1Q80A

Solution structure and dynamics of nereis sarcoplasmic calcium binding protein
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
174
structure length
174
Chain Sequence
SDLWVQKMKTYFNRIDFDKDGAITRMDFESMAERFAKESEMKAEHAKVLMDSLTGVWDNFLTAVAGGKGIDETTFINSMKEMVKNPEAKSVVEGPLPLFFRAVDTNEDNNISRDEYGIFFGMLGLDKTMAPASFDAIDTNNDGLLSLEEFVIAGSDFFMNDGDSTNKVFWGPLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Sarcoplasmic calcium-binding protein
publication title Solution structure and internal dynamics of NSCP, a compact calcium-binding protein.
pubmed doi rcsb
source organism Neanthes diversicolor
total genus 60
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2003-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1q80A00
4MRXA 1NX1A 2CTNA 2KQ6A 1UHIA 1R6PA 1W7IB 1WRLA 2LAPA 3NSOA 2Q91A 2KAXA 1PSRA 1YRTB 2LMUA 4I5JA 3ZWHA 1MQ1A 2BCXA 1QS7A 3FWBA 2MLFC 2Y4QA 5KU1A 2V53A 2MLEC 4NDBA 1EG3A 3BUNB 1TRFA 3BOWB 1F4OA 2EC6C 2KQYA 3CLNA 3I5IC 1IJ5A 2K7BA 4U8DA 2H61A 2R2IA 4GUKA 2D8NA 2BE6A 3OB2B 4MLWA 5J3XA 3TZ1A 3DF0B 4AQJA 2LLTA 5BPJA 1KFUL 1GGZA 1MWNA 3TDZA 4R1EA 1KWOB 2KYCA 2HF5A 4JQ0D 2Y1MA 4PE7A 1MXLC 1YX8A 1TNPA 3CR2A 1EJ3A 1R2UA 1YVLA 1S36A 4GGNA 3F45A 5CSNA 1W7JB 2M29A 3D0YA 4IL1A 1ALWA 2WCBA 1B4CA 1N65A 4GFTA 1YRUB 2G2BA 1CFDA 1NX0A 2NZ0A 2ZNDA 1WDCC 3GOFA 3D10A 4NQGA 1DJIA 2I7AA 4DS7A 3AAJA 2P6BB 1SBJA 2EC6B 1AP4A 1L2OB 1OMDA 4MEWA 1OZOA 4ETOA 3ICBA 3OX5A 4PHMA 1RK9A 2JU0A 2KFHA 1DJHA 2QPTA 3AAKA 4YGDB 4OR9B 3WXAA 3FWCA 1QVIY 3K21A 3SIBA 1CMFA 1FI5A 1Y1XA 2OS8B 4ORCB 2ZKMX 4C0KA 4CIDA 1BMOA 1G4YR 3VROA 5I2OA 3RM1A 1U5IB 1Y0VH 2JNXA 4L9MA 1S3PA 3NSLA 1CFCA 1AJ5A 2PRUA 4UPGA 2M8UA 1QJTA 1ZACA 1JFKA 1N0YA 1K9PA 1KK8C 2E30A 1TCFA 4GPLB 1PSBA 4HRHA 1Q80A 5CPVA 1M39A 2RGIA 1TNQA 1PULA 2WCFA 4C0JA 1WDCB 1WLZA 2WORA 5HKWA 1JUOA 3I5FC 4HRGA 2BBNA 1Y1AA 1XK4C 4CPVA 5AFPA 4ZCUA 2F2OA 4N1FA 2JXCA 5AEQA 2KI6D 1IQ3A 2AMIA 3EK7A 1LINA 1G33A 4PALA 2LLSA 3I5HB 4ORBB 3A4UB 3SJSA 4QJ3B 1A75B 3BQ3A 3BXKA 1CDPA 3A8RA 2K0JA 3EVVA 2LP2A 3KHEA 2CXJA 2I18A 4GGFA 1J7PA 5AERA 1XFUO 3CTNA 4C0LA 2LV7A 1WRKA 2NCOA 1NIWA 2LVIA 3FS7A 3DD4A 2M3WA 2KYFA 2WNDA 1MF8B 3WHTB 4WQ2A 1NX2A 1NYAA 1CTRA 4YGAA 1S1EA 2JTTA 3OX6A 1QX5B 3DVJA 2F3ZA 3OP0A 1YUUA 3PFVA 2LUCA 1J1EA 1QATA 2JRFA 2Y5IA 1V1GA 3PALA 1KFXL 1NCXA 4YGCB 1IWQA 3TS5B 4DUQA 2CT9A 3CR4X 1K9KA 1EH2A 2JQ6A 3SG4A 3GK4X 2EGDA 1KSMA 4GAOA 1RTP1 1QLKA 2KFGA 1QV0A 1S26D 4USLA 1J7QA 2GGMA 3DF0A 1BG1A 3VGOA 4WQ3A 5ER4X 4TNCA 1IKUA 1OZSA 2E6WA 1KSOA 3WHUB 2F33A 3AKBA 1A03A 1K90D 4MVFA 1MXEA 3KO0A 3GK2A 4YI8A 2JPTA 1FPWA 1CM4A 4ICBA 3FIAA 1M63B 3LL8B 1JSAA 3IF7A 4BY5A 1S6IA 3CWGA 4DIRA 2KDHA 1L2OC 1PVAA 2L4IA 1V1FA 1UHHA 3MSEB 2I94A 4XJKB 1A2XA 1D1OA 2KHNA 1S5GZ 2BKHB 2LLUA 4QJ5B 2K7CA 1SNLA 1SL8A 1S5GY 2LANA 1A4PA 1X02A 4PHNA 3IQQA 3SG6A 2OS8C 3EKJA 3TDUA 2M49B 5HLVA 1SCMC 1ZFSA 3CS1A 1QX2A 1XFYO 3VRQA 1BF5A 1PVBA 2LCPA 2VRGA 1BU3A 1KQMC 1DMOA 2SCPA 3EKHA 1SK6D 1UHJA 1FI6A 4P5OE 1B9AA 3JVTB 3DVKA 2K7OA 1CMGA 2HETA 4ZCVA 1LVCD 2M0RA 2KFFA 1FF1A 1IG5A 2MRDA 1WY9A 1OE9B 1TNXA 5HLOA 1JFJA 2F2PA 1QX7A 2LM5A 4PCWA 5F6TA 5FYXA 2LUXA 2BE4A 1E8AA 3LK1A 3I5GB 5DKQA 2AUCA 3O6BA 1QVIZ 1IQ5A 3I5HC 1NX3A 3NSKA 4I5LB 2M7LA 1CB1A 1JBAA 1RJVA 2WOSA 1AHRA 1XYDA 1C07A 2KGBC 1QXPA 3QRXA 1SCMB 2K8MB 1SL7A 1BODA 2ZRTA 4GBAA 1HT9A 1KQMB 1JWDA 5AXIA 1F70A 1YURA 4OCIA 1HQVA 1AK8A 2FOTA 1TIZA 1A75A 2COLB 1BT6A 1SMGA 3OB1B 1CLLA 5HKYA 2MBXA 2PVBA 1KK7Z 3TS5C 1AJ4A 1OMRA 1TOPA 1OMVA 1SPYA 1KK7Y 3BUOB 1ZUZA 5G08A 2HPSA 3EK8A 1YUSA 3EVRA 3LLEA 3KEVA 2F8PA 1B8RA 2PSRA 3BYAA 1CDNA 5PALA 1KFUS 1XFXO 2NCPA 4BY4A 2K7DA 3VRPA 1YTZC 1LXFC 2PMYA 1XFWO 1C7VA 1EXRA 3C1VA 4YRUA 1VRKA 4ORAB 4AOMA 1WLMA 2LHIA 5CSFA 4OV2A 3TUYC 1H4BA 2LHLA 1FBVA 3CGAA 2K61A 4MSPA 1DJGA 1XK4A 3PM8A 4MZKA 2I2RE 2BL0B 1ODBA 1F8HA 2L50A 1KQVA 2PALA 3PLFB 1AVSA 1UHNA 2FCDA 4PHJA 2LMTA 1XA5A 2M1UA 5KSZA 4F0ZB 5KTYA 3O4YA 1TCOB 1DJXA 5DKNA 1KCYA 3PATA 2KBMA 2ISDA 3SG3A 1F71A 1MR8A 3JTDC 5CSIA 4Q04A 4I5NB 1S6CA 1SCVA 1UP5A 2OTGB 1MHOA 2CCMA 3BOWA 1DJWA 1BJFA 1SR6B 1XFVO 2BECA 2HQ8A 2WCEA 1G8IA 2JTZA 1CLBA 4XJKA 1DF0B 4A4CA 1SL9A 2WC8A 3OHMB 4CFRA 1J7OA 3TUYB 1DTLA 2M9GA 2M97A 3SG2A 3JVTC 1B1GA 2JT3A 2L51A 3PSRA 1TTXA 2G9BA 1CKKA 2KBIA 5D69A 1JC2A 1F4QA 1M46A 1J1DA 1DGUA 1RECA 2CNPA 1PRWA 2JXLA 3DVEA 4OKHA 3BUWB 1WRZA 1TN4A 2LP3A 1NP8A 1NPQA 1QLSA 1K9UA 3I5GC 1K93D 1H8BA 3JTDB 4MN0A 4YBHB 2ZFDA 2ZNEA 2LMVA 2H61C 4PE0A 1LA3A 2L2EA 2LE9B 1MUXA 4PE1A 1CFPA 1YR5A 1IJ6A 1XO5A 1RROA 2JOJA 1EL4A 4YGBB 1YX7A 4JWQA 1NUBA 3SG7A 1SW8A 1J55A 4E68A 2HQWA 2MHHA 5ER5A 3VRNA 1JF2A 2KSPA 5HYDA 2JULA 1IGVA 1YVHA 4M2OA 3O2PA 1UHKA 1U5IA 4N1GA 1C7WA 4PHKA 1LKJA 3LCPC 1UURA 4FTGA 2LC5A 1Y6WA 1A29A 3O78A 1KFXS 1UUSA 4MZLA 3PN7C 4D1EA 2MA2A 5B8IB 1YUTA 1CNPA 3DVMA 4GNKB 4FQOA 1QIWA 3EVUA 4NDDA 2IS9A 2LVVA 5HKZA 1OSAA 5TNCA 1NWDA 1NCZA 3SIAA 2KI6C 2KI4C 1AUIB 1CDMA 2Y1NA 3IQOA 2K2FA 2BL0C 5AANA 5K89A 1ZOTB 3BUXB 4M2QA 1LA0A 1B7TZ 1QTXA 4NDCA 1SRAA 2B1UA 2O5GA 5IBWA 1B7TY 3H4SE 2DOQA 2JC2A 1NCYA 3NXAA 3I5IB 5JJGA 1B8CA 4JPZB 4OVNF 4QJ4B 2OPOA 1GGWA 1CDLA 5CSJA 3KF9A 3ZNIA 2L0PA 3M0WA 3TDIA 3CR5X 1DJZA 3D0YB 2K2AA 4I5KA 1K96A 2JZIA 1CFFA 1BR1B 3RLZA 2LVJA 2NXQA 2OTGC 3BUMB 1PK0D 1J7RA 2NLNA 2A4JA 3PN7B 4HSZA 4PDZA 1BLQA 1SR6C 1QIVA 2KAYA 5I8NA 4HREE 2O60A 3SG5A 1IH0A 1BR4B 1F54A 1OQPA 1CM1A 3WNXB 1XFZO 4MZJA 5JOLA 1BOCA 4DCKA 1GJYA 1B47A 3E3RA 2MAZA 2LVKA 1L7ZA 2H2KA 2KI4B 1UWOA 2PASA 1PALA 2KNEA 4YGEB 1EG4A 1QV1A 2Q4UA 1ALVA 2GGZA 1GQMA 2SASA 2KOTA 1SY9A 2L4HA 1DF0A 4N5XA 2LNKA 1IRJA 3EK4A 2KGRA 2JT0A 1K8UA 1XVJA 4GGFC 4MRYA 1N2DA 2ZN8A 5D7FA 2BBMA 1SYMA 4XYNA 2L98A 2BKIB 2BCBA 1QASA 3AKAA 4CLNA 3CZTX 5DKRA 4MBEA 3NSIA 1TNWA 1DJYA 2JWWA 1K94A 3HCMA 5I2LA 1M31A 5GQQC 5I2QA 1B8LA 1JF0A 2L5XB 2M1KB 4AQIA 4DRWA 1F55A 2BCAA 1RWYA 1M45A 4M2PA 2MJWB 1CLMA 3LK0A 1S6JA 1Y1UA 4CFQA 1KK8B 2GV5A 1DGVA 2M7NA 2JT8A 2KAVA 2FCEA 1ZMZA 2CBLA 2ZN9A 4WRIA 1K95A 3GK1A 3HX4A 4P2YB 1K2HA 1DVIA 3I5FB 1RFJA 2JNFA 4YI9A 3VRRA 4A4BA 1KWOC 1SKTA 2TN4A 2AAOA 2FJUB 2QACA 1OOJA 2EHBA 4PE4A 2F3YA 1NSHA 2ZRSA 3KPXA 1DT7B 1FW4A
chains in the Genus database with same CATH superfamily
3CYZA 4MRXA 1NX1A 2CTNA 2KQ6A 1UHIA 1R6PA 3B6XA 1W7IB 1WRLA 2LAPA 2YGUA 3NSOA 2Q91A 2H8VA 2KAXA 1PSRA 1YRTB 2LMUA 4I5JA 3ZWHA 1MQ1A 3B87A 2BCXA 1QS7A 3FWBA 2MLFC 2Y4QA 5KU1A 2V53A 2MLEC 3O4XA 4NDBA 3R1VA 1EG3A 3BUNB 1TRFA 3BOWB 1F4OA 2EC6C 2KQYA 3CLNA 3I5IC 1IJ5A 2K7BA 4U8DA 2H61A 2R2IA 2L2CA 2D8NA 4GUKA 2BE6A 3OB2B 4MLWA 5J3XA 3TZ1A 3DF0B 4AQJA 2LLTA 5BPJA 1KFUL 1GGZA 3K1EA 1MWNA 3TDZA 4R1EA 1KWOB 2KYCA 2HF5A 4JQ0D 2Y1MA 4PE7A 1MXLC 1YX8A 1TNPA 3CR2A 1EJ3A 1R2UA 1YVLA 1S36A 4GGNA 3F45A 5CSNA 1W7JB 2M29A 3D0YA 4IL1A 1ALWA 2WCBA 1B4CA 1N65A 4GFTA 1YRUB 2G2BA 1CFDA 1NX0A 2NZ0A 2ZNDA 1WDCC 3CZ2A 3GOFA 3D10A 1OOGA 4NQGA 1DJIA 2I7AA 4DS7A 3AAJA 4KYNA 2P6BB 1SBJA 2EC6B 1Z4HA 1AP4A 2L5YA 1L2OB 1OMDA 2JPOA 3TS5B 4MEWA 1OZOA 3CZ1A 3ICBA 3OX5A 4PHMA 4ETOA 1RK9A 2JU0A 2KFHA 1DJHA 2QPTA 3AAKA 4YGDB 3V2LA 4JKTA 4PT1A 4OR9B 3WXAA 3FWCA 1QVIY 3K21A 3SIBA 1CMFA 1FI5A 1Y1XA 2OS8B 4ORCB 2ZKMX 4C0KA 4CIDA 1BMOA 4INXA 1G4YR 3VROA 5I2OA 3RM1A 1U5IB 1Y0VH 2QEVA 2JNXA 4L9MA 1S3PA 3NSLA 1CFCA 1AJ5A 2PRUA 4UPGA 2M8UA 1QJTA 1ZACA 1JFKA 1N0YA 1K9PA 1ORGA 1KK8C 2E30A 1TCFA 4GPLB 1PSBA 4HRHA 1P28A 1Q80A 1M39A 2WC5A 5CPVA 3QMEA 2RGIA 1TNQA 2ERBA 1PULA 2WCFA 4C0JA 1WDCB 1WLZA 2WORA 5HKWA 1JUOA 2P71A 3I5FC 4HRGA 2QEBA 2BBNA 1Y1AA 1TUZA 1XK4C 4CPVA 5AFPA 4ZCUA 2F2OA 4N1FA 2JXCA 5AEQA 3R72A 2KI6D 1IQ3A 2AMIA 3EK7A 1LINA 1G33A 4PALA 2LLSA 3I5HB 4ORBB 3A4UB 3CZ0A 3D75A 3SJSA 4QJ3B 1A75B 3BQ3A 3BXKA 1CDPA 3A8RA 2K0JA 3DY9A 3EVVA 2LP2A 3KHEA 2CXJA 2I18A 4GGFA 1J7PA 5FI6A 5AERA 1XFUO 3CTNA 4C0LA 2LV7A 3RZSA 1WRKA 2WCKA 2NCOA 1NIWA 2LVIA 3FS7A 3DD4A 2M3WA 2KYFA 2WNDA 1MF8B 3NHTA 3WHTB 4WQ2A 1NX2A 1NYAA 1CTRA 4INWA 4YGAA 1S1EA 2JTTA 3OX6A 1QX5B 3DVJA 1GM0A 2F3ZA 3UO9A 3OP0A 3B86A 1YUUA 3PFVA 2LUCA 1J1EA 1QATA 2JRFA 2Y5IA 1V1GA 3PALA 1KFXL 1NCXA 4YGCB 1IWQA 3SS4A 4DUQA 2CT9A 2KLEA 1K9KA 3CR4X 2JQ6A 1EH2A 3D78A 3SG4A 3GK4X 2EGDA 1KSMA 4GAOA 1RTP1 3L4AA 3BJHA 1QLKA 2KFGA 1QV0A 1S26D 4USLA 1J7QA 2GGMA 3DF0A 5HL1A 3VGOA 4WQ3A 1BG1A 5ER4X 4TNCA 1IKUA 1OZSA 2E6WA 1KSOA 3WHUB 2F33A 3AKBA 1A03A 1K90D 4MVFA 1MXEA 3KO0A 3GK2A 4YI8A 2JPTA 3R1PA 1CM4A 4ICBA 1FPWA 2QEHA 3FE8A 3FIAA 1M63B 3CABA 3LL8B 1JSAA 3IF7A 4BY5A 3NHIA 2GTEA 1S6IA 3CWGA 4DIRA 1SSEB 2KDHA 1L2OC 1PVAA 2L4IA 1V1FA 1UHHA 3MSEB 2I94A 4XJKB 1A2XA 1D1OA 2KHNA 1S5GZ 2BKHB 2LLUA 4QJ5B 2K7CA 1SNLA 1SL8A 1S5GY 2LANA 3B7AA 1A4PA 1X02A 4PHNA 3IQQA 3SG6A 2OS8C 3EKJA 3S0EA 3TDUA 2M49B 5EL2A 5HLVA 1SCMC 1ZFSA 3CS1A 1QX2A 1XFYO 3VRQA 1BF5A 1PVBA 1Z2CB 2LCPA 1BU3A 1KQMC 2VRGA 1DMOA 2SCPA 2PYQA 3EKHA 1SK6D 1UHJA 1FI6A 4P5OE 1B9AA 3JVTB 3DVKA 2K7OA 1CMGA 1T14A 2HETA 4ZCVA 1LVCD 2M0RA 2KFFA 1FF1A 1IG5A 2MRDA 1WY9A 1OE9B 1TNXA 3L4LA 5DICA 5HLOA 2F2PA 1JFJA 1QX7A 2LM5A 4PCWA 5F6TA 5FYXA 2LUXA 2BE4A 1E8AA 3LK1A 3I5GB 5DKQA 2AUCA 1OOFA 3O6BA 1QVIZ 1IQ5A 3I5HC 1NX3A 3NSKA 4I5LB 2M7LA 1CB1A 1JBAA 1RJVA 2WOSA 1AHRA 1XYDA 1C07A 2KGBC 1QXPA 3NGVA 3QRXA 1SCMB 2K8MB 1SL7A 1BODA 2ZRTA 4GBAA 1HT9A 1KQMB 1JWDA 5AXIA 1F70A 1YURA 4OCIA 1HQVA 1AK8A 2FOTA 1TIZA 1A75A 2COLB 1BT6A 1SMGA 3OB1B 1CLLA 5HKYA 2MBXA 2PVBA 1KK7Z 1OOHA 1AJ4A 1OMRA 1TOPA 3N7HA 3TS5C 1OMVA 1SPYA 1KK7Y 3BUOB 1ZUZA 5G08A 2HPSA 3EK8A 1YUSA 3EVRA 3LLEA 3KEVA 2F8PA 1B8RA 2PSRA 3BYAA 1CDNA 5PALA 1KFUS 1XFXO 2NCPA 1OOIX 4BY4A 2K7DA 3VRPA 1YTZC 1LXFC 2PMYA 1XFWO 1C7VA 1EXRA 3C1VA 4YRUA 1VRKA 4ORAB 4AOMA 1WLMA 2LHIA 5CSFA 4OV2A 3TUYC 1H4BA 2LHLA 1FBVA 3CGAA 2K61A 4MSPA 1DJGA 1XK4A 3PM8A 4MZKA 1QWVA 2I2RE 2BL0B 1ODBA 1F8HA 2L50A 1KQVA 3PM2A 2PALA 3PLFB 1AVSA 1UHNA 2FCDA 4PHJA 2LMTA 1XA5A 2M1UA 4FQTA 5KSZA 4F0ZB 5FI2A 3O4YA 5KTYA 3IVTA 1TCOB 1DJXA 5DKNA 1KCYA 3BFAA 3PATA 2KBMA 3VB1A 2ISDA 3SG3A 1F71A 1MR8A 3JTDC 5D3OA 5CSIA 4Q04A 4I5NB 1S6CA 1SCVA 1UP5A 2OTGB 1MHOA 2CCMA 3BOWA 1DJWA 3S0FA 1BJFA 1SR6B 1XFVO 2BECA 2HQ8A 2K60A 2WCEA 1G8IA 2JTZA 4JD9A 1CLBA 4XJKA 1DF0B 4A4CA 1SL9A 2WC8A 3OHMB 4CFRA 1J7OA 3TUYB 1DTLA 2M9GA 1LS8A 2M97A 3SG2A 3JVTC 1B1GA 2JT3A 2L51A 3PSRA 1TTXA 2G9BA 1CKKA 2KBIA 5D69A 3S0GA 1JC2A 1F4QA 3FE6A 1M46A 1J1DA 1C3YA 1DGUA 1RECA 2CNPA 1PRWA 3L47A 2JXLA 3DVEA 4OKHA 3BUWB 1WRZA 1DQEA 1TN4A 2FJYA 2LP3A 3OGNA 4IJ7A 2WC6A 1NP8A 1NPQA 1QLSA 1K9UA 3I5GC 1K93D 3B88A 1H8BA 3JTDB 3D76A 4MN0A 4YBHB 2ZFDA 2ZNEA 2LMVA 2H61C 4PE0A 1XFRA 1DC1A 1LA3A 2L2EA 2LE9B 1MUXA 4PE1A 1CFPA 3DXLA 3FE9A 1YR5A 1IJ6A 4OZDA 1XO5A 1RROA 2JOJA 1EL4A 4YGBB 1YX7A 4JWQA 1NUBA 3SG7A 2WCMA 1SW8A 1J55A 4E68A 2HQWA 3EG5B 2MHHA 5ER5A 3VRNA 1JF2A 2KSPA 5HYDA 2JULA 1IGVA 1YVHA 4M2OA 3O2PA 1UHKA 1U5IA 3BFBA 4N1GA 1C7WA 4PHKA 1LKJA 3LCPC 1UURA 4FTGA 2LC5A 1Y6WA 1A29A 3O78A 1KFXS 1UUSA 4MZLA 1TUJA 3PN7C 4D1EA 2MA2A 5B8IB 1YUTA 1CNPA 3DVMA 4GNKB 4FQOA 1QIWA 3EVUA 4NDDA 3DZTA 1BLQA 2IS9A 2LVVA 5HKZA 1OSAA 5TNCA 1NWDA 2PQLA 1NCZA 3SIAA 2KI6C 2KI4C 1AUIB 1CDMA 2QEOA 2Y1NA 3IQOA 2K2FA 2BL0C 5AANA 5K89A 2QDIA 1ZOTB 3BUXB 4M2QA 1LA0A 1B7TZ 1QTXA 4NDCA 1SRAA 2B1UA 3CDNA 2O5GA 5IBWA 1B7TY 3H4SE 2DOQA 2JC2A 1NCYA 3NXAA 3I5IB 5JJGA 1B8CA 4JPZB 4OVNF 4QJ4B 2OPOA 1GGWA 1CDLA 5CSJA 3KF9A 3ZNIA 2L0PA 3M0WA 2WCHA 3TDIA 3CR5X 1DJZA 3D0YB 2K2AA 4I5KA 1K96A 3S0DA 2JZIA 1CFFA 1BR1B 3RLZA 2LVJA 2NXQA 2OTGC 3BUMB 1PK0D 1J7RA 2NLNA 2A4JA 3PN7B 4HSZA 4PDZA 5FI7A 3Q8IA 1SR6C 1QIVA 2KAYA 5I8NA 4HREE 2O60A 3SG5A 1IH0A 1BR4B 1F54A 1OQPA 1CM1A 3WNXB 1XFZO 4MZJA 5JOLA 1BOCA 2BNXA 3R1OA 1GJYA 4DCKA 1B47A 3E3RA 4F7FA 2MAZA 2LVKA 1L7ZA 2H2KA 2KI4B 3S0AA 1UWOA 2PASA 1PALA 2KNEA 4YGEB 1EG4A 1QV1A 2Q4UA 1ALVA 2GGZA 1GQMA 2SASA 2KOTA 2P70A 1SY9A 2L4HA 1DF0A 4N5XA 2LNKA 1IRJA 3EK4A 2KGRA 2JT0A 1DEKA 2WCJA 1K8UA 3OBVA 1XVJA 4GGFC 4MRYA 1N2DA 2ZN8A 5D7FA 2BBMA 1SYMA 4XYNA 2L98A 2BKIB 1W9ZA 2BCBA 1QASA 3AKAA 3BFHA 4CLNA 3CZTX 5DKRA 4MBEA 3NSIA 1TNWA 1DJYA 2JWWA 1K94A 3HCMA 3D74A 5I2LA 2BAPA 1M31A 5GQQC 2WCLA 5I2QA 1B8LA 1JF0A 2L5XB 2M1KB 3D77A 3UNWA 4AQIA 4DRWA 1DELA 1F55A 2BCAA 1RWYA 1M45A 5I94A 4M2PA 2MJWB 1CLMA 3LK0A 1S6JA 1Y1UA 1C3ZA 4CFQA 1KK8B 1IIOA 2GV5A 1DGVA 2M7NA 2JT8A 2KAVA 2KPHA 2FCEA 3SS3A 1ZMZA 2CBLA 2ZN9A 4WRIA 1K95A 3GK1A 3HX4A 4P2YB 1K2HA 1DVIA 3S0BA 3I5FB 1RFJA 2JNFA 4YI9A 3VRRA 4A4BA 1KWOC 1SKTA 2TN4A 3D73A 1TWOA 3SS5A 2AAOA 2FJUB 2QACA 1OOJA 2KLDA 3DYEA 2EHBA 4PE4A 1OW4A 2F3YA 1NSHA 3PJIA 2ZRSA 3KPXA 1DT7B 1FW4A
chains in the Genus database with same CATH topology
4MRXA 1NX1A 2CTNA 2KQ6A 1UHIA 1R6PA 1W7IB 1WRLA 2LAPA 3NSOA 2Q91A 2KAXA 1PSRA 1YRTB 2LMUA 4I5JA 3ZWHA 1MQ1A 2BCXA 1QS7A 3FWBA 2MLFC 2Y4QA 5KU1A 2V53A 2MLEC 4NDBA 1EG3A 3BUNB 1TRFA 3BOWB 1F4OA 2EC6C 2KQYA 3CLNA 3I5IC 1IJ5A 2K7BA 4U8DA 2H61A 2R2IA 4GUKA 2D8NA 2BE6A 3OB2B 4MLWA 5J3XA 3TZ1A 3DF0B 4AQJA 2LLTA 5BPJA 1KFUL 1GGZA 1MWNA 3TDZA 4R1EA 1KWOB 2KYCA 2HF5A 4JQ0D 2Y1MA 4PE7A 1MXLC 1YX8A 1TNPA 3CR2A 1EJ3A 1R2UA 1YVLA 1S36A 4GGNA 3F45A 5CSNA 1W7JB 2M29A 3D0YA 4IL1A 1ALWA 2WCBA 1B4CA 1N65A 4GFTA 1YRUB 2G2BA 1CFDA 1NX0A 2NZ0A 2ZNDA 1WDCC 3GOFA 3D10A 4NQGA 1DJIA 2I7AA 4DS7A 3AAJA 2P6BB 1SBJA 2EC6B 1AP4A 1L2OB 1OMDA 4MEWA 1OZOA 4ETOA 3ICBA 3OX5A 4PHMA 1RK9A 2JU0A 2KFHA 1DJHA 2QPTA 3AAKA 4YGDB 4OR9B 3WXAA 3FWCA 1QVIY 3K21A 3SIBA 1CMFA 1FI5A 1Y1XA 2OS8B 4ORCB 2ZKMX 4C0KA 4CIDA 1BMOA 1G4YR 3VROA 5I2OA 3RM1A 1U5IB 1Y0VH 2JNXA 4L9MA 1S3PA 3NSLA 1CFCA 1AJ5A 2PRUA 4UPGA 2M8UA 1QJTA 1ZACA 1JFKA 1N0YA 1K9PA 1KK8C 2E30A 1TCFA 4GPLB 1PSBA 4HRHA 1Q80A 5CPVA 1M39A 2RGIA 1TNQA 1PULA 2WCFA 4C0JA 1WDCB 1WLZA 2WORA 5HKWA 1JUOA 3I5FC 4HRGA 2BBNA 1Y1AA 1XK4C 4CPVA 5AFPA 4ZCUA 2F2OA 4N1FA 2JXCA 5AEQA 2KI6D 1IQ3A 2AMIA 3EK7A 1LINA 1G33A 4PALA 2LLSA 3I5HB 4ORBB 3A4UB 3SJSA 4QJ3B 1A75B 3BQ3A 3BXKA 1CDPA 3A8RA 2K0JA 3EVVA 2LP2A 3KHEA 2CXJA 2I18A 4GGFA 1J7PA 5AERA 1XFUO 3CTNA 4C0LA 2LV7A 1WRKA 2NCOA 1NIWA 2LVIA 3FS7A 3DD4A 2M3WA 2KYFA 2WNDA 1MF8B 3WHTB 4WQ2A 1NX2A 1NYAA 1CTRA 4YGAA 1S1EA 2JTTA 3OX6A 1QX5B 3DVJA 2F3ZA 3OP0A 1YUUA 3PFVA 2LUCA 1J1EA 1QATA 2JRFA 2Y5IA 1V1GA 3PALA 1KFXL 1NCXA 4YGCB 1IWQA 3TS5B 4DUQA 2CT9A 3CR4X 1K9KA 1EH2A 2JQ6A 3SG4A 3GK4X 2EGDA 1KSMA 4GAOA 1RTP1 1QLKA 2KFGA 1QV0A 1S26D 4USLA 1J7QA 2GGMA 3DF0A 1BG1A 3VGOA 4WQ3A 5ER4X 4TNCA 1IKUA 1OZSA 2E6WA 1KSOA 3WHUB 2F33A 3AKBA 1A03A 1K90D 4MVFA 1MXEA 3KO0A 3GK2A 4YI8A 2JPTA 1FPWA 1CM4A 4ICBA 3FIAA 1M63B 3LL8B 1JSAA 3IF7A 4BY5A 1S6IA 3CWGA 4DIRA 2KDHA 1L2OC 1PVAA 2L4IA 1V1FA 1UHHA 3MSEB 2I94A 4XJKB 1A2XA 1D1OA 2KHNA 1S5GZ 2BKHB 2LLUA 4QJ5B 2K7CA 1SNLA 1SL8A 1S5GY 2LANA 1A4PA 1X02A 4PHNA 3IQQA 3SG6A 2OS8C 3EKJA 3TDUA 2M49B 5HLVA 1SCMC 1ZFSA 3CS1A 1QX2A 1XFYO 3VRQA 1BF5A 1PVBA 2LCPA 2VRGA 1BU3A 1KQMC 1DMOA 2SCPA 3EKHA 1SK6D 1UHJA 1FI6A 4P5OE 1B9AA 3JVTB 3DVKA 2K7OA 1CMGA 2HETA 4ZCVA 1LVCD 2M0RA 2KFFA 1FF1A 1IG5A 2MRDA 1WY9A 1OE9B 1TNXA 5HLOA 1JFJA 2F2PA 1QX7A 2LM5A 4PCWA 5F6TA 5FYXA 2LUXA 2BE4A 1E8AA 3LK1A 3I5GB 5DKQA 2AUCA 3O6BA 1QVIZ 1IQ5A 3I5HC 1NX3A 3NSKA 4I5LB 2M7LA 1CB1A 1JBAA 1RJVA 2WOSA 1AHRA 1XYDA 1C07A 2KGBC 1QXPA 3QRXA 1SCMB 2K8MB 1SL7A 1BODA 2ZRTA 4GBAA 1HT9A 1KQMB 1JWDA 5AXIA 1F70A 1YURA 4OCIA 1HQVA 1AK8A 2FOTA 1TIZA 1A75A 2COLB 1BT6A 1SMGA 3OB1B 1CLLA 5HKYA 2MBXA 2PVBA 1KK7Z 3TS5C 1AJ4A 1OMRA 1TOPA 1OMVA 1SPYA 1KK7Y 3BUOB 1ZUZA 5G08A 2HPSA 3EK8A 1YUSA 3EVRA 3LLEA 3KEVA 2F8PA 1B8RA 2PSRA 3BYAA 1CDNA 5PALA 1KFUS 1XFXO 2NCPA 4BY4A 2K7DA 3VRPA 1YTZC 1LXFC 2PMYA 1XFWO 1C7VA 1EXRA 3C1VA 4YRUA 1VRKA 4ORAB 4AOMA 1WLMA 2LHIA 5CSFA 4OV2A 3TUYC 1H4BA 2LHLA 1FBVA 3CGAA 2K61A 4MSPA 1DJGA 1XK4A 3PM8A 4MZKA 2I2RE 2BL0B 1ODBA 1F8HA 2L50A 1KQVA 2PALA 3PLFB 1AVSA 1UHNA 2FCDA 4PHJA 2LMTA 1XA5A 2M1UA 5KSZA 4F0ZB 5KTYA 3O4YA 1TCOB 1DJXA 5DKNA 1KCYA 3PATA 2KBMA 2ISDA 3SG3A 1F71A 1MR8A 3JTDC 5CSIA 4Q04A 4I5NB 1S6CA 1SCVA 1UP5A 2OTGB 1MHOA 2CCMA 3BOWA 1DJWA 1BJFA 1SR6B 1XFVO 2BECA 2HQ8A 2WCEA 1G8IA 2JTZA 1CLBA 4XJKA 1DF0B 4A4CA 1SL9A 2WC8A 3OHMB 4CFRA 1J7OA 3TUYB 1DTLA 2M9GA 2M97A 3SG2A 3JVTC 1B1GA 2JT3A 2L51A 3PSRA 1TTXA 2G9BA 1CKKA 2KBIA 5D69A 1JC2A 1F4QA 1M46A 1J1DA 1DGUA 1RECA 2CNPA 1PRWA 2JXLA 3DVEA 4OKHA 3BUWB 1WRZA 1TN4A 2LP3A 1NP8A 1NPQA 1QLSA 1K9UA 3I5GC 1K93D 1H8BA 3JTDB 4MN0A 4YBHB 2ZFDA 2ZNEA 2LMVA 2H61C 4PE0A 1LA3A 2L2EA 2LE9B 1MUXA 4PE1A 1CFPA 1YR5A 1IJ6A 1XO5A 1RROA 2JOJA 1EL4A 4YGBB 1YX7A 4JWQA 1NUBA 3SG7A 1SW8A 1J55A 4E68A 2HQWA 2MHHA 5ER5A 3VRNA 1JF2A 2KSPA 5HYDA 2JULA 1IGVA 1YVHA 4M2OA 3O2PA 1UHKA 1U5IA 4N1GA 1C7WA 4PHKA 1LKJA 3LCPC 1UURA 4FTGA 2LC5A 1Y6WA 1A29A 3O78A 1KFXS 1UUSA 4MZLA 3PN7C 4D1EA 2MA2A 5B8IB 1YUTA 1CNPA 3DVMA 4GNKB 4FQOA 1QIWA 3EVUA 4NDDA 2IS9A 2LVVA 5HKZA 1OSAA 5TNCA 1NWDA 1NCZA 3SIAA 2KI6C 2KI4C 1AUIB 1CDMA 2Y1NA 3IQOA 2K2FA 2BL0C 5AANA 5K89A 1ZOTB 3BUXB 4M2QA 1LA0A 1B7TZ 1QTXA 4NDCA 1SRAA 2B1UA 2O5GA 5IBWA 1B7TY 3H4SE 2DOQA 2JC2A 1NCYA 3NXAA 3I5IB 5JJGA 1B8CA 4JPZB 4OVNF 4QJ4B 2OPOA 1GGWA 1CDLA 5CSJA 3KF9A 3ZNIA 2L0PA 3M0WA 3TDIA 3CR5X 1DJZA 3D0YB 2K2AA 4I5KA 1K96A 2JZIA 1CFFA 1BR1B 3RLZA 2LVJA 2NXQA 2OTGC 3BUMB 1PK0D 1J7RA 2NLNA 2A4JA 3PN7B 4HSZA 4PDZA 1BLQA 1SR6C 1QIVA 2KAYA 5I8NA 4HREE 2O60A 3SG5A 1IH0A 1BR4B 1F54A 1OQPA 1CM1A 3WNXB 1XFZO 4MZJA 5JOLA 1BOCA 4DCKA 1GJYA 1B47A 3E3RA 2MAZA 2LVKA 1L7ZA 2H2KA 2KI4B 1UWOA 2PASA 1PALA 2KNEA 4YGEB 1EG4A 1QV1A 2Q4UA 1ALVA 2GGZA 1GQMA 2SASA 2KOTA 1SY9A 2L4HA 1DF0A 4N5XA 2LNKA 1IRJA 3EK4A 2KGRA 2JT0A 1K8UA 1XVJA 4GGFC 4MRYA 1N2DA 2ZN8A 5D7FA 2BBMA 1SYMA 4XYNA 2L98A 2BKIB 2BCBA 1QASA 3AKAA 4CLNA 3CZTX 5DKRA 4MBEA 3NSIA 1TNWA 1DJYA 2JWWA 1K94A 3HCMA 5I2LA 1M31A 5GQQC 5I2QA 1B8LA 1JF0A 2L5XB 2M1KB 4AQIA 4DRWA 1F55A 2BCAA 1RWYA 1M45A 4M2PA 2MJWB 1CLMA 3LK0A 1S6JA 1Y1UA 4CFQA 1KK8B 2GV5A 1DGVA 2M7NA 2JT8A 2KAVA 2FCEA 1ZMZA 2CBLA 2ZN9A 4WRIA 1K95A 3GK1A 3HX4A 4P2YB 1K2HA 1DVIA 3I5FB 1RFJA 2JNFA 4YI9A 3VRRA 4A4BA 1KWOC 1SKTA 2TN4A 2AAOA 2FJUB 2QACA 1OOJA 2EHBA 4PE4A 2F3YA 1NSHA 2ZRSA 3KPXA 1DT7B 1FW4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MRX A;  1NX1 A;  2CTN A;  2KQ6 A;  1UHI A;  1R6P A;  1W7I B;  1WRL A;  2LAP A;  3NSO A;  2Q91 A;  2KAX A;  1PSR A;  1YRT B;  2LMU A;  4I5J A;  3ZWH A;  1MQ1 A;  2BCX A;  1QS7 A;  3FWB A;  2MLF C;  2Y4Q A;  5KU1 A;  2V53 A;  2MLE C;  4NDB A;  1EG3 A;  3BUN B;  1TRF A;  3BOW B;  1F4O A;  2EC6 C;  2KQY A;  3CLN A;  3I5I C;  1IJ5 A;  2K7B A;  4U8D A;  2H61 A;  2R2I A;  4GUK A;  2D8N A;  2BE6 A;  3OB2 B;  4MLW A;  5J3X A;  3TZ1 A;  3DF0 B;  4AQJ A;  2LLT A;  5BPJ A;  1KFU L;  1GGZ A;  1MWN A;  3TDZ A;  4R1E A;  1KWO B;  2KYC A;  2HF5 A;  4JQ0 D;  2Y1M A;  4PE7 A;  1MXL C;  1YX8 A;  1TNP A;  3CR2 A;  1EJ3 A;  1R2U A;  1YVL A;  1S36 A;  4GGN A;  3F45 A;  5CSN A;  1W7J B;  2M29 A;  3D0Y A;  4IL1 A;  1ALW A;  2WCB A;  1B4C A;  1N65 A;  4GFT A;  1YRU B;  2G2B A;  1CFD A;  1NX0 A;  2NZ0 A;  2ZND A;  1WDC C;  3GOF A;  3D10 A;  4NQG A;  1DJI A;  2I7A A;  4DS7 A;  3AAJ A;  2P6B B;  1SBJ A;  2EC6 B;  1AP4 A;  1L2O B;  1OMD A;  4MEW A;  1OZO A;  4ETO A;  3ICB A;  3OX5 A;  4PHM A;  1RK9 A;  2JU0 A;  2KFH A;  1DJH A;  2QPT A;  3AAK A;  4YGD B;  4OR9 B;  3WXA A;  3FWC A;  1QVI Y;  3K21 A;  3SIB A;  1CMF A;  1FI5 A;  1Y1X A;  2OS8 B;  4ORC B;  2ZKM X;  4C0K A;  4CID A;  1BMO A;  1G4Y R;  3VRO A;  5I2O A;  3RM1 A;  1U5I B;  1Y0V H;  2JNX A;  4L9M A;  1S3P A;  3NSL A;  1CFC A;  1AJ5 A;  2PRU A;  4UPG A;  2M8U A;  1QJT A;  1ZAC A;  1JFK A;  1N0Y A;  1K9P A;  1KK8 C;  2E30 A;  1TCF A;  4GPL B;  1PSB A;  4HRH A;  1Q80 A;  5CPV A;  1M39 A;  2RGI A;  1TNQ A;  1PUL A;  2WCF A;  4C0J A;  1WDC B;  1WLZ A;  2WOR A;  5HKW A;  1JUO A;  3I5F C;  4HRG A;  2BBN A;  1Y1A A;  1XK4 C;  4CPV A;  5AFP A;  4ZCU A;  2F2O A;  4N1F A;  2JXC A;  5AEQ A;  2KI6 D;  1IQ3 A;  2AMI A;  3EK7 A;  1LIN A;  1G33 A;  4PAL A;  2LLS A;  3I5H B;  4ORB B;  3A4U B;  3SJS A;  4QJ3 B;  1A75 B;  3BQ3 A;  3BXK A;  1CDP A;  3A8R A;  2K0J A;  3EVV A;  2LP2 A;  3KHE A;  2CXJ A;  2I18 A;  4GGF A;  1J7P A;  5AER A;  1XFU O;  3CTN A;  4C0L A;  2LV7 A;  1WRK A;  2NCO A;  1NIW A;  2LVI A;  3FS7 A;  3DD4 A;  2M3W A;  2KYF A;  2WND A;  1MF8 B;  3WHT B;  4WQ2 A;  1NX2 A;  1NYA A;  1CTR A;  4YGA A;  1S1E A;  2JTT A;  3OX6 A;  1QX5 B;  3DVJ A;  2F3Z A;  3OP0 A;  1YUU A;  3PFV A;  2LUC A;  1J1E A;  1QAT A;  2JRF A;  2Y5I A;  1V1G A;  3PAL A;  1KFX L;  1NCX A;  4YGC B;  1IWQ A;  3TS5 B;  4DUQ A;  2CT9 A;  3CR4 X;  1K9K A;  1EH2 A;  2JQ6 A;  3SG4 A;  3GK4 X;  2EGD A;  1KSM A;  4GAO A;  1RTP 1;  1QLK A;  2KFG A;  1QV0 A;  1S26 D;  4USL A;  1J7Q A;  2GGM A;  3DF0 A;  1BG1 A;  3VGO A;  4WQ3 A;  5ER4 X;  4TNC A;  1IKU A;  1OZS A;  2E6W A;  1KSO A;  3WHU B;  2F33 A;  3AKB A;  1A03 A;  1K90 D;  4MVF A;  1MXE A;  3KO0 A;  3GK2 A;  4YI8 A;  2JPT A;  1FPW A;  1CM4 A;  4ICB A;  3FIA A;  1M63 B;  3LL8 B;  1JSA A;  3IF7 A;  4BY5 A;  1S6I A;  3CWG A;  4DIR A;  2KDH A;  1L2O C;  1PVA A;  2L4I A;  1V1F A;  1UHH A;  3MSE B;  2I94 A;  4XJK B;  1A2X A;  1D1O A;  2KHN A;  1S5G Z;  2BKH B;  2LLU A;  4QJ5 B;  2K7C A;  1SNL A;  1SL8 A;  1S5G Y;  2LAN A;  1A4P A;  1X02 A;  4PHN A;  3IQQ A;  3SG6 A;  2OS8 C;  3EKJ A;  3TDU A;  2M49 B;  5HLV A;  1SCM C;  1ZFS A;  3CS1 A;  1QX2 A;  1XFY O;  3VRQ A;  1BF5 A;  1PVB A;  2LCP A;  2VRG A;  1BU3 A;  1KQM C;  1DMO A;  2SCP A;  3EKH A;  1SK6 D;  1UHJ A;  1FI6 A;  4P5O E;  1B9A A;  3JVT B;  3DVK A;  2K7O A;  1CMG A;  2HET A;  4ZCV A;  1LVC D;  2M0R A;  2KFF A;  1FF1 A;  1IG5 A;  2MRD A;  1WY9 A;  1OE9 B;  1TNX A;  5HLO A;  1JFJ A;  2F2P A;  1QX7 A;  2LM5 A;  4PCW A;  5F6T A;  5FYX A;  2LUX A;  2BE4 A;  1E8A A;  3LK1 A;  3I5G B;  5DKQ A;  2AUC A;  3O6B A;  1QVI Z;  1IQ5 A;  3I5H C;  1NX3 A;  3NSK A;  4I5L B;  2M7L A;  1CB1 A;  1JBA A;  1RJV A;  2WOS A;  1AHR A;  1XYD A;  1C07 A;  2KGB C;  1QXP A;  3QRX A;  1SCM B;  2K8M B;  1SL7 A;  1BOD A;  2ZRT A;  4GBA A;  1HT9 A;  1KQM B;  1JWD A;  5AXI A;  1F70 A;  1YUR A;  4OCI A;  1HQV A;  1AK8 A;  2FOT A;  1TIZ A;  1A75 A;  2COL B;  1BT6 A;  1SMG A;  3OB1 B;  1CLL A;  5HKY A;  2MBX A;  2PVB A;  1KK7 Z;  3TS5 C;  1AJ4 A;  1OMR A;  1TOP A;  1OMV A;  1SPY A;  1KK7 Y;  3BUO B;  1ZUZ A;  5G08 A;  2HPS A;  3EK8 A;  1YUS A;  3EVR A;  3LLE A;  3KEV A;  2F8P A;  1B8R A;  2PSR A;  3BYA A;  1CDN A;  5PAL A;  1KFU S;  1XFX O;  2NCP A;  4BY4 A;  2K7D A;  3VRP A;  1YTZ C;  1LXF C;  2PMY A;  1XFW O;  1C7V A;  1EXR A;  3C1V A;  4YRU A;  1VRK A;  4ORA B;  4AOM A;  1WLM A;  2LHI A;  5CSF A;  4OV2 A;  3TUY C;  1H4B A;  2LHL A;  1FBV A;  3CGA A;  2K61 A;  4MSP A;  1DJG A;  1XK4 A;  3PM8 A;  4MZK A;  2I2R E;  2BL0 B;  1ODB A;  1F8H A;  2L50 A;  1KQV A;  2PAL A;  3PLF B;  1AVS A;  1UHN A;  2FCD A;  4PHJ A;  2LMT A;  1XA5 A;  2M1U A;  5KSZ A;  4F0Z B;  5KTY A;  3O4Y A;  1TCO B;  1DJX A;  5DKN A;  1KCY A;  3PAT A;  2KBM A;  2ISD A;  3SG3 A;  1F71 A;  1MR8 A;  3JTD C;  5CSI A;  4Q04 A;  4I5N B;  1S6C A;  1SCV A;  1UP5 A;  2OTG B;  1MHO A;  2CCM A;  3BOW A;  1DJW A;  1BJF A;  1SR6 B;  1XFV O;  2BEC A;  2HQ8 A;  2WCE A;  1G8I A;  2JTZ A;  1CLB A;  4XJK A;  1DF0 B;  4A4C A;  1SL9 A;  2WC8 A;  3OHM B;  4CFR A;  1J7O A;  3TUY B;  1DTL A;  2M9G A;  2M97 A;  3SG2 A;  3JVT C;  1B1G A;  2JT3 A;  2L51 A;  3PSR A;  1TTX A;  2G9B A;  1CKK A;  2KBI A;  5D69 A;  1JC2 A;  1F4Q A;  1M46 A;  1J1D A;  1DGU A;  1REC A;  2CNP A;  1PRW A;  2JXL A;  3DVE A;  4OKH A;  3BUW B;  1WRZ A;  1TN4 A;  2LP3 A;  1NP8 A;  1NPQ A;  1QLS A;  1K9U A;  3I5G C;  1K93 D;  1H8B A;  3JTD B;  4MN0 A;  4YBH B;  2ZFD A;  2ZNE A;  2LMV A;  2H61 C;  4PE0 A;  1LA3 A;  2L2E A;  2LE9 B;  1MUX A;  4PE1 A;  1CFP A;  1YR5 A;  1IJ6 A;  1XO5 A;  1RRO A;  2JOJ A;  1EL4 A;  4YGB B;  1YX7 A;  4JWQ A;  1NUB A;  3SG7 A;  1SW8 A;  1J55 A;  4E68 A;  2HQW A;  2MHH A;  5ER5 A;  3VRN A;  1JF2 A;  2KSP A;  5HYD A;  2JUL A;  1IGV A;  1YVH A;  4M2O A;  3O2P A;  1UHK A;  1U5I A;  4N1G A;  1C7W A;  4PHK A;  1LKJ A;  3LCP C;  1UUR A;  4FTG A;  2LC5 A;  1Y6W A;  1A29 A;  3O78 A;  1KFX S;  1UUS A;  4MZL A;  3PN7 C;  4D1E A;  2MA2 A;  5B8I B;  1YUT A;  1CNP A;  3DVM A;  4GNK B;  4FQO A;  1QIW A;  3EVU A;  4NDD A;  2IS9 A;  2LVV A;  5HKZ A;  1OSA A;  5TNC A;  1NWD A;  1NCZ A;  3SIA A;  2KI6 C;  2KI4 C;  1AUI B;  1CDM A;  2Y1N A;  3IQO A;  2K2F A;  2BL0 C;  5AAN A;  5K89 A;  1ZOT B;  3BUX B;  4M2Q A;  1LA0 A;  1B7T Z;  1QTX A;  4NDC A;  1SRA A;  2B1U A;  2O5G A;  5IBW A;  1B7T Y;  3H4S E;  2DOQ A;  2JC2 A;  1NCY A;  3NXA A;  3I5I B;  5JJG A;  1B8C A;  4JPZ B;  4OVN F;  4QJ4 B;  2OPO A;  1GGW A;  1CDL A;  5CSJ A;  3KF9 A;  3ZNI A;  2L0P A;  3M0W A;  3TDI A;  3CR5 X;  1DJZ A;  3D0Y B;  2K2A A;  4I5K A;  1K96 A;  2JZI A;  1CFF A;  1BR1 B;  3RLZ A;  2LVJ A;  2NXQ A;  2OTG C;  3BUM B;  1PK0 D;  1J7R A;  2NLN A;  2A4J A;  3PN7 B;  4HSZ A;  4PDZ A;  1BLQ A;  1SR6 C;  1QIV A;  2KAY A;  5I8N A;  4HRE E;  2O60 A;  3SG5 A;  1IH0 A;  1BR4 B;  1F54 A;  1OQP A;  1CM1 A;  3WNX B;  1XFZ O;  4MZJ A;  5JOL A;  1BOC A;  4DCK A;  1GJY A;  1B47 A;  3E3R A;  2MAZ A;  2LVK A;  1L7Z A;  2H2K A;  2KI4 B;  1UWO A;  2PAS A;  1PAL A;  2KNE A;  4YGE B;  1EG4 A;  1QV1 A;  2Q4U A;  1ALV A;  2GGZ A;  1GQM A;  2SAS A;  2KOT A;  1SY9 A;  2L4H A;  1DF0 A;  4N5X A;  2LNK A;  1IRJ A;  3EK4 A;  2KGR A;  2JT0 A;  1K8U A;  1XVJ A;  4GGF C;  4MRY A;  1N2D A;  2ZN8 A;  5D7F A;  2BBM A;  1SYM A;  4XYN A;  2L98 A;  2BKI B;  2BCB A;  1QAS A;  3AKA A;  4CLN A;  3CZT X;  5DKR A;  4MBE A;  3NSI A;  1TNW A;  1DJY A;  2JWW A;  1K94 A;  3HCM A;  5I2L A;  1M31 A;  5GQQ C;  5I2Q A;  1B8L A;  1JF0 A;  2L5X B;  2M1K B;  4AQI A;  4DRW A;  1F55 A;  2BCA A;  1RWY A;  1M45 A;  4M2P A;  2MJW B;  1CLM A;  3LK0 A;  1S6J A;  1Y1U A;  4CFQ A;  1KK8 B;  2GV5 A;  1DGV A;  2M7N A;  2JT8 A;  2KAV A;  2FCE A;  1ZMZ A;  2CBL A;  2ZN9 A;  4WRI A;  1K95 A;  3GK1 A;  3HX4 A;  4P2Y B;  1K2H A;  1DVI A;  3I5F B;  1RFJ A;  2JNF A;  4YI9 A;  3VRR A;  4A4B A;  1KWO C;  1SKT A;  2TN4 A;  2AAO A;  2FJU B;  2QAC A;  1OOJ A;  2EHB A;  4PE4 A;  2F3Y A;  1NSH A;  2ZRS A;  3KPX A;  1DT7 B;  1FW4 A; 
#chains in the Genus database with same CATH topology
 3CYZ A;  4MRX A;  1NX1 A;  2CTN A;  2KQ6 A;  1UHI A;  1R6P A;  3B6X A;  1W7I B;  1WRL A;  2LAP A;  2YGU A;  3NSO A;  2Q91 A;  2H8V A;  2KAX A;  1PSR A;  1YRT B;  2LMU A;  4I5J A;  3ZWH A;  1MQ1 A;  3B87 A;  2BCX A;  1QS7 A;  3FWB A;  2MLF C;  2Y4Q A;  5KU1 A;  2V53 A;  2MLE C;  3O4X A;  4NDB A;  3R1V A;  1EG3 A;  3BUN B;  1TRF A;  3BOW B;  1F4O A;  2EC6 C;  2KQY A;  3CLN A;  3I5I C;  1IJ5 A;  2K7B A;  4U8D A;  2H61 A;  2R2I A;  2L2C A;  2D8N A;  4GUK A;  2BE6 A;  3OB2 B;  4MLW A;  5J3X A;  3TZ1 A;  3DF0 B;  4AQJ A;  2LLT A;  5BPJ A;  1KFU L;  1GGZ A;  3K1E A;  1MWN A;  3TDZ A;  4R1E A;  1KWO B;  2KYC A;  2HF5 A;  4JQ0 D;  2Y1M A;  4PE7 A;  1MXL C;  1YX8 A;  1TNP A;  3CR2 A;  1EJ3 A;  1R2U A;  1YVL A;  1S36 A;  4GGN A;  3F45 A;  5CSN A;  1W7J B;  2M29 A;  3D0Y A;  4IL1 A;  1ALW A;  2WCB A;  1B4C A;  1N65 A;  4GFT A;  1YRU B;  2G2B A;  1CFD A;  1NX0 A;  2NZ0 A;  2ZND A;  1WDC C;  3CZ2 A;  3GOF A;  3D10 A;  1OOG A;  4NQG A;  1DJI A;  2I7A A;  4DS7 A;  3AAJ A;  4KYN A;  2P6B B;  1SBJ A;  2EC6 B;  1Z4H A;  1AP4 A;  2L5Y A;  1L2O B;  1OMD A;  2JPO A;  3TS5 B;  4MEW A;  1OZO A;  3CZ1 A;  3ICB A;  3OX5 A;  4PHM A;  4ETO A;  1RK9 A;  2JU0 A;  2KFH A;  1DJH A;  2QPT A;  3AAK A;  4YGD B;  3V2L A;  4JKT A;  4PT1 A;  4OR9 B;  3WXA A;  3FWC A;  1QVI Y;  3K21 A;  3SIB A;  1CMF A;  1FI5 A;  1Y1X A;  2OS8 B;  4ORC B;  2ZKM X;  4C0K A;  4CID A;  1BMO A;  4INX A;  1G4Y R;  3VRO A;  5I2O A;  3RM1 A;  1U5I B;  1Y0V H;  2QEV A;  2JNX A;  4L9M A;  1S3P A;  3NSL A;  1CFC A;  1AJ5 A;  2PRU A;  4UPG A;  2M8U A;  1QJT A;  1ZAC A;  1JFK A;  1N0Y A;  1K9P A;  1ORG A;  1KK8 C;  2E30 A;  1TCF A;  4GPL B;  1PSB A;  4HRH A;  1P28 A;  1Q80 A;  1M39 A;  2WC5 A;  5CPV A;  3QME A;  2RGI A;  1TNQ A;  2ERB A;  1PUL A;  2WCF A;  4C0J A;  1WDC B;  1WLZ A;  2WOR A;  5HKW A;  1JUO A;  2P71 A;  3I5F C;  4HRG A;  2QEB A;  2BBN A;  1Y1A A;  1TUZ A;  1XK4 C;  4CPV A;  5AFP A;  4ZCU A;  2F2O A;  4N1F A;  2JXC A;  5AEQ A;  3R72 A;  2KI6 D;  1IQ3 A;  2AMI A;  3EK7 A;  1LIN A;  1G33 A;  4PAL A;  2LLS A;  3I5H B;  4ORB B;  3A4U B;  3CZ0 A;  3D75 A;  3SJS A;  4QJ3 B;  1A75 B;  3BQ3 A;  3BXK A;  1CDP A;  3A8R A;  2K0J A;  3DY9 A;  3EVV A;  2LP2 A;  3KHE A;  2CXJ A;  2I18 A;  4GGF A;  1J7P A;  5FI6 A;  5AER A;  1XFU O;  3CTN A;  4C0L A;  2LV7 A;  3RZS A;  1WRK A;  2WCK A;  2NCO A;  1NIW A;  2LVI A;  3FS7 A;  3DD4 A;  2M3W A;  2KYF A;  2WND A;  1MF8 B;  3NHT A;  3WHT B;  4WQ2 A;  1NX2 A;  1NYA A;  1CTR A;  4INW A;  4YGA A;  1S1E A;  2JTT A;  3OX6 A;  1QX5 B;  3DVJ A;  1GM0 A;  2F3Z A;  3UO9 A;  3OP0 A;  3B86 A;  1YUU A;  3PFV A;  2LUC A;  1J1E A;  1QAT A;  2JRF A;  2Y5I A;  1V1G A;  3PAL A;  1KFX L;  1NCX A;  4YGC B;  1IWQ A;  3SS4 A;  4DUQ A;  2CT9 A;  2KLE A;  1K9K A;  3CR4 X;  2JQ6 A;  1EH2 A;  3D78 A;  3SG4 A;  3GK4 X;  2EGD A;  1KSM A;  4GAO A;  1RTP 1;  3L4A A;  3BJH A;  1QLK A;  2KFG A;  1QV0 A;  1S26 D;  4USL A;  1J7Q A;  2GGM A;  3DF0 A;  5HL1 A;  3VGO A;  4WQ3 A;  1BG1 A;  5ER4 X;  4TNC A;  1IKU A;  1OZS A;  2E6W A;  1KSO A;  3WHU B;  2F33 A;  3AKB A;  1A03 A;  1K90 D;  4MVF A;  1MXE A;  3KO0 A;  3GK2 A;  4YI8 A;  2JPT A;  3R1P A;  1CM4 A;  4ICB A;  1FPW A;  2QEH A;  3FE8 A;  3FIA A;  1M63 B;  3CAB A;  3LL8 B;  1JSA A;  3IF7 A;  4BY5 A;  3NHI A;  2GTE A;  1S6I A;  3CWG A;  4DIR A;  1SSE B;  2KDH A;  1L2O C;  1PVA A;  2L4I A;  1V1F A;  1UHH A;  3MSE B;  2I94 A;  4XJK B;  1A2X A;  1D1O A;  2KHN A;  1S5G Z;  2BKH B;  2LLU A;  4QJ5 B;  2K7C A;  1SNL A;  1SL8 A;  1S5G Y;  2LAN A;  3B7A A;  1A4P A;  1X02 A;  4PHN A;  3IQQ A;  3SG6 A;  2OS8 C;  3EKJ A;  3S0E A;  3TDU A;  2M49 B;  5EL2 A;  5HLV A;  1SCM C;  1ZFS A;  3CS1 A;  1QX2 A;  1XFY O;  3VRQ A;  1BF5 A;  1PVB A;  1Z2C B;  2LCP A;  1BU3 A;  1KQM C;  2VRG A;  1DMO A;  2SCP A;  2PYQ A;  3EKH A;  1SK6 D;  1UHJ A;  1FI6 A;  4P5O E;  1B9A A;  3JVT B;  3DVK A;  2K7O A;  1CMG A;  1T14 A;  2HET A;  4ZCV A;  1LVC D;  2M0R A;  2KFF A;  1FF1 A;  1IG5 A;  2MRD A;  1WY9 A;  1OE9 B;  1TNX A;  3L4L A;  5DIC A;  5HLO A;  2F2P A;  1JFJ A;  1QX7 A;  2LM5 A;  4PCW A;  5F6T A;  5FYX A;  2LUX A;  2BE4 A;  1E8A A;  3LK1 A;  3I5G B;  5DKQ A;  2AUC A;  1OOF A;  3O6B A;  1QVI Z;  1IQ5 A;  3I5H C;  1NX3 A;  3NSK A;  4I5L B;  2M7L A;  1CB1 A;  1JBA A;  1RJV A;  2WOS A;  1AHR A;  1XYD A;  1C07 A;  2KGB C;  1QXP A;  3NGV A;  3QRX A;  1SCM B;  2K8M B;  1SL7 A;  1BOD A;  2ZRT A;  4GBA A;  1HT9 A;  1KQM B;  1JWD A;  5AXI A;  1F70 A;  1YUR A;  4OCI A;  1HQV A;  1AK8 A;  2FOT A;  1TIZ A;  1A75 A;  2COL B;  1BT6 A;  1SMG A;  3OB1 B;  1CLL A;  5HKY A;  2MBX A;  2PVB A;  1KK7 Z;  1OOH A;  1AJ4 A;  1OMR A;  1TOP A;  3N7H A;  3TS5 C;  1OMV A;  1SPY A;  1KK7 Y;  3BUO B;  1ZUZ A;  5G08 A;  2HPS A;  3EK8 A;  1YUS A;  3EVR A;  3LLE A;  3KEV A;  2F8P A;  1B8R A;  2PSR A;  3BYA A;  1CDN A;  5PAL A;  1KFU S;  1XFX O;  2NCP A;  1OOI X;  4BY4 A;  2K7D A;  3VRP A;  1YTZ C;  1LXF C;  2PMY A;  1XFW O;  1C7V A;  1EXR A;  3C1V A;  4YRU A;  1VRK A;  4ORA B;  4AOM A;  1WLM A;  2LHI A;  5CSF A;  4OV2 A;  3TUY C;  1H4B A;  2LHL A;  1FBV A;  3CGA A;  2K61 A;  4MSP A;  1DJG A;  1XK4 A;  3PM8 A;  4MZK A;  1QWV A;  2I2R E;  2BL0 B;  1ODB A;  1F8H A;  2L50 A;  1KQV A;  3PM2 A;  2PAL A;  3PLF B;  1AVS A;  1UHN A;  2FCD A;  4PHJ A;  2LMT A;  1XA5 A;  2M1U A;  4FQT A;  5KSZ A;  4F0Z B;  5FI2 A;  3O4Y A;  5KTY A;  3IVT A;  1TCO B;  1DJX A;  5DKN A;  1KCY A;  3BFA A;  3PAT A;  2KBM A;  3VB1 A;  2ISD A;  3SG3 A;  1F71 A;  1MR8 A;  3JTD C;  5D3O A;  5CSI A;  4Q04 A;  4I5N B;  1S6C A;  1SCV A;  1UP5 A;  2OTG B;  1MHO A;  2CCM A;  3BOW A;  1DJW A;  3S0F A;  1BJF A;  1SR6 B;  1XFV O;  2BEC A;  2HQ8 A;  2K60 A;  2WCE A;  1G8I A;  2JTZ A;  4JD9 A;  1CLB A;  4XJK A;  1DF0 B;  4A4C A;  1SL9 A;  2WC8 A;  3OHM B;  4CFR A;  1J7O A;  3TUY B;  1DTL A;  2M9G A;  1LS8 A;  2M97 A;  3SG2 A;  3JVT C;  1B1G A;  2JT3 A;  2L51 A;  3PSR A;  1TTX A;  2G9B A;  1CKK A;  2KBI A;  5D69 A;  3S0G A;  1JC2 A;  1F4Q A;  3FE6 A;  1M46 A;  1J1D A;  1C3Y A;  1DGU A;  1REC A;  2CNP A;  1PRW A;  3L47 A;  2JXL A;  3DVE A;  4OKH A;  3BUW B;  1WRZ A;  1DQE A;  1TN4 A;  2FJY A;  2LP3 A;  3OGN A;  4IJ7 A;  2WC6 A;  1NP8 A;  1NPQ A;  1QLS A;  1K9U A;  3I5G C;  1K93 D;  3B88 A;  1H8B A;  3JTD B;  3D76 A;  4MN0 A;  4YBH B;  2ZFD A;  2ZNE A;  2LMV A;  2H61 C;  4PE0 A;  1XFR A;  1DC1 A;  1LA3 A;  2L2E A;  2LE9 B;  1MUX A;  4PE1 A;  1CFP A;  3DXL A;  3FE9 A;  1YR5 A;  1IJ6 A;  4OZD A;  1XO5 A;  1RRO A;  2JOJ A;  1EL4 A;  4YGB B;  1YX7 A;  4JWQ A;  1NUB A;  3SG7 A;  2WCM A;  1SW8 A;  1J55 A;  4E68 A;  2HQW A;  3EG5 B;  2MHH A;  5ER5 A;  3VRN A;  1JF2 A;  2KSP A;  5HYD A;  2JUL A;  1IGV A;  1YVH A;  4M2O A;  3O2P A;  1UHK A;  1U5I A;  3BFB A;  4N1G A;  1C7W A;  4PHK A;  1LKJ A;  3LCP C;  1UUR A;  4FTG A;  2LC5 A;  1Y6W A;  1A29 A;  3O78 A;  1KFX S;  1UUS A;  4MZL A;  1TUJ A;  3PN7 C;  4D1E A;  2MA2 A;  5B8I B;  1YUT A;  1CNP A;  3DVM A;  4GNK B;  4FQO A;  1QIW A;  3EVU A;  4NDD A;  3DZT A;  1BLQ A;  2IS9 A;  2LVV A;  5HKZ A;  1OSA A;  5TNC A;  1NWD A;  2PQL A;  1NCZ A;  3SIA A;  2KI6 C;  2KI4 C;  1AUI B;  1CDM A;  2QEO A;  2Y1N A;  3IQO A;  2K2F A;  2BL0 C;  5AAN A;  5K89 A;  2QDI A;  1ZOT B;  3BUX B;  4M2Q A;  1LA0 A;  1B7T Z;  1QTX A;  4NDC A;  1SRA A;  2B1U A;  3CDN A;  2O5G A;  5IBW A;  1B7T Y;  3H4S E;  2DOQ A;  2JC2 A;  1NCY A;  3NXA A;  3I5I B;  5JJG A;  1B8C A;  4JPZ B;  4OVN F;  4QJ4 B;  2OPO A;  1GGW A;  1CDL A;  5CSJ A;  3KF9 A;  3ZNI A;  2L0P A;  3M0W A;  2WCH A;  3TDI A;  3CR5 X;  1DJZ A;  3D0Y B;  2K2A A;  4I5K A;  1K96 A;  3S0D A;  2JZI A;  1CFF A;  1BR1 B;  3RLZ A;  2LVJ A;  2NXQ A;  2OTG C;  3BUM B;  1PK0 D;  1J7R A;  2NLN A;  2A4J A;  3PN7 B;  4HSZ A;  4PDZ A;  5FI7 A;  3Q8I A;  1SR6 C;  1QIV A;  2KAY A;  5I8N A;  4HRE E;  2O60 A;  3SG5 A;  1IH0 A;  1BR4 B;  1F54 A;  1OQP A;  1CM1 A;  3WNX B;  1XFZ O;  4MZJ A;  5JOL A;  1BOC A;  2BNX A;  3R1O A;  1GJY A;  4DCK A;  1B47 A;  3E3R A;  4F7F A;  2MAZ A;  2LVK A;  1L7Z A;  2H2K A;  2KI4 B;  3S0A A;  1UWO A;  2PAS A;  1PAL A;  2KNE A;  4YGE B;  1EG4 A;  1QV1 A;  2Q4U A;  1ALV A;  2GGZ A;  1GQM A;  2SAS A;  2KOT A;  2P70 A;  1SY9 A;  2L4H A;  1DF0 A;  4N5X A;  2LNK A;  1IRJ A;  3EK4 A;  2KGR A;  2JT0 A;  1DEK A;  2WCJ A;  1K8U A;  3OBV A;  1XVJ A;  4GGF C;  4MRY A;  1N2D A;  2ZN8 A;  5D7F A;  2BBM A;  1SYM A;  4XYN A;  2L98 A;  2BKI B;  1W9Z A;  2BCB A;  1QAS A;  3AKA A;  3BFH A;  4CLN A;  3CZT X;  5DKR A;  4MBE A;  3NSI A;  1TNW A;  1DJY A;  2JWW A;  1K94 A;  3HCM A;  3D74 A;  5I2L A;  2BAP A;  1M31 A;  5GQQ C;  2WCL A;  5I2Q A;  1B8L A;  1JF0 A;  2L5X B;  2M1K B;  3D77 A;  3UNW A;  4AQI A;  4DRW A;  1DEL A;  1F55 A;  2BCA A;  1RWY A;  1M45 A;  5I94 A;  4M2P A;  2MJW B;  1CLM A;  3LK0 A;  1S6J A;  1Y1U A;  1C3Z A;  4CFQ A;  1KK8 B;  1IIO A;  2GV5 A;  1DGV A;  2M7N A;  2JT8 A;  2KAV A;  2KPH A;  2FCE A;  3SS3 A;  1ZMZ A;  2CBL A;  2ZN9 A;  4WRI A;  1K95 A;  3GK1 A;  3HX4 A;  4P2Y B;  1K2H A;  1DVI A;  3S0B A;  3I5F B;  1RFJ A;  2JNF A;  4YI9 A;  3VRR A;  4A4B A;  1KWO C;  1SKT A;  2TN4 A;  3D73 A;  1TWO A;  3SS5 A;  2AAO A;  2FJU B;  2QAC A;  1OOJ A;  2KLD A;  3DYE A;  2EHB A;  4PE4 A;  1OW4 A;  2F3Y A;  1NSH A;  3PJI A;  2ZRS A;  3KPX A;  1DT7 B;  1FW4 A; 
#chains in the Genus database with same CATH homology
 4MRX A;  1NX1 A;  2CTN A;  2KQ6 A;  1UHI A;  1R6P A;  1W7I B;  1WRL A;  2LAP A;  3NSO A;  2Q91 A;  2KAX A;  1PSR A;  1YRT B;  2LMU A;  4I5J A;  3ZWH A;  1MQ1 A;  2BCX A;  1QS7 A;  3FWB A;  2MLF C;  2Y4Q A;  5KU1 A;  2V53 A;  2MLE C;  4NDB A;  1EG3 A;  3BUN B;  1TRF A;  3BOW B;  1F4O A;  2EC6 C;  2KQY A;  3CLN A;  3I5I C;  1IJ5 A;  2K7B A;  4U8D A;  2H61 A;  2R2I A;  4GUK A;  2D8N A;  2BE6 A;  3OB2 B;  4MLW A;  5J3X A;  3TZ1 A;  3DF0 B;  4AQJ A;  2LLT A;  5BPJ A;  1KFU L;  1GGZ A;  1MWN A;  3TDZ A;  4R1E A;  1KWO B;  2KYC A;  2HF5 A;  4JQ0 D;  2Y1M A;  4PE7 A;  1MXL C;  1YX8 A;  1TNP A;  3CR2 A;  1EJ3 A;  1R2U A;  1YVL A;  1S36 A;  4GGN A;  3F45 A;  5CSN A;  1W7J B;  2M29 A;  3D0Y A;  4IL1 A;  1ALW A;  2WCB A;  1B4C A;  1N65 A;  4GFT A;  1YRU B;  2G2B A;  1CFD A;  1NX0 A;  2NZ0 A;  2ZND A;  1WDC C;  3GOF A;  3D10 A;  4NQG A;  1DJI A;  2I7A A;  4DS7 A;  3AAJ A;  2P6B B;  1SBJ A;  2EC6 B;  1AP4 A;  1L2O B;  1OMD A;  4MEW A;  1OZO A;  4ETO A;  3ICB A;  3OX5 A;  4PHM A;  1RK9 A;  2JU0 A;  2KFH A;  1DJH A;  2QPT A;  3AAK A;  4YGD B;  4OR9 B;  3WXA A;  3FWC A;  1QVI Y;  3K21 A;  3SIB A;  1CMF A;  1FI5 A;  1Y1X A;  2OS8 B;  4ORC B;  2ZKM X;  4C0K A;  4CID A;  1BMO A;  1G4Y R;  3VRO A;  5I2O A;  3RM1 A;  1U5I B;  1Y0V H;  2JNX A;  4L9M A;  1S3P A;  3NSL A;  1CFC A;  1AJ5 A;  2PRU A;  4UPG A;  2M8U A;  1QJT A;  1ZAC A;  1JFK A;  1N0Y A;  1K9P A;  1KK8 C;  2E30 A;  1TCF A;  4GPL B;  1PSB A;  4HRH A;  1Q80 A;  5CPV A;  1M39 A;  2RGI A;  1TNQ A;  1PUL A;  2WCF A;  4C0J A;  1WDC B;  1WLZ A;  2WOR A;  5HKW A;  1JUO A;  3I5F C;  4HRG A;  2BBN A;  1Y1A A;  1XK4 C;  4CPV A;  5AFP A;  4ZCU A;  2F2O A;  4N1F A;  2JXC A;  5AEQ A;  2KI6 D;  1IQ3 A;  2AMI A;  3EK7 A;  1LIN A;  1G33 A;  4PAL A;  2LLS A;  3I5H B;  4ORB B;  3A4U B;  3SJS A;  4QJ3 B;  1A75 B;  3BQ3 A;  3BXK A;  1CDP A;  3A8R A;  2K0J A;  3EVV A;  2LP2 A;  3KHE A;  2CXJ A;  2I18 A;  4GGF A;  1J7P A;  5AER A;  1XFU O;  3CTN A;  4C0L A;  2LV7 A;  1WRK A;  2NCO A;  1NIW A;  2LVI A;  3FS7 A;  3DD4 A;  2M3W A;  2KYF A;  2WND A;  1MF8 B;  3WHT B;  4WQ2 A;  1NX2 A;  1NYA A;  1CTR A;  4YGA A;  1S1E A;  2JTT A;  3OX6 A;  1QX5 B;  3DVJ A;  2F3Z A;  3OP0 A;  1YUU A;  3PFV A;  2LUC A;  1J1E A;  1QAT A;  2JRF A;  2Y5I A;  1V1G A;  3PAL A;  1KFX L;  1NCX A;  4YGC B;  1IWQ A;  3TS5 B;  4DUQ A;  2CT9 A;  3CR4 X;  1K9K A;  1EH2 A;  2JQ6 A;  3SG4 A;  3GK4 X;  2EGD A;  1KSM A;  4GAO A;  1RTP 1;  1QLK A;  2KFG A;  1QV0 A;  1S26 D;  4USL A;  1J7Q A;  2GGM A;  3DF0 A;  1BG1 A;  3VGO A;  4WQ3 A;  5ER4 X;  4TNC A;  1IKU A;  1OZS A;  2E6W A;  1KSO A;  3WHU B;  2F33 A;  3AKB A;  1A03 A;  1K90 D;  4MVF A;  1MXE A;  3KO0 A;  3GK2 A;  4YI8 A;  2JPT A;  1FPW A;  1CM4 A;  4ICB A;  3FIA A;  1M63 B;  3LL8 B;  1JSA A;  3IF7 A;  4BY5 A;  1S6I A;  3CWG A;  4DIR A;  2KDH A;  1L2O C;  1PVA A;  2L4I A;  1V1F A;  1UHH A;  3MSE B;  2I94 A;  4XJK B;  1A2X A;  1D1O A;  2KHN A;  1S5G Z;  2BKH B;  2LLU A;  4QJ5 B;  2K7C A;  1SNL A;  1SL8 A;  1S5G Y;  2LAN A;  1A4P A;  1X02 A;  4PHN A;  3IQQ A;  3SG6 A;  2OS8 C;  3EKJ A;  3TDU A;  2M49 B;  5HLV A;  1SCM C;  1ZFS A;  3CS1 A;  1QX2 A;  1XFY O;  3VRQ A;  1BF5 A;  1PVB A;  2LCP A;  2VRG A;  1BU3 A;  1KQM C;  1DMO A;  2SCP A;  3EKH A;  1SK6 D;  1UHJ A;  1FI6 A;  4P5O E;  1B9A A;  3JVT B;  3DVK A;  2K7O A;  1CMG A;  2HET A;  4ZCV A;  1LVC D;  2M0R A;  2KFF A;  1FF1 A;  1IG5 A;  2MRD A;  1WY9 A;  1OE9 B;  1TNX A;  5HLO A;  1JFJ A;  2F2P A;  1QX7 A;  2LM5 A;  4PCW A;  5F6T A;  5FYX A;  2LUX A;  2BE4 A;  1E8A A;  3LK1 A;  3I5G B;  5DKQ A;  2AUC A;  3O6B A;  1QVI Z;  1IQ5 A;  3I5H C;  1NX3 A;  3NSK A;  4I5L B;  2M7L A;  1CB1 A;  1JBA A;  1RJV A;  2WOS A;  1AHR A;  1XYD A;  1C07 A;  2KGB C;  1QXP A;  3QRX A;  1SCM B;  2K8M B;  1SL7 A;  1BOD A;  2ZRT A;  4GBA A;  1HT9 A;  1KQM B;  1JWD A;  5AXI A;  1F70 A;  1YUR A;  4OCI A;  1HQV A;  1AK8 A;  2FOT A;  1TIZ A;  1A75 A;  2COL B;  1BT6 A;  1SMG A;  3OB1 B;  1CLL A;  5HKY A;  2MBX A;  2PVB A;  1KK7 Z;  3TS5 C;  1AJ4 A;  1OMR A;  1TOP A;  1OMV A;  1SPY A;  1KK7 Y;  3BUO B;  1ZUZ A;  5G08 A;  2HPS A;  3EK8 A;  1YUS A;  3EVR A;  3LLE A;  3KEV A;  2F8P A;  1B8R A;  2PSR A;  3BYA A;  1CDN A;  5PAL A;  1KFU S;  1XFX O;  2NCP A;  4BY4 A;  2K7D A;  3VRP A;  1YTZ C;  1LXF C;  2PMY A;  1XFW O;  1C7V A;  1EXR A;  3C1V A;  4YRU A;  1VRK A;  4ORA B;  4AOM A;  1WLM A;  2LHI A;  5CSF A;  4OV2 A;  3TUY C;  1H4B A;  2LHL A;  1FBV A;  3CGA A;  2K61 A;  4MSP A;  1DJG A;  1XK4 A;  3PM8 A;  4MZK A;  2I2R E;  2BL0 B;  1ODB A;  1F8H A;  2L50 A;  1KQV A;  2PAL A;  3PLF B;  1AVS A;  1UHN A;  2FCD A;  4PHJ A;  2LMT A;  1XA5 A;  2M1U A;  5KSZ A;  4F0Z B;  5KTY A;  3O4Y A;  1TCO B;  1DJX A;  5DKN A;  1KCY A;  3PAT A;  2KBM A;  2ISD A;  3SG3 A;  1F71 A;  1MR8 A;  3JTD C;  5CSI A;  4Q04 A;  4I5N B;  1S6C A;  1SCV A;  1UP5 A;  2OTG B;  1MHO A;  2CCM A;  3BOW A;  1DJW A;  1BJF A;  1SR6 B;  1XFV O;  2BEC A;  2HQ8 A;  2WCE A;  1G8I A;  2JTZ A;  1CLB A;  4XJK A;  1DF0 B;  4A4C A;  1SL9 A;  2WC8 A;  3OHM B;  4CFR A;  1J7O A;  3TUY B;  1DTL A;  2M9G A;  2M97 A;  3SG2 A;  3JVT C;  1B1G A;  2JT3 A;  2L51 A;  3PSR A;  1TTX A;  2G9B A;  1CKK A;  2KBI A;  5D69 A;  1JC2 A;  1F4Q A;  1M46 A;  1J1D A;  1DGU A;  1REC A;  2CNP A;  1PRW A;  2JXL A;  3DVE A;  4OKH A;  3BUW B;  1WRZ A;  1TN4 A;  2LP3 A;  1NP8 A;  1NPQ A;  1QLS A;  1K9U A;  3I5G C;  1K93 D;  1H8B A;  3JTD B;  4MN0 A;  4YBH B;  2ZFD A;  2ZNE A;  2LMV A;  2H61 C;  4PE0 A;  1LA3 A;  2L2E A;  2LE9 B;  1MUX A;  4PE1 A;  1CFP A;  1YR5 A;  1IJ6 A;  1XO5 A;  1RRO A;  2JOJ A;  1EL4 A;  4YGB B;  1YX7 A;  4JWQ A;  1NUB A;  3SG7 A;  1SW8 A;  1J55 A;  4E68 A;  2HQW A;  2MHH A;  5ER5 A;  3VRN A;  1JF2 A;  2KSP A;  5HYD A;  2JUL A;  1IGV A;  1YVH A;  4M2O A;  3O2P A;  1UHK A;  1U5I A;  4N1G A;  1C7W A;  4PHK A;  1LKJ A;  3LCP C;  1UUR A;  4FTG A;  2LC5 A;  1Y6W A;  1A29 A;  3O78 A;  1KFX S;  1UUS A;  4MZL A;  3PN7 C;  4D1E A;  2MA2 A;  5B8I B;  1YUT A;  1CNP A;  3DVM A;  4GNK B;  4FQO A;  1QIW A;  3EVU A;  4NDD A;  2IS9 A;  2LVV A;  5HKZ A;  1OSA A;  5TNC A;  1NWD A;  1NCZ A;  3SIA A;  2KI6 C;  2KI4 C;  1AUI B;  1CDM A;  2Y1N A;  3IQO A;  2K2F A;  2BL0 C;  5AAN A;  5K89 A;  1ZOT B;  3BUX B;  4M2Q A;  1LA0 A;  1B7T Z;  1QTX A;  4NDC A;  1SRA A;  2B1U A;  2O5G A;  5IBW A;  1B7T Y;  3H4S E;  2DOQ A;  2JC2 A;  1NCY A;  3NXA A;  3I5I B;  5JJG A;  1B8C A;  4JPZ B;  4OVN F;  4QJ4 B;  2OPO A;  1GGW A;  1CDL A;  5CSJ A;  3KF9 A;  3ZNI A;  2L0P A;  3M0W A;  3TDI A;  3CR5 X;  1DJZ A;  3D0Y B;  2K2A A;  4I5K A;  1K96 A;  2JZI A;  1CFF A;  1BR1 B;  3RLZ A;  2LVJ A;  2NXQ A;  2OTG C;  3BUM B;  1PK0 D;  1J7R A;  2NLN A;  2A4J A;  3PN7 B;  4HSZ A;  4PDZ A;  1BLQ A;  1SR6 C;  1QIV A;  2KAY A;  5I8N A;  4HRE E;  2O60 A;  3SG5 A;  1IH0 A;  1BR4 B;  1F54 A;  1OQP A;  1CM1 A;  3WNX B;  1XFZ O;  4MZJ A;  5JOL A;  1BOC A;  4DCK A;  1GJY A;  1B47 A;  3E3R A;  2MAZ A;  2LVK A;  1L7Z A;  2H2K A;  2KI4 B;  1UWO A;  2PAS A;  1PAL A;  2KNE A;  4YGE B;  1EG4 A;  1QV1 A;  2Q4U A;  1ALV A;  2GGZ A;  1GQM A;  2SAS A;  2KOT A;  1SY9 A;  2L4H A;  1DF0 A;  4N5X A;  2LNK A;  1IRJ A;  3EK4 A;  2KGR A;  2JT0 A;  1K8U A;  1XVJ A;  4GGF C;  4MRY A;  1N2D A;  2ZN8 A;  5D7F A;  2BBM A;  1SYM A;  4XYN A;  2L98 A;  2BKI B;  2BCB A;  1QAS A;  3AKA A;  4CLN A;  3CZT X;  5DKR A;  4MBE A;  3NSI A;  1TNW A;  1DJY A;  2JWW A;  1K94 A;  3HCM A;  5I2L A;  1M31 A;  5GQQ C;  5I2Q A;  1B8L A;  1JF0 A;  2L5X B;  2M1K B;  4AQI A;  4DRW A;  1F55 A;  2BCA A;  1RWY A;  1M45 A;  4M2P A;  2MJW B;  1CLM A;  3LK0 A;  1S6J A;  1Y1U A;  4CFQ A;  1KK8 B;  2GV5 A;  1DGV A;  2M7N A;  2JT8 A;  2KAV A;  2FCE A;  1ZMZ A;  2CBL A;  2ZN9 A;  4WRI A;  1K95 A;  3GK1 A;  3HX4 A;  4P2Y B;  1K2H A;  1DVI A;  3I5F B;  1RFJ A;  2JNF A;  4YI9 A;  3VRR A;  4A4B A;  1KWO C;  1SKT A;  2TN4 A;  2AAO A;  2FJU B;  2QAC A;  1OOJ A;  2EHB A;  4PE4 A;  2F3Y A;  1NSH A;  2ZRS A;  3KPX A;  1DT7 B;  1FW4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...