4PE1A 2JNXA 2Y1NA 4JPZB 2F3YA 2SCPA 1K8UA 2F33A 5KSZA 1F4OA 3I5FC 4MZKA 1OQPA 2A4JA 3IQOA 2KQ6A 1VRKA 3BUNB 1DTLA 2EGDA 4MSPA 5J3XA 2V53A 2G9BA 4I5JA 1NX3A 1NYAA 2MJWB 2NXQA 2GV5A 1BF5A 1J1DA 4GGFA 2G2BA 1XFXO 4JWQA 2KDHA 2M97A 4R1EA 4C0JA 1YVLA 1F70A 4C0LA 1RTP1 1XFUO 2JC2A 3CR4X 2CTNA 2B1UA 3NSKA 2E6WA 2JPTA 3GK2A 1SCVA 4YGBB 3H4SE 1JWDA 1G8IA 3FS7A 1TRFA 1YRUB 2L5XB 1CM4A 2LLTA 2MBXA 1KK7Z 3F45A 3TUYB 3AAKA 1RROA 3WXAA 4ZCUA 1LKJA 1TIZA 1OOJA 1UP5A 5DKRA 1NX0A 3DD4A 2PVBA 3SG2A 3SIBA 4PALA 5CSIA 1DGUA 1KWOC 4IL1A 4ETOA 4I5LB 1JFJA 2KHNA 2JNFA 1SL8A 1RFJA 2I94A 1ZMZA 4CFQA 2JOJA 2PALA 5HKWA 2QACA 3BYAA 1KK7Y 5I2QA 3O4YA 1OZOA 5CPVA 2WORA 1RJVA 2CT9A 3OB1B 1SW8A 1WDCC 1AK8A 2LM5A 4GBAA 2JTTA 3O2PA 3DVMA 1G33A 3C1VA 3JTDB 1SY9A 4YI9A 3ZWHA 3A8RA 1DGVA 1CFPA 2WCFA 2BCBA 2BKIB 3KF9A 5AANA 2K8MB 2JXCA 1CKKA 1F8HA 2KQYA 1XFVO 3M0WA 2M0RA 1BT6A 2OTGB 1CM1A 2KAXA 1AUIB 2LE9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VRR A;  1XYD A;  1NIW A;  4MZL A;  2GGM A;  2Y1M A;  5AFP A;  2SAS A;  1FI6 A;  3K21 A;  3SG6 A;  3PAL A;  1SCM B;  2WCE A;  1DF0 B;  1M39 A;  1AVS A;  4PDZ A;  1CMF A;  2JUL A;  4HRE E;  1AJ4 A;  3JVT C;  1SL7 A;  3I5G B;  4DIR A;  1JC2 A;  2CXJ A;  1C7V A;  1F55 A;  1A29 A;  1QS7 A;  2TN4 A;  1OE9 B;  3RLZ A;  1S26 D;  1NSH A;  2BBN A;  1GJY A;  4PE7 A;  3TDI A;  4NQG A;  1SRA A;  1V1F A;  1B47 A;  3EVU A;  1UHN A;  3HCM A;  5CSJ A;  3OX6 A;  2DOQ A;  2L4H A;  1SYM A;  3EK8 A;  1B7T Z;  2LVK A;  1OMR A;  2BE4 A;  1MHO A;  2KOT A;  2OPO A;  1YRT B;  1IWQ A;  4NDC A;  4AOM A;  1S1E A;  3IQQ A;  3WHT B;  2WND A;  3AKB A;  3D0Y A;  3SIA A;  2LP3 A;  4F0Z B;  5B8I B;  4YI8 A;  2EHB A;  4A4B A;  2ZRT A;  1YVH A;  3PN7 B;  2RGI A;  1RK9 A;  3NSI A;  1B7T Y;  5HKY A;  2ZND A;  2WC8 A;  5HYD A;  2MAZ A;  1SR6 C;  2PAS A;  2LLS A;  3DVJ A;  4PHN A;  2I2R E;  1NUB A;  5IBW A;  1KK8 C;  5DKN A;  1M45 A;  2LAN A;  4WQ2 A;  2Y5I A;  1CLB A;  3VRP A;  2KI6 C;  1AHR A;  1CDL A;  1NWD A;  1A75 B;  1DJZ A;  1QAT A;  2D8N A;  1ZAC A;  1S6I A;  4N5X A;  5PAL A;  2M7L A;  2WCB A;  1YUU A;  2K2F A;  3PSR A;  4GGF C;  4MZJ A;  2LV7 A;  2NCO A;  1V1G A;  3AKA A;  1GGW A;  3KHE A;  5CSN A;  1QXP A;  2P6B B;  4FQO A;  5DKQ A;  1IH0 A;  1JSA A;  1A4P A;  2ZRS A;  1TTX A;  1PK0 D;  2COL B;  1PVA A;  1K94 A;  4YBH B;  1UHH A;  5GQQ C;  1PUL A;  3PAT A;  1QVI Y;  4MVF A;  5JJG A;  2JZI A;  2JT0 A;  2K7D A;  1B4C A;  3LK0 A;  3EVV A;  1SK6 D;  2LC5 A;  5CSF A;  1S6C A;  3A4U B;  1CNP A;  3SG5 A;  4A4C A;  4MBE A;  1CDN A;  1BU3 A;  1NP8 A;  1L2O B;  1N65 A;  2ZN8 A;  1WRZ A;  1YR5 A;  1OMV A;  2K2A A;  3O78 A;  3MSE B;  1S5G Z;  1NCX A;  2H61 C;  1Y6W A;  2M3W A;  3WNX B;  1GGZ A;  1U5I B;  1NX2 A;  1REC A;  1TN4 A;  4C0K A;  5KU1 A;  2K7O A;  3VRQ A;  1KFU L;  4E68 A;  4OCI A;  4PE0 A;  3TZ1 A;  1FPW A;  2IS9 A;  3TDU A;  1TCO B;  2LUC A;  1XO5 A;  3VGO A;  4OVN F;  3CZT X;  3CS1 A;  1DJY A;  1BR4 B;  2ZN9 A;  1HT9 A;  2H61 A;  5F6T A;  1BLQ A;  1S5G Y;  1DJG A;  2HET A;  2GGZ A;  3I5F B;  3GK1 A;  5I8N A;  1R6P A;  2M49 B;  3DVE A;  1JF2 A;  1F71 A;  2BL0 B;  2K7B A;  4BY4 A;  4N1F A;  3I5G C;  4YRU A;  2LP2 A;  1XFZ O;  4MLW A;  1CB1 A;  2HPS A;  1KCY A;  3CR5 X;  3NSO A;  1XA5 A;  1DF0 A;  2MRD A;  3KO0 A;  3NXA A;  4AQI A;  1XVJ A;  2FJU B;  2EC6 C;  4HSZ A;  2CCM A;  2F2O A;  1B9A A;  4WRI A;  1QV1 A;  1B8R A;  5G08 A;  1BOC A;  1DMO A;  4GUK A;  1E8A A;  3OX5 A;  1AP4 A;  1K9U A;  1N0Y A;  3SG3 A;  1MXL C;  1X02 A;  4YGA A;  3I5I C;  2BBM A;  1QX7 A;  5K89 A;  1LVC D;  1K9K A;  3LLE A;  3QRX A;  2LHI A;  4DRW A;  4QJ5 B;  1HQV A;  2PSR A;  2KGB C;  2LVV A;  4UPG A;  1ALW A;  1IQ5 A;  5JOL A;  2LMU A;  3TDZ A;  3EKJ A;  4HRG A;  1Y0V H;  1YTZ C;  3FWC A;  3BOW B;  1W7I B;  1YUT A;  2L50 A;  1XFY O;  1CDM A;  2M8U A;  1TNX A;  4U8D A;  4M2O A;  3BUO B;  2I7A A;  1TNQ A;  2AMI A;  3PN7 C;  2M1K B;  3ICB A;  2LHL A;  4PHJ A;  2KFG A;  3I5H B;  4MEW A;  1MUX A;  4TNC A;  1PVB A;  1UUR A;  1DJX A;  1EH2 A;  2OS8 B;  1WDC B;  2HQW A;  1QJT A;  4MN0 A;  1UHI A;  2M29 A;  3OB2 B;  3SG7 A;  1TCF A;  4GAO A;  1PRW A;  4GFT A;  1QX2 A;  5ER5 A;  3BUM B;  2Q4U A;  2BE6 A;  2L98 A;  2F3Z A;  1CLL A;  5D69 A;  3IF7 A;  3E3R A;  1C07 A;  3HX4 A;  1GQM A;  1MXE A;  1F4Q A;  1QTX A;  4L9M A;  5AER A;  1KQM B;  4Q04 A;  2M7N A;  3DF0 B;  1NX1 A;  4OV2 A;  4CLN A;  1A75 A;  3LL8 B;  2KI4 B;  2PMY A;  3BXK A;  1IGV A;  1QIV A;  3BUW B;  1J55 A;  4PHM A;  1BMO A;  1QVI Z;  4PHK A;  1CDP A;  1MR8 A;  2L0P A;  4MRX A;  1BR1 B;  1WRL A;  1F54 A;  4DUQ A;  1ODB A;  1A03 A;  1KFU S;  1L2O C;  2JQ6 A;  1NCY A;  2LAP A;  3EK4 A;  3TUY C;  4PE4 A;  1Y1U A;  1QV0 A;  2I18 A;  1R2U A;  5AEQ A;  4BY5 A;  2NZ0 A;  2MLF C;  4XYN A;  1XFW O;  4CFR A;  1LXF C;  3CR2 A;  4GGN A;  1WLZ A;  3SG4 A;  2KI6 D;  2LVI A;  2KYC A;  4OR9 B;  1G4Y R;  1SMG A;  2E30 A;  4XJK B;  2BKH B;  3EK7 A;  1W7J B;  2JT8 A;  3CLN A;  1KQV A;  3RM1 A;  1C7W A;  5FYX A;  1FBV A;  3FIA A;  1J1E A;  1J7R A;  3CGA A;  3LCP C;  4N1G A;  2BEC A;  3KPX A;  1B8L A;  2QPT A;  1U5I A;  2NLN A;  1LA0 A;  4FTG A;  1KFX L;  3DVK A;  5D7F A;  1TNP A;  2KYF A;  2LMV A;  2BL0 C;  2KSP A;  1PSB A;  5AXI A;  4JQ0 D;  3TS5 B;  1XK4 A;  2R2I A;  1K90 D;  1EL4 A;  1CFF A;  3JTD C;  4USL A;  4DCK A;  1YUS A;  2AUC A;  1K9P A;  1SR6 B;  1ZFS A;  2LNK A;  5BPJ A;  1QLS A;  1S36 A;  1KK8 B;  4CID A;  3SJS A;  1J7O A;  1WRK A;  2KFF A;  4NDB A;  1EG3 A;  1FW4 A;  1TOP A;  1DVI A;  2OTG C;  1CTR A;  4QJ4 B;  1UWO A;  1A2X A;  1SBJ A;  1BOD A;  2FOT A;  1D1O A;  1Y1X A;  1K2H A;  1CFC A;  1NPQ A;  2JRF A;  1SCM C;  2JWW A;  3PLF B;  2K61 A;  4M2P A;  1JUO A;  3CTN A;  1ZUZ A;  5HLO A;  2JT3 A;  4I5K A;  1YX8 A;  1K93 D;  1YUR A;  1FF1 A;  4DS7 A;  1BG1 A;  4YGD B;  1CFD A;  1JBA A;  4ORB B;  1KSM A;  2M9G A;  1M31 A;  2L51 A;  1J7P A;  2O5G A;  1IRJ A;  1OSA A;  1BJF A;  1B8C A;  4MRY A;  3I5H C;  1ZOT B;  4GPL B;  1S3P A;  1CMG A;  1DJI A;  1QX5 B;  2OS8 C;  4WQ3 A;  3BOW A;  1EXR A;  5HLV A;  1OMD A;  2KBM A;  1YX7 A;  2VRG A;  2K0J A;  1JFK A;  4OKH A;  3LK1 A;  2LMT A;  2F8P A;  1MWN A;  4ORA B;  2CNP A;  2AAO A;  1KWO B;  2ISD A;  4I5N B;  4NDD A;  1KQM C;  1LA3 A;  2KBI A;  3VRN A;  1WY9 A;  1QIW A;  3NSL A;  1IQ3 A;  3KEV A;  1IJ5 A;  3AAJ A;  1IG5 A;  1EG4 A;  5I2L A;  2KI4 C;  2ZKM X;  2KNE A;  2BCA A;  2JXL A;  1H8B A;  1UHJ A;  2CBL A;  5KTY A;  2KAY A;  2LUX A;  2F2P A;  3CWG A;  1MF8 B;  2FCE A;  3EVR A;  3OP0 A;  4YGC B;  3VRO A;  2BCX A;  3PFV A;  3WHU B;  4CPV A;  3DF0 A;  1ALV A;  2O60 A;  1CLM A;  1LIN A;  5TNC A;  2HF5 A;  1EJ3 A;  2LVJ A;  2Q91 A;  1SPY A;  4QJ3 B;  2M1U A;  2H2K A;  1UHK A;  4ORC B;  2EC6 B;  1K95 A;  2JU0 A;  5HKZ A;  3FWB A;  4P2Y B;  1KSO A;  1DJH A;  1DJW A;  2ZFD A;  4HRH A;  1SL9 A;  1Q80 A;  5ER4 X;  4AQJ A;  5I2O A;  1DT7 B;  1S6J A;  1OZS A;  1M46 A;  1KFX S;  1AJ5 A;  4ICB A;  2MHH A;  1B1G A;  2HQ8 A;  3I5I B;  2LLU A;  1UUS A;  3D10 A;  2MLE C;  1N2D A;  2LCP A;  4YGE B;  2PRU A;  3BUX B;  1TNW A;  3JVT B;  1NCZ A;  4ZCV A;  2MA2 A;  1M63 B;  3ZNI A;  2KAV A;  4M2Q A;  1QAS A;  1SKT A;  2JTZ A;  2KFH A;  2L4I A;  3BQ3 A;  2NCP A;  3O6B A;  3OHM B;  1PAL A;  4D1E A;  1MQ1 A;  2KGR A;  3TS5 C;  4XJK A;  2ZNE A;  1IKU A;  1H4B A;  3PM8 A;  3D0Y B;  1Y1A A;  1FI5 A;  1QLK A;  2Y4Q A;  1RWY A;  2K7C A;  4PCW A;  2L2E A;  2WOS A;  1K96 A;  1L7Z A;  3EKH A;  3GK4 X;  3GOF A;  4GNK B;  1JF0 A;  1PSR A;  2FCD A;  1XK4 C;  1SNL A;  1J7Q A;  4P5O E;  1IJ6 A;  1WLM A;  4PE1 A;  2JNX A;  2Y1N A;  4JPZ B;  2F3Y A;  2SCP A;  1K8U A;  2F33 A;  5KSZ A;  1F4O A;  3I5F C;  4MZK A;  1OQP A;  2A4J A;  3IQO A;  2KQ6 A;  1VRK A;  3BUN B;  1DTL A;  2EGD A;  4MSP A;  5J3X A;  2V53 A;  2G9B A;  4I5J A;  1NX3 A;  1NYA A;  2MJW B;  2NXQ A;  2GV5 A;  1BF5 A;  1J1D A;  4GGF A;  2G2B A;  1XFX O;  4JWQ A;  2KDH A;  2M97 A;  4R1E A;  4C0J A;  1YVL A;  1F70 A;  4C0L A;  1RTP 1;  1XFU O;  2JC2 A;  3CR4 X;  2CTN A;  2B1U A;  3NSK A;  2E6W A;  2JPT A;  3GK2 A;  1SCV A;  4YGB B;  3H4S E;  1JWD A;  1G8I A;  3FS7 A;  1TRF A;  1YRU B;  2L5X B;  1CM4 A;  2LLT A;  2MBX A;  1KK7 Z;  3F45 A;  3TUY B;  3AAK A;  1RRO A;  3WXA A;  4ZCU A;  1LKJ A;  1TIZ A;  1OOJ A;  1UP5 A;  5DKR A;  1NX0 A;  3DD4 A;  2PVB A;  3SG2 A;  3SIB A;  4PAL A;  5CSI A;  1DGU A;  1KWO C;  4IL1 A;  4ETO A;  4I5L B;  1JFJ A;  2KHN A;  2JNF A;  1SL8 A;  1RFJ A;  2I94 A;  1ZMZ A;  4CFQ A;  2JOJ A;  2PAL A;  5HKW A;  2QAC A;  3BYA A;  1KK7 Y;  5I2Q A;  3O4Y A;  1OZO A;  5CPV A;  2WOR A;  1RJV A;  2CT9 A;  3OB1 B;  1SW8 A;  1WDC C;  1AK8 A;  2LM5 A;  4GBA A;  2JTT A;  3O2P A;  3DVM A;  1G33 A;  3C1V A;  3JTD B;  1SY9 A;  4YI9 A;  3ZWH A;  3A8R A;  1DGV A;  1CFP A;  2WCF A;  2BCB A;  2BKI B;  3KF9 A;  5AAN A;  2K8M B;  2JXC A;  1CKK A;  1F8H A;  2KQY A;  1XFV O;  3M0W A;  2M0R A;  1BT6 A;  2OTG B;  1CM1 A;  2KAX A;  1AUI B;  2LE9 B; 
#chains in the Genus database with same CATH topology
 3VRR A;  1XYD A;  1NIW A;  2KLE A;  2GGM A;  2Y1M A;  4MZL A;  5AFP A;  2SAS A;  1FI6 A;  3K21 A;  3SG6 A;  3PAL A;  1SCM B;  2WCE A;  1DF0 B;  1M39 A;  1OOF A;  1AVS A;  3D74 A;  4PDZ A;  1CMF A;  2JUL A;  4HRE E;  1AJ4 A;  3JVT C;  1SL7 A;  1ORG A;  3S0D A;  3I5G B;  4DIR A;  1JC2 A;  2CXJ A;  2QEH A;  1C7V A;  1F55 A;  1A29 A;  1QS7 A;  2TN4 A;  1OE9 B;  3RLZ A;  1S26 D;  1NSH A;  3OBV A;  2BBN A;  1GJY A;  4PE7 A;  3TDI A;  4NQG A;  1SRA A;  1TUZ A;  3BJH A;  1V1F A;  1B47 A;  3EVU A;  1UHN A;  3HCM A;  5CSJ A;  3OX6 A;  2DOQ A;  2L4H A;  1SYM A;  3EK8 A;  1B7T Z;  2WCH A;  2LVK A;  1OMR A;  2BE4 A;  1MHO A;  3NHT A;  2KOT A;  2OPO A;  1YRT B;  1IWQ A;  3QME A;  4NDC A;  4AOM A;  1S1E A;  3IQQ A;  3WHT B;  2ERB A;  2WND A;  3AKB A;  3CDN A;  2QEV A;  3D0Y A;  3L47 A;  3SIA A;  2LP3 A;  4F0Z B;  5B8I B;  1SSE B;  4YI8 A;  2EHB A;  4A4B A;  2ZRT A;  1YVH A;  3R1P A;  3PN7 B;  2RGI A;  1RK9 A;  3NSI A;  1B7T Y;  5HKY A;  2ZND A;  2WC8 A;  5HYD A;  2MAZ A;  1SR6 C;  3SS4 A;  2PAS A;  2LLS A;  3DVJ A;  4PHN A;  2I2R E;  1NUB A;  5IBW A;  1KK8 C;  5DKN A;  1M45 A;  2LAN A;  4WQ2 A;  1DC1 A;  2Y5I A;  3EG5 B;  1CLB A;  3VRP A;  2KI6 C;  1AHR A;  1CDL A;  2P71 A;  1NWD A;  5FI7 A;  1A75 B;  1DJZ A;  1QAT A;  2D8N A;  1ZAC A;  1S6I A;  3D75 A;  4N5X A;  5PAL A;  2M7L A;  1TUJ A;  2WCB A;  1YUU A;  2K2F A;  3PSR A;  4GGF C;  1XFR A;  4MZJ A;  2LV7 A;  2NCO A;  1V1G A;  3AKA A;  1GGW A;  3KHE A;  5CSN A;  1QXP A;  2P6B B;  4FQO A;  5DKQ A;  1IH0 A;  3DY9 A;  3V2L A;  1JSA A;  1A4P A;  2ZRS A;  1TTX A;  1PK0 D;  2COL B;  1PVA A;  1K94 A;  4YBH B;  1UHH A;  3NHI A;  5GQQ C;  1PUL A;  3PAT A;  1QVI Y;  4MVF A;  5JJG A;  2JZI A;  3B86 A;  2JT0 A;  2K7D A;  2QDI A;  1B4C A;  3LK0 A;  3EVV A;  1SK6 D;  2LC5 A;  5CSF A;  1S6C A;  3A4U B;  4F7F A;  1CNP A;  3SG5 A;  4A4C A;  4MBE A;  1CDN A;  1BU3 A;  1NP8 A;  1L2O B;  3R1O A;  1N65 A;  2ZN8 A;  3BFA A;  1WRZ A;  1YR5 A;  1OMV A;  2K2A A;  3O78 A;  3MSE B;  1S5G Z;  1NCX A;  2PQL A;  5D3O A;  2H61 C;  1Y6W A;  2M3W A;  3WNX B;  1GGZ A;  1U5I B;  3B7A A;  1NX2 A;  1REC A;  1TN4 A;  4C0K A;  5KU1 A;  1C3Y A;  2K7O A;  3VRQ A;  1KFU L;  4E68 A;  4OCI A;  4PE0 A;  3TZ1 A;  1FPW A;  2IS9 A;  3TDU A;  1TCO B;  2LUC A;  1XO5 A;  3FE6 A;  4OVN F;  3VGO A;  3CZT X;  3CS1 A;  1DJY A;  1BR4 B;  2ZN9 A;  1HT9 A;  2H61 A;  5F6T A;  1BLQ A;  1S5G Y;  3SS5 A;  1DJG A;  2HET A;  3NGV A;  2GGZ A;  3I5F B;  3GK1 A;  5I8N A;  1R6P A;  2M49 B;  3DVE A;  1JF2 A;  1F71 A;  2BL0 B;  2K7B A;  4BY4 A;  4N1F A;  3I5G C;  4YRU A;  2LP2 A;  1XFZ O;  4MLW A;  1CB1 A;  2HPS A;  3BFB A;  1KCY A;  3CR5 X;  3NSO A;  1XA5 A;  1DF0 A;  2MRD A;  3KO0 A;  3NXA A;  4AQI A;  1XVJ A;  2FJU B;  1DEK A;  2EC6 C;  2CCM A;  2F2O A;  1B9A A;  4HSZ A;  1QV1 A;  1B8R A;  4WRI A;  5G08 A;  1BOC A;  1DMO A;  4GUK A;  1E8A A;  3OX5 A;  1AP4 A;  1K9U A;  1N0Y A;  2BNX A;  1MXL C;  3SG3 A;  1X02 A;  3FE9 A;  4YGA A;  3I5I C;  2BBM A;  1QX7 A;  1TWO A;  5K89 A;  1LVC D;  1K9K A;  3LLE A;  3QRX A;  2LHI A;  4DRW A;  4QJ5 B;  1HQV A;  2H8V A;  2PSR A;  2KGB C;  2LVV A;  4UPG A;  1ALW A;  2JPO A;  1IQ5 A;  5JOL A;  2LMU A;  3TDZ A;  3EKJ A;  4HRG A;  1Y0V H;  1YTZ C;  3FWC A;  3BOW B;  1W7I B;  3CAB A;  1YUT A;  3S0A A;  2L50 A;  1XFY O;  1CDM A;  2M8U A;  1TNX A;  4U8D A;  4M2O A;  3BUO B;  2I7A A;  1TNQ A;  2AMI A;  3PN7 C;  2M1K B;  3ICB A;  4INX A;  2LHL A;  1OOG A;  4FQT A;  4PHJ A;  2KFG A;  3B87 A;  3I5H B;  4MEW A;  1MUX A;  4TNC A;  1PVB A;  1UUR A;  1DJX A;  1EH2 A;  4OZD A;  2K60 A;  2OS8 B;  1WDC B;  2HQW A;  3D78 A;  1QJT A;  4MN0 A;  1UHI A;  2M29 A;  3OB2 B;  3SG7 A;  1TCF A;  4GAO A;  1PRW A;  4GFT A;  1QX2 A;  5ER5 A;  3BUM B;  3IVT A;  2Q4U A;  2BE6 A;  2L98 A;  2F3Z A;  1CLL A;  5D69 A;  2FJY A;  3IF7 A;  3E3R A;  1C07 A;  3HX4 A;  1GQM A;  1MXE A;  1F4Q A;  1QTX A;  4L9M A;  5AER A;  1KQM B;  4Q04 A;  3B6X A;  2M7N A;  3DF0 B;  1NX1 A;  3DYE A;  4OV2 A;  4CLN A;  1A75 A;  3LL8 B;  2KI4 B;  2PMY A;  3BXK A;  1IGV A;  1QIV A;  3BUW B;  1J55 A;  4PHM A;  1BMO A;  1QVI Z;  2L5Y A;  1CDP A;  1MR8 A;  2L0P A;  4MRX A;  4PHK A;  1BR1 B;  1WRL A;  2WCL A;  1F54 A;  4DUQ A;  1ODB A;  1A03 A;  1KFU S;  1L2O C;  2JQ6 A;  1NCY A;  2LAP A;  3EK4 A;  3TUY C;  4PE4 A;  1Y1U A;  1QV0 A;  2I18 A;  3RZS A;  1R2U A;  5AEQ A;  4BY5 A;  2NZ0 A;  2MLF C;  4XYN A;  3UNW A;  1XFW O;  2WC6 A;  4CFR A;  1LXF C;  3CR2 A;  4GGN A;  1WLZ A;  3S0G A;  3SG4 A;  2KI6 D;  2LVI A;  2KYC A;  4INW A;  1QWV A;  4OR9 B;  1G4Y R;  1SMG A;  2E30 A;  4XJK B;  2BKH B;  5EL2 A;  3EK7 A;  1W7J B;  2JT8 A;  3CLN A;  1KQV A;  2P70 A;  1W9Z A;  3L4A A;  3RM1 A;  1C7W A;  5FYX A;  1FBV A;  3FIA A;  1J1E A;  1J7R A;  3CGA A;  3LCP C;  4N1G A;  2BEC A;  3KPX A;  1B8L A;  2QPT A;  1U5I A;  2NLN A;  1LA0 A;  4FTG A;  1KFX L;  3DVK A;  5D7F A;  1TNP A;  2KYF A;  2LMV A;  2BL0 C;  2KSP A;  1PSB A;  5AXI A;  1IIO A;  4JQ0 D;  3TS5 B;  1XK4 A;  1OW4 A;  2R2I A;  1K90 D;  1EL4 A;  1CFF A;  3JTD C;  1OOH A;  4USL A;  4DCK A;  1YUS A;  2AUC A;  1T14 A;  1K9P A;  1SR6 B;  1ZFS A;  2LNK A;  5BPJ A;  1QLS A;  1S36 A;  1KK8 B;  4CID A;  3K1E A;  3SJS A;  1WRK A;  2KFF A;  4NDB A;  1EG3 A;  1J7O A;  1FW4 A;  1TOP A;  1DVI A;  2OTG C;  1CTR A;  4QJ4 B;  1UWO A;  1A2X A;  1SBJ A;  3CZ2 A;  1BOD A;  2FOT A;  1D1O A;  1Y1X A;  1K2H A;  3D77 A;  1CFC A;  1NPQ A;  2JRF A;  1SCM C;  2JWW A;  3PLF B;  2K61 A;  4M2P A;  1JUO A;  3CTN A;  1ZUZ A;  3D73 A;  5HLO A;  2JT3 A;  4I5K A;  1YX8 A;  1K93 D;  1YUR A;  1FF1 A;  4DS7 A;  1BG1 A;  4YGD B;  1CFD A;  1JBA A;  3S0E A;  4ORB B;  1KSM A;  2WCJ A;  2M9G A;  1M31 A;  2L51 A;  1J7P A;  2O5G A;  1IRJ A;  1Z2C B;  1OSA A;  1BJF A;  1B8C A;  4MRY A;  3I5H C;  1ZOT B;  2WCK A;  2YGU A;  4GPL B;  1S3P A;  1CMG A;  1DJI A;  1QX5 B;  2OS8 C;  4WQ3 A;  3BOW A;  1EXR A;  1LS8 A;  5HLV A;  1OMD A;  2KBM A;  1YX7 A;  2VRG A;  2K0J A;  1JFK A;  4OKH A;  3LK1 A;  2LMT A;  2F8P A;  1MWN A;  4ORA B;  2CNP A;  3CYZ A;  2AAO A;  1KWO B;  3S0F A;  2ISD A;  3S0B A;  4I5N B;  4NDD A;  1KQM C;  5HL1 A;  1LA3 A;  2KBI A;  3VRN A;  1WY9 A;  1QIW A;  3NSL A;  1IQ3 A;  3KEV A;  1IJ5 A;  2GTE A;  3AAJ A;  1IG5 A;  1EG4 A;  5I2L A;  2KI4 C;  2WC5 A;  2ZKM X;  2KNE A;  2BCA A;  2JXL A;  1H8B A;  1UHJ A;  2CBL A;  5KTY A;  2KAY A;  2LUX A;  2F2P A;  3CWG A;  3R1V A;  1MF8 B;  5FI6 A;  2FCE A;  3EVR A;  3OP0 A;  3O4X A;  4YGC B;  2BCX A;  3VRO A;  3PFV A;  3WHU B;  4CPV A;  3DF0 A;  1ALV A;  2O60 A;  1CLM A;  1GM0 A;  1LIN A;  5TNC A;  2HF5 A;  1EJ3 A;  2LVJ A;  2Q91 A;  1P28 A;  1SPY A;  2BAP A;  4QJ3 B;  2PYQ A;  2M1U A;  2H2K A;  1UHK A;  5I94 A;  4ORC B;  2EC6 B;  1K95 A;  2JU0 A;  5HKZ A;  3FWB A;  4P2Y B;  1KSO A;  1DJH A;  1DJW A;  2ZFD A;  4HRH A;  1SL9 A;  1Q80 A;  5ER4 X;  4AQJ A;  5I2O A;  2QEB A;  1DT7 B;  1S6J A;  1OZS A;  1M46 A;  3DXL A;  1KFX S;  1AJ5 A;  4ICB A;  2MHH A;  1B1G A;  2HQ8 A;  3I5I B;  2LLU A;  1UUS A;  3D10 A;  2MLE C;  1N2D A;  2LCP A;  3R72 A;  4YGE B;  2PRU A;  3BUX B;  1TNW A;  3JVT B;  3Q8I A;  1NCZ A;  4ZCV A;  2MA2 A;  1M63 B;  3ZNI A;  2KAV A;  4M2Q A;  1QAS A;  1SKT A;  2JTZ A;  2KFH A;  2L4I A;  3BQ3 A;  2NCP A;  2KLD A;  3O6B A;  3OHM B;  1PAL A;  4D1E A;  1MQ1 A;  3BFH A;  2KGR A;  3TS5 C;  4XJK A;  2ZNE A;  1IKU A;  3CZ1 A;  3PM8 A;  1H4B A;  1DEL A;  3D0Y B;  1Y1A A;  3PJI A;  1FI5 A;  1QLK A;  2Y4Q A;  1RWY A;  2K7C A;  4PCW A;  2L2E A;  2WOS A;  1K96 A;  1L7Z A;  3EKH A;  3GK4 X;  3GOF A;  4GNK B;  1JF0 A;  1PSR A;  2FCD A;  1XK4 C;  1SNL A;  1J7Q A;  4P5O E;  1IJ6 A;  1WLM A;  4PE1 A;  2JNX A;  2Y1N A;  4JPZ B;  2F3Y A;  2SCP A;  1K8U A;  2F33 A;  5KSZ A;  1F4O A;  3I5F C;  4MZK A;  1OQP A;  2A4J A;  3IQO A;  2KQ6 A;  1VRK A;  3BUN B;  1DTL A;  2EGD A;  4MSP A;  4JD9 A;  2V53 A;  2G9B A;  5J3X A;  4I5J A;  1NX3 A;  1NYA A;  2KPH A;  3CZ0 A;  2MJW B;  2WCM A;  2NXQ A;  2GV5 A;  1BF5 A;  3VB1 A;  1J1D A;  4GGF A;  2G2B A;  1XFX O;  4JWQ A;  2KDH A;  2M97 A;  4R1E A;  4C0J A;  1YVL A;  1F70 A;  5FI2 A;  4C0L A;  1RTP 1;  1XFU O;  2JC2 A;  3CR4 X;  2CTN A;  2B1U A;  3NSK A;  1C3Z A;  2E6W A;  2JPT A;  1SCV A;  3GK2 A;  3H4S E;  4YGB B;  1JWD A;  1G8I A;  3FS7 A;  1TRF A;  1YRU B;  2L5X B;  1CM4 A;  2LLT A;  2MBX A;  1KK7 Z;  3F45 A;  3TUY B;  3AAK A;  1RRO A;  1Z4H A;  4ZCU A;  1LKJ A;  1TIZ A;  3WXA A;  1OOJ A;  1UP5 A;  4JKT A;  3OGN A;  1NX0 A;  5DKR A;  3DD4 A;  2PVB A;  3SG2 A;  3SIB A;  4PAL A;  5CSI A;  1DGU A;  1KWO C;  4IL1 A;  4ETO A;  4I5L B;  1JFJ A;  2KHN A;  2JNF A;  1SL8 A;  1RFJ A;  2I94 A;  1ZMZ A;  4CFQ A;  3PM2 A;  4PT1 A;  2JOJ A;  2PAL A;  5HKW A;  2QAC A;  3BYA A;  2QEO A;  5DIC A;  1KK7 Y;  5I2Q A;  3FE8 A;  1DQE A;  4KYN A;  3O4Y A;  1OZO A;  2L2C A;  2WOR A;  5CPV A;  1RJV A;  2CT9 A;  3OB1 B;  1OOI X;  1SW8 A;  1WDC C;  1AK8 A;  2LM5 A;  4GBA A;  2JTT A;  4IJ7 A;  3O2P A;  3DVM A;  1G33 A;  3N7H A;  3C1V A;  3JTD B;  1SY9 A;  4YI9 A;  3L4L A;  3ZWH A;  3D76 A;  3A8R A;  1DGV A;  1CFP A;  2WCF A;  2BCB A;  2BKI B;  3KF9 A;  5AAN A;  2K8M B;  2JXC A;  3DZT A;  1CKK A;  1F8H A;  2KQY A;  1XFV O;  3M0W A;  2M0R A;  1BT6 A;  3UO9 A;  2OTG B;  1CM1 A;  2KAX A;  3SS3 A;  1AUI B;  2LE9 B;  3B88 A; 
#chains in the Genus database with same CATH homology
 3VRR A;  1XYD A;  1NIW A;  4MZL A;  2GGM A;  2Y1M A;  5AFP A;  2SAS A;  1FI6 A;  3K21 A;  3SG6 A;  3PAL A;  1SCM B;  2WCE A;  1DF0 B;  1M39 A;  1AVS A;  4PDZ A;  1CMF A;  2JUL A;  4HRE E;  1AJ4 A;  3JVT C;  1SL7 A;  3I5G B;  4DIR A;  1JC2 A;  2CXJ A;  1C7V A;  1F55 A;  1A29 A;  1QS7 A;  2TN4 A;  1OE9 B;  3RLZ A;  1S26 D;  1NSH A;  2BBN A;  1GJY A;  4PE7 A;  3TDI A;  4NQG A;  1SRA A;  1V1F A;  1B47 A;  3EVU A;  1UHN A;  3HCM A;  5CSJ A;  3OX6 A;  2DOQ A;  2L4H A;  1SYM A;  3EK8 A;  1B7T Z;  2LVK A;  1OMR A;  2BE4 A;  1MHO A;  2KOT A;  2OPO A;  1YRT B;  1IWQ A;  4NDC A;  4AOM A;  1S1E A;  3IQQ A;  3WHT B;  2WND A;  3AKB A;  3D0Y A;  3SIA A;  2LP3 A;  4F0Z B;  5B8I B;  4YI8 A;  2EHB A;  4A4B A;  2ZRT A;  1YVH A;  3PN7 B;  2RGI A;  1RK9 A;  3NSI A;  1B7T Y;  5HKY A;  2ZND A;  2WC8 A;  5HYD A;  2MAZ A;  1SR6 C;  2PAS A;  2LLS A;  3DVJ A;  4PHN A;  2I2R E;  1NUB A;  5IBW A;  1KK8 C;  5DKN A;  1M45 A;  2LAN A;  4WQ2 A;  2Y5I A;  1CLB A;  3VRP A;  2KI6 C;  1AHR A;  1CDL A;  1NWD A;  1A75 B;  1DJZ A;  1QAT A;  2D8N A;  1ZAC A;  1S6I A;  4N5X A;  5PAL A;  2M7L A;  2WCB A;  1YUU A;  2K2F A;  3PSR A;  4GGF C;  4MZJ A;  2LV7 A;  2NCO A;  1V1G A;  3AKA A;  1GGW A;  3KHE A;  5CSN A;  1QXP A;  2P6B B;  4FQO A;  5DKQ A;  1IH0 A;  1JSA A;  1A4P A;  2ZRS A;  1TTX A;  1PK0 D;  2COL B;  1PVA A;  1K94 A;  4YBH B;  1UHH A;  5GQQ C;  1PUL A;  3PAT A;  1QVI Y;  4MVF A;  5JJG A;  2JZI A;  2JT0 A;  2K7D A;  1B4C A;  3LK0 A;  3EVV A;  1SK6 D;  2LC5 A;  5CSF A;  1S6C A;  3A4U B;  1CNP A;  3SG5 A;  4A4C A;  4MBE A;  1CDN A;  1BU3 A;  1NP8 A;  1L2O B;  1N65 A;  2ZN8 A;  1WRZ A;  1YR5 A;  1OMV A;  2K2A A;  3O78 A;  3MSE B;  1S5G Z;  1NCX A;  2H61 C;  1Y6W A;  2M3W A;  3WNX B;  1GGZ A;  1U5I B;  1NX2 A;  1REC A;  1TN4 A;  4C0K A;  5KU1 A;  2K7O A;  3VRQ A;  1KFU L;  4E68 A;  4OCI A;  4PE0 A;  3TZ1 A;  1FPW A;  2IS9 A;  3TDU A;  1TCO B;  2LUC A;  1XO5 A;  3VGO A;  4OVN F;  3CZT X;  3CS1 A;  1DJY A;  1BR4 B;  2ZN9 A;  1HT9 A;  2H61 A;  5F6T A;  1BLQ A;  1S5G Y;  1DJG A;  2HET A;  2GGZ A;  3I5F B;  3GK1 A;  5I8N A;  1R6P A;  2M49 B;  3DVE A;  1JF2 A;  1F71 A;  2BL0 B;  2K7B A;  4BY4 A;  4N1F A;  3I5G C;  4YRU A;  2LP2 A;  1XFZ O;  4MLW A;  1CB1 A;  2HPS A;  1KCY A;  3CR5 X;  3NSO A;  1XA5 A;  1DF0 A;  2MRD A;  3KO0 A;  3NXA A;  4AQI A;  1XVJ A;  2FJU B;  2EC6 C;  4HSZ A;  2CCM A;  2F2O A;  1B9A A;  4WRI A;  1QV1 A;  1B8R A;  5G08 A;  1BOC A;  1DMO A;  4GUK A;  1E8A A;  3OX5 A;  1AP4 A;  1K9U A;  1N0Y A;  3SG3 A;  1MXL C;  1X02 A;  4YGA A;  3I5I C;  2BBM A;  1QX7 A;  5K89 A;  1LVC D;  1K9K A;  3LLE A;  3QRX A;  2LHI A;  4DRW A;  4QJ5 B;  1HQV A;  2PSR A;  2KGB C;  2LVV A;  4UPG A;  1ALW A;  1IQ5 A;  5JOL A;  2LMU A;  3TDZ A;  3EKJ A;  4HRG A;  1Y0V H;  1YTZ C;  3FWC A;  3BOW B;  1W7I B;  1YUT A;  2L50 A;  1XFY O;  1CDM A;  2M8U A;  1TNX A;  4U8D A;  4M2O A;  3BUO B;  2I7A A;  1TNQ A;  2AMI A;  3PN7 C;  2M1K B;  3ICB A;  2LHL A;  4PHJ A;  2KFG A;  3I5H B;  4MEW A;  1MUX A;  4TNC A;  1PVB A;  1UUR A;  1DJX A;  1EH2 A;  2OS8 B;  1WDC B;  2HQW A;  1QJT A;  4MN0 A;  1UHI A;  2M29 A;  3OB2 B;  3SG7 A;  1TCF A;  4GAO A;  1PRW A;  4GFT A;  1QX2 A;  5ER5 A;  3BUM B;  2Q4U A;  2BE6 A;  2L98 A;  2F3Z A;  1CLL A;  5D69 A;  3IF7 A;  3E3R A;  1C07 A;  3HX4 A;  1GQM A;  1MXE A;  1F4Q A;  1QTX A;  4L9M A;  5AER A;  1KQM B;  4Q04 A;  2M7N A;  3DF0 B;  1NX1 A;  4OV2 A;  4CLN A;  1A75 A;  3LL8 B;  2KI4 B;  2PMY A;  3BXK A;  1IGV A;  1QIV A;  3BUW B;  1J55 A;  4PHM A;  1BMO A;  1QVI Z;  4PHK A;  1CDP A;  1MR8 A;  2L0P A;  4MRX A;  1BR1 B;  1WRL A;  1F54 A;  4DUQ A;  1ODB A;  1A03 A;  1KFU S;  1L2O C;  2JQ6 A;  1NCY A;  2LAP A;  3EK4 A;  3TUY C;  4PE4 A;  1Y1U A;  1QV0 A;  2I18 A;  1R2U A;  5AEQ A;  4BY5 A;  2NZ0 A;  2MLF C;  4XYN A;  1XFW O;  4CFR A;  1LXF C;  3CR2 A;  4GGN A;  1WLZ A;  3SG4 A;  2KI6 D;  2LVI A;  2KYC A;  4OR9 B;  1G4Y R;  1SMG A;  2E30 A;  4XJK B;  2BKH B;  3EK7 A;  1W7J B;  2JT8 A;  3CLN A;  1KQV A;  3RM1 A;  1C7W A;  5FYX A;  1FBV A;  3FIA A;  1J1E A;  1J7R A;  3CGA A;  3LCP C;  4N1G A;  2BEC A;  3KPX A;  1B8L A;  2QPT A;  1U5I A;  2NLN A;  1LA0 A;  4FTG A;  1KFX L;  3DVK A;  5D7F A;  1TNP A;  2KYF A;  2LMV A;  2BL0 C;  2KSP A;  1PSB A;  5AXI A;  4JQ0 D;  3TS5 B;  1XK4 A;  2R2I A;  1K90 D;  1EL4 A;  1CFF A;  3JTD C;  4USL A;  4DCK A;  1YUS A;  2AUC A;  1K9P A;  1SR6 B;  1ZFS A;  2LNK A;  5BPJ A;  1QLS A;  1S36 A;  1KK8 B;  4CID A;  3SJS A;  1J7O A;  1WRK A;  2KFF A;  4NDB A;  1EG3 A;  1FW4 A;  1TOP A;  1DVI A;  2OTG C;  1CTR A;  4QJ4 B;  1UWO A;  1A2X A;  1SBJ A;  1BOD A;  2FOT A;  1D1O A;  1Y1X A;  1K2H A;  1CFC A;  1NPQ A;  2JRF A;  1SCM C;  2JWW A;  3PLF B;  2K61 A;  4M2P A;  1JUO A;  3CTN A;  1ZUZ A;  5HLO A;  2JT3 A;  4I5K A;  1YX8 A;  1K93 D;  1YUR A;  1FF1 A;  4DS7 A;  1BG1 A;  4YGD B;  1CFD A;  1JBA A;  4ORB B;  1KSM A;  2M9G A;  1M31 A;  2L51 A;  1J7P A;  2O5G A;  1IRJ A;  1OSA A;  1BJF A;  1B8C A;  4MRY A;  3I5H C;  1ZOT B;  4GPL B;  1S3P A;  1CMG A;  1DJI A;  1QX5 B;  2OS8 C;  4WQ3 A;  3BOW A;  1EXR A;  5HLV A;  1OMD A;  2KBM A;  1YX7 A;  2VRG A;  2K0J A;  1JFK A;  4OKH A;  3LK1 A;  2LMT A;  2F8P A;  1MWN A;  4ORA B;  2CNP A;  2AAO A;  1KWO B;  2ISD A;  4I5N B;  4NDD A;  1KQM C;  1LA3 A;  2KBI A;  3VRN A;  1WY9 A;  1QIW A;  3NSL A;  1IQ3 A;  3KEV A;  1IJ5 A;  3AAJ A;  1IG5 A;  1EG4 A;  5I2L A;  2KI4 C;  2ZKM X;  2KNE A;  2BCA A;  2JXL A;  1H8B A;  1UHJ A;  2CBL A;  5KTY A;  2KAY A;  2LUX A;  2F2P A;  3CWG A;  1MF8 B;  2FCE A;  3EVR A;  3OP0 A;  4YGC B;  3VRO A;  2BCX A;  3PFV A;  3WHU B;  4CPV A;  3DF0 A;  1ALV A;  2O60 A;  1CLM A;  1LIN A;  5TNC A;  2HF5 A;  1EJ3 A;  2LVJ A;  2Q91 A;  1SPY A;  4QJ3 B;  2M1U A;  2H2K A;  1UHK A;  4ORC B;  2EC6 B;  1K95 A;  2JU0 A;  5HKZ A;  3FWB A;  4P2Y B;  1KSO A;  1DJH A;  1DJW A;  2ZFD A;  4HRH A;  1SL9 A;  1Q80 A;  5ER4 X;  4AQJ A;  5I2O A;  1DT7 B;  1S6J A;  1OZS A;  1M46 A;  1KFX S;  1AJ5 A;  4ICB A;  2MHH A;  1B1G A;  2HQ8 A;  3I5I B;  2LLU A;  1UUS A;  3D10 A;  2MLE C;  1N2D A;  2LCP A;  4YGE B;  2PRU A;  3BUX B;  1TNW A;  3JVT B;  1NCZ A;  4ZCV A;  2MA2 A;  1M63 B;  3ZNI A;  2KAV A;  4M2Q A;  1QAS A;  1SKT A;  2JTZ A;  2KFH A;  2L4I A;  3BQ3 A;  2NCP A;  3O6B A;  3OHM B;  1PAL A;  4D1E A;  1MQ1 A;  2KGR A;  3TS5 C;  4XJK A;  2ZNE A;  1IKU A;  1H4B A;  3PM8 A;  3D0Y B;  1Y1A A;  1FI5 A;  1QLK A;  2Y4Q A;  1RWY A;  2K7C A;  4PCW A;  2L2E A;  2WOS A;  1K96 A;  1L7Z A;  3EKH A;  3GK4 X;  3GOF A;  4GNK B;  1JF0 A;  1PSR A;  2FCD A;  1XK4 C;  1SNL A;  1J7Q A;  4P5O E;  1IJ6 A;  1WLM A;  4PE1 A;  2JNX A;  2Y1N A;  4JPZ B;  2F3Y A;  2SCP A;  1K8U A;  2F33 A;  5KSZ A;  1F4O A;  3I5F C;  4MZK A;  1OQP A;  2A4J A;  3IQO A;  2KQ6 A;  1VRK A;  3BUN B;  1DTL A;  2EGD A;  4MSP A;  5J3X A;  2V53 A;  2G9B A;  4I5J A;  1NX3 A;  1NYA A;  2MJW B;  2NXQ A;  2GV5 A;  1BF5 A;  1J1D A;  4GGF A;  2G2B A;  1XFX O;  4JWQ A;  2KDH A;  2M97 A;  4R1E A;  4C0J A;  1YVL A;  1F70 A;  4C0L A;  1RTP 1;  1XFU O;  2JC2 A;  3CR4 X;  2CTN A;  2B1U A;  3NSK A;  2E6W A;  2JPT A;  3GK2 A;  1SCV A;  4YGB B;  3H4S E;  1JWD A;  1G8I A;  3FS7 A;  1TRF A;  1YRU B;  2L5X B;  1CM4 A;  2LLT A;  2MBX A;  1KK7 Z;  3F45 A;  3TUY B;  3AAK A;  1RRO A;  3WXA A;  4ZCU A;  1LKJ A;  1TIZ A;  1OOJ A;  1UP5 A;  5DKR A;  1NX0 A;  3DD4 A;  2PVB A;  3SG2 A;  3SIB A;  4PAL A;  5CSI A;  1DGU A;  1KWO C;  4IL1 A;  4ETO A;  4I5L B;  1JFJ A;  2KHN A;  2JNF A;  1SL8 A;  1RFJ A;  2I94 A;  1ZMZ A;  4CFQ A;  2JOJ A;  2PAL A;  5HKW A;  2QAC A;  3BYA A;  1KK7 Y;  5I2Q A;  3O4Y A;  1OZO A;  5CPV A;  2WOR A;  1RJV A;  2CT9 A;  3OB1 B;  1SW8 A;  1WDC C;  1AK8 A;  2LM5 A;  4GBA A;  2JTT A;  3O2P A;  3DVM A;  1G33 A;  3C1V A;  3JTD B;  1SY9 A;  4YI9 A;  3ZWH A;  3A8R A;  1DGV A;  1CFP A;  2WCF A;  2BCB A;  2BKI B;  3KF9 A;  5AAN A;  2K8M B;  2JXC A;  1CKK A;  1F8H A;  2KQY A;  1XFV O;  3M0W A;  2M0R A;  1BT6 A;  2OTG B;  1CM1 A;  2KAX A;  1AUI B;  2LE9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...