1Q80A

Solution structure and dynamics of nereis sarcoplasmic calcium binding protein
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
174
structure length
174
Chain Sequence
SDLWVQKMKTYFNRIDFDKDGAITRMDFESMAERFAKESEMKAEHAKVLMDSLTGVWDNFLTAVAGGKGIDETTFINSMKEMVKNPEAKSVVEGPLPLFFRAVDTNEDNNISRDEYGIFFGMLGLDKTMAPASFDAIDTNNDGLLSLEEFVIAGSDFFMNDGDSTNKVFWGPLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sarcoplasmic calcium-binding protein
publication title Solution structure and internal dynamics of NSCP, a compact calcium-binding protein.
pubmed doi rcsb
source organism Neanthes diversicolor
molecule tags Metal binding protein
total genus 60
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2003-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1q80A00
1J7PA 4A4CA 2LLSA 1CFDA 3SG6A 1ALWA 1EG3A 1PRWA 2L4HA 4XJKB 3MSEB 4YGBB 2JNXA 2JULA 5DKNA 1NX3A 3TUYB 1PSRA 3I5HC 3NSOA 4GNKB 1BOCA 3KPXA 4UPGA 4PE4A 1YX7A 1XA5A 2F33A 1QX2A 2L4IA 5I2OA 2BCXA 2E30A 4YGAA 4QJ4B 3DD4A 2K7OA 1LKJA 2OS8B 2SCPA 1C07A 1SYMA 1J7QA 1TNQA 4GGFC 3ZWHA 1UHHA 3TS5C 1OZSA 1AJ5A 1TIZA 5AANA 2CBLA 3EKHA 2M49B 1BU3A 3E3RA 3BOWA 4DS7A 2BECA 1G4YR 2WC8A 2PASA 2L50A 1FI5A 1MWNA 3JTDC 3JVTB 3ZNIA 1OMRA 1TNWA 3DF0B 4MZJA 4M2QA 2SASA 2M7LA 1AK8A 2KYCA 1EL4A 1A03A 2L0PA 3I5HB 1BR1B 5DKRA 4PALA 1NIWA 1S1EA 1SK6D 1MF8B 1MXLC 1YX8A 3EVUA 1N0YA 2WCBA 2K61A 1GGWA 4Q04A 2KFFA 4MSPA 2KAVA 2I18A 2ZFDA 2TN4A 1KWOC 2ISDA 1ZMZA 2K7BA 1CB1A 1XYDA 1RECA 4YGEB 5ER5A 2LV7A 1WRKA 1H4BA 3PATA 1CDPA 1F4QA 2CT9A 1JUOA 1UP5A 1IG5A 2KI4B 2QACA 2WCEA 3EK8A 3OB2B 4OCIA 3A8RA 4YBHB 2KGBC 3TS5B 1RROA 2H2KA 2OTGC 1TRFA 3PN7C 4NQGA 1Q80A 2K7CA 2F8PA 5I2LA 2EHBA 2BKIB 1IWQA 1IJ6A 1DGVA 2MBXA 4ZCVA 5TNCA 3CWGA 1SNLA 1ZACA 1MHOA 5CSFA 2LMTA 1KQMC 1SCMB 2LMUA 2NXQA 2BCAA 1DJXA 2MLEC 1CDNA 5JOLA 3SG4A 1YVHA 3ICBA 1DJWA 3FWBA 2H61A 3VRPA 5KSZA 4GFTA 1AJ4A 4YRUA 1UHNA 4PCWA 1VRKA 3O6BA 1WLMA 3TUYC 1FPWA 2KQ6A 3EK7A 5HLVA 1BR4B 3IQQA 1YURA 4PDZA 4PHJA 2L98A 2KI6D 1XFWO 2MJWB 3M0WA 4PE1A 1TCOB 1K96A 2M0RA 4WRIA 4GPLB 1ZUZA 1CDMA 1DF0A 1XFUO 3C1VA 3HCMA 2O5GA 1S6JA 2K8MB 2PSRA 2OTGB 2QPTA 3PN7B 5CSIA 1NPQA 1UURA 2HETA 2O60A 3WXAA 3OP0A 1J7OA 1RFJA 2CCMA 2I2RE 1DJHA 2BCBA 2M29A 1BLQA 2LVIA 4TNCA 1CM4A 3SG7A 1A2XA 3PFVA 1CLLA 4NDDA 5I2QA 2F3ZA 4OV2A 1A75B 1H8BA 2BBMA 2BKHB 2Q4UA 1SRAA 1PK0D 1WY9A 3VRRA 2PVBA 1DJYA 2JRFA 2WNDA 3EK4A 4NDCA 3JVTC 3GK2A 2WOSA 1R6PA 1YTZC 3DF0A 2LVKA 1TNXA 1RJVA 1K9KA 1FF1A 4GBAA 4BY4A 1FI6A 4YGCB 1AVSA 3AAKA 4IL1A 3BXKA 1SR6B 1KSOA 1QV1A 4ORCB 1YRUB 1JF2A 3EVVA 1IQ5A 3PSRA 3I5FB 2LVVA 2ZNEA 1WRLA 1G8IA 2HQ8A 3AKBA 1DJGA 4ICBA 1TNPA 2JXLA 2ZN8A 3O78A 4MEWA 1KCYA 2JZIA 1QXPA 4AQJA 4CFQA 1Y6WA 2KI4C 1IRJA 1SW8A 1UHJA 2D8NA 2ZNDA 1SL7A 2AUCA 2FCEA 2KBMA 3OB1B 1F71A 2JT8A 2LMVA 4MLWA 1SMGA 4YI9A 5AXIA 2LVJA 2Y1MA 1CMFA 1CTRA 1LXFC 2PALA 1FBVA 1OE9B 2NCOA 4I5JA 1NSHA 1M31A 2VRGA 1R2UA 2Y4QA 1SL8A 3AKAA 1CKKA 1NUBA 4OKHA 2K2AA 1SPYA 1K93D 1NX0A 5I8NA 1HT9A 3BUXB 2EC6C 4A4BA 4GAOA 1MUXA 1SCMC 2COLB 2KOTA 3F45A 1KK7Z 2KAXA 3FIAA 2F3YA 4MVFA 1BODA 1NX1A 3OHMB 2Y1NA 3WHUB 3KHEA 2KSPA 3NSLA 1LINA 2JTZA 1JBAA 4AQIA 4QJ5B 3VRQA 1BJFA 4CIDA 3RLZA 1B8LA 4PE0A 2V53A 3SIBA 4WQ3A 1EH2A 2GV5A 4GUKA 3IQOA 3QRXA 4C0KA 3SG3A 3KF9A 1K90D 1M45A 4N1GA 5K89A 2JPTA 1B1GA 2CXJA 3BUNB 3D10A 1SL9A 2B1UA 3FS7A 1AHRA 1C7VA 2JXCA 2LUCA 5FYXA 2M7NA 1ODBA 2M8UA 3D0YA 4HRGA 1J55A 1QX7A 1SKTA 1J7RA 3KEVA 2JTTA 2F2OA 2KI6C 4C0LA 2JQ6A 1S3PA 1JC2A 3SG5A 1B47A 2I94A 2L2EA 2EC6B 1G33A 1D1OA 2K0JA 2JNFA 3DVEA 2LP2A 1ALVA 5JJGA 1S26D 1MR8A 2E6WA 1OOJA 3LCPC 3OX6A 1U5IA 3O2PA 1F55A 1QV0A 2M3WA 3NSKA 4QJ3B 1TOPA 2JWWA 1KK8B 1NCZA 1UUSA 2KHNA 3BOWB 4XJKA 3VRNA 5HKWA 2HPSA 4ORAB 2KBIA 4DUQA 1XVJA 2JC2A 5HKZA 5DKQA 2MLFC 1OSAA 1OZOA 1SR6C 2MAZA 2ZKMX 2DOQA 2BL0C 2LC5A 4C0JA 2PRUA 2F2PA 3CZTX 3FWCA 1AP4A 1NCXA 3I5FC 1UHIA 1DTLA 4MBEA 3A4UB 1GGZA 1SCVA 1N2DA 3RM1A 1F4OA 2PMYA 1MXEA 1XK4C 2L51A 2LHLA 3CTNA 2K7DA 1CFCA 1A29A 1YVLA 3BYAA 3I5IC 4BY5A 1NP8A 1EJ3A 3GK1A 1JWDA 1S6IA 4PHKA 1PALA 4I5LB 1BMOA 5IBWA 5ER4X 1HQVA 1FW4A 1WDCB 1LA3A 1XFZO 4I5NB 1KFUS 2IS9A 1AUIB 1B8CA 1K2HA 3EVRA 4ETOA 4DCKA 2KYFA 4NDBA 4P2YB 4ZCUA 1ZFSA 2LE9B 2GGMA 4GGNA 4XYNA 3CR5X 1RWYA 5KTYA 1B7TZ 3GK4X 3CGAA 4CPVA 2LNKA 1K8UA 1GQMA 4FTGA 3SG2A 1F70A 5CSNA 2NCPA 2BL0B 4N5XA 1Y1XA 1SBJA 2HF5A 1A4PA 1CM1A 3EKJA 1V1GA 4MN0A 1YR5A 3LL8B 2KAYA 2A4JA 3CLNA 1QLKA 1J1EA 1QVIZ 1Y0VH 3O4YA 4PHNA 1KFXS 3CR2A 2AAOA 3CR4X 4GGFA 1BF5A 2FJUB 3I5IB 4M2OA 3OX5A 1CMGA 1M63B 3BUMB 2M1UA 2Y5IA 1B8RA 2MHHA 1KFUL 5CSJA 1BT6A 1YUUA 5AEQA 4CFRA 1NYAA 3VGOA 1TCFA 1XFYO 2M9GA 2AMIA 1B7TY 1DF0B 1JFKA 1MQ1A 2G2BA 3BUWB 4HSZA 2ZN9A 1QTXA 1E8AA 1QIWA 2KDHA 2FCDA 4ORBB 5BPJA 1XFVO 3LK0A 3TDZA 4D1EA 4JWQA 2KGRA 3GOFA 3TDIA 3WHTB 5PALA 4R1EA 1LA0A 2LAPA 1KQVA 2K2FA 2LM5A 3AAJA 5HYDA 1QVIY 1TTXA 3PALA 4M2PA 2M1KB 1S6CA 1KK8C 1NX2A 3I5GB 3TZ1A 1QLSA 1PSBA 5D7FA 1J1DA 1K95A 1OMVA 4U8DA 1RTP1 3TDUA 1F54A 1W7IB 1KFXL 1L7ZA 4JQ0D 1QS7A 4CLNA 4E68A 1WRZA 1S5GZ 2G9BA 2L5XB 3VROA 1S36A 2FOTA 2Q91A 1IH0A 5AFPA 1TN4A 2I7AA 4MRXA 1IGVA 4P5OE 1DMOA 1RK9A 1XFXO 3SIAA 1IQ3A 3LK1A 1EG4A 1KK7Y 1KSMA 1NWDA 4HREE 4MZLA 1CNPA 2R2IA 1NCYA 1PULA 1GJYA 1CDLA 1L2OC 1UHKA 3BUOB 1PVAA 1DVIA 1A75A 2LANA 1SY9A 1WDCC 2BE4A 4DRWA 1QJTA 1W7JB 5F6TA 2GGZA 2CTNA 4PHMA 5KU1A 2LLTA 3SJSA 1JSAA 1DGUA 5J3XA 4USLA 3H4SE 1CLMA 1OQPA 1S5GY 5D69A 1K9UA 1CFPA 2LUXA 1QX5B 5B8IB 3PLFB 1X02A 2EGDA 2LCPA 2LLUA 4I5KA 1B4CA 1F8HA 2M97A 4N1FA 5G08A 2OPOA 3BQ3A 3JTDB 1DJZA 1DJIA 1YUTA 1EXRA 1OMDA 2HQWA 1ZOTB 2ZRTA 1CFFA 5HKYA 1V1FA 1QATA 2WCFA 1Y1UA 1K9PA 2KNEA 2MA2A 1C7WA 1M39A 2H61C 3PM8A 3DVJA 4MRYA 1XK4A 5GQQC 2WORA 3K21A 3LLEA 2MRDA 4OVNF 1DT7B 1KWOB 2JOJA 2KQYA 3IF7A 4L9MA 1WLZA 1L2OB 2JU0A 1Y1AA 1UWOA 1XO5A 2CNPA 2NLNA 3DVKA 1B9AA 4OR9B 4YI8A 4WQ2A 1JF0A 4JPZB 2NZ0A 1QASA 5AERA 2BE6A 3NSIA 3KO0A 4YGDB 1YRTB 2OS8C 3NXAA 1QIVA 2P6BB 4FQOA 4PE7A 3WNXB 1JFJA 1BG1A 2JT3A 3D0YB 5CPVA 2RGIA 4F0ZB 1IKUA 2KFGA 1YUSA 3HX4A 2KFHA 4MZKA 4AOMA 1LVCD 1N65A 2BBNA 1CLBA 2LP3A 2ZRSA 1IJ5A 1K94A 3CS1A 4DIRA 1M46A 1PVBA 3DVMA 1KQMB 3I5GC 2LHIA 2JT0A 5HLOA 1U5IB 4HRHA
chains in the Genus database with same CATH superfamily
1J7PA 1ORGA 3DYEA 4A4CA 2LLSA 1CFDA 3SG6A 1ALWA 1EG3A 1PRWA 2L4HA 4XJKB 3MSEB 4YGBB 2JNXA 2JULA 5DKNA 1NX3A 3TUYB 3BJHA 1PSRA 3I5HC 3NSOA 1QWVA 4GNKB 1BOCA 1T14A 3KPXA 3BFAA 4PE4A 4UPGA 1YX7A 1XA5A 2F33A 1QX2A 3PJIA 2L4IA 5I2OA 2BCXA 2E30A 4YGAA 4QJ4B 2WCKA 3DD4A 2K7OA 1LKJA 2OS8B 2SCPA 1C07A 1SYMA 1GM0A 1Z2CB 1J7QA 1TNQA 4GGFC 3BFBA 3ZWHA 1UHHA 3TS5C 1OZSA 1AJ5A 1TIZA 5AANA 1IIOA 2CBLA 3EKHA 2M49B 3N7HA 1BU3A 3E3RA 3BOWA 4DS7A 2BECA 1G4YR 2WC8A 2PASA 2L50A 1FI5A 1MWNA 3JTDC 3JVTB 3ZNIA 1OMRA 1TNWA 3DF0B 3DXLA 4M2QA 2SASA 4MZJA 2M7LA 1AK8A 5FI6A 2KYCA 1EL4A 1A03A 2L0PA 3I5HB 1BR1B 5DKRA 4PALA 1NIWA 1S1EA 1SK6D 3NHIA 1MF8B 1MXLC 1YX8A 3EVUA 3NGVA 1N0YA 4PT1A 2WCBA 2K61A 1GGWA 4Q04A 2KFFA 4MSPA 2KAVA 2I18A 2ZFDA 2TN4A 1KWOC 2ISDA 1ZMZA 2K7BA 1CB1A 1XYDA 1RECA 4YGEB 5ER5A 2LV7A 1WRKA 1H4BA 3PATA 1CDPA 1F4QA 2CT9A 1JUOA 1UP5A 1IG5A 2KI4B 2QACA 2WCEA 3EK8A 3OB2B 4OCIA 3A8RA 4YBHB 2KGBC 3TS5B 1RROA 2H2KA 2OTGC 1TRFA 3PN7C 4NQGA 1Q80A 1TWOA 2K7CA 2F8PA 3D78A 5I2LA 2EHBA 3CZ2A 2BKIB 1IWQA 1IJ6A 1DGVA 2MBXA 4ZCVA 5TNCA 3CWGA 1SNLA 3UNWA 1ZACA 1MHOA 3FE8A 5CSFA 4IJ7A 2LMTA 1KQMC 1SCMB 2LMUA 2NXQA 3RZSA 3FE6A 2BCAA 1DJXA 2MLEC 1CDNA 5JOLA 3SG4A 1YVHA 3ICBA 1DJWA 3B88A 2H61A 3FWBA 3VRPA 5KSZA 4GFTA 2L5YA 1AJ4A 4YRUA 1UHNA 2WCHA 4PCWA 1VRKA 3CZ1A 3O6BA 1WLMA 3TUYC 1FPWA 4F7FA 2KQ6A 3EK7A 5HLVA 1BR4B 3IQQA 1YURA 4PDZA 4PHJA 2L98A 2KI6D 1XFWO 2MJWB 3M0WA 4PE1A 1TCOB 1K96A 2KLDA 1P28A 2M0RA 1ZUZA 4GPLB 4WRIA 1CDMA 1DF0A 1XFUO 3C1VA 3HCMA 2O5GA 1S6JA 2K8MB 2PSRA 2OTGB 2QPTA 3B86A 3PN7B 5CSIA 1NPQA 1UURA 2HETA 2O60A 3WXAA 3OP0A 1J7OA 1RFJA 2CCMA 2I2RE 1DJHA 2BCBA 2M29A 3L4LA 1BLQA 1Z4HA 2LVIA 4TNCA 1CM4A 3SG7A 1A2XA 3PFVA 1CLLA 4NDDA 5FI2A 5I2QA 2F3ZA 4OV2A 1A75B 4JD9A 3S0EA 2BBMA 2BKHB 2Q4UA 1H8BA 1SRAA 1PK0D 1WY9A 3V2LA 3K1EA 3VRRA 2PVBA 1DJYA 2JRFA 2WNDA 3EK4A 4NDCA 3JVTC 3GK2A 2WOSA 1R6PA 1YTZC 3DF0A 2QEOA 2LVKA 3R72A 1TNXA 1RJVA 1K9KA 4OZDA 4GBAA 3UO9A 4BY4A 1FF1A 1FI6A 4YGCB 1AVSA 3AAKA 4IL1A 3BXKA 1SR6B 1KSOA 1QV1A 4ORCB 1YRUB 1JF2A 3EVVA 3IVTA 1IQ5A 3PSRA 3I5FB 2LVVA 2ZNEA 1WRLA 1G8IA 2HQ8A 3AKBA 1DJGA 3CZ0A 2GTEA 1TNPA 2JXLA 2ZN8A 3O78A 4ICBA 4MEWA 1KCYA 2JZIA 5DICA 1QXPA 4AQJA 4CFQA 1Y6WA 2KI4C 1IRJA 1SW8A 3PM2A 1UHJA 2D8NA 2ZNDA 1XFRA 4INWA 1W9ZA 3SS5A 1SL7A 2AUCA 3OGNA 2FCEA 2KBMA 2H8VA 3OB1B 2JT8A 1TUZA 1F71A 2LMVA 4INXA 1SMGA 4MLWA 4YI9A 5AXIA 2LVJA 2Y1MA 1CMFA 1CTRA 1LXFC 2PALA 1FBVA 1OE9B 2NCOA 3QMEA 1NSHA 1M31A 4I5JA 3S0GA 2VRGA 1R2UA 2Y4QA 1SL8A 3AKAA 1DEKA 1CKKA 1NUBA 4OKHA 2K2AA 1SPYA 1K93D 1NX0A 5I8NA 1HT9A 3BUXB 2EC6C 4A4BA 4GAOA 1MUXA 1SCMC 2COLB 2KOTA 2P70A 3F45A 3L4AA 1KK7Z 2KAXA 3FIAA 2F3YA 4MVFA 1BODA 1NX1A 3OHMB 2Y1NA 3WHUB 3KHEA 2KSPA 3NSLA 1LINA 2JTZA 1JBAA 4AQIA 4QJ5B 3VRQA 1BJFA 4CIDA 3RLZA 1B8LA 4PE0A 2V53A 3SIBA 4WQ3A 1EH2A 2GV5A 4JKTA 4GUKA 3IQOA 3QRXA 4C0KA 3SG3A 3KF9A 1K90D 1M45A 4N1GA 5K89A 2JPTA 1B1GA 2CXJA 1OOHA 3BUNB 3D10A 3SS4A 1SL9A 2B1UA 1C3YA 2PYQA 1AHRA 3FS7A 1C7VA 2JXCA 2LUCA 5FYXA 2M7NA 1ODBA 2M8UA 3D0YA 4HRGA 1J55A 1QX7A 1SKTA 1J7RA 3KEVA 2JTTA 2F2OA 2KI6C 4C0LA 2JQ6A 1S3PA 1JC2A 1DELA 3SG5A 5HL1A 1B47A 2I94A 2L2EA 2EC6B 1G33A 1D1OA 2K0JA 2JNFA 3DVEA 2LP2A 1ALVA 5I94A 1S26D 1MR8A 2E6WA 1OOJA 3LCPC 5JJGA 3OX6A 1U5IA 1TUJA 3O2PA 3S0FA 1F55A 1QV0A 2P71A 3R1OA 1OOFA 2M3WA 3NSKA 4QJ3B 1TOPA 2JWWA 1KK8B 1NCZA 1UUSA 2KHNA 2WCJA 3BOWB 3O4XA 3BFHA 4XJKA 3VRNA 5HKWA 2HPSA 4ORAB 2KBIA 4DUQA 1XVJA 2JC2A 5HKZA 5DKQA 2MLFC 1OSAA 1OZOA 1SR6C 2MAZA 2ZKMX 2DOQA 2BL0C 2LC5A 4C0JA 2PRUA 2F2PA 3CZTX 3FWCA 3S0AA 1AP4A 1NCXA 3I5FC 1UHIA 1DTLA 4MBEA 3D76A 3A4UB 1GGZA 3FE9A 1SCVA 1N2DA 3RM1A 2YGUA 1F4OA 2PMYA 1MXEA 1XK4C 2L51A 2LHLA 2KLEA 4FQTA 3CTNA 2K7DA 1CFCA 1A29A 1YVLA 3BYAA 3I5IC 5D3OA 4BY5A 1NP8A 1EJ3A 3GK1A 1JWDA 1S6IA 4PHKA 1PALA 2PQLA 4I5LB 1BMOA 5IBWA 3D77A 3S0BA 2ERBA 3L47A 5ER4X 1HQVA 1FW4A 1WDCB 1LA3A 1XFZO 4I5NB 1KFUS 2IS9A 3SS3A 1AUIB 1B8CA 1K2HA 3CYZA 3EVRA 4ETOA 4DCKA 1SSEB 2KYFA 2L2CA 4NDBA 4P2YB 4ZCUA 1ZFSA 2LE9B 2GGMA 4GGNA 2WC5A 4XYNA 2QEHA 3CR5X 1RWYA 5KTYA 1B7TZ 3GK4X 3CGAA 4CPVA 2LNKA 1K8UA 1GQMA 4FTGA 3SG2A 1F70A 5CSNA 2NCPA 2BL0B 4N5XA 1Y1XA 1SBJA 2HF5A 1A4PA 1CM1A 3EKJA 1V1GA 2WCMA 4MN0A 1OW4A 1YR5A 3LL8B 3S0DA 2KAYA 4KYNA 2A4JA 3CLNA 1QLKA 1J1EA 1QVIZ 1Y0VH 3O4YA 4PHNA 1KFXS 3CR2A 2AAOA 3CR4X 4GGFA 3NHTA 1BF5A 3D74A 2FJUB 3B7AA 3I5IB 4M2OA 3OX5A 1CMGA 1M63B 3BUMB 2M1UA 2Y5IA 1B8RA 2MHHA 1KFUL 5CSJA 1BT6A 1YUUA 5AEQA 4CFRA 1NYAA 2FJYA 3VGOA 1TCFA 1XFYO 3OBVA 2M9GA 2AMIA 1B7TY 1DF0B 1JFKA 1MQ1A 2G2BA 3BUWB 3DZTA 4HSZA 2ZN9A 3DY9A 1QTXA 1E8AA 1QIWA 2KDHA 2FCDA 4ORBB 5BPJA 1XFVO 3LK0A 3TDZA 4D1EA 4JWQA 2KGRA 3GOFA 3TDIA 3WHTB 5PALA 4R1EA 1LA0A 2LAPA 1KQVA 2K2FA 2LM5A 3AAJA 5HYDA 1LS8A 1QVIY 1TTXA 3PALA 4M2PA 2M1KB 3B6XA 1S6CA 1KK8C 1NX2A 3I5GB 3TZ1A 1QLSA 1PSBA 5D7FA 1J1DA 1DQEA 2WCLA 1K95A 1OMVA 4U8DA 1RTP1 3TDUA 1F54A 1W7IB 1KFXL 1L7ZA 2WC6A 4JQ0D 1QS7A 4CLNA 4E68A 1WRZA 1S5GZ 2G9BA 2L5XB 3VROA 1S36A 2FOTA 2Q91A 3B87A 5AFPA 1IH0A 1TN4A 2I7AA 4MRXA 1IGVA 4P5OE 1DMOA 5EL2A 3D73A 1RK9A 1XFXO 3R1VA 3SIAA 3Q8IA 1IQ3A 3LK1A 1EG4A 1KK7Y 1KSMA 1NWDA 4HREE 4MZLA 1CNPA 2QDIA 2R2IA 1NCYA 1PULA 1GJYA 2K60A 1CDLA 1L2OC 1UHKA 3BUOB 1PVAA 1DVIA 1A75A 2LANA 3CABA 1SY9A 1WDCC 2BE4A 4DRWA 1QJTA 2BNXA 1W7JB 5F6TA 2GGZA 2CTNA 4PHMA 5KU1A 2LLTA 3SJSA 1JSAA 1DGUA 5J3XA 4USLA 3H4SE 1CLMA 1OQPA 1S5GY 5D69A 1K9UA 1CFPA 2LUXA 1QX5B 5B8IB 1C3ZA 3PLFB 1X02A 2EGDA 2LCPA 2LLUA 4I5KA 1B4CA 1F8HA 1DC1A 2M97A 4N1FA 5G08A 2OPOA 3BQ3A 3JTDB 1DJZA 1DJIA 1YUTA 1EXRA 1OMDA 2HQWA 1ZOTB 2ZRTA 5FI7A 1CFFA 5HKYA 1V1FA 1QATA 2WCFA 3CDNA 1Y1UA 1K9PA 1OOIX 2KNEA 2MA2A 1C7WA 1M39A 2H61C 3PM8A 3DVJA 4MRYA 1XK4A 5GQQC 2WORA 3K21A 3EG5B 3LLEA 2MRDA 4OVNF 2JPOA 3R1PA 1DT7B 1KWOB 2JOJA 2KQYA 3IF7A 4L9MA 1WLZA 1L2OB 2JU0A 1Y1AA 1UWOA 1XO5A 2CNPA 2NLNA 3DVKA 1B9AA 4OR9B 4YI8A 4WQ2A 1JF0A 4JPZB 2NZ0A 1QASA 2KPHA 5AERA 2BE6A 3NSIA 3KO0A 4YGDB 1YRTB 2OS8C 3NXAA 1QIVA 2P6BB 4FQOA 4PE7A 3WNXB 1JFJA 1BG1A 2JT3A 3VB1A 3D0YB 5CPVA 2RGIA 4F0ZB 2QEBA 1IKUA 2KFGA 1YUSA 3HX4A 2KFHA 4MZKA 4AOMA 1LVCD 1N65A 2BBNA 3D75A 1CLBA 2LP3A 2ZRSA 1IJ5A 1K94A 3CS1A 4DIRA 1M46A 1PVBA 3DVMA 1KQMB 3I5GC 2BAPA 2LHIA 2QEVA 2JT0A 5HLOA 1U5IB 1OOGA 4HRHA
chains in the Genus database with same CATH topology
1J7PA 4A4CA 2LLSA 1CFDA 3SG6A 1ALWA 1EG3A 1PRWA 2L4HA 4XJKB 3MSEB 4YGBB 2JNXA 2JULA 5DKNA 1NX3A 3TUYB 1PSRA 3I5HC 3NSOA 4GNKB 1BOCA 3KPXA 4UPGA 4PE4A 1YX7A 1XA5A 2F33A 1QX2A 2L4IA 5I2OA 2BCXA 2E30A 4YGAA 4QJ4B 3DD4A 2K7OA 1LKJA 2OS8B 2SCPA 1C07A 1SYMA 1J7QA 1TNQA 4GGFC 3ZWHA 1UHHA 3TS5C 1OZSA 1AJ5A 1TIZA 5AANA 2CBLA 3EKHA 2M49B 1BU3A 3E3RA 3BOWA 4DS7A 2BECA 1G4YR 2WC8A 2PASA 2L50A 1FI5A 1MWNA 3JTDC 3JVTB 3ZNIA 1OMRA 1TNWA 3DF0B 4MZJA 4M2QA 2SASA 2M7LA 1AK8A 2KYCA 1EL4A 1A03A 2L0PA 3I5HB 1BR1B 5DKRA 4PALA 1NIWA 1S1EA 1SK6D 1MF8B 1MXLC 1YX8A 3EVUA 1N0YA 2WCBA 2K61A 1GGWA 4Q04A 2KFFA 4MSPA 2KAVA 2I18A 2ZFDA 2TN4A 1KWOC 2ISDA 1ZMZA 2K7BA 1CB1A 1XYDA 1RECA 4YGEB 5ER5A 2LV7A 1WRKA 1H4BA 3PATA 1CDPA 1F4QA 2CT9A 1JUOA 1UP5A 1IG5A 2KI4B 2QACA 2WCEA 3EK8A 3OB2B 4OCIA 3A8RA 4YBHB 2KGBC 3TS5B 1RROA 2H2KA 2OTGC 1TRFA 3PN7C 4NQGA 1Q80A 2K7CA 2F8PA 5I2LA 2EHBA 2BKIB 1IWQA 1IJ6A 1DGVA 2MBXA 4ZCVA 5TNCA 3CWGA 1SNLA 1ZACA 1MHOA 5CSFA 2LMTA 1KQMC 1SCMB 2LMUA 2NXQA 2BCAA 1DJXA 2MLEC 1CDNA 5JOLA 3SG4A 1YVHA 3ICBA 1DJWA 3FWBA 2H61A 3VRPA 5KSZA 4GFTA 1AJ4A 4YRUA 1UHNA 4PCWA 1VRKA 3O6BA 1WLMA 3TUYC 1FPWA 2KQ6A 3EK7A 5HLVA 1BR4B 3IQQA 1YURA 4PDZA 4PHJA 2L98A 2KI6D 1XFWO 2MJWB 3M0WA 4PE1A 1TCOB 1K96A 2M0RA 4WRIA 4GPLB 1ZUZA 1CDMA 1DF0A 1XFUO 3C1VA 3HCMA 2O5GA 1S6JA 2K8MB 2PSRA 2OTGB 2QPTA 3PN7B 5CSIA 1NPQA 1UURA 2HETA 2O60A 3WXAA 3OP0A 1J7OA 1RFJA 2CCMA 2I2RE 1DJHA 2BCBA 2M29A 1BLQA 2LVIA 4TNCA 1CM4A 3SG7A 1A2XA 3PFVA 1CLLA 4NDDA 5I2QA 2F3ZA 4OV2A 1A75B 1H8BA 2BBMA 2BKHB 2Q4UA 1SRAA 1PK0D 1WY9A 3VRRA 2PVBA 1DJYA 2JRFA 2WNDA 3EK4A 4NDCA 3JVTC 3GK2A 2WOSA 1R6PA 1YTZC 3DF0A 2LVKA 1TNXA 1RJVA 1K9KA 1FF1A 4GBAA 4BY4A 1FI6A 4YGCB 1AVSA 3AAKA 4IL1A 3BXKA 1SR6B 1KSOA 1QV1A 4ORCB 1YRUB 1JF2A 3EVVA 1IQ5A 3PSRA 3I5FB 2LVVA 2ZNEA 1WRLA 1G8IA 2HQ8A 3AKBA 1DJGA 4ICBA 1TNPA 2JXLA 2ZN8A 3O78A 4MEWA 1KCYA 2JZIA 1QXPA 4AQJA 4CFQA 1Y6WA 2KI4C 1IRJA 1SW8A 1UHJA 2D8NA 2ZNDA 1SL7A 2AUCA 2FCEA 2KBMA 3OB1B 1F71A 2JT8A 2LMVA 4MLWA 1SMGA 4YI9A 5AXIA 2LVJA 2Y1MA 1CMFA 1CTRA 1LXFC 2PALA 1FBVA 1OE9B 2NCOA 4I5JA 1NSHA 1M31A 2VRGA 1R2UA 2Y4QA 1SL8A 3AKAA 1CKKA 1NUBA 4OKHA 2K2AA 1SPYA 1K93D 1NX0A 5I8NA 1HT9A 3BUXB 2EC6C 4A4BA 4GAOA 1MUXA 1SCMC 2COLB 2KOTA 3F45A 1KK7Z 2KAXA 3FIAA 2F3YA 4MVFA 1BODA 1NX1A 3OHMB 2Y1NA 3WHUB 3KHEA 2KSPA 3NSLA 1LINA 2JTZA 1JBAA 4AQIA 4QJ5B 3VRQA 1BJFA 4CIDA 3RLZA 1B8LA 4PE0A 2V53A 3SIBA 4WQ3A 1EH2A 2GV5A 4GUKA 3IQOA 3QRXA 4C0KA 3SG3A 3KF9A 1K90D 1M45A 4N1GA 5K89A 2JPTA 1B1GA 2CXJA 3BUNB 3D10A 1SL9A 2B1UA 3FS7A 1AHRA 1C7VA 2JXCA 2LUCA 5FYXA 2M7NA 1ODBA 2M8UA 3D0YA 4HRGA 1J55A 1QX7A 1SKTA 1J7RA 3KEVA 2JTTA 2F2OA 2KI6C 4C0LA 2JQ6A 1S3PA 1JC2A 3SG5A 1B47A 2I94A 2L2EA 2EC6B 1G33A 1D1OA 2K0JA 2JNFA 3DVEA 2LP2A 1ALVA 5JJGA 1S26D 1MR8A 2E6WA 1OOJA 3LCPC 3OX6A 1U5IA 3O2PA 1F55A 1QV0A 2M3WA 3NSKA 4QJ3B 1TOPA 2JWWA 1KK8B 1NCZA 1UUSA 2KHNA 3BOWB 4XJKA 3VRNA 5HKWA 2HPSA 4ORAB 2KBIA 4DUQA 1XVJA 2JC2A 5HKZA 5DKQA 2MLFC 1OSAA 1OZOA 1SR6C 2MAZA 2ZKMX 2DOQA 2BL0C 2LC5A 4C0JA 2PRUA 2F2PA 3CZTX 3FWCA 1AP4A 1NCXA 3I5FC 1UHIA 1DTLA 4MBEA 3A4UB 1GGZA 1SCVA 1N2DA 3RM1A 1F4OA 2PMYA 1MXEA 1XK4C 2L51A 2LHLA 3CTNA 2K7DA 1CFCA 1A29A 1YVLA 3BYAA 3I5IC 4BY5A 1NP8A 1EJ3A 3GK1A 1JWDA 1S6IA 4PHKA 1PALA 4I5LB 1BMOA 5IBWA 5ER4X 1HQVA 1FW4A 1WDCB 1LA3A 1XFZO 4I5NB 1KFUS 2IS9A 1AUIB 1B8CA 1K2HA 3EVRA 4ETOA 4DCKA 2KYFA 4NDBA 4P2YB 4ZCUA 1ZFSA 2LE9B 2GGMA 4GGNA 4XYNA 3CR5X 1RWYA 5KTYA 1B7TZ 3GK4X 3CGAA 4CPVA 2LNKA 1K8UA 1GQMA 4FTGA 3SG2A 1F70A 5CSNA 2NCPA 2BL0B 4N5XA 1Y1XA 1SBJA 2HF5A 1A4PA 1CM1A 3EKJA 1V1GA 4MN0A 1YR5A 3LL8B 2KAYA 2A4JA 3CLNA 1QLKA 1J1EA 1QVIZ 1Y0VH 3O4YA 4PHNA 1KFXS 3CR2A 2AAOA 3CR4X 4GGFA 1BF5A 2FJUB 3I5IB 4M2OA 3OX5A 1CMGA 1M63B 3BUMB 2M1UA 2Y5IA 1B8RA 2MHHA 1KFUL 5CSJA 1BT6A 1YUUA 5AEQA 4CFRA 1NYAA 3VGOA 1TCFA 1XFYO 2M9GA 2AMIA 1B7TY 1DF0B 1JFKA 1MQ1A 2G2BA 3BUWB 4HSZA 2ZN9A 1QTXA 1E8AA 1QIWA 2KDHA 2FCDA 4ORBB 5BPJA 1XFVO 3LK0A 3TDZA 4D1EA 4JWQA 2KGRA 3GOFA 3TDIA 3WHTB 5PALA 4R1EA 1LA0A 2LAPA 1KQVA 2K2FA 2LM5A 3AAJA 5HYDA 1QVIY 1TTXA 3PALA 4M2PA 2M1KB 1S6CA 1KK8C 1NX2A 3I5GB 3TZ1A 1QLSA 1PSBA 5D7FA 1J1DA 1K95A 1OMVA 4U8DA 1RTP1 3TDUA 1F54A 1W7IB 1KFXL 1L7ZA 4JQ0D 1QS7A 4CLNA 4E68A 1WRZA 1S5GZ 2G9BA 2L5XB 3VROA 1S36A 2FOTA 2Q91A 1IH0A 5AFPA 1TN4A 2I7AA 4MRXA 1IGVA 4P5OE 1DMOA 1RK9A 1XFXO 3SIAA 1IQ3A 3LK1A 1EG4A 1KK7Y 1KSMA 1NWDA 4HREE 4MZLA 1CNPA 2R2IA 1NCYA 1PULA 1GJYA 1CDLA 1L2OC 1UHKA 3BUOB 1PVAA 1DVIA 1A75A 2LANA 1SY9A 1WDCC 2BE4A 4DRWA 1QJTA 1W7JB 5F6TA 2GGZA 2CTNA 4PHMA 5KU1A 2LLTA 3SJSA 1JSAA 1DGUA 5J3XA 4USLA 3H4SE 1CLMA 1OQPA 1S5GY 5D69A 1K9UA 1CFPA 2LUXA 1QX5B 5B8IB 3PLFB 1X02A 2EGDA 2LCPA 2LLUA 4I5KA 1B4CA 1F8HA 2M97A 4N1FA 5G08A 2OPOA 3BQ3A 3JTDB 1DJZA 1DJIA 1YUTA 1EXRA 1OMDA 2HQWA 1ZOTB 2ZRTA 1CFFA 5HKYA 1V1FA 1QATA 2WCFA 1Y1UA 1K9PA 2KNEA 2MA2A 1C7WA 1M39A 2H61C 3PM8A 3DVJA 4MRYA 1XK4A 5GQQC 2WORA 3K21A 3LLEA 2MRDA 4OVNF 1DT7B 1KWOB 2JOJA 2KQYA 3IF7A 4L9MA 1WLZA 1L2OB 2JU0A 1Y1AA 1UWOA 1XO5A 2CNPA 2NLNA 3DVKA 1B9AA 4OR9B 4YI8A 4WQ2A 1JF0A 4JPZB 2NZ0A 1QASA 5AERA 2BE6A 3NSIA 3KO0A 4YGDB 1YRTB 2OS8C 3NXAA 1QIVA 2P6BB 4FQOA 4PE7A 3WNXB 1JFJA 1BG1A 2JT3A 3D0YB 5CPVA 2RGIA 4F0ZB 1IKUA 2KFGA 1YUSA 3HX4A 2KFHA 4MZKA 4AOMA 1LVCD 1N65A 2BBNA 1CLBA 2LP3A 2ZRSA 1IJ5A 1K94A 3CS1A 4DIRA 1M46A 1PVBA 3DVMA 1KQMB 3I5GC 2LHIA 2JT0A 5HLOA 1U5IB 4HRHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J7P A;  4A4C A;  2LLS A;  1CFD A;  3SG6 A;  1ALW A;  1EG3 A;  1PRW A;  2L4H A;  4XJK B;  3MSE B;  4YGB B;  2JNX A;  2JUL A;  5DKN A;  1NX3 A;  3TUY B;  1PSR A;  3I5H C;  3NSO A;  4GNK B;  1BOC A;  3KPX A;  4UPG A;  4PE4 A;  1YX7 A;  1XA5 A;  2F33 A;  1QX2 A;  2L4I A;  5I2O A;  2BCX A;  2E30 A;  4YGA A;  4QJ4 B;  3DD4 A;  2K7O A;  1LKJ A;  2OS8 B;  2SCP A;  1C07 A;  1SYM A;  1J7Q A;  1TNQ A;  4GGF C;  3ZWH A;  1UHH A;  3TS5 C;  1OZS A;  1AJ5 A;  1TIZ A;  5AAN A;  2CBL A;  3EKH A;  2M49 B;  1BU3 A;  3E3R A;  3BOW A;  4DS7 A;  2BEC A;  1G4Y R;  2WC8 A;  2PAS A;  2L50 A;  1FI5 A;  1MWN A;  3JTD C;  3JVT B;  3ZNI A;  1OMR A;  1TNW A;  3DF0 B;  4MZJ A;  4M2Q A;  2SAS A;  2M7L A;  1AK8 A;  2KYC A;  1EL4 A;  1A03 A;  2L0P A;  3I5H B;  1BR1 B;  5DKR A;  4PAL A;  1NIW A;  1S1E A;  1SK6 D;  1MF8 B;  1MXL C;  1YX8 A;  3EVU A;  1N0Y A;  2WCB A;  2K61 A;  1GGW A;  4Q04 A;  2KFF A;  4MSP A;  2KAV A;  2I18 A;  2ZFD A;  2TN4 A;  1KWO C;  2ISD A;  1ZMZ A;  2K7B A;  1CB1 A;  1XYD A;  1REC A;  4YGE B;  5ER5 A;  2LV7 A;  1WRK A;  1H4B A;  3PAT A;  1CDP A;  1F4Q A;  2CT9 A;  1JUO A;  1UP5 A;  1IG5 A;  2KI4 B;  2QAC A;  2WCE A;  3EK8 A;  3OB2 B;  4OCI A;  3A8R A;  4YBH B;  2KGB C;  3TS5 B;  1RRO A;  2H2K A;  2OTG C;  1TRF A;  3PN7 C;  4NQG A;  1Q80 A;  2K7C A;  2F8P A;  5I2L A;  2EHB A;  2BKI B;  1IWQ A;  1IJ6 A;  1DGV A;  2MBX A;  4ZCV A;  5TNC A;  3CWG A;  1SNL A;  1ZAC A;  1MHO A;  5CSF A;  2LMT A;  1KQM C;  1SCM B;  2LMU A;  2NXQ A;  2BCA A;  1DJX A;  2MLE C;  1CDN A;  5JOL A;  3SG4 A;  1YVH A;  3ICB A;  1DJW A;  3FWB A;  2H61 A;  3VRP A;  5KSZ A;  4GFT A;  1AJ4 A;  4YRU A;  1UHN A;  4PCW A;  1VRK A;  3O6B A;  1WLM A;  3TUY C;  1FPW A;  2KQ6 A;  3EK7 A;  5HLV A;  1BR4 B;  3IQQ A;  1YUR A;  4PDZ A;  4PHJ A;  2L98 A;  2KI6 D;  1XFW O;  2MJW B;  3M0W A;  4PE1 A;  1TCO B;  1K96 A;  2M0R A;  4WRI A;  4GPL B;  1ZUZ A;  1CDM A;  1DF0 A;  1XFU O;  3C1V A;  3HCM A;  2O5G A;  1S6J A;  2K8M B;  2PSR A;  2OTG B;  2QPT A;  3PN7 B;  5CSI A;  1NPQ A;  1UUR A;  2HET A;  2O60 A;  3WXA A;  3OP0 A;  1J7O A;  1RFJ A;  2CCM A;  2I2R E;  1DJH A;  2BCB A;  2M29 A;  1BLQ A;  2LVI A;  4TNC A;  1CM4 A;  3SG7 A;  1A2X A;  3PFV A;  1CLL A;  4NDD A;  5I2Q A;  2F3Z A;  4OV2 A;  1A75 B;  1H8B A;  2BBM A;  2BKH B;  2Q4U A;  1SRA A;  1PK0 D;  1WY9 A;  3VRR A;  2PVB A;  1DJY A;  2JRF A;  2WND A;  3EK4 A;  4NDC A;  3JVT C;  3GK2 A;  2WOS A;  1R6P A;  1YTZ C;  3DF0 A;  2LVK A;  1TNX A;  1RJV A;  1K9K A;  1FF1 A;  4GBA A;  4BY4 A;  1FI6 A;  4YGC B;  1AVS A;  3AAK A;  4IL1 A;  3BXK A;  1SR6 B;  1KSO A;  1QV1 A;  4ORC B;  1YRU B;  1JF2 A;  3EVV A;  1IQ5 A;  3PSR A;  3I5F B;  2LVV A;  2ZNE A;  1WRL A;  1G8I A;  2HQ8 A;  3AKB A;  1DJG A;  4ICB A;  1TNP A;  2JXL A;  2ZN8 A;  3O78 A;  4MEW A;  1KCY A;  2JZI A;  1QXP A;  4AQJ A;  4CFQ A;  1Y6W A;  2KI4 C;  1IRJ A;  1SW8 A;  1UHJ A;  2D8N A;  2ZND A;  1SL7 A;  2AUC A;  2FCE A;  2KBM A;  3OB1 B;  1F71 A;  2JT8 A;  2LMV A;  4MLW A;  1SMG A;  4YI9 A;  5AXI A;  2LVJ A;  2Y1M A;  1CMF A;  1CTR A;  1LXF C;  2PAL A;  1FBV A;  1OE9 B;  2NCO A;  4I5J A;  1NSH A;  1M31 A;  2VRG A;  1R2U A;  2Y4Q A;  1SL8 A;  3AKA A;  1CKK A;  1NUB A;  4OKH A;  2K2A A;  1SPY A;  1K93 D;  1NX0 A;  5I8N A;  1HT9 A;  3BUX B;  2EC6 C;  4A4B A;  4GAO A;  1MUX A;  1SCM C;  2COL B;  2KOT A;  3F45 A;  1KK7 Z;  2KAX A;  3FIA A;  2F3Y A;  4MVF A;  1BOD A;  1NX1 A;  3OHM B;  2Y1N A;  3WHU B;  3KHE A;  2KSP A;  3NSL A;  1LIN A;  2JTZ A;  1JBA A;  4AQI A;  4QJ5 B;  3VRQ A;  1BJF A;  4CID A;  3RLZ A;  1B8L A;  4PE0 A;  2V53 A;  3SIB A;  4WQ3 A;  1EH2 A;  2GV5 A;  4GUK A;  3IQO A;  3QRX A;  4C0K A;  3SG3 A;  3KF9 A;  1K90 D;  1M45 A;  4N1G A;  5K89 A;  2JPT A;  1B1G A;  2CXJ A;  3BUN B;  3D10 A;  1SL9 A;  2B1U A;  3FS7 A;  1AHR A;  1C7V A;  2JXC A;  2LUC A;  5FYX A;  2M7N A;  1ODB A;  2M8U A;  3D0Y A;  4HRG A;  1J55 A;  1QX7 A;  1SKT A;  1J7R A;  3KEV A;  2JTT A;  2F2O A;  2KI6 C;  4C0L A;  2JQ6 A;  1S3P A;  1JC2 A;  3SG5 A;  1B47 A;  2I94 A;  2L2E A;  2EC6 B;  1G33 A;  1D1O A;  2K0J A;  2JNF A;  3DVE A;  2LP2 A;  1ALV A;  5JJG A;  1S26 D;  1MR8 A;  2E6W A;  1OOJ A;  3LCP C;  3OX6 A;  1U5I A;  3O2P A;  1F55 A;  1QV0 A;  2M3W A;  3NSK A;  4QJ3 B;  1TOP A;  2JWW A;  1KK8 B;  1NCZ A;  1UUS A;  2KHN A;  3BOW B;  4XJK A;  3VRN A;  5HKW A;  2HPS A;  4ORA B;  2KBI A;  4DUQ A;  1XVJ A;  2JC2 A;  5HKZ A;  5DKQ A;  2MLF C;  1OSA A;  1OZO A;  1SR6 C;  2MAZ A;  2ZKM X;  2DOQ A;  2BL0 C;  2LC5 A;  4C0J A;  2PRU A;  2F2P A;  3CZT X;  3FWC A;  1AP4 A;  1NCX A;  3I5F C;  1UHI A;  1DTL A;  4MBE A;  3A4U B;  1GGZ A;  1SCV A;  1N2D A;  3RM1 A;  1F4O A;  2PMY A;  1MXE A;  1XK4 C;  2L51 A;  2LHL A;  3CTN A;  2K7D A;  1CFC A;  1A29 A;  1YVL A;  3BYA A;  3I5I C;  4BY5 A;  1NP8 A;  1EJ3 A;  3GK1 A;  1JWD A;  1S6I A;  4PHK A;  1PAL A;  4I5L B;  1BMO A;  5IBW A;  5ER4 X;  1HQV A;  1FW4 A;  1WDC B;  1LA3 A;  1XFZ O;  4I5N B;  1KFU S;  2IS9 A;  1AUI B;  1B8C A;  1K2H A;  3EVR A;  4ETO A;  4DCK A;  2KYF A;  4NDB A;  4P2Y B;  4ZCU A;  1ZFS A;  2LE9 B;  2GGM A;  4GGN A;  4XYN A;  3CR5 X;  1RWY A;  5KTY A;  1B7T Z;  3GK4 X;  3CGA A;  4CPV A;  2LNK A;  1K8U A;  1GQM A;  4FTG A;  3SG2 A;  1F70 A;  5CSN A;  2NCP A;  2BL0 B;  4N5X A;  1Y1X A;  1SBJ A;  2HF5 A;  1A4P A;  1CM1 A;  3EKJ A;  1V1G A;  4MN0 A;  1YR5 A;  3LL8 B;  2KAY A;  2A4J A;  3CLN A;  1QLK A;  1J1E A;  1QVI Z;  1Y0V H;  3O4Y A;  4PHN A;  1KFX S;  3CR2 A;  2AAO A;  3CR4 X;  4GGF A;  1BF5 A;  2FJU B;  3I5I B;  4M2O A;  3OX5 A;  1CMG A;  1M63 B;  3BUM B;  2M1U A;  2Y5I A;  1B8R A;  2MHH A;  1KFU L;  5CSJ A;  1BT6 A;  1YUU A;  5AEQ A;  4CFR A;  1NYA A;  3VGO A;  1TCF A;  1XFY O;  2M9G A;  2AMI A;  1B7T Y;  1DF0 B;  1JFK A;  1MQ1 A;  2G2B A;  3BUW B;  4HSZ A;  2ZN9 A;  1QTX A;  1E8A A;  1QIW A;  2KDH A;  2FCD A;  4ORB B;  5BPJ A;  1XFV O;  3LK0 A;  3TDZ A;  4D1E A;  4JWQ A;  2KGR A;  3GOF A;  3TDI A;  3WHT B;  5PAL A;  4R1E A;  1LA0 A;  2LAP A;  1KQV A;  2K2F A;  2LM5 A;  3AAJ A;  5HYD A;  1QVI Y;  1TTX A;  3PAL A;  4M2P A;  2M1K B;  1S6C A;  1KK8 C;  1NX2 A;  3I5G B;  3TZ1 A;  1QLS A;  1PSB A;  5D7F A;  1J1D A;  1K95 A;  1OMV A;  4U8D A;  1RTP 1;  3TDU A;  1F54 A;  1W7I B;  1KFX L;  1L7Z A;  4JQ0 D;  1QS7 A;  4CLN A;  4E68 A;  1WRZ A;  1S5G Z;  2G9B A;  2L5X B;  3VRO A;  1S36 A;  2FOT A;  2Q91 A;  1IH0 A;  5AFP A;  1TN4 A;  2I7A A;  4MRX A;  1IGV A;  4P5O E;  1DMO A;  1RK9 A;  1XFX O;  3SIA A;  1IQ3 A;  3LK1 A;  1EG4 A;  1KK7 Y;  1KSM A;  1NWD A;  4HRE E;  4MZL A;  1CNP A;  2R2I A;  1NCY A;  1PUL A;  1GJY A;  1CDL A;  1L2O C;  1UHK A;  3BUO B;  1PVA A;  1DVI A;  1A75 A;  2LAN A;  1SY9 A;  1WDC C;  2BE4 A;  4DRW A;  1QJT A;  1W7J B;  5F6T A;  2GGZ A;  2CTN A;  4PHM A;  5KU1 A;  2LLT A;  3SJS A;  1JSA A;  1DGU A;  5J3X A;  4USL A;  3H4S E;  1CLM A;  1OQP A;  1S5G Y;  5D69 A;  1K9U A;  1CFP A;  2LUX A;  1QX5 B;  5B8I B;  3PLF B;  1X02 A;  2EGD A;  2LCP A;  2LLU A;  4I5K A;  1B4C A;  1F8H A;  2M97 A;  4N1F A;  5G08 A;  2OPO A;  3BQ3 A;  3JTD B;  1DJZ A;  1DJI A;  1YUT A;  1EXR A;  1OMD A;  2HQW A;  1ZOT B;  2ZRT A;  1CFF A;  5HKY A;  1V1F A;  1QAT A;  2WCF A;  1Y1U A;  1K9P A;  2KNE A;  2MA2 A;  1C7W A;  1M39 A;  2H61 C;  3PM8 A;  3DVJ A;  4MRY A;  1XK4 A;  5GQQ C;  2WOR A;  3K21 A;  3LLE A;  2MRD A;  4OVN F;  1DT7 B;  1KWO B;  2JOJ A;  2KQY A;  3IF7 A;  4L9M A;  1WLZ A;  1L2O B;  2JU0 A;  1Y1A A;  1UWO A;  1XO5 A;  2CNP A;  2NLN A;  3DVK A;  1B9A A;  4OR9 B;  4YI8 A;  4WQ2 A;  1JF0 A;  4JPZ B;  2NZ0 A;  1QAS A;  5AER A;  2BE6 A;  3NSI A;  3KO0 A;  4YGD B;  1YRT B;  2OS8 C;  3NXA A;  1QIV A;  2P6B B;  4FQO A;  4PE7 A;  3WNX B;  1JFJ A;  1BG1 A;  2JT3 A;  3D0Y B;  5CPV A;  2RGI A;  4F0Z B;  1IKU A;  2KFG A;  1YUS A;  3HX4 A;  2KFH A;  4MZK A;  4AOM A;  1LVC D;  1N65 A;  2BBN A;  1CLB A;  2LP3 A;  2ZRS A;  1IJ5 A;  1K94 A;  3CS1 A;  4DIR A;  1M46 A;  1PVB A;  3DVM A;  1KQM B;  3I5G C;  2LHI A;  2JT0 A;  5HLO A;  1U5I B;  4HRH A; 
#chains in the Genus database with same CATH topology
 1J7P A;  1ORG A;  3DYE A;  4A4C A;  2LLS A;  1CFD A;  3SG6 A;  1ALW A;  1EG3 A;  1PRW A;  2L4H A;  4XJK B;  3MSE B;  4YGB B;  2JNX A;  2JUL A;  5DKN A;  1NX3 A;  3TUY B;  3BJH A;  1PSR A;  3I5H C;  3NSO A;  1QWV A;  4GNK B;  1BOC A;  1T14 A;  3KPX A;  3BFA A;  4PE4 A;  4UPG A;  1YX7 A;  1XA5 A;  2F33 A;  1QX2 A;  3PJI A;  2L4I A;  5I2O A;  2BCX A;  2E30 A;  4YGA A;  4QJ4 B;  2WCK A;  3DD4 A;  2K7O A;  1LKJ A;  2OS8 B;  2SCP A;  1C07 A;  1SYM A;  1GM0 A;  1Z2C B;  1J7Q A;  1TNQ A;  4GGF C;  3BFB A;  3ZWH A;  1UHH A;  3TS5 C;  1OZS A;  1AJ5 A;  1TIZ A;  5AAN A;  1IIO A;  2CBL A;  3EKH A;  2M49 B;  3N7H A;  1BU3 A;  3E3R A;  3BOW A;  4DS7 A;  2BEC A;  1G4Y R;  2WC8 A;  2PAS A;  2L50 A;  1FI5 A;  1MWN A;  3JTD C;  3JVT B;  3ZNI A;  1OMR A;  1TNW A;  3DF0 B;  3DXL A;  4M2Q A;  2SAS A;  4MZJ A;  2M7L A;  1AK8 A;  5FI6 A;  2KYC A;  1EL4 A;  1A03 A;  2L0P A;  3I5H B;  1BR1 B;  5DKR A;  4PAL A;  1NIW A;  1S1E A;  1SK6 D;  3NHI A;  1MF8 B;  1MXL C;  1YX8 A;  3EVU A;  3NGV A;  1N0Y A;  4PT1 A;  2WCB A;  2K61 A;  1GGW A;  4Q04 A;  2KFF A;  4MSP A;  2KAV A;  2I18 A;  2ZFD A;  2TN4 A;  1KWO C;  2ISD A;  1ZMZ A;  2K7B A;  1CB1 A;  1XYD A;  1REC A;  4YGE B;  5ER5 A;  2LV7 A;  1WRK A;  1H4B A;  3PAT A;  1CDP A;  1F4Q A;  2CT9 A;  1JUO A;  1UP5 A;  1IG5 A;  2KI4 B;  2QAC A;  2WCE A;  3EK8 A;  3OB2 B;  4OCI A;  3A8R A;  4YBH B;  2KGB C;  3TS5 B;  1RRO A;  2H2K A;  2OTG C;  1TRF A;  3PN7 C;  4NQG A;  1Q80 A;  1TWO A;  2K7C A;  2F8P A;  3D78 A;  5I2L A;  2EHB A;  3CZ2 A;  2BKI B;  1IWQ A;  1IJ6 A;  1DGV A;  2MBX A;  4ZCV A;  5TNC A;  3CWG A;  1SNL A;  3UNW A;  1ZAC A;  1MHO A;  3FE8 A;  5CSF A;  4IJ7 A;  2LMT A;  1KQM C;  1SCM B;  2LMU A;  2NXQ A;  3RZS A;  3FE6 A;  2BCA A;  1DJX A;  2MLE C;  1CDN A;  5JOL A;  3SG4 A;  1YVH A;  3ICB A;  1DJW A;  3B88 A;  2H61 A;  3FWB A;  3VRP A;  5KSZ A;  4GFT A;  2L5Y A;  1AJ4 A;  4YRU A;  1UHN A;  2WCH A;  4PCW A;  1VRK A;  3CZ1 A;  3O6B A;  1WLM A;  3TUY C;  1FPW A;  4F7F A;  2KQ6 A;  3EK7 A;  5HLV A;  1BR4 B;  3IQQ A;  1YUR A;  4PDZ A;  4PHJ A;  2L98 A;  2KI6 D;  1XFW O;  2MJW B;  3M0W A;  4PE1 A;  1TCO B;  1K96 A;  2KLD A;  1P28 A;  2M0R A;  1ZUZ A;  4GPL B;  4WRI A;  1CDM A;  1DF0 A;  1XFU O;  3C1V A;  3HCM A;  2O5G A;  1S6J A;  2K8M B;  2PSR A;  2OTG B;  2QPT A;  3B86 A;  3PN7 B;  5CSI A;  1NPQ A;  1UUR A;  2HET A;  2O60 A;  3WXA A;  3OP0 A;  1J7O A;  1RFJ A;  2CCM A;  2I2R E;  1DJH A;  2BCB A;  2M29 A;  3L4L A;  1BLQ A;  1Z4H A;  2LVI A;  4TNC A;  1CM4 A;  3SG7 A;  1A2X A;  3PFV A;  1CLL A;  4NDD A;  5FI2 A;  5I2Q A;  2F3Z A;  4OV2 A;  1A75 B;  4JD9 A;  3S0E A;  2BBM A;  2BKH B;  2Q4U A;  1H8B A;  1SRA A;  1PK0 D;  1WY9 A;  3V2L A;  3K1E A;  3VRR A;  2PVB A;  1DJY A;  2JRF A;  2WND A;  3EK4 A;  4NDC A;  3JVT C;  3GK2 A;  2WOS A;  1R6P A;  1YTZ C;  3DF0 A;  2QEO A;  2LVK A;  3R72 A;  1TNX A;  1RJV A;  1K9K A;  4OZD A;  4GBA A;  3UO9 A;  4BY4 A;  1FF1 A;  1FI6 A;  4YGC B;  1AVS A;  3AAK A;  4IL1 A;  3BXK A;  1SR6 B;  1KSO A;  1QV1 A;  4ORC B;  1YRU B;  1JF2 A;  3EVV A;  3IVT A;  1IQ5 A;  3PSR A;  3I5F B;  2LVV A;  2ZNE A;  1WRL A;  1G8I A;  2HQ8 A;  3AKB A;  1DJG A;  3CZ0 A;  2GTE A;  1TNP A;  2JXL A;  2ZN8 A;  3O78 A;  4ICB A;  4MEW A;  1KCY A;  2JZI A;  5DIC A;  1QXP A;  4AQJ A;  4CFQ A;  1Y6W A;  2KI4 C;  1IRJ A;  1SW8 A;  3PM2 A;  1UHJ A;  2D8N A;  2ZND A;  1XFR A;  4INW A;  1W9Z A;  3SS5 A;  1SL7 A;  2AUC A;  3OGN A;  2FCE A;  2KBM A;  2H8V A;  3OB1 B;  2JT8 A;  1TUZ A;  1F71 A;  2LMV A;  4INX A;  1SMG A;  4MLW A;  4YI9 A;  5AXI A;  2LVJ A;  2Y1M A;  1CMF A;  1CTR A;  1LXF C;  2PAL A;  1FBV A;  1OE9 B;  2NCO A;  3QME A;  1NSH A;  1M31 A;  4I5J A;  3S0G A;  2VRG A;  1R2U A;  2Y4Q A;  1SL8 A;  3AKA A;  1DEK A;  1CKK A;  1NUB A;  4OKH A;  2K2A A;  1SPY A;  1K93 D;  1NX0 A;  5I8N A;  1HT9 A;  3BUX B;  2EC6 C;  4A4B A;  4GAO A;  1MUX A;  1SCM C;  2COL B;  2KOT A;  2P70 A;  3F45 A;  3L4A A;  1KK7 Z;  2KAX A;  3FIA A;  2F3Y A;  4MVF A;  1BOD A;  1NX1 A;  3OHM B;  2Y1N A;  3WHU B;  3KHE A;  2KSP A;  3NSL A;  1LIN A;  2JTZ A;  1JBA A;  4AQI A;  4QJ5 B;  3VRQ A;  1BJF A;  4CID A;  3RLZ A;  1B8L A;  4PE0 A;  2V53 A;  3SIB A;  4WQ3 A;  1EH2 A;  2GV5 A;  4JKT A;  4GUK A;  3IQO A;  3QRX A;  4C0K A;  3SG3 A;  3KF9 A;  1K90 D;  1M45 A;  4N1G A;  5K89 A;  2JPT A;  1B1G A;  2CXJ A;  1OOH A;  3BUN B;  3D10 A;  3SS4 A;  1SL9 A;  2B1U A;  1C3Y A;  2PYQ A;  1AHR A;  3FS7 A;  1C7V A;  2JXC A;  2LUC A;  5FYX A;  2M7N A;  1ODB A;  2M8U A;  3D0Y A;  4HRG A;  1J55 A;  1QX7 A;  1SKT A;  1J7R A;  3KEV A;  2JTT A;  2F2O A;  2KI6 C;  4C0L A;  2JQ6 A;  1S3P A;  1JC2 A;  1DEL A;  3SG5 A;  5HL1 A;  1B47 A;  2I94 A;  2L2E A;  2EC6 B;  1G33 A;  1D1O A;  2K0J A;  2JNF A;  3DVE A;  2LP2 A;  1ALV A;  5I94 A;  1S26 D;  1MR8 A;  2E6W A;  1OOJ A;  3LCP C;  5JJG A;  3OX6 A;  1U5I A;  1TUJ A;  3O2P A;  3S0F A;  1F55 A;  1QV0 A;  2P71 A;  3R1O A;  1OOF A;  2M3W A;  3NSK A;  4QJ3 B;  1TOP A;  2JWW A;  1KK8 B;  1NCZ A;  1UUS A;  2KHN A;  2WCJ A;  3BOW B;  3O4X A;  3BFH A;  4XJK A;  3VRN A;  5HKW A;  2HPS A;  4ORA B;  2KBI A;  4DUQ A;  1XVJ A;  2JC2 A;  5HKZ A;  5DKQ A;  2MLF C;  1OSA A;  1OZO A;  1SR6 C;  2MAZ A;  2ZKM X;  2DOQ A;  2BL0 C;  2LC5 A;  4C0J A;  2PRU A;  2F2P A;  3CZT X;  3FWC A;  3S0A A;  1AP4 A;  1NCX A;  3I5F C;  1UHI A;  1DTL A;  4MBE A;  3D76 A;  3A4U B;  1GGZ A;  3FE9 A;  1SCV A;  1N2D A;  3RM1 A;  2YGU A;  1F4O A;  2PMY A;  1MXE A;  1XK4 C;  2L51 A;  2LHL A;  2KLE A;  4FQT A;  3CTN A;  2K7D A;  1CFC A;  1A29 A;  1YVL A;  3BYA A;  3I5I C;  5D3O A;  4BY5 A;  1NP8 A;  1EJ3 A;  3GK1 A;  1JWD A;  1S6I A;  4PHK A;  1PAL A;  2PQL A;  4I5L B;  1BMO A;  5IBW A;  3D77 A;  3S0B A;  2ERB A;  3L47 A;  5ER4 X;  1HQV A;  1FW4 A;  1WDC B;  1LA3 A;  1XFZ O;  4I5N B;  1KFU S;  2IS9 A;  3SS3 A;  1AUI B;  1B8C A;  1K2H A;  3CYZ A;  3EVR A;  4ETO A;  4DCK A;  1SSE B;  2KYF A;  2L2C A;  4NDB A;  4P2Y B;  4ZCU A;  1ZFS A;  2LE9 B;  2GGM A;  4GGN A;  2WC5 A;  4XYN A;  2QEH A;  3CR5 X;  1RWY A;  5KTY A;  1B7T Z;  3GK4 X;  3CGA A;  4CPV A;  2LNK A;  1K8U A;  1GQM A;  4FTG A;  3SG2 A;  1F70 A;  5CSN A;  2NCP A;  2BL0 B;  4N5X A;  1Y1X A;  1SBJ A;  2HF5 A;  1A4P A;  1CM1 A;  3EKJ A;  1V1G A;  2WCM A;  4MN0 A;  1OW4 A;  1YR5 A;  3LL8 B;  3S0D A;  2KAY A;  4KYN A;  2A4J A;  3CLN A;  1QLK A;  1J1E A;  1QVI Z;  1Y0V H;  3O4Y A;  4PHN A;  1KFX S;  3CR2 A;  2AAO A;  3CR4 X;  4GGF A;  3NHT A;  1BF5 A;  3D74 A;  2FJU B;  3B7A A;  3I5I B;  4M2O A;  3OX5 A;  1CMG A;  1M63 B;  3BUM B;  2M1U A;  2Y5I A;  1B8R A;  2MHH A;  1KFU L;  5CSJ A;  1BT6 A;  1YUU A;  5AEQ A;  4CFR A;  1NYA A;  2FJY A;  3VGO A;  1TCF A;  1XFY O;  3OBV A;  2M9G A;  2AMI A;  1B7T Y;  1DF0 B;  1JFK A;  1MQ1 A;  2G2B A;  3BUW B;  3DZT A;  4HSZ A;  2ZN9 A;  3DY9 A;  1QTX A;  1E8A A;  1QIW A;  2KDH A;  2FCD A;  4ORB B;  5BPJ A;  1XFV O;  3LK0 A;  3TDZ A;  4D1E A;  4JWQ A;  2KGR A;  3GOF A;  3TDI A;  3WHT B;  5PAL A;  4R1E A;  1LA0 A;  2LAP A;  1KQV A;  2K2F A;  2LM5 A;  3AAJ A;  5HYD A;  1LS8 A;  1QVI Y;  1TTX A;  3PAL A;  4M2P A;  2M1K B;  3B6X A;  1S6C A;  1KK8 C;  1NX2 A;  3I5G B;  3TZ1 A;  1QLS A;  1PSB A;  5D7F A;  1J1D A;  1DQE A;  2WCL A;  1K95 A;  1OMV A;  4U8D A;  1RTP 1;  3TDU A;  1F54 A;  1W7I B;  1KFX L;  1L7Z A;  2WC6 A;  4JQ0 D;  1QS7 A;  4CLN A;  4E68 A;  1WRZ A;  1S5G Z;  2G9B A;  2L5X B;  3VRO A;  1S36 A;  2FOT A;  2Q91 A;  3B87 A;  5AFP A;  1IH0 A;  1TN4 A;  2I7A A;  4MRX A;  1IGV A;  4P5O E;  1DMO A;  5EL2 A;  3D73 A;  1RK9 A;  1XFX O;  3R1V A;  3SIA A;  3Q8I A;  1IQ3 A;  3LK1 A;  1EG4 A;  1KK7 Y;  1KSM A;  1NWD A;  4HRE E;  4MZL A;  1CNP A;  2QDI A;  2R2I A;  1NCY A;  1PUL A;  1GJY A;  2K60 A;  1CDL A;  1L2O C;  1UHK A;  3BUO B;  1PVA A;  1DVI A;  1A75 A;  2LAN A;  3CAB A;  1SY9 A;  1WDC C;  2BE4 A;  4DRW A;  1QJT A;  2BNX A;  1W7J B;  5F6T A;  2GGZ A;  2CTN A;  4PHM A;  5KU1 A;  2LLT A;  3SJS A;  1JSA A;  1DGU A;  5J3X A;  4USL A;  3H4S E;  1CLM A;  1OQP A;  1S5G Y;  5D69 A;  1K9U A;  1CFP A;  2LUX A;  1QX5 B;  5B8I B;  1C3Z A;  3PLF B;  1X02 A;  2EGD A;  2LCP A;  2LLU A;  4I5K A;  1B4C A;  1F8H A;  1DC1 A;  2M97 A;  4N1F A;  5G08 A;  2OPO A;  3BQ3 A;  3JTD B;  1DJZ A;  1DJI A;  1YUT A;  1EXR A;  1OMD A;  2HQW A;  1ZOT B;  2ZRT A;  5FI7 A;  1CFF A;  5HKY A;  1V1F A;  1QAT A;  2WCF A;  3CDN A;  1Y1U A;  1K9P A;  1OOI X;  2KNE A;  2MA2 A;  1C7W A;  1M39 A;  2H61 C;  3PM8 A;  3DVJ A;  4MRY A;  1XK4 A;  5GQQ C;  2WOR A;  3K21 A;  3EG5 B;  3LLE A;  2MRD A;  4OVN F;  2JPO A;  3R1P A;  1DT7 B;  1KWO B;  2JOJ A;  2KQY A;  3IF7 A;  4L9M A;  1WLZ A;  1L2O B;  2JU0 A;  1Y1A A;  1UWO A;  1XO5 A;  2CNP A;  2NLN A;  3DVK A;  1B9A A;  4OR9 B;  4YI8 A;  4WQ2 A;  1JF0 A;  4JPZ B;  2NZ0 A;  1QAS A;  2KPH A;  5AER A;  2BE6 A;  3NSI A;  3KO0 A;  4YGD B;  1YRT B;  2OS8 C;  3NXA A;  1QIV A;  2P6B B;  4FQO A;  4PE7 A;  3WNX B;  1JFJ A;  1BG1 A;  2JT3 A;  3VB1 A;  3D0Y B;  5CPV A;  2RGI A;  4F0Z B;  2QEB A;  1IKU A;  2KFG A;  1YUS A;  3HX4 A;  2KFH A;  4MZK A;  4AOM A;  1LVC D;  1N65 A;  2BBN A;  3D75 A;  1CLB A;  2LP3 A;  2ZRS A;  1IJ5 A;  1K94 A;  3CS1 A;  4DIR A;  1M46 A;  1PVB A;  3DVM A;  1KQM B;  3I5G C;  2BAP A;  2LHI A;  2QEV A;  2JT0 A;  5HLO A;  1U5I B;  1OOG A;  4HRH A; 
#chains in the Genus database with same CATH homology
 1J7P A;  4A4C A;  2LLS A;  1CFD A;  3SG6 A;  1ALW A;  1EG3 A;  1PRW A;  2L4H A;  4XJK B;  3MSE B;  4YGB B;  2JNX A;  2JUL A;  5DKN A;  1NX3 A;  3TUY B;  1PSR A;  3I5H C;  3NSO A;  4GNK B;  1BOC A;  3KPX A;  4UPG A;  4PE4 A;  1YX7 A;  1XA5 A;  2F33 A;  1QX2 A;  2L4I A;  5I2O A;  2BCX A;  2E30 A;  4YGA A;  4QJ4 B;  3DD4 A;  2K7O A;  1LKJ A;  2OS8 B;  2SCP A;  1C07 A;  1SYM A;  1J7Q A;  1TNQ A;  4GGF C;  3ZWH A;  1UHH A;  3TS5 C;  1OZS A;  1AJ5 A;  1TIZ A;  5AAN A;  2CBL A;  3EKH A;  2M49 B;  1BU3 A;  3E3R A;  3BOW A;  4DS7 A;  2BEC A;  1G4Y R;  2WC8 A;  2PAS A;  2L50 A;  1FI5 A;  1MWN A;  3JTD C;  3JVT B;  3ZNI A;  1OMR A;  1TNW A;  3DF0 B;  4MZJ A;  4M2Q A;  2SAS A;  2M7L A;  1AK8 A;  2KYC A;  1EL4 A;  1A03 A;  2L0P A;  3I5H B;  1BR1 B;  5DKR A;  4PAL A;  1NIW A;  1S1E A;  1SK6 D;  1MF8 B;  1MXL C;  1YX8 A;  3EVU A;  1N0Y A;  2WCB A;  2K61 A;  1GGW A;  4Q04 A;  2KFF A;  4MSP A;  2KAV A;  2I18 A;  2ZFD A;  2TN4 A;  1KWO C;  2ISD A;  1ZMZ A;  2K7B A;  1CB1 A;  1XYD A;  1REC A;  4YGE B;  5ER5 A;  2LV7 A;  1WRK A;  1H4B A;  3PAT A;  1CDP A;  1F4Q A;  2CT9 A;  1JUO A;  1UP5 A;  1IG5 A;  2KI4 B;  2QAC A;  2WCE A;  3EK8 A;  3OB2 B;  4OCI A;  3A8R A;  4YBH B;  2KGB C;  3TS5 B;  1RRO A;  2H2K A;  2OTG C;  1TRF A;  3PN7 C;  4NQG A;  1Q80 A;  2K7C A;  2F8P A;  5I2L A;  2EHB A;  2BKI B;  1IWQ A;  1IJ6 A;  1DGV A;  2MBX A;  4ZCV A;  5TNC A;  3CWG A;  1SNL A;  1ZAC A;  1MHO A;  5CSF A;  2LMT A;  1KQM C;  1SCM B;  2LMU A;  2NXQ A;  2BCA A;  1DJX A;  2MLE C;  1CDN A;  5JOL A;  3SG4 A;  1YVH A;  3ICB A;  1DJW A;  3FWB A;  2H61 A;  3VRP A;  5KSZ A;  4GFT A;  1AJ4 A;  4YRU A;  1UHN A;  4PCW A;  1VRK A;  3O6B A;  1WLM A;  3TUY C;  1FPW A;  2KQ6 A;  3EK7 A;  5HLV A;  1BR4 B;  3IQQ A;  1YUR A;  4PDZ A;  4PHJ A;  2L98 A;  2KI6 D;  1XFW O;  2MJW B;  3M0W A;  4PE1 A;  1TCO B;  1K96 A;  2M0R A;  4WRI A;  4GPL B;  1ZUZ A;  1CDM A;  1DF0 A;  1XFU O;  3C1V A;  3HCM A;  2O5G A;  1S6J A;  2K8M B;  2PSR A;  2OTG B;  2QPT A;  3PN7 B;  5CSI A;  1NPQ A;  1UUR A;  2HET A;  2O60 A;  3WXA A;  3OP0 A;  1J7O A;  1RFJ A;  2CCM A;  2I2R E;  1DJH A;  2BCB A;  2M29 A;  1BLQ A;  2LVI A;  4TNC A;  1CM4 A;  3SG7 A;  1A2X A;  3PFV A;  1CLL A;  4NDD A;  5I2Q A;  2F3Z A;  4OV2 A;  1A75 B;  1H8B A;  2BBM A;  2BKH B;  2Q4U A;  1SRA A;  1PK0 D;  1WY9 A;  3VRR A;  2PVB A;  1DJY A;  2JRF A;  2WND A;  3EK4 A;  4NDC A;  3JVT C;  3GK2 A;  2WOS A;  1R6P A;  1YTZ C;  3DF0 A;  2LVK A;  1TNX A;  1RJV A;  1K9K A;  1FF1 A;  4GBA A;  4BY4 A;  1FI6 A;  4YGC B;  1AVS A;  3AAK A;  4IL1 A;  3BXK A;  1SR6 B;  1KSO A;  1QV1 A;  4ORC B;  1YRU B;  1JF2 A;  3EVV A;  1IQ5 A;  3PSR A;  3I5F B;  2LVV A;  2ZNE A;  1WRL A;  1G8I A;  2HQ8 A;  3AKB A;  1DJG A;  4ICB A;  1TNP A;  2JXL A;  2ZN8 A;  3O78 A;  4MEW A;  1KCY A;  2JZI A;  1QXP A;  4AQJ A;  4CFQ A;  1Y6W A;  2KI4 C;  1IRJ A;  1SW8 A;  1UHJ A;  2D8N A;  2ZND A;  1SL7 A;  2AUC A;  2FCE A;  2KBM A;  3OB1 B;  1F71 A;  2JT8 A;  2LMV A;  4MLW A;  1SMG A;  4YI9 A;  5AXI A;  2LVJ A;  2Y1M A;  1CMF A;  1CTR A;  1LXF C;  2PAL A;  1FBV A;  1OE9 B;  2NCO A;  4I5J A;  1NSH A;  1M31 A;  2VRG A;  1R2U A;  2Y4Q A;  1SL8 A;  3AKA A;  1CKK A;  1NUB A;  4OKH A;  2K2A A;  1SPY A;  1K93 D;  1NX0 A;  5I8N A;  1HT9 A;  3BUX B;  2EC6 C;  4A4B A;  4GAO A;  1MUX A;  1SCM C;  2COL B;  2KOT A;  3F45 A;  1KK7 Z;  2KAX A;  3FIA A;  2F3Y A;  4MVF A;  1BOD A;  1NX1 A;  3OHM B;  2Y1N A;  3WHU B;  3KHE A;  2KSP A;  3NSL A;  1LIN A;  2JTZ A;  1JBA A;  4AQI A;  4QJ5 B;  3VRQ A;  1BJF A;  4CID A;  3RLZ A;  1B8L A;  4PE0 A;  2V53 A;  3SIB A;  4WQ3 A;  1EH2 A;  2GV5 A;  4GUK A;  3IQO A;  3QRX A;  4C0K A;  3SG3 A;  3KF9 A;  1K90 D;  1M45 A;  4N1G A;  5K89 A;  2JPT A;  1B1G A;  2CXJ A;  3BUN B;  3D10 A;  1SL9 A;  2B1U A;  3FS7 A;  1AHR A;  1C7V A;  2JXC A;  2LUC A;  5FYX A;  2M7N A;  1ODB A;  2M8U A;  3D0Y A;  4HRG A;  1J55 A;  1QX7 A;  1SKT A;  1J7R A;  3KEV A;  2JTT A;  2F2O A;  2KI6 C;  4C0L A;  2JQ6 A;  1S3P A;  1JC2 A;  3SG5 A;  1B47 A;  2I94 A;  2L2E A;  2EC6 B;  1G33 A;  1D1O A;  2K0J A;  2JNF A;  3DVE A;  2LP2 A;  1ALV A;  5JJG A;  1S26 D;  1MR8 A;  2E6W A;  1OOJ A;  3LCP C;  3OX6 A;  1U5I A;  3O2P A;  1F55 A;  1QV0 A;  2M3W A;  3NSK A;  4QJ3 B;  1TOP A;  2JWW A;  1KK8 B;  1NCZ A;  1UUS A;  2KHN A;  3BOW B;  4XJK A;  3VRN A;  5HKW A;  2HPS A;  4ORA B;  2KBI A;  4DUQ A;  1XVJ A;  2JC2 A;  5HKZ A;  5DKQ A;  2MLF C;  1OSA A;  1OZO A;  1SR6 C;  2MAZ A;  2ZKM X;  2DOQ A;  2BL0 C;  2LC5 A;  4C0J A;  2PRU A;  2F2P A;  3CZT X;  3FWC A;  1AP4 A;  1NCX A;  3I5F C;  1UHI A;  1DTL A;  4MBE A;  3A4U B;  1GGZ A;  1SCV A;  1N2D A;  3RM1 A;  1F4O A;  2PMY A;  1MXE A;  1XK4 C;  2L51 A;  2LHL A;  3CTN A;  2K7D A;  1CFC A;  1A29 A;  1YVL A;  3BYA A;  3I5I C;  4BY5 A;  1NP8 A;  1EJ3 A;  3GK1 A;  1JWD A;  1S6I A;  4PHK A;  1PAL A;  4I5L B;  1BMO A;  5IBW A;  5ER4 X;  1HQV A;  1FW4 A;  1WDC B;  1LA3 A;  1XFZ O;  4I5N B;  1KFU S;  2IS9 A;  1AUI B;  1B8C A;  1K2H A;  3EVR A;  4ETO A;  4DCK A;  2KYF A;  4NDB A;  4P2Y B;  4ZCU A;  1ZFS A;  2LE9 B;  2GGM A;  4GGN A;  4XYN A;  3CR5 X;  1RWY A;  5KTY A;  1B7T Z;  3GK4 X;  3CGA A;  4CPV A;  2LNK A;  1K8U A;  1GQM A;  4FTG A;  3SG2 A;  1F70 A;  5CSN A;  2NCP A;  2BL0 B;  4N5X A;  1Y1X A;  1SBJ A;  2HF5 A;  1A4P A;  1CM1 A;  3EKJ A;  1V1G A;  4MN0 A;  1YR5 A;  3LL8 B;  2KAY A;  2A4J A;  3CLN A;  1QLK A;  1J1E A;  1QVI Z;  1Y0V H;  3O4Y A;  4PHN A;  1KFX S;  3CR2 A;  2AAO A;  3CR4 X;  4GGF A;  1BF5 A;  2FJU B;  3I5I B;  4M2O A;  3OX5 A;  1CMG A;  1M63 B;  3BUM B;  2M1U A;  2Y5I A;  1B8R A;  2MHH A;  1KFU L;  5CSJ A;  1BT6 A;  1YUU A;  5AEQ A;  4CFR A;  1NYA A;  3VGO A;  1TCF A;  1XFY O;  2M9G A;  2AMI A;  1B7T Y;  1DF0 B;  1JFK A;  1MQ1 A;  2G2B A;  3BUW B;  4HSZ A;  2ZN9 A;  1QTX A;  1E8A A;  1QIW A;  2KDH A;  2FCD A;  4ORB B;  5BPJ A;  1XFV O;  3LK0 A;  3TDZ A;  4D1E A;  4JWQ A;  2KGR A;  3GOF A;  3TDI A;  3WHT B;  5PAL A;  4R1E A;  1LA0 A;  2LAP A;  1KQV A;  2K2F A;  2LM5 A;  3AAJ A;  5HYD A;  1QVI Y;  1TTX A;  3PAL A;  4M2P A;  2M1K B;  1S6C A;  1KK8 C;  1NX2 A;  3I5G B;  3TZ1 A;  1QLS A;  1PSB A;  5D7F A;  1J1D A;  1K95 A;  1OMV A;  4U8D A;  1RTP 1;  3TDU A;  1F54 A;  1W7I B;  1KFX L;  1L7Z A;  4JQ0 D;  1QS7 A;  4CLN A;  4E68 A;  1WRZ A;  1S5G Z;  2G9B A;  2L5X B;  3VRO A;  1S36 A;  2FOT A;  2Q91 A;  1IH0 A;  5AFP A;  1TN4 A;  2I7A A;  4MRX A;  1IGV A;  4P5O E;  1DMO A;  1RK9 A;  1XFX O;  3SIA A;  1IQ3 A;  3LK1 A;  1EG4 A;  1KK7 Y;  1KSM A;  1NWD A;  4HRE E;  4MZL A;  1CNP A;  2R2I A;  1NCY A;  1PUL A;  1GJY A;  1CDL A;  1L2O C;  1UHK A;  3BUO B;  1PVA A;  1DVI A;  1A75 A;  2LAN A;  1SY9 A;  1WDC C;  2BE4 A;  4DRW A;  1QJT A;  1W7J B;  5F6T A;  2GGZ A;  2CTN A;  4PHM A;  5KU1 A;  2LLT A;  3SJS A;  1JSA A;  1DGU A;  5J3X A;  4USL A;  3H4S E;  1CLM A;  1OQP A;  1S5G Y;  5D69 A;  1K9U A;  1CFP A;  2LUX A;  1QX5 B;  5B8I B;  3PLF B;  1X02 A;  2EGD A;  2LCP A;  2LLU A;  4I5K A;  1B4C A;  1F8H A;  2M97 A;  4N1F A;  5G08 A;  2OPO A;  3BQ3 A;  3JTD B;  1DJZ A;  1DJI A;  1YUT A;  1EXR A;  1OMD A;  2HQW A;  1ZOT B;  2ZRT A;  1CFF A;  5HKY A;  1V1F A;  1QAT A;  2WCF A;  1Y1U A;  1K9P A;  2KNE A;  2MA2 A;  1C7W A;  1M39 A;  2H61 C;  3PM8 A;  3DVJ A;  4MRY A;  1XK4 A;  5GQQ C;  2WOR A;  3K21 A;  3LLE A;  2MRD A;  4OVN F;  1DT7 B;  1KWO B;  2JOJ A;  2KQY A;  3IF7 A;  4L9M A;  1WLZ A;  1L2O B;  2JU0 A;  1Y1A A;  1UWO A;  1XO5 A;  2CNP A;  2NLN A;  3DVK A;  1B9A A;  4OR9 B;  4YI8 A;  4WQ2 A;  1JF0 A;  4JPZ B;  2NZ0 A;  1QAS A;  5AER A;  2BE6 A;  3NSI A;  3KO0 A;  4YGD B;  1YRT B;  2OS8 C;  3NXA A;  1QIV A;  2P6B B;  4FQO A;  4PE7 A;  3WNX B;  1JFJ A;  1BG1 A;  2JT3 A;  3D0Y B;  5CPV A;  2RGI A;  4F0Z B;  1IKU A;  2KFG A;  1YUS A;  3HX4 A;  2KFH A;  4MZK A;  4AOM A;  1LVC D;  1N65 A;  2BBN A;  1CLB A;  2LP3 A;  2ZRS A;  1IJ5 A;  1K94 A;  3CS1 A;  4DIR A;  1M46 A;  1PVB A;  3DVM A;  1KQM B;  3I5G C;  2LHI A;  2JT0 A;  5HLO A;  1U5I B;  4HRH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...