1AUIB

Human calcineurin heterodimer
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
165
structure length
165
Chain Sequence
SYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords SERINE/THREONINE PHOSPHATASE 2B
publication title Crystal structures of human calcineurin and the human FKBP12-FK506-calcineurin complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 60
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 1997-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00036 EF-hand_1 EF hand
B PF13202 EF-hand_5 EF hand
B PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1auiB00
2ISDA 1NCZA 2LM5A 2MAZA 1IQ3A 1CLLA 2CCMA 3GOFA 1J7RA 1QV0A 4YGDB 1K90D 1S1EA 2EC6B 1FI6A 2LV7A 1YX7A 1EG3A 4WRIA 4DS7A 4UPGA 4MN0A 1AK8A 1NIWA 1J7QA 2LVIA 4F0ZB 3IQOA 2E30A 3KO0A 1CNPA 1S6CA 2JRFA 1TNPA 4P2YB 2FCEA 1SPYA 2MHHA 1K95A 1EH2A 4IL1A 4GPLB 1S6JA 1KFXL 1L2OC 1MUXA 2LVJA 3QRXA 2BCAA 4GBAA 5CSNA 5GQQC 1VRKA 4MSPA 3I5HC 1DJWA 2MA2A 3PFVA 2KAVA 3VRPA 2FOTA 3F45A 1ZUZA 2M49B 4NDCA 4DIRA 1NSHA 2JOJA 4A4CA 1A75A 1XFYO 2JPTA 3BUWB 1NX1A 4HREE 1Y1UA 1QXPA 5HYDA 1FPWA 2F3ZA 2M8UA 1C7VA 1SK6D 4JQ0D 1OMRA 2D8NA 2EHBA 5AANA 2TN4A 1EJ3A 4A4BA 2LC5A 3BOWB 1F54A 1N2DA 3AAKA 2GV5A 1QJTA 2LP2A 4NDBA 2M7NA 4GUKA 4FQOA 3C1VA 3CGAA 2SCPA 1KFXS 3VRQA 4ORCB 2COLB 1DJIA 1U5IA 3TZ1A 3SJSA 4ETOA 4MZLA 1K96A 1TIZA 3O78A 1QLKA 3SG7A 3EVUA 1KCYA 1QX5B 2F8PA 2MLFC 2L98A 2BL0B 3HCMA 1TOPA 1LXFC 1YX8A 3SIBA 1CLBA 1CB1A 1CDLA 1V1GA 3VRNA 4TNCA 1X02A 4MRXA 1UWOA 1F8HA 2VRGA 1SNLA 5I8NA 2O60A 2PRUA 4XJKB 2BCXA 5CSIA 1GQMA 1HQVA 1GJYA 4MZJA 1IQ5A 1XA5A 2CBLA 2A4JA 2RGIA 2ZFDA 2IS9A 5JOLA 3NSLA 2LE9B 1K9KA 1KQMB 1LA3A 3PALA 1SCVA 2L4IA 2PALA 4QJ4B 1FI5A 1WDCC 1YVHA 2KAYA 3O2PA 4YGCB 1D1OA 1XFVO 3EK4A 3DD4A 3TDIA 1PSBA 3LK0A 3AAJA 1Q80A 1XFXO 1KWOB 2KHNA 1TNWA 1JSAA 4OCIA 1KQVA 1ZFSA 4WQ3A 5B8IB 4YGAA 1XYDA 3DVEA 2K7CA 3PN7C 2KGRA 1NUBA 4M2PA 1OOJA 2HQWA 1F70A 4OR9B 1B7TY 2G9BA 3DF0B 3BXKA 1IKUA 2NLNA 1DVIA 4DRWA 1RWYA 2KGBC 3VROA 4JPZB 4C0LA 2JNFA 1WY9A 1DT7B 3JTDC 4PHKA 1ZOTB 2CT9A 2OTGB 3NSIA 2KI6D 2JQ6A 1OMVA 3BUXB 3HX4A 1UHJA 2O5GA 3H4SE 4PHMA 4YBHB 1DF0A 2L50A 4GGFC 1NP8A 1YR5A 2K7BA 1LA0A 1SY9A 3VGOA 2LCPA 2BCBA 3TS5C 2F2PA 1J7OA 4AQJA 4PCWA 2LLTA 1DJZA 2KAXA 3ICBA 2JC2A 3KF9A 1J1EA 2KI4B 3SG4A 1OSAA 4ICBA 1S26D 2BBMA 2P6BB 1ALWA 3CWGA 1NX3A 4HRGA 1SR6C 3NXAA 4N1FA 1QVIY 1AJ5A 3I5FC 1K93D 1K8UA 5ER5A 1NCXA 3AKBA 3WXAA 1UHKA 1AVSA 3BQ3A 1SCMC 1RTP1 1M39A 4CFQA 1PALA 2K2AA 4JWQA 1CDMA 3NSKA 1CDPA 2KFFA 1DJHA 2PVBA 5D7FA 1QX7A 3TUYC 3WNXB 2NCPA 1PULA 4XYNA 2EGDA 3BUOB 1IWQA 1QX2A 1R2UA 1DF0B 2PMYA 3RM1A 2QACA 2ZN8A 3OB2B 3ZWHA 2L5XB 4L9MA 1TRFA 2JU0A 1ZMZA 3BOWA 4I5LB 2WCEA 4ORAB 1UHNA 4MZKA 3TUYB 1QVIZ 4HRHA 3IQQA 4MVFA 2K2FA 1FBVA 5AFPA 5KU1A 4GNKB 3FS7A 3EVRA 4ORBB 1IJ5A 4BY4A 1CDNA 4OVNF 2BE6A 1L2OB 2BBNA 3I5IC 4E68A 3EK7A 2ZKMX 1B8CA 1HT9A 2K61A 3I5HB 2ZRTA 1N0YA 3FWBA 4USLA 3O4YA 1B4CA 3FIAA 4XJKA 1F55A 4YGBB 4NDDA 2JULA 1S3PA 1BOCA 4DUQA 1JBAA 2I94A 1R6PA 3OHMB 1YUSA 1B8LA 1BT6A 2KOTA 1M45A 5J3XA 4QJ5B 1UP5A 1TN4A 5I2LA 1BF5A 1XFZO 1BR4B 4N5XA 1XVJA 2K0JA 3TDUA 3WHTB 1C7WA 4C0JA 2M3WA 2SASA 3PLFB 1DJXA 1CTRA 1MWNA 1QIWA 1CKKA 2M9GA 2MRDA 5DKRA 3SIAA 1J7PA 2LLUA 5CSFA 4BY5A 2LUXA 3NSOA 1Y1XA 1CM1A 1WRKA 3I5GC 1Y1AA 3D10A 2NCOA 3DF0A 1QASA 2HQ8A 2JZIA 3CR4X 4PE0A 1LKJA 2KBMA 3MSEB 1NPQA 2ZNEA 2ZNDA 2AAOA 3CR5X 5G08A 2JWWA 5FYXA 1G33A 1QLSA 4YI9A 1LVCD 1S5GZ 1A2XA 2M97A 1SRAA 1IJ6A 2L4HA 1Y0VH 2K7OA 1WRZA 3BUNB 1NX0A 1WRLA 4GGNA 4YRUA 1DGUA 1YTZC 3D0YB 1UHIA 1G4YR 2WC8A 3GK1A 2KQ6A 1XFUO 1IG5A 4HSZA 2H61A 1MXLC 1WDCB 4PHJA 1MF8B 1XK4A 3O6BA 1WLZA 3PATA 1OQPA 1OE9B 2MLEC 1TNQA 1BG1A 5CSJA 1CFPA 2CTNA 2JXCA 1JF0A 1IGVA 3PN7B 4I5NB 3OB1B 2L2EA 2KFHA 5AEQA 2LMVA 3CS1A 2KI6C 4WQ2A 2LP3A 2Q4UA 2I18A 3PM8A 2MBXA 2HETA 3JTDB 2ZN9A 2KDHA 1Y6WA 3OP0A 4NQGA 5DKQA 3CLNA 2I2RE 2JTZA 1L7ZA 1YRTB 2KSPA 3GK2A 1QV1A 2Y1MA 4FTGA 1BLQA 1UHHA 3TS5B 1TCFA 3LLEA 2F3YA 5CPVA 1NWDA 1MXEA 3OX6A 2BKIB 3AKAA 4D1EA 1KFUS 2KBIA 2F2OA 1OZOA 1WLMA 2B1UA 5AXIA 1SR6B 2NZ0A 3DVMA 2V53A 3I5FB 3M0WA 1FF1A 1V1FA 2CXJA 2OS8C 1SKTA 2Y4QA 5D69A 1SCMB 1FW4A 3OX5A 2LANA 2L51A 1BODA 3LK1A 1CFFA 2HF5A 3EVVA 2JTTA 3BUMB 1ALVA 1RROA 3SG5A 1AHRA 2EC6C 2M1KB 1M31A 1UURA 2OS8B 1KSOA 1SBJA 2GGZA 2LNKA 4PDZA 5KTYA 1A03A 1B8RA 2BECA 1DTLA 2LVVA 2KYFA 1F4QA 1CM4A 2WORA 1AJ4A 3EK8A 4GFTA 4M2QA 1K9PA 4PHNA 2KNEA 3KPXA 1E8AA 1KK7Y 2LVKA 2I7AA 3SG3A 1EG4A 2H2KA 1M46A 1G8IA 1PVBA 3VRRA 1CLMA 1A29A 4I5JA 1AUIB 2R2IA 1NCYA 2G2BA 5IBWA 2LLSA 2WOSA 1JFJA 2M0RA 3CZTX 1QS7A 1SW8A 4ZCVA 1XO5A 1EL4A 2M7LA 1MR8A 3I5IB 2BKHB 4DCKA 2NXQA 4AOMA 1H8BA 5BPJA 4Q04A 3GK4X 2AMIA 2GGMA 1S5GY 1ZACA 1W7JB 2LMUA 4MEWA 2E6WA 1B9AA 1SL7A 1S36A 1CFCA 1BR1B 4U8DA 1NX2A 1KK7Z 4N1GA 3D0YA 1JC2A 4P5OE 4PALA 5I2OA 1YRUB 2BL0C 2JT0A 1OMDA 1MHOA 2K7DA 1EXRA 3RLZA 2LMTA 3EKJA 1AP4A 1B1GA 4MBEA 4AQIA 3SG2A 1CFDA 1J55A 2BE4A 2JNXA 4I5KA 2ZRSA 1A75B 1YURA 1K2HA 1M63B 1GGWA 1A4PA 1YVLA 4CPVA 4YGEB 4MLWA 1RJVA 2JXLA 5HKZA 1LINA 3LL8B 2MJWB 3LCPC 1PVAA 1DMOA 3I5GB 2LHIA 4R1EA 1TCOB 4PE1A 3A8RA 2OPOA 4CIDA 1GGZA 1KQMC 1YUTA 1TTXA 1PK0D 1KK8C 3EKHA 3CR2A 1U5IB 3IF7A 1UUSA 5HLOA 1BU3A 1NYAA 4GGFA 1KWOC 1W7IB 3SG6A 1QTXA 3E3RA 1B47A 1QIVA 1BMOA 1JFKA 1KK8B 1MQ1A 2HPSA 2JT8A 2KQYA 5K89A 1F4OA 1KFUL 1K94A 2FCDA 5HKYA 1JWDA 3TDZA 1YUUA 1C07A 4OKHA 3ZNIA 5PALA 1JUOA 2PASA 2OTGC 4PE7A 5KSZA 2Q91A 5HKWA 1N65A 2JT3A 1DJYA 5AERA 5HLVA 4CLNA 2Y1NA 1SL9A 1JF2A 3A4UB 4M2OA 1SMGA 1PSRA 3FWCA 3JVTC 2WCFA 1ODBA 4MRYA 2Y5IA 4GAOA 2M1UA 3WHUB 2QPTA 2KI4C 1SYMA 5F6TA 1J1DA 2H61C 1H4BA 2F33A 2KFGA 1XK4C 1XFWO 5DKNA 4OV2A 2FJUB 2DOQA 1IH0A 5ER4X 3JVTB 1F71A 1RK9A 1TNXA 5TNCA 1KSMA 2LAPA 1K9UA 1BJFA 1CMGA 3BYAA 1IRJA 1RECA 4C0KA 3DVKA 4CFRA 2KYCA 2LUCA 4PE4A 3K21A 5I2QA 1DGVA 2LHLA 2K8MB 3KHEA 1PRWA 2L0PA 2M29A 2CNPA 4YI8A 2AUCA 1DJGA 1S6IA 3KEVA 1CMFA 4QJ3B 1B7TZ 3DVJA 3CTNA 1QATA 4ZCUA 5JJGA 1RFJA 2PSRA 1OZSA 2WNDA 2WCBA 3PSRA 1SL8A
chains in the Genus database with same CATH superfamily
2ISDA 1NCZA 3S0AA 2LM5A 4FQTA 2MAZA 1IQ3A 1CLLA 2CCMA 3GOFA 1J7RA 1QV0A 4YGDB 1K90D 1S1EA 2EC6B 4IJ7A 1FI6A 2LV7A 1YX7A 1EG3A 4WRIA 4DS7A 4UPGA 4MN0A 1AK8A 1NIWA 1J7QA 2LVIA 4F0ZB 3BFAA 3IQOA 2E30A 3KO0A 1CNPA 1S6CA 2JRFA 1TNPA 4P2YB 2FCEA 1SPYA 3IVTA 2MHHA 1K95A 1EH2A 3K1EA 4GPLB 4IL1A 1S6JA 1KFXL 1L2OC 1MUXA 2LVJA 3QRXA 2BCAA 3OBVA 4GBAA 5CSNA 5GQQC 1VRKA 4MSPA 1DC1A 3I5HC 1DJWA 2MA2A 3PFVA 2KAVA 3VRPA 2FOTA 3F45A 1ZUZA 2M49B 4NDCA 4DIRA 1NSHA 1OW4A 2JOJA 3CYZA 4A4CA 1A75A 1XFYO 3BJHA 2JPTA 3BUWB 1NX1A 3EG5B 4HREE 3CZ2A 1Y1UA 1QXPA 5HYDA 1FPWA 2F3ZA 2M8UA 1C7VA 1SK6D 3VB1A 4JQ0D 1OMRA 2D8NA 2EHBA 5AANA 2TN4A 1EJ3A 3B6XA 4A4BA 2LC5A 3BOWB 1F54A 1N2DA 2KLEA 3AAKA 2GV5A 1QJTA 2LP2A 4NDBA 2M7NA 4GUKA 4FQOA 3S0DA 3C1VA 3CGAA 2SCPA 1KFXS 3VRQA 4ORCB 2COLB 1DJIA 1U5IA 3TZ1A 3SJSA 2KLDA 4ETOA 4MZLA 1K96A 1TIZA 3O78A 1QLKA 3DYEA 3EVUA 3SG7A 1KCYA 1QX5B 2F8PA 2MLFC 2L98A 2BL0B 3HCMA 1TOPA 1LXFC 1YX8A 3SIBA 5HL1A 1CLBA 4INXA 1CDLA 1CB1A 1V1GA 5EL2A 3B88A 3VRNA 2WCJA 4TNCA 3B86A 1X02A 4MRXA 1UWOA 1F8HA 2VRGA 2H8VA 1SNLA 5I8NA 2O60A 2PRUA 4XJKB 1OOGA 2BCXA 3R72A 5CSIA 1GQMA 1HQVA 1GJYA 4MZJA 1IQ5A 1XA5A 2CBLA 3L4AA 3CZ0A 3FE8A 2A4JA 2RGIA 2ZFDA 2IS9A 5JOLA 3NSLA 2LE9B 1K9KA 1KQMB 1OOFA 1LA3A 3PALA 1SCVA 2L4IA 2PALA 4QJ4B 1FI5A 1QWVA 1WDCC 1YVHA 2KAYA 3O2PA 4YGCB 1D1OA 1XFVO 3EK4A 3DD4A 3TDIA 1PSBA 3LK0A 3AAJA 1Q80A 1XFXO 1KWOB 2KHNA 1TNWA 1JSAA 4OCIA 1KQVA 1ZFSA 4WQ3A 5B8IB 4YGAA 1XYDA 3DVEA 2K7CA 3PN7C 2KGRA 1NUBA 4M2PA 1OOJA 2HQWA 1F70A 2L2CA 4OR9B 1B7TY 2G9BA 3DF0B 3BXKA 1IKUA 2NLNA 1DVIA 4DRWA 3NHIA 1RWYA 2KGBC 3VROA 4JPZB 4C0LA 2JNFA 1WY9A 1DT7B 3JTDC 4PHKA 1ZOTB 2CT9A 2OTGB 3NSIA 2KI6D 2JQ6A 1OMVA 3BUXB 3HX4A 1UHJA 2O5GA 3H4SE 1GM0A 1Z2CB 4PHMA 4YBHB 1DF0A 2L50A 4GGFC 1NP8A 1YR5A 2K7BA 1LA0A 1SY9A 3VGOA 3D73A 3B7AA 2LCPA 2BCBA 3OGNA 3TS5C 2F2PA 1J7OA 4AQJA 4PCWA 2LLTA 1DJZA 2KAXA 3ICBA 2JC2A 3KF9A 1J1EA 2KI4B 3DZTA 1OSAA 4ICBA 3SG4A 1S26D 2BBMA 2P6BB 1ALWA 3CWGA 1NX3A 4HRGA 1SR6C 2JPOA 3NXAA 4N1FA 1QVIY 1AJ5A 3I5FC 3UO9A 1K93D 1K8UA 5ER5A 1NCXA 3AKBA 3WXAA 1UHKA 1AVSA 3BQ3A 1SCMC 1RTP1 1M39A 4CFQA 1PALA 2K2AA 4JWQA 1CDMA 3NSKA 3PJIA 1ORGA 1CDPA 2KFFA 1DJHA 3R1PA 2PVBA 5D7FA 5D3OA 1QX7A 3TUYC 2PQLA 3WNXB 2NCPA 1PULA 4XYNA 2EGDA 3BUOB 1IWQA 1QX2A 1R2UA 1DF0B 2PMYA 3RM1A 2QACA 2ZN8A 3OB2B 3ZWHA 2L5XB 4L9MA 1TRFA 2JU0A 1ZMZA 3BOWA 3NHTA 2WCEA 4I5LB 3B87A 4ORAB 1UHNA 4MZKA 3TUYB 1QVIZ 4HRHA 3IQQA 3QMEA 4MVFA 2K2FA 1FBVA 5AFPA 5KU1A 4GNKB 3FS7A 3EVRA 4ORBB 1TUJA 1IJ5A 4BY4A 1CDNA 3V2LA 4OVNF 2BE6A 1L2OB 2BBNA 3DY9A 3I5IC 4E68A 3L47A 3EK7A 2ZKMX 1B8CA 1HT9A 2K61A 3I5HB 2ZRTA 1N0YA 3FWBA 4USLA 3O4YA 1B4CA 3FIAA 4XJKA 1F55A 4YGBB 4NDDA 2JULA 1S3PA 1BOCA 4DUQA 1JBAA 2I94A 1R6PA 3OHMB 1YUSA 1B8LA 1BT6A 2KOTA 1M45A 5J3XA 4QJ5B 1UP5A 1TN4A 5I2LA 1BF5A 5FI6A 1XFZO 1BR4B 4N5XA 3CZ1A 1XVJA 2K0JA 3TDUA 3WHTB 1C7WA 1W9ZA 4C0JA 2M3WA 2SASA 3PLFB 1DJXA 2BAPA 2L5YA 1CTRA 1MWNA 4F7FA 1QIWA 1CKKA 2M9GA 2MRDA 5DKRA 2WCLA 3SIAA 3NGVA 1J7PA 2LLUA 5CSFA 4BY5A 2LUXA 3NSOA 1Y1XA 1CM1A 1WRKA 3I5GC 1Y1AA 3D10A 2NCOA 3DF0A 1QASA 1SSEB 2HQ8A 3R1OA 2JZIA 1C3YA 3CR4X 4PE0A 1LKJA 2KBMA 3MSEB 3S0EA 1NPQA 2ZNEA 2ZNDA 2AAOA 3CR5X 5G08A 2JWWA 3CDNA 1G33A 1QLSA 5FYXA 4YI9A 1LVCD 1S5GZ 2KPHA 4KYNA 1A2XA 2M97A 1SRAA 1IJ6A 2L4HA 1Y0VH 2K7OA 1P28A 1WRZA 3BUNB 1NX0A 1WRLA 4GGNA 4YRUA 1DGUA 1YTZC 2QEVA 1UHIA 3D0YB 1G4YR 2WC8A 3FE9A 3GK1A 4INWA 2KQ6A 1XFUO 1IG5A 4HSZA 3PM2A 3L4LA 2H61A 1MXLC 1WDCB 4PHJA 1DEKA 1MF8B 1XK4A 3O4XA 5FI7A 3O6BA 3S0BA 1WLZA 3PATA 1OQPA 1OE9B 2MLEC 1TNQA 1BG1A 5CSJA 1CFPA 2CTNA 2JXCA 1JF0A 1IGVA 3PN7B 4I5NB 1OOIX 2BNXA 3OB1B 2L2EA 2KFHA 5AEQA 2LMVA 3CS1A 2KI6C 4WQ2A 2LP3A 2Q4UA 2I18A 4JD9A 5FI2A 3PM8A 2MBXA 2HETA 3JTDB 2ZN9A 2KDHA 1Y6WA 3OP0A 3D78A 4NQGA 5DKQA 3CLNA 2I2RE 2JTZA 1L7ZA 1YRTB 2KSPA 3GK2A 1QV1A 2Y1MA 4FTGA 1BLQA 1UHHA 3TS5B 4JKTA 1TCFA 3LLEA 2F3YA 5CPVA 1C3ZA 1NWDA 1MXEA 3OX6A 2BKIB 3AKAA 4D1EA 1XFRA 1KFUS 2KBIA 2F2OA 1OZOA 1WLMA 2B1UA 5AXIA 1SR6B 1Z4HA 2NZ0A 3BFBA 3D74A 3DVMA 2V53A 3I5FB 3M0WA 1FF1A 1V1FA 2CXJA 2OS8C 1SKTA 2Y4QA 5D69A 1SCMB 1FW4A 2WC5A 3OX5A 2LANA 1DELA 2L51A 1BODA 3LK1A 1CFFA 2HF5A 2QEHA 3EVVA 3S0GA 2JTTA 3BUMB 1ALVA 1RROA 3SG5A 1AHRA 2EC6C 2M1KB 1M31A 1UURA 2OS8B 1KSOA 1SBJA 2GGZA 2LNKA 4PDZA 5KTYA 1A03A 1B8RA 2BECA 3SS4A 5HKZA 1DTLA 1LS8A 2LVVA 2KYFA 1F4QA 1CM4A 2WORA 1AJ4A 3EK8A 4GFTA 4M2QA 1K9PA 4PHNA 2KNEA 3Q8IA 3KPXA 2QEOA 1E8AA 1KK7Y 2LVKA 2I7AA 3SG3A 1EG4A 2H2KA 1M46A 1G8IA 1PVBA 3VRRA 1CLMA 2YGUA 1A29A 4I5JA 1AUIB 2R2IA 1NCYA 2G2BA 5IBWA 2LLSA 2WOSA 1JFJA 2M0RA 3CZTX 1QS7A 1SW8A 4ZCVA 1XO5A 1EL4A 2M7LA 1MR8A 3I5IB 2BKHB 4DCKA 3FE6A 5DICA 2NXQA 4AOMA 1H8BA 5BPJA 4Q04A 3GK4X 2AMIA 2GGMA 1S5GY 1ZACA 1W7JB 2LMUA 4MEWA 2E6WA 3SS5A 1OOHA 1B9AA 2WCHA 1SL7A 1S36A 1CFCA 1BR1B 4U8DA 1NX2A 1KK7Z 4N1GA 3D0YA 1JC2A 4P5OE 4PALA 5I2OA 1YRUB 2BL0C 2JT0A 1OMDA 1MHOA 2K7DA 4PT1A 1EXRA 3RLZA 2LMTA 3EKJA 1AP4A 1B1GA 4MBEA 4AQIA 3R1VA 3SG2A 1CFDA 1J55A 2BE4A 2JNXA 4I5KA 2ZRSA 1A75B 1YURA 3D77A 1K2HA 1M63B 1GGWA 2ERBA 1A4PA 1YVLA 4CPVA 4YGEB 4MLWA 1RJVA 2JXLA 3D76A 1LINA 3LL8B 2MJWB 3LCPC 1PVAA 2WC6A 3SS3A 1DMOA 3I5GB 2LHIA 4R1EA 2P70A 2PYQA 2GTEA 1TCOB 3BFHA 4PE1A 3A8RA 2OPOA 4CIDA 1GGZA 1KQMC 1YUTA 1TTXA 1PK0D 1KK8C 3EKHA 1IIOA 3CR2A 1U5IB 3IF7A 1UUSA 4OZDA 5HLOA 1BU3A 1NYAA 4GGFA 1KWOC 1W7IB 3SG6A 1QTXA 3E3RA 1B47A 1QIVA 1BMOA 1JFKA 1KK8B 1MQ1A 2HPSA 2JT8A 2KQYA 3D75A 5K89A 1F4OA 1KFUL 5I94A 1K94A 2FCDA 5HKYA 1JWDA 3TDZA 2WCMA 1DQEA 1YUUA 1C07A 4OKHA 3ZNIA 5PALA 1JUOA 2PASA 3RZSA 2OTGC 4PE7A 5KSZA 2Q91A 5HKWA 1N65A 2P71A 2JT3A 1DJYA 1TUZA 5AERA 5HLVA 4CLNA 2Y1NA 1SL9A 1JF2A 3A4UB 4M2OA 1SMGA 1PSRA 3FWCA 3JVTC 2WCFA 1ODBA 4MRYA 2Y5IA 4GAOA 2M1UA 3WHUB 2QPTA 2KI4C 3CABA 1SYMA 5F6TA 1J1DA 2H61C 1H4BA 2F33A 2KFGA 1XK4C 1XFWO 5DKNA 4OV2A 2FJUB 2QDIA 2DOQA 1IH0A 5ER4X 3JVTB 1F71A 3UNWA 1RK9A 1TNXA 5TNCA 1KSMA 2LAPA 1K9UA 1BJFA 1CMGA 3BYAA 1IRJA 1RECA 2WCKA 4C0KA 3DVKA 4CFRA 2KYCA 2LUCA 4PE4A 3K21A 5I2QA 1DGVA 2LHLA 2QEBA 3N7HA 2K8MB 3DXLA 3KHEA 1PRWA 2L0PA 2M29A 1TWOA 2CNPA 4YI8A 2AUCA 1DJGA 1S6IA 1T14A 2K60A 3KEVA 4QJ3B 3S0FA 1CMFA 1B7TZ 3DVJA 3CTNA 1QATA 4ZCUA 5JJGA 1RFJA 2PSRA 1OZSA 2WNDA 2FJYA 2WCBA 3PSRA 1SL8A
chains in the Genus database with same CATH topology
2ISDA 1NCZA 2LM5A 2MAZA 1IQ3A 1CLLA 2CCMA 3GOFA 1J7RA 1QV0A 4YGDB 1K90D 1S1EA 2EC6B 1FI6A 2LV7A 1YX7A 1EG3A 4WRIA 4DS7A 4UPGA 4MN0A 1AK8A 1NIWA 1J7QA 2LVIA 4F0ZB 3IQOA 2E30A 3KO0A 1CNPA 1S6CA 2JRFA 1TNPA 4P2YB 2FCEA 1SPYA 2MHHA 1K95A 1EH2A 4IL1A 4GPLB 1S6JA 1KFXL 1L2OC 1MUXA 2LVJA 3QRXA 2BCAA 4GBAA 5CSNA 5GQQC 1VRKA 4MSPA 3I5HC 1DJWA 2MA2A 3PFVA 2KAVA 3VRPA 2FOTA 3F45A 1ZUZA 2M49B 4NDCA 4DIRA 1NSHA 2JOJA 4A4CA 1A75A 1XFYO 2JPTA 3BUWB 1NX1A 4HREE 1Y1UA 1QXPA 5HYDA 1FPWA 2F3ZA 2M8UA 1C7VA 1SK6D 4JQ0D 1OMRA 2D8NA 2EHBA 5AANA 2TN4A 1EJ3A 4A4BA 2LC5A 3BOWB 1F54A 1N2DA 3AAKA 2GV5A 1QJTA 2LP2A 4NDBA 2M7NA 4GUKA 4FQOA 3C1VA 3CGAA 2SCPA 1KFXS 3VRQA 4ORCB 2COLB 1DJIA 1U5IA 3TZ1A 3SJSA 4ETOA 4MZLA 1K96A 1TIZA 3O78A 1QLKA 3SG7A 3EVUA 1KCYA 1QX5B 2F8PA 2MLFC 2L98A 2BL0B 3HCMA 1TOPA 1LXFC 1YX8A 3SIBA 1CLBA 1CB1A 1CDLA 1V1GA 3VRNA 4TNCA 1X02A 4MRXA 1UWOA 1F8HA 2VRGA 1SNLA 5I8NA 2O60A 2PRUA 4XJKB 2BCXA 5CSIA 1GQMA 1HQVA 1GJYA 4MZJA 1IQ5A 1XA5A 2CBLA 2A4JA 2RGIA 2ZFDA 2IS9A 5JOLA 3NSLA 2LE9B 1K9KA 1KQMB 1LA3A 3PALA 1SCVA 2L4IA 2PALA 4QJ4B 1FI5A 1WDCC 1YVHA 2KAYA 3O2PA 4YGCB 1D1OA 1XFVO 3EK4A 3DD4A 3TDIA 1PSBA 3LK0A 3AAJA 1Q80A 1XFXO 1KWOB 2KHNA 1TNWA 1JSAA 4OCIA 1KQVA 1ZFSA 4WQ3A 5B8IB 4YGAA 1XYDA 3DVEA 2K7CA 3PN7C 2KGRA 1NUBA 4M2PA 1OOJA 2HQWA 1F70A 4OR9B 1B7TY 2G9BA 3DF0B 3BXKA 1IKUA 2NLNA 1DVIA 4DRWA 1RWYA 2KGBC 3VROA 4JPZB 4C0LA 2JNFA 1WY9A 1DT7B 3JTDC 4PHKA 1ZOTB 2CT9A 2OTGB 3NSIA 2KI6D 2JQ6A 1OMVA 3BUXB 3HX4A 1UHJA 2O5GA 3H4SE 4PHMA 4YBHB 1DF0A 2L50A 4GGFC 1NP8A 1YR5A 2K7BA 1LA0A 1SY9A 3VGOA 2LCPA 2BCBA 3TS5C 2F2PA 1J7OA 4AQJA 4PCWA 2LLTA 1DJZA 2KAXA 3ICBA 2JC2A 3KF9A 1J1EA 2KI4B 3SG4A 1OSAA 4ICBA 1S26D 2BBMA 2P6BB 1ALWA 3CWGA 1NX3A 4HRGA 1SR6C 3NXAA 4N1FA 1QVIY 1AJ5A 3I5FC 1K93D 1K8UA 5ER5A 1NCXA 3AKBA 3WXAA 1UHKA 1AVSA 3BQ3A 1SCMC 1RTP1 1M39A 4CFQA 1PALA 2K2AA 4JWQA 1CDMA 3NSKA 1CDPA 2KFFA 1DJHA 2PVBA 5D7FA 1QX7A 3TUYC 3WNXB 2NCPA 1PULA 4XYNA 2EGDA 3BUOB 1IWQA 1QX2A 1R2UA 1DF0B 2PMYA 3RM1A 2QACA 2ZN8A 3OB2B 3ZWHA 2L5XB 4L9MA 1TRFA 2JU0A 1ZMZA 3BOWA 4I5LB 2WCEA 4ORAB 1UHNA 4MZKA 3TUYB 1QVIZ 4HRHA 3IQQA 4MVFA 2K2FA 1FBVA 5AFPA 5KU1A 4GNKB 3FS7A 3EVRA 4ORBB 1IJ5A 4BY4A 1CDNA 4OVNF 2BE6A 1L2OB 2BBNA 3I5IC 4E68A 3EK7A 2ZKMX 1B8CA 1HT9A 2K61A 3I5HB 2ZRTA 1N0YA 3FWBA 4USLA 3O4YA 1B4CA 3FIAA 4XJKA 1F55A 4YGBB 4NDDA 2JULA 1S3PA 1BOCA 4DUQA 1JBAA 2I94A 1R6PA 3OHMB 1YUSA 1B8LA 1BT6A 2KOTA 1M45A 5J3XA 4QJ5B 1UP5A 1TN4A 5I2LA 1BF5A 1XFZO 1BR4B 4N5XA 1XVJA 2K0JA 3TDUA 3WHTB 1C7WA 4C0JA 2M3WA 2SASA 3PLFB 1DJXA 1CTRA 1MWNA 1QIWA 1CKKA 2M9GA 2MRDA 5DKRA 3SIAA 1J7PA 2LLUA 5CSFA 4BY5A 2LUXA 3NSOA 1Y1XA 1CM1A 1WRKA 3I5GC 1Y1AA 3D10A 2NCOA 3DF0A 1QASA 2HQ8A 2JZIA 3CR4X 4PE0A 1LKJA 2KBMA 3MSEB 1NPQA 2ZNEA 2ZNDA 2AAOA 3CR5X 5G08A 2JWWA 5FYXA 1G33A 1QLSA 4YI9A 1LVCD 1S5GZ 1A2XA 2M97A 1SRAA 1IJ6A 2L4HA 1Y0VH 2K7OA 1WRZA 3BUNB 1NX0A 1WRLA 4GGNA 4YRUA 1DGUA 1YTZC 3D0YB 1UHIA 1G4YR 2WC8A 3GK1A 2KQ6A 1XFUO 1IG5A 4HSZA 2H61A 1MXLC 1WDCB 4PHJA 1MF8B 1XK4A 3O6BA 1WLZA 3PATA 1OQPA 1OE9B 2MLEC 1TNQA 1BG1A 5CSJA 1CFPA 2CTNA 2JXCA 1JF0A 1IGVA 3PN7B 4I5NB 3OB1B 2L2EA 2KFHA 5AEQA 2LMVA 3CS1A 2KI6C 4WQ2A 2LP3A 2Q4UA 2I18A 3PM8A 2MBXA 2HETA 3JTDB 2ZN9A 2KDHA 1Y6WA 3OP0A 4NQGA 5DKQA 3CLNA 2I2RE 2JTZA 1L7ZA 1YRTB 2KSPA 3GK2A 1QV1A 2Y1MA 4FTGA 1BLQA 1UHHA 3TS5B 1TCFA 3LLEA 2F3YA 5CPVA 1NWDA 1MXEA 3OX6A 2BKIB 3AKAA 4D1EA 1KFUS 2KBIA 2F2OA 1OZOA 1WLMA 2B1UA 5AXIA 1SR6B 2NZ0A 3DVMA 2V53A 3I5FB 3M0WA 1FF1A 1V1FA 2CXJA 2OS8C 1SKTA 2Y4QA 5D69A 1SCMB 1FW4A 3OX5A 2LANA 2L51A 1BODA 3LK1A 1CFFA 2HF5A 3EVVA 2JTTA 3BUMB 1ALVA 1RROA 3SG5A 1AHRA 2EC6C 2M1KB 1M31A 1UURA 2OS8B 1KSOA 1SBJA 2GGZA 2LNKA 4PDZA 5KTYA 1A03A 1B8RA 2BECA 1DTLA 2LVVA 2KYFA 1F4QA 1CM4A 2WORA 1AJ4A 3EK8A 4GFTA 4M2QA 1K9PA 4PHNA 2KNEA 3KPXA 1E8AA 1KK7Y 2LVKA 2I7AA 3SG3A 1EG4A 2H2KA 1M46A 1G8IA 1PVBA 3VRRA 1CLMA 1A29A 4I5JA 1AUIB 2R2IA 1NCYA 2G2BA 5IBWA 2LLSA 2WOSA 1JFJA 2M0RA 3CZTX 1QS7A 1SW8A 4ZCVA 1XO5A 1EL4A 2M7LA 1MR8A 3I5IB 2BKHB 4DCKA 2NXQA 4AOMA 1H8BA 5BPJA 4Q04A 3GK4X 2AMIA 2GGMA 1S5GY 1ZACA 1W7JB 2LMUA 4MEWA 2E6WA 1B9AA 1SL7A 1S36A 1CFCA 1BR1B 4U8DA 1NX2A 1KK7Z 4N1GA 3D0YA 1JC2A 4P5OE 4PALA 5I2OA 1YRUB 2BL0C 2JT0A 1OMDA 1MHOA 2K7DA 1EXRA 3RLZA 2LMTA 3EKJA 1AP4A 1B1GA 4MBEA 4AQIA 3SG2A 1CFDA 1J55A 2BE4A 2JNXA 4I5KA 2ZRSA 1A75B 1YURA 1K2HA 1M63B 1GGWA 1A4PA 1YVLA 4CPVA 4YGEB 4MLWA 1RJVA 2JXLA 5HKZA 1LINA 3LL8B 2MJWB 3LCPC 1PVAA 1DMOA 3I5GB 2LHIA 4R1EA 1TCOB 4PE1A 3A8RA 2OPOA 4CIDA 1GGZA 1KQMC 1YUTA 1TTXA 1PK0D 1KK8C 3EKHA 3CR2A 1U5IB 3IF7A 1UUSA 5HLOA 1BU3A 1NYAA 4GGFA 1KWOC 1W7IB 3SG6A 1QTXA 3E3RA 1B47A 1QIVA 1BMOA 1JFKA 1KK8B 1MQ1A 2HPSA 2JT8A 2KQYA 5K89A 1F4OA 1KFUL 1K94A 2FCDA 5HKYA 1JWDA 3TDZA 1YUUA 1C07A 4OKHA 3ZNIA 5PALA 1JUOA 2PASA 2OTGC 4PE7A 5KSZA 2Q91A 5HKWA 1N65A 2JT3A 1DJYA 5AERA 5HLVA 4CLNA 2Y1NA 1SL9A 1JF2A 3A4UB 4M2OA 1SMGA 1PSRA 3FWCA 3JVTC 2WCFA 1ODBA 4MRYA 2Y5IA 4GAOA 2M1UA 3WHUB 2QPTA 2KI4C 1SYMA 5F6TA 1J1DA 2H61C 1H4BA 2F33A 2KFGA 1XK4C 1XFWO 5DKNA 4OV2A 2FJUB 2DOQA 1IH0A 5ER4X 3JVTB 1F71A 1RK9A 1TNXA 5TNCA 1KSMA 2LAPA 1K9UA 1BJFA 1CMGA 3BYAA 1IRJA 1RECA 4C0KA 3DVKA 4CFRA 2KYCA 2LUCA 4PE4A 3K21A 5I2QA 1DGVA 2LHLA 2K8MB 3KHEA 1PRWA 2L0PA 2M29A 2CNPA 4YI8A 2AUCA 1DJGA 1S6IA 3KEVA 1CMFA 4QJ3B 1B7TZ 3DVJA 3CTNA 1QATA 4ZCUA 5JJGA 1RFJA 2PSRA 1OZSA 2WNDA 2WCBA 3PSRA 1SL8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ISD A;  1NCZ A;  2LM5 A;  2MAZ A;  1IQ3 A;  1CLL A;  2CCM A;  3GOF A;  1J7R A;  1QV0 A;  4YGD B;  1K90 D;  1S1E A;  2EC6 B;  1FI6 A;  2LV7 A;  1YX7 A;  1EG3 A;  4WRI A;  4DS7 A;  4UPG A;  4MN0 A;  1AK8 A;  1NIW A;  1J7Q A;  2LVI A;  4F0Z B;  3IQO A;  2E30 A;  3KO0 A;  1CNP A;  1S6C A;  2JRF A;  1TNP A;  4P2Y B;  2FCE A;  1SPY A;  2MHH A;  1K95 A;  1EH2 A;  4IL1 A;  4GPL B;  1S6J A;  1KFX L;  1L2O C;  1MUX A;  2LVJ A;  3QRX A;  2BCA A;  4GBA A;  5CSN A;  5GQQ C;  1VRK A;  4MSP A;  3I5H C;  1DJW A;  2MA2 A;  3PFV A;  2KAV A;  3VRP A;  2FOT A;  3F45 A;  1ZUZ A;  2M49 B;  4NDC A;  4DIR A;  1NSH A;  2JOJ A;  4A4C A;  1A75 A;  1XFY O;  2JPT A;  3BUW B;  1NX1 A;  4HRE E;  1Y1U A;  1QXP A;  5HYD A;  1FPW A;  2F3Z A;  2M8U A;  1C7V A;  1SK6 D;  4JQ0 D;  1OMR A;  2D8N A;  2EHB A;  5AAN A;  2TN4 A;  1EJ3 A;  4A4B A;  2LC5 A;  3BOW B;  1F54 A;  1N2D A;  3AAK A;  2GV5 A;  1QJT A;  2LP2 A;  4NDB A;  2M7N A;  4GUK A;  4FQO A;  3C1V A;  3CGA A;  2SCP A;  1KFX S;  3VRQ A;  4ORC B;  2COL B;  1DJI A;  1U5I A;  3TZ1 A;  3SJS A;  4ETO A;  4MZL A;  1K96 A;  1TIZ A;  3O78 A;  1QLK A;  3SG7 A;  3EVU A;  1KCY A;  1QX5 B;  2F8P A;  2MLF C;  2L98 A;  2BL0 B;  3HCM A;  1TOP A;  1LXF C;  1YX8 A;  3SIB A;  1CLB A;  1CB1 A;  1CDL A;  1V1G A;  3VRN A;  4TNC A;  1X02 A;  4MRX A;  1UWO A;  1F8H A;  2VRG A;  1SNL A;  5I8N A;  2O60 A;  2PRU A;  4XJK B;  2BCX A;  5CSI A;  1GQM A;  1HQV A;  1GJY A;  4MZJ A;  1IQ5 A;  1XA5 A;  2CBL A;  2A4J A;  2RGI A;  2ZFD A;  2IS9 A;  5JOL A;  3NSL A;  2LE9 B;  1K9K A;  1KQM B;  1LA3 A;  3PAL A;  1SCV A;  2L4I A;  2PAL A;  4QJ4 B;  1FI5 A;  1WDC C;  1YVH A;  2KAY A;  3O2P A;  4YGC B;  1D1O A;  1XFV O;  3EK4 A;  3DD4 A;  3TDI A;  1PSB A;  3LK0 A;  3AAJ A;  1Q80 A;  1XFX O;  1KWO B;  2KHN A;  1TNW A;  1JSA A;  4OCI A;  1KQV A;  1ZFS A;  4WQ3 A;  5B8I B;  4YGA A;  1XYD A;  3DVE A;  2K7C A;  3PN7 C;  2KGR A;  1NUB A;  4M2P A;  1OOJ A;  2HQW A;  1F70 A;  4OR9 B;  1B7T Y;  2G9B A;  3DF0 B;  3BXK A;  1IKU A;  2NLN A;  1DVI A;  4DRW A;  1RWY A;  2KGB C;  3VRO A;  4JPZ B;  4C0L A;  2JNF A;  1WY9 A;  1DT7 B;  3JTD C;  4PHK A;  1ZOT B;  2CT9 A;  2OTG B;  3NSI A;  2KI6 D;  2JQ6 A;  1OMV A;  3BUX B;  3HX4 A;  1UHJ A;  2O5G A;  3H4S E;  4PHM A;  4YBH B;  1DF0 A;  2L50 A;  4GGF C;  1NP8 A;  1YR5 A;  2K7B A;  1LA0 A;  1SY9 A;  3VGO A;  2LCP A;  2BCB A;  3TS5 C;  2F2P A;  1J7O A;  4AQJ A;  4PCW A;  2LLT A;  1DJZ A;  2KAX A;  3ICB A;  2JC2 A;  3KF9 A;  1J1E A;  2KI4 B;  3SG4 A;  1OSA A;  4ICB A;  1S26 D;  2BBM A;  2P6B B;  1ALW A;  3CWG A;  1NX3 A;  4HRG A;  1SR6 C;  3NXA A;  4N1F A;  1QVI Y;  1AJ5 A;  3I5F C;  1K93 D;  1K8U A;  5ER5 A;  1NCX A;  3AKB A;  3WXA A;  1UHK A;  1AVS A;  3BQ3 A;  1SCM C;  1RTP 1;  1M39 A;  4CFQ A;  1PAL A;  2K2A A;  4JWQ A;  1CDM A;  3NSK A;  1CDP A;  2KFF A;  1DJH A;  2PVB A;  5D7F A;  1QX7 A;  3TUY C;  3WNX B;  2NCP A;  1PUL A;  4XYN A;  2EGD A;  3BUO B;  1IWQ A;  1QX2 A;  1R2U A;  1DF0 B;  2PMY A;  3RM1 A;  2QAC A;  2ZN8 A;  3OB2 B;  3ZWH A;  2L5X B;  4L9M A;  1TRF A;  2JU0 A;  1ZMZ A;  3BOW A;  4I5L B;  2WCE A;  4ORA B;  1UHN A;  4MZK A;  3TUY B;  1QVI Z;  4HRH A;  3IQQ A;  4MVF A;  2K2F A;  1FBV A;  5AFP A;  5KU1 A;  4GNK B;  3FS7 A;  3EVR A;  4ORB B;  1IJ5 A;  4BY4 A;  1CDN A;  4OVN F;  2BE6 A;  1L2O B;  2BBN A;  3I5I C;  4E68 A;  3EK7 A;  2ZKM X;  1B8C A;  1HT9 A;  2K61 A;  3I5H B;  2ZRT A;  1N0Y A;  3FWB A;  4USL A;  3O4Y A;  1B4C A;  3FIA A;  4XJK A;  1F55 A;  4YGB B;  4NDD A;  2JUL A;  1S3P A;  1BOC A;  4DUQ A;  1JBA A;  2I94 A;  1R6P A;  3OHM B;  1YUS A;  1B8L A;  1BT6 A;  2KOT A;  1M45 A;  5J3X A;  4QJ5 B;  1UP5 A;  1TN4 A;  5I2L A;  1BF5 A;  1XFZ O;  1BR4 B;  4N5X A;  1XVJ A;  2K0J A;  3TDU A;  3WHT B;  1C7W A;  4C0J A;  2M3W A;  2SAS A;  3PLF B;  1DJX A;  1CTR A;  1MWN A;  1QIW A;  1CKK A;  2M9G A;  2MRD A;  5DKR A;  3SIA A;  1J7P A;  2LLU A;  5CSF A;  4BY5 A;  2LUX A;  3NSO A;  1Y1X A;  1CM1 A;  1WRK A;  3I5G C;  1Y1A A;  3D10 A;  2NCO A;  3DF0 A;  1QAS A;  2HQ8 A;  2JZI A;  3CR4 X;  4PE0 A;  1LKJ A;  2KBM A;  3MSE B;  1NPQ A;  2ZNE A;  2ZND A;  2AAO A;  3CR5 X;  5G08 A;  2JWW A;  5FYX A;  1G33 A;  1QLS A;  4YI9 A;  1LVC D;  1S5G Z;  1A2X A;  2M97 A;  1SRA A;  1IJ6 A;  2L4H A;  1Y0V H;  2K7O A;  1WRZ A;  3BUN B;  1NX0 A;  1WRL A;  4GGN A;  4YRU A;  1DGU A;  1YTZ C;  3D0Y B;  1UHI A;  1G4Y R;  2WC8 A;  3GK1 A;  2KQ6 A;  1XFU O;  1IG5 A;  4HSZ A;  2H61 A;  1MXL C;  1WDC B;  4PHJ A;  1MF8 B;  1XK4 A;  3O6B A;  1WLZ A;  3PAT A;  1OQP A;  1OE9 B;  2MLE C;  1TNQ A;  1BG1 A;  5CSJ A;  1CFP A;  2CTN A;  2JXC A;  1JF0 A;  1IGV A;  3PN7 B;  4I5N B;  3OB1 B;  2L2E A;  2KFH A;  5AEQ A;  2LMV A;  3CS1 A;  2KI6 C;  4WQ2 A;  2LP3 A;  2Q4U A;  2I18 A;  3PM8 A;  2MBX A;  2HET A;  3JTD B;  2ZN9 A;  2KDH A;  1Y6W A;  3OP0 A;  4NQG A;  5DKQ A;  3CLN A;  2I2R E;  2JTZ A;  1L7Z A;  1YRT B;  2KSP A;  3GK2 A;  1QV1 A;  2Y1M A;  4FTG A;  1BLQ A;  1UHH A;  3TS5 B;  1TCF A;  3LLE A;  2F3Y A;  5CPV A;  1NWD A;  1MXE A;  3OX6 A;  2BKI B;  3AKA A;  4D1E A;  1KFU S;  2KBI A;  2F2O A;  1OZO A;  1WLM A;  2B1U A;  5AXI A;  1SR6 B;  2NZ0 A;  3DVM A;  2V53 A;  3I5F B;  3M0W A;  1FF1 A;  1V1F A;  2CXJ A;  2OS8 C;  1SKT A;  2Y4Q A;  5D69 A;  1SCM B;  1FW4 A;  3OX5 A;  2LAN A;  2L51 A;  1BOD A;  3LK1 A;  1CFF A;  2HF5 A;  3EVV A;  2JTT A;  3BUM B;  1ALV A;  1RRO A;  3SG5 A;  1AHR A;  2EC6 C;  2M1K B;  1M31 A;  1UUR A;  2OS8 B;  1KSO A;  1SBJ A;  2GGZ A;  2LNK A;  4PDZ A;  5KTY A;  1A03 A;  1B8R A;  2BEC A;  1DTL A;  2LVV A;  2KYF A;  1F4Q A;  1CM4 A;  2WOR A;  1AJ4 A;  3EK8 A;  4GFT A;  4M2Q A;  1K9P A;  4PHN A;  2KNE A;  3KPX A;  1E8A A;  1KK7 Y;  2LVK A;  2I7A A;  3SG3 A;  1EG4 A;  2H2K A;  1M46 A;  1G8I A;  1PVB A;  3VRR A;  1CLM A;  1A29 A;  4I5J A;  1AUI B;  2R2I A;  1NCY A;  2G2B A;  5IBW A;  2LLS A;  2WOS A;  1JFJ A;  2M0R A;  3CZT X;  1QS7 A;  1SW8 A;  4ZCV A;  1XO5 A;  1EL4 A;  2M7L A;  1MR8 A;  3I5I B;  2BKH B;  4DCK A;  2NXQ A;  4AOM A;  1H8B A;  5BPJ A;  4Q04 A;  3GK4 X;  2AMI A;  2GGM A;  1S5G Y;  1ZAC A;  1W7J B;  2LMU A;  4MEW A;  2E6W A;  1B9A A;  1SL7 A;  1S36 A;  1CFC A;  1BR1 B;  4U8D A;  1NX2 A;  1KK7 Z;  4N1G A;  3D0Y A;  1JC2 A;  4P5O E;  4PAL A;  5I2O A;  1YRU B;  2BL0 C;  2JT0 A;  1OMD A;  1MHO A;  2K7D A;  1EXR A;  3RLZ A;  2LMT A;  3EKJ A;  1AP4 A;  1B1G A;  4MBE A;  4AQI A;  3SG2 A;  1CFD A;  1J55 A;  2BE4 A;  2JNX A;  4I5K A;  2ZRS A;  1A75 B;  1YUR A;  1K2H A;  1M63 B;  1GGW A;  1A4P A;  1YVL A;  4CPV A;  4YGE B;  4MLW A;  1RJV A;  2JXL A;  5HKZ A;  1LIN A;  3LL8 B;  2MJW B;  3LCP C;  1PVA A;  1DMO A;  3I5G B;  2LHI A;  4R1E A;  1TCO B;  4PE1 A;  3A8R A;  2OPO A;  4CID A;  1GGZ A;  1KQM C;  1YUT A;  1TTX A;  1PK0 D;  1KK8 C;  3EKH A;  3CR2 A;  1U5I B;  3IF7 A;  1UUS A;  5HLO A;  1BU3 A;  1NYA A;  4GGF A;  1KWO C;  1W7I B;  3SG6 A;  1QTX A;  3E3R A;  1B47 A;  1QIV A;  1BMO A;  1JFK A;  1KK8 B;  1MQ1 A;  2HPS A;  2JT8 A;  2KQY A;  5K89 A;  1F4O A;  1KFU L;  1K94 A;  2FCD A;  5HKY A;  1JWD A;  3TDZ A;  1YUU A;  1C07 A;  4OKH A;  3ZNI A;  5PAL A;  1JUO A;  2PAS A;  2OTG C;  4PE7 A;  5KSZ A;  2Q91 A;  5HKW A;  1N65 A;  2JT3 A;  1DJY A;  5AER A;  5HLV A;  4CLN A;  2Y1N A;  1SL9 A;  1JF2 A;  3A4U B;  4M2O A;  1SMG A;  1PSR A;  3FWC A;  3JVT C;  2WCF A;  1ODB A;  4MRY A;  2Y5I A;  4GAO A;  2M1U A;  3WHU B;  2QPT A;  2KI4 C;  1SYM A;  5F6T A;  1J1D A;  2H61 C;  1H4B A;  2F33 A;  2KFG A;  1XK4 C;  1XFW O;  5DKN A;  4OV2 A;  2FJU B;  2DOQ A;  1IH0 A;  5ER4 X;  3JVT B;  1F71 A;  1RK9 A;  1TNX A;  5TNC A;  1KSM A;  2LAP A;  1K9U A;  1BJF A;  1CMG A;  3BYA A;  1IRJ A;  1REC A;  4C0K A;  3DVK A;  4CFR A;  2KYC A;  2LUC A;  4PE4 A;  3K21 A;  5I2Q A;  1DGV A;  2LHL A;  2K8M B;  3KHE A;  1PRW A;  2L0P A;  2M29 A;  2CNP A;  4YI8 A;  2AUC A;  1DJG A;  1S6I A;  3KEV A;  1CMF A;  4QJ3 B;  1B7T Z;  3DVJ A;  3CTN A;  1QAT A;  4ZCU A;  5JJG A;  1RFJ A;  2PSR A;  1OZS A;  2WND A;  2WCB A;  3PSR A;  1SL8 A; 
#chains in the Genus database with same CATH topology
 2ISD A;  1NCZ A;  3S0A A;  2LM5 A;  4FQT A;  2MAZ A;  1IQ3 A;  1CLL A;  2CCM A;  3GOF A;  1J7R A;  1QV0 A;  4YGD B;  1K90 D;  1S1E A;  2EC6 B;  4IJ7 A;  1FI6 A;  2LV7 A;  1YX7 A;  1EG3 A;  4WRI A;  4DS7 A;  4UPG A;  4MN0 A;  1AK8 A;  1NIW A;  1J7Q A;  2LVI A;  4F0Z B;  3BFA A;  3IQO A;  2E30 A;  3KO0 A;  1CNP A;  1S6C A;  2JRF A;  1TNP A;  4P2Y B;  2FCE A;  1SPY A;  3IVT A;  2MHH A;  1K95 A;  1EH2 A;  3K1E A;  4GPL B;  4IL1 A;  1S6J A;  1KFX L;  1L2O C;  1MUX A;  2LVJ A;  3QRX A;  2BCA A;  3OBV A;  4GBA A;  5CSN A;  5GQQ C;  1VRK A;  4MSP A;  1DC1 A;  3I5H C;  1DJW A;  2MA2 A;  3PFV A;  2KAV A;  3VRP A;  2FOT A;  3F45 A;  1ZUZ A;  2M49 B;  4NDC A;  4DIR A;  1NSH A;  1OW4 A;  2JOJ A;  3CYZ A;  4A4C A;  1A75 A;  1XFY O;  3BJH A;  2JPT A;  3BUW B;  1NX1 A;  3EG5 B;  4HRE E;  3CZ2 A;  1Y1U A;  1QXP A;  5HYD A;  1FPW A;  2F3Z A;  2M8U A;  1C7V A;  1SK6 D;  3VB1 A;  4JQ0 D;  1OMR A;  2D8N A;  2EHB A;  5AAN A;  2TN4 A;  1EJ3 A;  3B6X A;  4A4B A;  2LC5 A;  3BOW B;  1F54 A;  1N2D A;  2KLE A;  3AAK A;  2GV5 A;  1QJT A;  2LP2 A;  4NDB A;  2M7N A;  4GUK A;  4FQO A;  3S0D A;  3C1V A;  3CGA A;  2SCP A;  1KFX S;  3VRQ A;  4ORC B;  2COL B;  1DJI A;  1U5I A;  3TZ1 A;  3SJS A;  2KLD A;  4ETO A;  4MZL A;  1K96 A;  1TIZ A;  3O78 A;  1QLK A;  3DYE A;  3EVU A;  3SG7 A;  1KCY A;  1QX5 B;  2F8P A;  2MLF C;  2L98 A;  2BL0 B;  3HCM A;  1TOP A;  1LXF C;  1YX8 A;  3SIB A;  5HL1 A;  1CLB A;  4INX A;  1CDL A;  1CB1 A;  1V1G A;  5EL2 A;  3B88 A;  3VRN A;  2WCJ A;  4TNC A;  3B86 A;  1X02 A;  4MRX A;  1UWO A;  1F8H A;  2VRG A;  2H8V A;  1SNL A;  5I8N A;  2O60 A;  2PRU A;  4XJK B;  1OOG A;  2BCX A;  3R72 A;  5CSI A;  1GQM A;  1HQV A;  1GJY A;  4MZJ A;  1IQ5 A;  1XA5 A;  2CBL A;  3L4A A;  3CZ0 A;  3FE8 A;  2A4J A;  2RGI A;  2ZFD A;  2IS9 A;  5JOL A;  3NSL A;  2LE9 B;  1K9K A;  1KQM B;  1OOF A;  1LA3 A;  3PAL A;  1SCV A;  2L4I A;  2PAL A;  4QJ4 B;  1FI5 A;  1QWV A;  1WDC C;  1YVH A;  2KAY A;  3O2P A;  4YGC B;  1D1O A;  1XFV O;  3EK4 A;  3DD4 A;  3TDI A;  1PSB A;  3LK0 A;  3AAJ A;  1Q80 A;  1XFX O;  1KWO B;  2KHN A;  1TNW A;  1JSA A;  4OCI A;  1KQV A;  1ZFS A;  4WQ3 A;  5B8I B;  4YGA A;  1XYD A;  3DVE A;  2K7C A;  3PN7 C;  2KGR A;  1NUB A;  4M2P A;  1OOJ A;  2HQW A;  1F70 A;  2L2C A;  4OR9 B;  1B7T Y;  2G9B A;  3DF0 B;  3BXK A;  1IKU A;  2NLN A;  1DVI A;  4DRW A;  3NHI A;  1RWY A;  2KGB C;  3VRO A;  4JPZ B;  4C0L A;  2JNF A;  1WY9 A;  1DT7 B;  3JTD C;  4PHK A;  1ZOT B;  2CT9 A;  2OTG B;  3NSI A;  2KI6 D;  2JQ6 A;  1OMV A;  3BUX B;  3HX4 A;  1UHJ A;  2O5G A;  3H4S E;  1GM0 A;  1Z2C B;  4PHM A;  4YBH B;  1DF0 A;  2L50 A;  4GGF C;  1NP8 A;  1YR5 A;  2K7B A;  1LA0 A;  1SY9 A;  3VGO A;  3D73 A;  3B7A A;  2LCP A;  2BCB A;  3OGN A;  3TS5 C;  2F2P A;  1J7O A;  4AQJ A;  4PCW A;  2LLT A;  1DJZ A;  2KAX A;  3ICB A;  2JC2 A;  3KF9 A;  1J1E A;  2KI4 B;  3DZT A;  1OSA A;  4ICB A;  3SG4 A;  1S26 D;  2BBM A;  2P6B B;  1ALW A;  3CWG A;  1NX3 A;  4HRG A;  1SR6 C;  2JPO A;  3NXA A;  4N1F A;  1QVI Y;  1AJ5 A;  3I5F C;  3UO9 A;  1K93 D;  1K8U A;  5ER5 A;  1NCX A;  3AKB A;  3WXA A;  1UHK A;  1AVS A;  3BQ3 A;  1SCM C;  1RTP 1;  1M39 A;  4CFQ A;  1PAL A;  2K2A A;  4JWQ A;  1CDM A;  3NSK A;  3PJI A;  1ORG A;  1CDP A;  2KFF A;  1DJH A;  3R1P A;  2PVB A;  5D7F A;  5D3O A;  1QX7 A;  3TUY C;  2PQL A;  3WNX B;  2NCP A;  1PUL A;  4XYN A;  2EGD A;  3BUO B;  1IWQ A;  1QX2 A;  1R2U A;  1DF0 B;  2PMY A;  3RM1 A;  2QAC A;  2ZN8 A;  3OB2 B;  3ZWH A;  2L5X B;  4L9M A;  1TRF A;  2JU0 A;  1ZMZ A;  3BOW A;  3NHT A;  2WCE A;  4I5L B;  3B87 A;  4ORA B;  1UHN A;  4MZK A;  3TUY B;  1QVI Z;  4HRH A;  3IQQ A;  3QME A;  4MVF A;  2K2F A;  1FBV A;  5AFP A;  5KU1 A;  4GNK B;  3FS7 A;  3EVR A;  4ORB B;  1TUJ A;  1IJ5 A;  4BY4 A;  1CDN A;  3V2L A;  4OVN F;  2BE6 A;  1L2O B;  2BBN A;  3DY9 A;  3I5I C;  4E68 A;  3L47 A;  3EK7 A;  2ZKM X;  1B8C A;  1HT9 A;  2K61 A;  3I5H B;  2ZRT A;  1N0Y A;  3FWB A;  4USL A;  3O4Y A;  1B4C A;  3FIA A;  4XJK A;  1F55 A;  4YGB B;  4NDD A;  2JUL A;  1S3P A;  1BOC A;  4DUQ A;  1JBA A;  2I94 A;  1R6P A;  3OHM B;  1YUS A;  1B8L A;  1BT6 A;  2KOT A;  1M45 A;  5J3X A;  4QJ5 B;  1UP5 A;  1TN4 A;  5I2L A;  1BF5 A;  5FI6 A;  1XFZ O;  1BR4 B;  4N5X A;  3CZ1 A;  1XVJ A;  2K0J A;  3TDU A;  3WHT B;  1C7W A;  1W9Z A;  4C0J A;  2M3W A;  2SAS A;  3PLF B;  1DJX A;  2BAP A;  2L5Y A;  1CTR A;  1MWN A;  4F7F A;  1QIW A;  1CKK A;  2M9G A;  2MRD A;  5DKR A;  2WCL A;  3SIA A;  3NGV A;  1J7P A;  2LLU A;  5CSF A;  4BY5 A;  2LUX A;  3NSO A;  1Y1X A;  1CM1 A;  1WRK A;  3I5G C;  1Y1A A;  3D10 A;  2NCO A;  3DF0 A;  1QAS A;  1SSE B;  2HQ8 A;  3R1O A;  2JZI A;  1C3Y A;  3CR4 X;  4PE0 A;  1LKJ A;  2KBM A;  3MSE B;  3S0E A;  1NPQ A;  2ZNE A;  2ZND A;  2AAO A;  3CR5 X;  5G08 A;  2JWW A;  3CDN A;  1G33 A;  1QLS A;  5FYX A;  4YI9 A;  1LVC D;  1S5G Z;  2KPH A;  4KYN A;  1A2X A;  2M97 A;  1SRA A;  1IJ6 A;  2L4H A;  1Y0V H;  2K7O A;  1P28 A;  1WRZ A;  3BUN B;  1NX0 A;  1WRL A;  4GGN A;  4YRU A;  1DGU A;  1YTZ C;  2QEV A;  1UHI A;  3D0Y B;  1G4Y R;  2WC8 A;  3FE9 A;  3GK1 A;  4INW A;  2KQ6 A;  1XFU O;  1IG5 A;  4HSZ A;  3PM2 A;  3L4L A;  2H61 A;  1MXL C;  1WDC B;  4PHJ A;  1DEK A;  1MF8 B;  1XK4 A;  3O4X A;  5FI7 A;  3O6B A;  3S0B A;  1WLZ A;  3PAT A;  1OQP A;  1OE9 B;  2MLE C;  1TNQ A;  1BG1 A;  5CSJ A;  1CFP A;  2CTN A;  2JXC A;  1JF0 A;  1IGV A;  3PN7 B;  4I5N B;  1OOI X;  2BNX A;  3OB1 B;  2L2E A;  2KFH A;  5AEQ A;  2LMV A;  3CS1 A;  2KI6 C;  4WQ2 A;  2LP3 A;  2Q4U A;  2I18 A;  4JD9 A;  5FI2 A;  3PM8 A;  2MBX A;  2HET A;  3JTD B;  2ZN9 A;  2KDH A;  1Y6W A;  3OP0 A;  3D78 A;  4NQG A;  5DKQ A;  3CLN A;  2I2R E;  2JTZ A;  1L7Z A;  1YRT B;  2KSP A;  3GK2 A;  1QV1 A;  2Y1M A;  4FTG A;  1BLQ A;  1UHH A;  3TS5 B;  4JKT A;  1TCF A;  3LLE A;  2F3Y A;  5CPV A;  1C3Z A;  1NWD A;  1MXE A;  3OX6 A;  2BKI B;  3AKA A;  4D1E A;  1XFR A;  1KFU S;  2KBI A;  2F2O A;  1OZO A;  1WLM A;  2B1U A;  5AXI A;  1SR6 B;  1Z4H A;  2NZ0 A;  3BFB A;  3D74 A;  3DVM A;  2V53 A;  3I5F B;  3M0W A;  1FF1 A;  1V1F A;  2CXJ A;  2OS8 C;  1SKT A;  2Y4Q A;  5D69 A;  1SCM B;  1FW4 A;  2WC5 A;  3OX5 A;  2LAN A;  1DEL A;  2L51 A;  1BOD A;  3LK1 A;  1CFF A;  2HF5 A;  2QEH A;  3EVV A;  3S0G A;  2JTT A;  3BUM B;  1ALV A;  1RRO A;  3SG5 A;  1AHR A;  2EC6 C;  2M1K B;  1M31 A;  1UUR A;  2OS8 B;  1KSO A;  1SBJ A;  2GGZ A;  2LNK A;  4PDZ A;  5KTY A;  1A03 A;  1B8R A;  2BEC A;  3SS4 A;  5HKZ A;  1DTL A;  1LS8 A;  2LVV A;  2KYF A;  1F4Q A;  1CM4 A;  2WOR A;  1AJ4 A;  3EK8 A;  4GFT A;  4M2Q A;  1K9P A;  4PHN A;  2KNE A;  3Q8I A;  3KPX A;  2QEO A;  1E8A A;  1KK7 Y;  2LVK A;  2I7A A;  3SG3 A;  1EG4 A;  2H2K A;  1M46 A;  1G8I A;  1PVB A;  3VRR A;  1CLM A;  2YGU A;  1A29 A;  4I5J A;  1AUI B;  2R2I A;  1NCY A;  2G2B A;  5IBW A;  2LLS A;  2WOS A;  1JFJ A;  2M0R A;  3CZT X;  1QS7 A;  1SW8 A;  4ZCV A;  1XO5 A;  1EL4 A;  2M7L A;  1MR8 A;  3I5I B;  2BKH B;  4DCK A;  3FE6 A;  5DIC A;  2NXQ A;  4AOM A;  1H8B A;  5BPJ A;  4Q04 A;  3GK4 X;  2AMI A;  2GGM A;  1S5G Y;  1ZAC A;  1W7J B;  2LMU A;  4MEW A;  2E6W A;  3SS5 A;  1OOH A;  1B9A A;  2WCH A;  1SL7 A;  1S36 A;  1CFC A;  1BR1 B;  4U8D A;  1NX2 A;  1KK7 Z;  4N1G A;  3D0Y A;  1JC2 A;  4P5O E;  4PAL A;  5I2O A;  1YRU B;  2BL0 C;  2JT0 A;  1OMD A;  1MHO A;  2K7D A;  4PT1 A;  1EXR A;  3RLZ A;  2LMT A;  3EKJ A;  1AP4 A;  1B1G A;  4MBE A;  4AQI A;  3R1V A;  3SG2 A;  1CFD A;  1J55 A;  2BE4 A;  2JNX A;  4I5K A;  2ZRS A;  1A75 B;  1YUR A;  3D77 A;  1K2H A;  1M63 B;  1GGW A;  2ERB A;  1A4P A;  1YVL A;  4CPV A;  4YGE B;  4MLW A;  1RJV A;  2JXL A;  3D76 A;  1LIN A;  3LL8 B;  2MJW B;  3LCP C;  1PVA A;  2WC6 A;  3SS3 A;  1DMO A;  3I5G B;  2LHI A;  4R1E A;  2P70 A;  2PYQ A;  2GTE A;  1TCO B;  3BFH A;  4PE1 A;  3A8R A;  2OPO A;  4CID A;  1GGZ A;  1KQM C;  1YUT A;  1TTX A;  1PK0 D;  1KK8 C;  3EKH A;  1IIO A;  3CR2 A;  1U5I B;  3IF7 A;  1UUS A;  4OZD A;  5HLO A;  1BU3 A;  1NYA A;  4GGF A;  1KWO C;  1W7I B;  3SG6 A;  1QTX A;  3E3R A;  1B47 A;  1QIV A;  1BMO A;  1JFK A;  1KK8 B;  1MQ1 A;  2HPS A;  2JT8 A;  2KQY A;  3D75 A;  5K89 A;  1F4O A;  1KFU L;  5I94 A;  1K94 A;  2FCD A;  5HKY A;  1JWD A;  3TDZ A;  2WCM A;  1DQE A;  1YUU A;  1C07 A;  4OKH A;  3ZNI A;  5PAL A;  1JUO A;  2PAS A;  3RZS A;  2OTG C;  4PE7 A;  5KSZ A;  2Q91 A;  5HKW A;  1N65 A;  2P71 A;  2JT3 A;  1DJY A;  1TUZ A;  5AER A;  5HLV A;  4CLN A;  2Y1N A;  1SL9 A;  1JF2 A;  3A4U B;  4M2O A;  1SMG A;  1PSR A;  3FWC A;  3JVT C;  2WCF A;  1ODB A;  4MRY A;  2Y5I A;  4GAO A;  2M1U A;  3WHU B;  2QPT A;  2KI4 C;  3CAB A;  1SYM A;  5F6T A;  1J1D A;  2H61 C;  1H4B A;  2F33 A;  2KFG A;  1XK4 C;  1XFW O;  5DKN A;  4OV2 A;  2FJU B;  2QDI A;  2DOQ A;  1IH0 A;  5ER4 X;  3JVT B;  1F71 A;  3UNW A;  1RK9 A;  1TNX A;  5TNC A;  1KSM A;  2LAP A;  1K9U A;  1BJF A;  1CMG A;  3BYA A;  1IRJ A;  1REC A;  2WCK A;  4C0K A;  3DVK A;  4CFR A;  2KYC A;  2LUC A;  4PE4 A;  3K21 A;  5I2Q A;  1DGV A;  2LHL A;  2QEB A;  3N7H A;  2K8M B;  3DXL A;  3KHE A;  1PRW A;  2L0P A;  2M29 A;  1TWO A;  2CNP A;  4YI8 A;  2AUC A;  1DJG A;  1S6I A;  1T14 A;  2K60 A;  3KEV A;  4QJ3 B;  3S0F A;  1CMF A;  1B7T Z;  3DVJ A;  3CTN A;  1QAT A;  4ZCU A;  5JJG A;  1RFJ A;  2PSR A;  1OZS A;  2WND A;  2FJY A;  2WCB A;  3PSR A;  1SL8 A; 
#chains in the Genus database with same CATH homology
 2ISD A;  1NCZ A;  2LM5 A;  2MAZ A;  1IQ3 A;  1CLL A;  2CCM A;  3GOF A;  1J7R A;  1QV0 A;  4YGD B;  1K90 D;  1S1E A;  2EC6 B;  1FI6 A;  2LV7 A;  1YX7 A;  1EG3 A;  4WRI A;  4DS7 A;  4UPG A;  4MN0 A;  1AK8 A;  1NIW A;  1J7Q A;  2LVI A;  4F0Z B;  3IQO A;  2E30 A;  3KO0 A;  1CNP A;  1S6C A;  2JRF A;  1TNP A;  4P2Y B;  2FCE A;  1SPY A;  2MHH A;  1K95 A;  1EH2 A;  4IL1 A;  4GPL B;  1S6J A;  1KFX L;  1L2O C;  1MUX A;  2LVJ A;  3QRX A;  2BCA A;  4GBA A;  5CSN A;  5GQQ C;  1VRK A;  4MSP A;  3I5H C;  1DJW A;  2MA2 A;  3PFV A;  2KAV A;  3VRP A;  2FOT A;  3F45 A;  1ZUZ A;  2M49 B;  4NDC A;  4DIR A;  1NSH A;  2JOJ A;  4A4C A;  1A75 A;  1XFY O;  2JPT A;  3BUW B;  1NX1 A;  4HRE E;  1Y1U A;  1QXP A;  5HYD A;  1FPW A;  2F3Z A;  2M8U A;  1C7V A;  1SK6 D;  4JQ0 D;  1OMR A;  2D8N A;  2EHB A;  5AAN A;  2TN4 A;  1EJ3 A;  4A4B A;  2LC5 A;  3BOW B;  1F54 A;  1N2D A;  3AAK A;  2GV5 A;  1QJT A;  2LP2 A;  4NDB A;  2M7N A;  4GUK A;  4FQO A;  3C1V A;  3CGA A;  2SCP A;  1KFX S;  3VRQ A;  4ORC B;  2COL B;  1DJI A;  1U5I A;  3TZ1 A;  3SJS A;  4ETO A;  4MZL A;  1K96 A;  1TIZ A;  3O78 A;  1QLK A;  3SG7 A;  3EVU A;  1KCY A;  1QX5 B;  2F8P A;  2MLF C;  2L98 A;  2BL0 B;  3HCM A;  1TOP A;  1LXF C;  1YX8 A;  3SIB A;  1CLB A;  1CB1 A;  1CDL A;  1V1G A;  3VRN A;  4TNC A;  1X02 A;  4MRX A;  1UWO A;  1F8H A;  2VRG A;  1SNL A;  5I8N A;  2O60 A;  2PRU A;  4XJK B;  2BCX A;  5CSI A;  1GQM A;  1HQV A;  1GJY A;  4MZJ A;  1IQ5 A;  1XA5 A;  2CBL A;  2A4J A;  2RGI A;  2ZFD A;  2IS9 A;  5JOL A;  3NSL A;  2LE9 B;  1K9K A;  1KQM B;  1LA3 A;  3PAL A;  1SCV A;  2L4I A;  2PAL A;  4QJ4 B;  1FI5 A;  1WDC C;  1YVH A;  2KAY A;  3O2P A;  4YGC B;  1D1O A;  1XFV O;  3EK4 A;  3DD4 A;  3TDI A;  1PSB A;  3LK0 A;  3AAJ A;  1Q80 A;  1XFX O;  1KWO B;  2KHN A;  1TNW A;  1JSA A;  4OCI A;  1KQV A;  1ZFS A;  4WQ3 A;  5B8I B;  4YGA A;  1XYD A;  3DVE A;  2K7C A;  3PN7 C;  2KGR A;  1NUB A;  4M2P A;  1OOJ A;  2HQW A;  1F70 A;  4OR9 B;  1B7T Y;  2G9B A;  3DF0 B;  3BXK A;  1IKU A;  2NLN A;  1DVI A;  4DRW A;  1RWY A;  2KGB C;  3VRO A;  4JPZ B;  4C0L A;  2JNF A;  1WY9 A;  1DT7 B;  3JTD C;  4PHK A;  1ZOT B;  2CT9 A;  2OTG B;  3NSI A;  2KI6 D;  2JQ6 A;  1OMV A;  3BUX B;  3HX4 A;  1UHJ A;  2O5G A;  3H4S E;  4PHM A;  4YBH B;  1DF0 A;  2L50 A;  4GGF C;  1NP8 A;  1YR5 A;  2K7B A;  1LA0 A;  1SY9 A;  3VGO A;  2LCP A;  2BCB A;  3TS5 C;  2F2P A;  1J7O A;  4AQJ A;  4PCW A;  2LLT A;  1DJZ A;  2KAX A;  3ICB A;  2JC2 A;  3KF9 A;  1J1E A;  2KI4 B;  3SG4 A;  1OSA A;  4ICB A;  1S26 D;  2BBM A;  2P6B B;  1ALW A;  3CWG A;  1NX3 A;  4HRG A;  1SR6 C;  3NXA A;  4N1F A;  1QVI Y;  1AJ5 A;  3I5F C;  1K93 D;  1K8U A;  5ER5 A;  1NCX A;  3AKB A;  3WXA A;  1UHK A;  1AVS A;  3BQ3 A;  1SCM C;  1RTP 1;  1M39 A;  4CFQ A;  1PAL A;  2K2A A;  4JWQ A;  1CDM A;  3NSK A;  1CDP A;  2KFF A;  1DJH A;  2PVB A;  5D7F A;  1QX7 A;  3TUY C;  3WNX B;  2NCP A;  1PUL A;  4XYN A;  2EGD A;  3BUO B;  1IWQ A;  1QX2 A;  1R2U A;  1DF0 B;  2PMY A;  3RM1 A;  2QAC A;  2ZN8 A;  3OB2 B;  3ZWH A;  2L5X B;  4L9M A;  1TRF A;  2JU0 A;  1ZMZ A;  3BOW A;  4I5L B;  2WCE A;  4ORA B;  1UHN A;  4MZK A;  3TUY B;  1QVI Z;  4HRH A;  3IQQ A;  4MVF A;  2K2F A;  1FBV A;  5AFP A;  5KU1 A;  4GNK B;  3FS7 A;  3EVR A;  4ORB B;  1IJ5 A;  4BY4 A;  1CDN A;  4OVN F;  2BE6 A;  1L2O B;  2BBN A;  3I5I C;  4E68 A;  3EK7 A;  2ZKM X;  1B8C A;  1HT9 A;  2K61 A;  3I5H B;  2ZRT A;  1N0Y A;  3FWB A;  4USL A;  3O4Y A;  1B4C A;  3FIA A;  4XJK A;  1F55 A;  4YGB B;  4NDD A;  2JUL A;  1S3P A;  1BOC A;  4DUQ A;  1JBA A;  2I94 A;  1R6P A;  3OHM B;  1YUS A;  1B8L A;  1BT6 A;  2KOT A;  1M45 A;  5J3X A;  4QJ5 B;  1UP5 A;  1TN4 A;  5I2L A;  1BF5 A;  1XFZ O;  1BR4 B;  4N5X A;  1XVJ A;  2K0J A;  3TDU A;  3WHT B;  1C7W A;  4C0J A;  2M3W A;  2SAS A;  3PLF B;  1DJX A;  1CTR A;  1MWN A;  1QIW A;  1CKK A;  2M9G A;  2MRD A;  5DKR A;  3SIA A;  1J7P A;  2LLU A;  5CSF A;  4BY5 A;  2LUX A;  3NSO A;  1Y1X A;  1CM1 A;  1WRK A;  3I5G C;  1Y1A A;  3D10 A;  2NCO A;  3DF0 A;  1QAS A;  2HQ8 A;  2JZI A;  3CR4 X;  4PE0 A;  1LKJ A;  2KBM A;  3MSE B;  1NPQ A;  2ZNE A;  2ZND A;  2AAO A;  3CR5 X;  5G08 A;  2JWW A;  5FYX A;  1G33 A;  1QLS A;  4YI9 A;  1LVC D;  1S5G Z;  1A2X A;  2M97 A;  1SRA A;  1IJ6 A;  2L4H A;  1Y0V H;  2K7O A;  1WRZ A;  3BUN B;  1NX0 A;  1WRL A;  4GGN A;  4YRU A;  1DGU A;  1YTZ C;  3D0Y B;  1UHI A;  1G4Y R;  2WC8 A;  3GK1 A;  2KQ6 A;  1XFU O;  1IG5 A;  4HSZ A;  2H61 A;  1MXL C;  1WDC B;  4PHJ A;  1MF8 B;  1XK4 A;  3O6B A;  1WLZ A;  3PAT A;  1OQP A;  1OE9 B;  2MLE C;  1TNQ A;  1BG1 A;  5CSJ A;  1CFP A;  2CTN A;  2JXC A;  1JF0 A;  1IGV A;  3PN7 B;  4I5N B;  3OB1 B;  2L2E A;  2KFH A;  5AEQ A;  2LMV A;  3CS1 A;  2KI6 C;  4WQ2 A;  2LP3 A;  2Q4U A;  2I18 A;  3PM8 A;  2MBX A;  2HET A;  3JTD B;  2ZN9 A;  2KDH A;  1Y6W A;  3OP0 A;  4NQG A;  5DKQ A;  3CLN A;  2I2R E;  2JTZ A;  1L7Z A;  1YRT B;  2KSP A;  3GK2 A;  1QV1 A;  2Y1M A;  4FTG A;  1BLQ A;  1UHH A;  3TS5 B;  1TCF A;  3LLE A;  2F3Y A;  5CPV A;  1NWD A;  1MXE A;  3OX6 A;  2BKI B;  3AKA A;  4D1E A;  1KFU S;  2KBI A;  2F2O A;  1OZO A;  1WLM A;  2B1U A;  5AXI A;  1SR6 B;  2NZ0 A;  3DVM A;  2V53 A;  3I5F B;  3M0W A;  1FF1 A;  1V1F A;  2CXJ A;  2OS8 C;  1SKT A;  2Y4Q A;  5D69 A;  1SCM B;  1FW4 A;  3OX5 A;  2LAN A;  2L51 A;  1BOD A;  3LK1 A;  1CFF A;  2HF5 A;  3EVV A;  2JTT A;  3BUM B;  1ALV A;  1RRO A;  3SG5 A;  1AHR A;  2EC6 C;  2M1K B;  1M31 A;  1UUR A;  2OS8 B;  1KSO A;  1SBJ A;  2GGZ A;  2LNK A;  4PDZ A;  5KTY A;  1A03 A;  1B8R A;  2BEC A;  1DTL A;  2LVV A;  2KYF A;  1F4Q A;  1CM4 A;  2WOR A;  1AJ4 A;  3EK8 A;  4GFT A;  4M2Q A;  1K9P A;  4PHN A;  2KNE A;  3KPX A;  1E8A A;  1KK7 Y;  2LVK A;  2I7A A;  3SG3 A;  1EG4 A;  2H2K A;  1M46 A;  1G8I A;  1PVB A;  3VRR A;  1CLM A;  1A29 A;  4I5J A;  1AUI B;  2R2I A;  1NCY A;  2G2B A;  5IBW A;  2LLS A;  2WOS A;  1JFJ A;  2M0R A;  3CZT X;  1QS7 A;  1SW8 A;  4ZCV A;  1XO5 A;  1EL4 A;  2M7L A;  1MR8 A;  3I5I B;  2BKH B;  4DCK A;  2NXQ A;  4AOM A;  1H8B A;  5BPJ A;  4Q04 A;  3GK4 X;  2AMI A;  2GGM A;  1S5G Y;  1ZAC A;  1W7J B;  2LMU A;  4MEW A;  2E6W A;  1B9A A;  1SL7 A;  1S36 A;  1CFC A;  1BR1 B;  4U8D A;  1NX2 A;  1KK7 Z;  4N1G A;  3D0Y A;  1JC2 A;  4P5O E;  4PAL A;  5I2O A;  1YRU B;  2BL0 C;  2JT0 A;  1OMD A;  1MHO A;  2K7D A;  1EXR A;  3RLZ A;  2LMT A;  3EKJ A;  1AP4 A;  1B1G A;  4MBE A;  4AQI A;  3SG2 A;  1CFD A;  1J55 A;  2BE4 A;  2JNX A;  4I5K A;  2ZRS A;  1A75 B;  1YUR A;  1K2H A;  1M63 B;  1GGW A;  1A4P A;  1YVL A;  4CPV A;  4YGE B;  4MLW A;  1RJV A;  2JXL A;  5HKZ A;  1LIN A;  3LL8 B;  2MJW B;  3LCP C;  1PVA A;  1DMO A;  3I5G B;  2LHI A;  4R1E A;  1TCO B;  4PE1 A;  3A8R A;  2OPO A;  4CID A;  1GGZ A;  1KQM C;  1YUT A;  1TTX A;  1PK0 D;  1KK8 C;  3EKH A;  3CR2 A;  1U5I B;  3IF7 A;  1UUS A;  5HLO A;  1BU3 A;  1NYA A;  4GGF A;  1KWO C;  1W7I B;  3SG6 A;  1QTX A;  3E3R A;  1B47 A;  1QIV A;  1BMO A;  1JFK A;  1KK8 B;  1MQ1 A;  2HPS A;  2JT8 A;  2KQY A;  5K89 A;  1F4O A;  1KFU L;  1K94 A;  2FCD A;  5HKY A;  1JWD A;  3TDZ A;  1YUU A;  1C07 A;  4OKH A;  3ZNI A;  5PAL A;  1JUO A;  2PAS A;  2OTG C;  4PE7 A;  5KSZ A;  2Q91 A;  5HKW A;  1N65 A;  2JT3 A;  1DJY A;  5AER A;  5HLV A;  4CLN A;  2Y1N A;  1SL9 A;  1JF2 A;  3A4U B;  4M2O A;  1SMG A;  1PSR A;  3FWC A;  3JVT C;  2WCF A;  1ODB A;  4MRY A;  2Y5I A;  4GAO A;  2M1U A;  3WHU B;  2QPT A;  2KI4 C;  1SYM A;  5F6T A;  1J1D A;  2H61 C;  1H4B A;  2F33 A;  2KFG A;  1XK4 C;  1XFW O;  5DKN A;  4OV2 A;  2FJU B;  2DOQ A;  1IH0 A;  5ER4 X;  3JVT B;  1F71 A;  1RK9 A;  1TNX A;  5TNC A;  1KSM A;  2LAP A;  1K9U A;  1BJF A;  1CMG A;  3BYA A;  1IRJ A;  1REC A;  4C0K A;  3DVK A;  4CFR A;  2KYC A;  2LUC A;  4PE4 A;  3K21 A;  5I2Q A;  1DGV A;  2LHL A;  2K8M B;  3KHE A;  1PRW A;  2L0P A;  2M29 A;  2CNP A;  4YI8 A;  2AUC A;  1DJG A;  1S6I A;  3KEV A;  1CMF A;  4QJ3 B;  1B7T Z;  3DVJ A;  3CTN A;  1QAT A;  4ZCU A;  5JJG A;  1RFJ A;  2PSR A;  1OZS A;  2WND A;  2WCB A;  3PSR A;  1SL8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...