1Q80A

Solution structure and dynamics of nereis sarcoplasmic calcium binding protein
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
174
structure length
174
Chain Sequence
SDLWVQKMKTYFNRIDFDKDGAITRMDFESMAERFAKESEMKAEHAKVLMDSLTGVWDNFLTAVAGGKGIDETTFINSMKEMVKNPEAKSVVEGPLPLFFRAVDTNEDNNISRDEYGIFFGMLGLDKTMAPASFDAIDTNNDGLLSLEEFVIAGSDFFMNDGDSTNKVFWGPLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sarcoplasmic calcium-binding protein
publication title Solution structure and internal dynamics of NSCP, a compact calcium-binding protein.
pubmed doi rcsb
source organism Neanthes diversicolor
molecule tags Metal binding protein
total genus 60
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2003-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1q80A00
5HKWA 2BE4A 3TDZA 1QLKA 2AUCA 2KAXA 2QACA 4GUKA 4N1FA 1RJVA 3AKAA 1XO5A 4R1EA 1N0YA 1OZOA 1J1DA 1TCFA 2OS8C 3KHEA 3CLNA 5HLVA 4ZCVA 5J3XA 2LHIA 1CLLA 1OMRA 1XVJA 4PDZA 5JOLA 1OE9B 1F4QA 2LVJA 2KNEA 4USLA 1NX0A 1MQ1A 1A03A 2L0PA 1A29A 2LLUA 1A4PA 1F55A 2I94A 1NWDA 1YURA 3CR4X 3PN7B 2JXCA 3TUYB 5JJGA 3D0YB 2JNXA 4U8DA 4PHMA 3NXAA 3RLZA 2HQWA 1M31A 1KSOA 1LVCD 1LINA 2F2PA 1RROA 2M1KB 2M1UA 3EK8A 2LMUA 2WCBA 2JU0A 1ALVA 1YUUA 1NUBA 1ZMZA 3I5HB 2JTZA 3I5IB 1CMGA 2M7NA 1KK7Z 3DF0A 5ER5A 1CTRA 1J7RA 1ALWA 1TNXA 4DCKA 1SKTA 1J7PA 1IRJA 2LM5A 2CT9A 3BOWB 1SR6B 1U5IB 4MN0A 2R2IA 1SRAA 1X02A 1TCOB 2TN4A 4XYNA 1VRKA 4YRUA 4PE4A 2MRDA 2K8MB 1Y1UA 1BG1A 1GGZA 1TNPA 1JSAA 4P2YB 4I5JA 2LMTA 1DMOA 1NPQA 2FJUB 2M9GA 3MSEB 2ZRSA 1ZOTB 1LKJA 3EVVA 1AJ4A 1MHOA 3OX6A 1K8UA 1CM1A 1F4OA 2KI6D 2PASA 1PVAA 3KEVA 1NP8A 4CFRA 3SG6A 4YGCB 3KO0A 5HYDA 2KI4B 3LLEA 1K94A 1Q80A 5AANA 2SASA 2QPTA 4GGFA 2SCPA 3JTDB 2BE6A 4I5NB 1GGWA 1J1EA 4AOMA 2LLTA 2OTGB 5FYXA 5BPJA 1E8AA 1RFJA 4PHJA 1KQMB 1TOPA 4MZKA 4YGAA 2O5GA 3A4UB 3IF7A 3BQ3A 1B7TY 4TNCA 1BR4B 4WQ3A 1Y0VH 3BUXB 4GGFC 2Y5IA 5CSFA 1UWOA 1C7VA 1B8CA 3PATA 5G08A 4DS7A 2JT3A 1PRWA 1GQMA 1CM4A 1RK9A 1TNWA 2ZN8A 1M39A 4HRGA 1QLSA 1CKKA 1SCMC 1KFXS 1QV1A 1WDCC 2HPSA 2MLFC 3EVUA 2CBLA 2CXJA 2IS9A 5HKYA 1B8RA 1TIZA 2F3YA 5HKZA 2EC6C 2KAVA 2MAZA 1PALA 4MZLA 2E6WA 1KWOB 2LP2A 4A4CA 3KPXA 1FI6A 4C0LA 3C1VA 4N5XA 1MXLC 1SNLA 2K7OA 2CCMA 1NCYA 1K9UA 3CS1A 2NCOA 2JNFA 1H8BA 2WOSA 4PE0A 4F0ZB 1QATA 1D1OA 1S6JA 2AMIA 1AHRA 2EHBA 1CFCA 1IQ3A 1BMOA 3OB2B 1NCXA 1S36A 1QTXA 1NX3A 2G2BA 3LL8B 4N1GA 2FOTA 2PMYA 5D7FA 4GPLB 1BU3A 3TDIA 1KK7Y 2JTTA 3O78A 3F45A 1KK8C 2LHLA 2ZFDA 1UHHA 5TNCA 1F70A 1JF0A 1YTZC 3PFVA 1K95A 4I5LB 1RWYA 2A4JA 5KSZA 1YX7A 2KFHA 4OR9B 4A4BA 2WNDA 2PRUA 2F8PA 1V1GA 3E3RA 3TS5C 2BL0B 4L9MA 2M7LA 3O4YA 3VGOA 1WRZA 2LVKA 1EG3A 2GV5A 3CGAA 1UURA 5IBWA 1SL7A 1QX7A 1U5IA 3BUWB 3I5FC 1IGVA 2FCDA 3IQOA 4AQJA 1EG4A 1K9KA 2JQ6A 1EH2A 3I5GB 5I2OA 4XJKA 2L5XB 4CIDA 1AJ5A 1Y1AA 1NIWA 2LUXA 5AFPA 3ZNIA 4DRWA 1UP5A 1KFUL 1RTP1 3EK4A 4YGEB 1XFWO 1TNQA 3O6BA 3CTNA 1JF2A 3GK4X 1DF0B 1M63B 3BUMB 1SBJA 1A75A 3AAJA 5F6TA 1BLQA 3CZTX 1J7OA 1AP4A 1IQ5A 4PALA 2F3ZA 1J7QA 2G9BA 4D1EA 3NSKA 2BECA 2WCEA 4ICBA 4ZCUA 5I2LA 3HCMA 1DJYA 4BY4A 1PULA 3PLFB 4NDDA 3FWBA 3TDUA 3OX5A 1YX8A 2KQYA 1MF8B 3OHMB 2BCXA 3AAKA 1XFYO 2KDHA 1TTXA 2L98A 2HF5A 4ORAB 1N65A 4YBHB 1L2OC 1W7JB 2Y4QA 2LC5A 3GK1A 5K89A 1OMVA 1IH0A 1BJFA 1FW4A 2KBMA 1QASA 3SJSA 1QIVA 4WQ2A 2GGZA 4OCIA 2V53A 3DVKA 2OS8B 1DJIA 4P5OE 5ER4X 2ZNEA 4MRYA 2P6BB 3D10A 2H61A 1JFJA 1KQVA 4NDBA 1XA5A 1F71A 2ZNDA 1OQPA 1WLMA 2RGIA 4CFQA 5CSNA 3BUOB 3BXKA 1QX5B 1LA0A 2COLB 2H61C 2K7DA 5AEQA 3PM8A 2PVBA 5AERA 4ORBB 2WCFA 2Y1MA 1CDMA 2KFFA 4NDCA 4MZJA 2K7BA 1AUIB 5CSIA 1K93D 3SIBA 3LK1A 2K2AA 4FQOA 4QJ3B 1WRLA 1WRKA 2NCPA 5B8IB 3PSRA 1F8HA 1S6CA 2KFGA 1DGVA 1M46A 2KBIA 1SL8A 2I18A 1XFVO 1SW8A 3DF0B 1C7WA 2M49B 1KFXL 1S1EA 1FI5A 1DT7B 4CPVA 1DJXA 2Q4UA 2JULA 1CFPA 2L2EA 4UPGA 5AXIA 4PE1A 1XYDA 1ZUZA 3JVTC 1WY9A 1Y1XA 3K21A 2JOJA 1B9AA 1SPYA 1NSHA 3A8RA 3DVJA 1YVHA 2LE9B 3M0WA 5DKRA 3RM1A 3VRNA 1CDLA 4NQGA 4PHNA 1PK0D 3DVMA 1YUTA 5KU1A 1S5GZ 2CNPA 4DUQA 2BBNA 3H4SE 1MWNA 3O2PA 3PALA 2ZRTA 3VRRA 2M0RA 1B4CA 2JWWA 1LXFC 1SY9A 1OOJA 3FS7A 3D0YA 1S26D 5D69A 4M2OA 1R2UA 3EKJA 1DF0A 1UHKA 2LNKA 1FBVA 1C07A 2MLEC 3BYAA 2JZIA 3PN7C 1CDNA 3TUYC 3IQQA 1QXPA 2LLSA 2M97A 4GNKB 2LVVA 1SK6D 4CLNA 4JWQA 2MBXA 1QJTA 2KHNA 1OMDA 3BOWA 1UHJA 3I5HC 1SCMB 1WDCB 2F33A 3SG7A 3WHUB 3I5IC 4GFTA 1QVIZ 1W7IB 1TRFA 2EC6B 2MA2A 3DVEA 1NYAA 1QX2A 1XFUO 1BODA 2LCPA 2LVIA 4FTGA 1JUOA 4MSPA 1R6PA 1SMGA 2KOTA 2L51A 1JBAA 1CLMA 5I2QA 3NSLA 1MR8A 1SR6C 2F2OA 1CB1A 3SG4A 1YRTB 2VRGA 2L4IA 4MBEA 1DJHA 1AVSA 4YGBB 2KYCA 1IG5A 1CNPA 1N2DA 3AKBA 3FWCA 3CR5X 1CFFA 4I5KA 4WRIA 5GQQC 1NX2A 1KCYA 1PSBA 2MHHA 1KFUS 2LMVA 1MUXA 1SL9A 1SYMA 1KK8B 3OB1B 2NXQA 3FIAA 2KI4C 1DGUA 1Y6WA 4AQIA 2AAOA 3JTDC 3SG3A 4GBAA 3TS5B 4M2PA 4IL1A 1CMFA 1DJWA 2OTGC 4GAOA 3HX4A 1KQMC 1DTLA 1ODBA 1V1FA 2KGBC 2NZ0A 2ZKMX 4ETOA 1K2HA 4YI8A 1DJZA 3I5FB 3LK0A 3TZ1A 3VRQA 3WHTB 4BY5A 4PHKA 1PSRA 1M45A 2MJWB 4ORCB 2WC8A 5KTYA 3NSIA 1MXEA 1IKUA 2BKHB 2KGRA 1DVIA 2O60A 1BF5A 3ZWHA 3CR2A 2ISDA 1NX1A 2KQ6A 1S5GY 1YR5A 4Q04A 4OVNF 5I8NA 1LA3A 4MVFA 1K90D 2BKIB 1L7ZA 4XJKB 1KWOC 2KI6C 4QJ5B 1EJ3A 3ICBA 1EXRA 2Q91A 1UUSA 1YVLA 2GGMA 3EKHA 1UHNA 4GGNA 2JPTA 4OKHA 3WXAA 1K96A 2BBMA 1G33A 2H2KA 2I7AA 1S6IA 1J55A 5DKNA 1G4YR 1KSMA 2HETA 2PALA 2KSPA 1A75B 2BCAA 4YI9A 1GJYA 1S3PA 4MRXA 2LANA 3SG5A 1A2XA 2M8UA 2L4HA 1QV0A 4HSZA 1JC2A 1QIWA 1F54A 3KF9A 1L2OB 1FPWA 2M3WA 2LV7A 4JQ0D 4C0JA 2KAYA 2NLNA 4PE7A 3OP0A 1QVIY 3CWGA 1EL4A 1RECA 2BCBA 1B1GA 1FF1A 1UHIA 3BUNB 5PALA 4JPZB 2CTNA 2HQ8A 2LUCA 4M2QA 1IJ5A 2BL0C 4HREE 4DIRA 1B8LA 3GK2A 1JWDA 3QRXA 4YGDB 1IJ6A 5HLOA 1CDPA 1XFXO 4MLWA 3GOFA 1WLZA 1YUSA 1XK4A 2JT8A 1QS7A 1ZFSA 2Y1NA 3WNXB 1K9PA 1PVBA 3LCPC 2OPOA 2EGDA 3I5GC 3NSOA 4QJ4B 2LP3A 3DD4A 1AK8A 1IWQA 2E30A 2KYFA 3VRPA 2L50A 2K61A 1JFKA 1OZSA 2DOQA 1XFZO 2LAPA 1DJGA 4E68A 2JXLA 2M29A 3EVRA 1B47A 3SG2A 1XK4C 5CSJA 2K7CA 1ZACA 1YRUB 2B1UA 1CLBA 2ZN9A 5DKQA 4C0KA 2D8NA 1CFDA 1G8IA 2JT0A 1OSAA 1HQVA 3SIAA 2WORA 5CPVA 2I2RE 1H4BA 1HT9A 1NCZA 2K2FA 2FCEA 4PCWA 1B7TZ 1BT6A 1BOCA 4OV2A 3EK7A 3JVTB 4MEWA 1SCVA 2K0JA 1TN4A 2JRFA 2JC2A 3VROA 4HRHA 2PSRA 1BR1B
chains in the Genus database with same CATH superfamily
5HKWA 2BE4A 3TDZA 1QLKA 2AUCA 2KAXA 3DY9A 2QACA 4GUKA 4N1FA 1RJVA 3AKAA 1XO5A 2QEBA 4R1EA 1N0YA 1OZOA 1J1DA 1TCFA 1Z2CB 2OS8C 3CLNA 3KHEA 5HLVA 3BJHA 4ZCVA 5J3XA 2LHIA 5DICA 1DC1A 1CLLA 1OMRA 1XVJA 4PDZA 5JOLA 1OE9B 1F4QA 2LVJA 2KNEA 4USLA 1NX0A 1MQ1A 3VB1A 1A03A 2L0PA 1A29A 2LLUA 1A4PA 1F55A 2I94A 1NWDA 1YURA 3CR4X 3NGVA 3PN7B 2JXCA 3TUYB 5JJGA 3D0YB 2JNXA 4U8DA 3B7AA 4PHMA 3NXAA 3RLZA 2HQWA 1M31A 1C3YA 1KSOA 1LVCD 1LINA 2F2PA 1TUJA 1RROA 2M1KB 2M1UA 3EK8A 2LMUA 2WCBA 2JU0A 1ALVA 1YUUA 1NUBA 1ZMZA 3I5HB 2JTZA 3I5IB 1CMGA 2M7NA 1KK7Z 3DF0A 5ER5A 1CTRA 1J7RA 3B86A 3BFHA 1ALWA 1TNXA 3CYZA 4DCKA 1SKTA 1J7PA 1IRJA 2LM5A 2CT9A 3BOWB 1SR6B 1U5IB 4MN0A 2R2IA 1SRAA 1X02A 1TCOB 2TN4A 4XYNA 1VRKA 4YRUA 4PE4A 2MRDA 2K8MB 1Y1UA 1BG1A 1GGZA 1TNPA 1JSAA 4P2YB 4I5JA 3K1EA 2LMTA 3FE9A 1DMOA 3CZ0A 1NPQA 3S0DA 2FJUB 2M9GA 3MSEB 3R72A 2ZRSA 1ZOTB 1LKJA 3EVVA 1AJ4A 1MHOA 3OX6A 1K8UA 2QEHA 1CM1A 1F4OA 2KI6D 2PASA 1PVAA 3KEVA 1NP8A 4CFRA 3SG6A 4YGCB 3KO0A 5HYDA 2KI4B 3LLEA 1K94A 1Q80A 5AANA 2SASA 2QPTA 4GGFA 2SCPA 3JTDB 2BE6A 4I5NB 4IJ7A 1J1EA 4AOMA 2LLTA 1GGWA 2OTGB 5FYXA 5BPJA 1E8AA 1RFJA 4PHJA 1DQEA 1KQMB 1TOPA 4MZKA 4YGAA 2O5GA 3A4UB 3CDNA 3IF7A 3PM2A 3BQ3A 1B7TY 4TNCA 1BR4B 2ERBA 4WQ3A 1Y0VH 3BUXB 4GGFC 2Y5IA 3FE6A 1UWOA 5CSFA 1C7VA 1B8CA 3PATA 5G08A 4DS7A 2JT3A 1PRWA 1GQMA 1CM4A 1RK9A 1TNWA 2ZN8A 1M39A 4HRGA 1QLSA 1CKKA 1LS8A 1SCMC 1KFXS 1QV1A 1WDCC 2HPSA 2MLFC 3EVUA 3D77A 2CBLA 2CXJA 2IS9A 5FI6A 1B8RA 1TIZA 5HKYA 2F3YA 5HKZA 2EC6C 2KLDA 2KAVA 2MAZA 4JD9A 3Q8IA 1PALA 4MZLA 2E6WA 1KWOB 3CABA 2LP2A 4A4CA 3KPXA 3B87A 1FI6A 4C0LA 3C1VA 4N5XA 3S0EA 1MXLC 1SNLA 2K7OA 3DYEA 1NCYA 2CCMA 1K9UA 3CS1A 2NCOA 2JNFA 4FQTA 2JPOA 2WOSA 1H8BA 4PE0A 4F0ZB 1QATA 3R1VA 1D1OA 1S6JA 2AMIA 1AHRA 2EHBA 3UO9A 1CFCA 1IQ3A 1DELA 1BMOA 3OB2B 2QEOA 1NCXA 1S36A 1QTXA 1NX3A 2G2BA 3LL8B 4N1GA 2P71A 2FOTA 2PMYA 5D7FA 3D75A 4GPLB 1BU3A 3TDIA 1KK7Y 2JTTA 3O78A 3F45A 3R1OA 1KK8C 2LHLA 2BAPA 1UHHA 2ZFDA 5TNCA 1F70A 1JF0A 1YTZC 3PFVA 1K95A 4I5LB 1RWYA 2A4JA 5KSZA 1YX7A 2KFHA 4OR9B 4A4BA 2WNDA 2PRUA 2F8PA 1V1GA 3D76A 3E3RA 2BL0B 4L9MA 2M7LA 3TS5C 3O4YA 3VGOA 3V2LA 1WRZA 2LVKA 1EG3A 2GV5A 3CGAA 1UURA 5IBWA 3D78A 1SL7A 1QX7A 1U5IA 3BUWB 3I5FC 1IGVA 2FCDA 3IQOA 3D74A 4AQJA 1EG4A 1K9KA 2JQ6A 1EH2A 3I5GB 4PT1A 4XJKA 5I2OA 2L5XB 4CIDA 1AJ5A 1Y1AA 5I94A 1NIWA 2LUXA 5AFPA 3ZNIA 4DRWA 1UP5A 1KFUL 1RTP1 3NHTA 3B6XA 3EK4A 4YGEB 1XFWO 1TNQA 3O6BA 3CTNA 1JF2A 3GK4X 1DF0B 1M63B 3BUMB 1SBJA 1A75A 3AAJA 5F6TA 1BLQA 3CZTX 1J7OA 1AP4A 1IQ5A 4PALA 2F3ZA 1J7QA 2G9BA 4D1EA 3NSKA 2BECA 2WCEA 4ICBA 4ZCUA 5I2LA 3HCMA 1DJYA 4BY4A 3SS5A 1PULA 3PLFB 4NDDA 3FWBA 3TDUA 3OX5A 1YX8A 2KQYA 3CZ2A 1MF8B 3OHMB 2BCXA 4OZDA 3AAKA 1XFYO 2KDHA 1TTXA 2L98A 2HF5A 4ORAB 1N65A 4YBHB 1L2OC 1W7JB 2L2CA 2LC5A 2Y4QA 3GK1A 5K89A 1OMVA 1IH0A 1BJFA 1FW4A 2KBMA 1QASA 3SJSA 1QIVA 4WQ2A 2GGZA 4OCIA 2PYQA 2V53A 3BFBA 3DVKA 2OS8B 1DJIA 4P5OE 5ER4X 2ZNEA 4MRYA 2P6BB 3D10A 2H61A 1JFJA 1KQVA 4NDBA 2FJYA 1XA5A 1F71A 2ZNDA 1OQPA 1WLMA 2RGIA 4CFQA 5CSNA 3BUOB 3BXKA 3UNWA 1QX5B 1LA0A 2COLB 2H61C 2K7DA 5AEQA 3PM8A 2PVBA 5AERA 4ORBB 2WCFA 2Y1MA 3R1PA 1CDMA 2KFFA 4NDCA 4MZJA 2K7BA 1AUIB 5CSIA 1K93D 3SIBA 3LK1A 2K2AA 4FQOA 3L4LA 4QJ3B 3RZSA 2WCHA 1WRLA 1WRKA 2NCPA 5B8IB 3PSRA 2H8VA 1F8HA 1S6CA 2KFGA 1DGVA 1M46A 2KBIA 1SL8A 2I18A 1XFVO 1SW8A 3DF0B 4JKTA 1P28A 1C7WA 2M49B 1KFXL 1S1EA 1FI5A 1DT7B 4CPVA 1DJXA 2Q4UA 2JULA 1CFPA 2L2EA 4UPGA 5AXIA 4PE1A 1ZUZA 1XYDA 3JVTC 1WY9A 1Y1XA 3S0GA 3K21A 2JOJA 1B9AA 1SPYA 1NSHA 3A8RA 3DVJA 1YVHA 2LE9B 3M0WA 5DKRA 3RM1A 3VRNA 1CDLA 4NQGA 4PHNA 1PK0D 3DVMA 1YUTA 5KU1A 1S5GZ 2CNPA 4DUQA 2BBNA 3H4SE 1MWNA 3O2PA 3PALA 2ZRTA 5EL2A 3VRRA 2M0RA 1B4CA 2JWWA 1LXFC 1SY9A 3SS3A 1OOJA 3FS7A 3D0YA 1S26D 5D69A 1W9ZA 2KLEA 1R2UA 3EKJA 4M2OA 1DF0A 1UHKA 3S0BA 2LNKA 4KYNA 1FBVA 1C07A 2MLEC 3BYAA 2JZIA 3PN7C 1CDNA 3TUYC 3IQQA 1QXPA 2LLSA 3PJIA 2M97A 4GNKB 2LVVA 3D73A 1SK6D 4CLNA 4JWQA 2MBXA 1QJTA 2KHNA 1OMDA 3BOWA 1UHJA 3I5HC 1SCMB 3IVTA 1WDCB 2F33A 3SG7A 3WHUB 3I5IC 4GFTA 1QVIZ 1W7IB 1TRFA 2EC6B 2MA2A 3DVEA 1NYAA 1QX2A 1XFUO 1BODA 2LCPA 2LVIA 4FTGA 1JUOA 3DZTA 3L4AA 4MSPA 3OGNA 1R6PA 1SMGA 2KOTA 2L51A 1JBAA 1CLMA 3OBVA 5I2QA 3NSLA 3EG5B 1MR8A 1SR6C 2F2OA 3O4XA 1CB1A 3SG4A 3DXLA 1YRTB 2VRGA 2L4IA 3FE8A 1XFRA 4MBEA 1DJHA 1AVSA 2L5YA 4YGBB 2KYCA 1IG5A 1CNPA 1N2DA 3AKBA 3FWCA 3QMEA 3CR5X 1CFFA 2WC6A 4I5KA 4WRIA 5GQQC 1NX2A 1KCYA 1PSBA 2MHHA 3B88A 1KFUS 2LMVA 1MUXA 1SL9A 1SYMA 2P70A 1KK8B 1OOIX 2K60A 3CZ1A 3OB1B 2NXQA 3FIAA 2KI4C 1DGUA 1Y6WA 4AQIA 2AAOA 3JTDC 3SG3A 4GBAA 3TS5B 4M2PA 4IL1A 1CMFA 1DJWA 2OTGC 4GAOA 3HX4A 1KQMC 1DTLA 1ODBA 1QWVA 1V1FA 2KGBC 2PQLA 2NZ0A 2ZKMX 4ETOA 1K2HA 2WCKA 1DJZA 3I5FB 3LK0A 4YI8A 3TZ1A 3VRQA 3WHTB 4BY5A 4PHKA 1PSRA 1M45A 2MJWB 4ORCB 2WC8A 3L47A 5KTYA 3NSIA 1MXEA 1IKUA 2WCJA 2BKHB 2KGRA 1DVIA 2WC5A 2O60A 1BF5A 2QDIA 3ZWHA 3CR2A 3S0FA 2ISDA 1NX1A 4INXA 2KQ6A 1S5GY 1YR5A 4Q04A 4OVNF 5I8NA 1LA3A 4MVFA 1K90D 2BKIB 1L7ZA 4XJKB 4F7FA 1KWOC 1T14A 2KI6C 4INWA 1EJ3A 4QJ5B 3ICBA 1TUZA 1EXRA 2Q91A 2WCMA 1UUSA 1YVLA 2GGMA 1OOHA 3EKHA 1UHNA 4GGNA 2JPTA 3SS4A 4OKHA 3WXAA 1K96A 2BBMA 1G33A 2KPHA 1OW4A 2H2KA 2I7AA 1S6IA 1J55A 5DKNA 1G4YR 1KSMA 2HETA 4QJ4B 2PALA 2KSPA 1A75B 2BCAA 4YI9A 1GJYA 1S3PA 4MRXA 2LANA 2GTEA 3SG5A 1A2XA 2M8UA 2L4HA 1QV0A 4HSZA 1JC2A 5FI7A 1QIWA 1F54A 3N7HA 3KF9A 1L2OB 1FPWA 1SSEB 2M3WA 2LV7A 4JQ0D 4C0JA 2YGUA 2KAYA 1OOGA 2NLNA 3OP0A 1QVIY 4PE7A 3CWGA 1EL4A 1RECA 2BCBA 1B1GA 1FF1A 1UHIA 3BUNB 5HL1A 5PALA 2WCLA 4JPZB 2CTNA 2BNXA 1TWOA 2HQ8A 2LUCA 1IJ5A 2QEVA 4M2QA 3S0AA 2BL0C 4HREE 4DIRA 1B8LA 3GK2A 1JWDA 1ORGA 3QRXA 4YGDB 3BFAA 1IJ6A 5HLOA 1CDPA 1XFXO 4MLWA 3GOFA 1WLZA 1YUSA 1XK4A 2JT8A 1QS7A 1ZFSA 2Y1NA 3WNXB 1K9PA 1OOFA 1PVBA 2OPOA 2EGDA 3I5GC 3LCPC 3NSOA 2LP3A 5FI2A 3DD4A 1AK8A 1IWQA 2E30A 2KYFA 3VRPA 2L50A 2K61A 1JFKA 1OZSA 2DOQA 1XFZO 2LAPA 1DJGA 4E68A 2JXLA 2M29A 3EVRA 1B47A 3SG2A 1XK4C 5D3OA 5CSJA 2K7CA 1ZACA 1YRUB 2B1UA 1CLBA 3NHIA 2ZN9A 5DKQA 4C0KA 2D8NA 1CFDA 1G8IA 2JT0A 1OSAA 1HQVA 3SIAA 2WORA 5CPVA 2I2RE 1H4BA 1HT9A 1NCZA 2K2FA 2FCEA 4PCWA 1B7TZ 1BT6A 1BOCA 1Z4HA 1IIOA 4OV2A 3EK7A 3JVTB 4MEWA 1C3ZA 1DEKA 1SCVA 1TN4A 2JRFA 2JC2A 2K0JA 3VROA 1GM0A 4HRHA 2PSRA 1BR1B
chains in the Genus database with same CATH topology
5HKWA 2BE4A 3TDZA 1QLKA 2AUCA 2KAXA 2QACA 4GUKA 4N1FA 1RJVA 3AKAA 1XO5A 4R1EA 1N0YA 1OZOA 1J1DA 1TCFA 2OS8C 3KHEA 3CLNA 5HLVA 4ZCVA 5J3XA 2LHIA 1CLLA 1OMRA 1XVJA 4PDZA 5JOLA 1OE9B 1F4QA 2LVJA 2KNEA 4USLA 1NX0A 1MQ1A 1A03A 2L0PA 1A29A 2LLUA 1A4PA 1F55A 2I94A 1NWDA 1YURA 3CR4X 3PN7B 2JXCA 3TUYB 5JJGA 3D0YB 2JNXA 4U8DA 4PHMA 3NXAA 3RLZA 2HQWA 1M31A 1KSOA 1LVCD 1LINA 2F2PA 1RROA 2M1KB 2M1UA 3EK8A 2LMUA 2WCBA 2JU0A 1ALVA 1YUUA 1NUBA 1ZMZA 3I5HB 2JTZA 3I5IB 1CMGA 2M7NA 1KK7Z 3DF0A 5ER5A 1CTRA 1J7RA 1ALWA 1TNXA 4DCKA 1SKTA 1J7PA 1IRJA 2LM5A 2CT9A 3BOWB 1SR6B 1U5IB 4MN0A 2R2IA 1SRAA 1X02A 1TCOB 2TN4A 4XYNA 1VRKA 4YRUA 4PE4A 2MRDA 2K8MB 1Y1UA 1BG1A 1GGZA 1TNPA 1JSAA 4P2YB 4I5JA 2LMTA 1DMOA 1NPQA 2FJUB 2M9GA 3MSEB 2ZRSA 1ZOTB 1LKJA 3EVVA 1AJ4A 1MHOA 3OX6A 1K8UA 1CM1A 1F4OA 2KI6D 2PASA 1PVAA 3KEVA 1NP8A 4CFRA 3SG6A 4YGCB 3KO0A 5HYDA 2KI4B 3LLEA 1K94A 1Q80A 5AANA 2SASA 2QPTA 4GGFA 2SCPA 3JTDB 2BE6A 4I5NB 1GGWA 1J1EA 4AOMA 2LLTA 2OTGB 5FYXA 5BPJA 1E8AA 1RFJA 4PHJA 1KQMB 1TOPA 4MZKA 4YGAA 2O5GA 3A4UB 3IF7A 3BQ3A 1B7TY 4TNCA 1BR4B 4WQ3A 1Y0VH 3BUXB 4GGFC 2Y5IA 5CSFA 1UWOA 1C7VA 1B8CA 3PATA 5G08A 4DS7A 2JT3A 1PRWA 1GQMA 1CM4A 1RK9A 1TNWA 2ZN8A 1M39A 4HRGA 1QLSA 1CKKA 1SCMC 1KFXS 1QV1A 1WDCC 2HPSA 2MLFC 3EVUA 2CBLA 2CXJA 2IS9A 5HKYA 1B8RA 1TIZA 2F3YA 5HKZA 2EC6C 2KAVA 2MAZA 1PALA 4MZLA 2E6WA 1KWOB 2LP2A 4A4CA 3KPXA 1FI6A 4C0LA 3C1VA 4N5XA 1MXLC 1SNLA 2K7OA 2CCMA 1NCYA 1K9UA 3CS1A 2NCOA 2JNFA 1H8BA 2WOSA 4PE0A 4F0ZB 1QATA 1D1OA 1S6JA 2AMIA 1AHRA 2EHBA 1CFCA 1IQ3A 1BMOA 3OB2B 1NCXA 1S36A 1QTXA 1NX3A 2G2BA 3LL8B 4N1GA 2FOTA 2PMYA 5D7FA 4GPLB 1BU3A 3TDIA 1KK7Y 2JTTA 3O78A 3F45A 1KK8C 2LHLA 2ZFDA 1UHHA 5TNCA 1F70A 1JF0A 1YTZC 3PFVA 1K95A 4I5LB 1RWYA 2A4JA 5KSZA 1YX7A 2KFHA 4OR9B 4A4BA 2WNDA 2PRUA 2F8PA 1V1GA 3E3RA 3TS5C 2BL0B 4L9MA 2M7LA 3O4YA 3VGOA 1WRZA 2LVKA 1EG3A 2GV5A 3CGAA 1UURA 5IBWA 1SL7A 1QX7A 1U5IA 3BUWB 3I5FC 1IGVA 2FCDA 3IQOA 4AQJA 1EG4A 1K9KA 2JQ6A 1EH2A 3I5GB 5I2OA 4XJKA 2L5XB 4CIDA 1AJ5A 1Y1AA 1NIWA 2LUXA 5AFPA 3ZNIA 4DRWA 1UP5A 1KFUL 1RTP1 3EK4A 4YGEB 1XFWO 1TNQA 3O6BA 3CTNA 1JF2A 3GK4X 1DF0B 1M63B 3BUMB 1SBJA 1A75A 3AAJA 5F6TA 1BLQA 3CZTX 1J7OA 1AP4A 1IQ5A 4PALA 2F3ZA 1J7QA 2G9BA 4D1EA 3NSKA 2BECA 2WCEA 4ICBA 4ZCUA 5I2LA 3HCMA 1DJYA 4BY4A 1PULA 3PLFB 4NDDA 3FWBA 3TDUA 3OX5A 1YX8A 2KQYA 1MF8B 3OHMB 2BCXA 3AAKA 1XFYO 2KDHA 1TTXA 2L98A 2HF5A 4ORAB 1N65A 4YBHB 1L2OC 1W7JB 2Y4QA 2LC5A 3GK1A 5K89A 1OMVA 1IH0A 1BJFA 1FW4A 2KBMA 1QASA 3SJSA 1QIVA 4WQ2A 2GGZA 4OCIA 2V53A 3DVKA 2OS8B 1DJIA 4P5OE 5ER4X 2ZNEA 4MRYA 2P6BB 3D10A 2H61A 1JFJA 1KQVA 4NDBA 1XA5A 1F71A 2ZNDA 1OQPA 1WLMA 2RGIA 4CFQA 5CSNA 3BUOB 3BXKA 1QX5B 1LA0A 2COLB 2H61C 2K7DA 5AEQA 3PM8A 2PVBA 5AERA 4ORBB 2WCFA 2Y1MA 1CDMA 2KFFA 4NDCA 4MZJA 2K7BA 1AUIB 5CSIA 1K93D 3SIBA 3LK1A 2K2AA 4FQOA 4QJ3B 1WRLA 1WRKA 2NCPA 5B8IB 3PSRA 1F8HA 1S6CA 2KFGA 1DGVA 1M46A 2KBIA 1SL8A 2I18A 1XFVO 1SW8A 3DF0B 1C7WA 2M49B 1KFXL 1S1EA 1FI5A 1DT7B 4CPVA 1DJXA 2Q4UA 2JULA 1CFPA 2L2EA 4UPGA 5AXIA 4PE1A 1XYDA 1ZUZA 3JVTC 1WY9A 1Y1XA 3K21A 2JOJA 1B9AA 1SPYA 1NSHA 3A8RA 3DVJA 1YVHA 2LE9B 3M0WA 5DKRA 3RM1A 3VRNA 1CDLA 4NQGA 4PHNA 1PK0D 3DVMA 1YUTA 5KU1A 1S5GZ 2CNPA 4DUQA 2BBNA 3H4SE 1MWNA 3O2PA 3PALA 2ZRTA 3VRRA 2M0RA 1B4CA 2JWWA 1LXFC 1SY9A 1OOJA 3FS7A 3D0YA 1S26D 5D69A 4M2OA 1R2UA 3EKJA 1DF0A 1UHKA 2LNKA 1FBVA 1C07A 2MLEC 3BYAA 2JZIA 3PN7C 1CDNA 3TUYC 3IQQA 1QXPA 2LLSA 2M97A 4GNKB 2LVVA 1SK6D 4CLNA 4JWQA 2MBXA 1QJTA 2KHNA 1OMDA 3BOWA 1UHJA 3I5HC 1SCMB 1WDCB 2F33A 3SG7A 3WHUB 3I5IC 4GFTA 1QVIZ 1W7IB 1TRFA 2EC6B 2MA2A 3DVEA 1NYAA 1QX2A 1XFUO 1BODA 2LCPA 2LVIA 4FTGA 1JUOA 4MSPA 1R6PA 1SMGA 2KOTA 2L51A 1JBAA 1CLMA 5I2QA 3NSLA 1MR8A 1SR6C 2F2OA 1CB1A 3SG4A 1YRTB 2VRGA 2L4IA 4MBEA 1DJHA 1AVSA 4YGBB 2KYCA 1IG5A 1CNPA 1N2DA 3AKBA 3FWCA 3CR5X 1CFFA 4I5KA 4WRIA 5GQQC 1NX2A 1KCYA 1PSBA 2MHHA 1KFUS 2LMVA 1MUXA 1SL9A 1SYMA 1KK8B 3OB1B 2NXQA 3FIAA 2KI4C 1DGUA 1Y6WA 4AQIA 2AAOA 3JTDC 3SG3A 4GBAA 3TS5B 4M2PA 4IL1A 1CMFA 1DJWA 2OTGC 4GAOA 3HX4A 1KQMC 1DTLA 1ODBA 1V1FA 2KGBC 2NZ0A 2ZKMX 4ETOA 1K2HA 4YI8A 1DJZA 3I5FB 3LK0A 3TZ1A 3VRQA 3WHTB 4BY5A 4PHKA 1PSRA 1M45A 2MJWB 4ORCB 2WC8A 5KTYA 3NSIA 1MXEA 1IKUA 2BKHB 2KGRA 1DVIA 2O60A 1BF5A 3ZWHA 3CR2A 2ISDA 1NX1A 2KQ6A 1S5GY 1YR5A 4Q04A 4OVNF 5I8NA 1LA3A 4MVFA 1K90D 2BKIB 1L7ZA 4XJKB 1KWOC 2KI6C 4QJ5B 1EJ3A 3ICBA 1EXRA 2Q91A 1UUSA 1YVLA 2GGMA 3EKHA 1UHNA 4GGNA 2JPTA 4OKHA 3WXAA 1K96A 2BBMA 1G33A 2H2KA 2I7AA 1S6IA 1J55A 5DKNA 1G4YR 1KSMA 2HETA 2PALA 2KSPA 1A75B 2BCAA 4YI9A 1GJYA 1S3PA 4MRXA 2LANA 3SG5A 1A2XA 2M8UA 2L4HA 1QV0A 4HSZA 1JC2A 1QIWA 1F54A 3KF9A 1L2OB 1FPWA 2M3WA 2LV7A 4JQ0D 4C0JA 2KAYA 2NLNA 4PE7A 3OP0A 1QVIY 3CWGA 1EL4A 1RECA 2BCBA 1B1GA 1FF1A 1UHIA 3BUNB 5PALA 4JPZB 2CTNA 2HQ8A 2LUCA 4M2QA 1IJ5A 2BL0C 4HREE 4DIRA 1B8LA 3GK2A 1JWDA 3QRXA 4YGDB 1IJ6A 5HLOA 1CDPA 1XFXO 4MLWA 3GOFA 1WLZA 1YUSA 1XK4A 2JT8A 1QS7A 1ZFSA 2Y1NA 3WNXB 1K9PA 1PVBA 3LCPC 2OPOA 2EGDA 3I5GC 3NSOA 4QJ4B 2LP3A 3DD4A 1AK8A 1IWQA 2E30A 2KYFA 3VRPA 2L50A 2K61A 1JFKA 1OZSA 2DOQA 1XFZO 2LAPA 1DJGA 4E68A 2JXLA 2M29A 3EVRA 1B47A 3SG2A 1XK4C 5CSJA 2K7CA 1ZACA 1YRUB 2B1UA 1CLBA 2ZN9A 5DKQA 4C0KA 2D8NA 1CFDA 1G8IA 2JT0A 1OSAA 1HQVA 3SIAA 2WORA 5CPVA 2I2RE 1H4BA 1HT9A 1NCZA 2K2FA 2FCEA 4PCWA 1B7TZ 1BT6A 1BOCA 4OV2A 3EK7A 3JVTB 4MEWA 1SCVA 2K0JA 1TN4A 2JRFA 2JC2A 3VROA 4HRHA 2PSRA 1BR1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HKW A;  2BE4 A;  3TDZ A;  1QLK A;  2AUC A;  2KAX A;  2QAC A;  4GUK A;  4N1F A;  1RJV A;  3AKA A;  1XO5 A;  4R1E A;  1N0Y A;  1OZO A;  1J1D A;  1TCF A;  2OS8 C;  3KHE A;  3CLN A;  5HLV A;  4ZCV A;  5J3X A;  2LHI A;  1CLL A;  1OMR A;  1XVJ A;  4PDZ A;  5JOL A;  1OE9 B;  1F4Q A;  2LVJ A;  2KNE A;  4USL A;  1NX0 A;  1MQ1 A;  1A03 A;  2L0P A;  1A29 A;  2LLU A;  1A4P A;  1F55 A;  2I94 A;  1NWD A;  1YUR A;  3CR4 X;  3PN7 B;  2JXC A;  3TUY B;  5JJG A;  3D0Y B;  2JNX A;  4U8D A;  4PHM A;  3NXA A;  3RLZ A;  2HQW A;  1M31 A;  1KSO A;  1LVC D;  1LIN A;  2F2P A;  1RRO A;  2M1K B;  2M1U A;  3EK8 A;  2LMU A;  2WCB A;  2JU0 A;  1ALV A;  1YUU A;  1NUB A;  1ZMZ A;  3I5H B;  2JTZ A;  3I5I B;  1CMG A;  2M7N A;  1KK7 Z;  3DF0 A;  5ER5 A;  1CTR A;  1J7R A;  1ALW A;  1TNX A;  4DCK A;  1SKT A;  1J7P A;  1IRJ A;  2LM5 A;  2CT9 A;  3BOW B;  1SR6 B;  1U5I B;  4MN0 A;  2R2I A;  1SRA A;  1X02 A;  1TCO B;  2TN4 A;  4XYN A;  1VRK A;  4YRU A;  4PE4 A;  2MRD A;  2K8M B;  1Y1U A;  1BG1 A;  1GGZ A;  1TNP A;  1JSA A;  4P2Y B;  4I5J A;  2LMT A;  1DMO A;  1NPQ A;  2FJU B;  2M9G A;  3MSE B;  2ZRS A;  1ZOT B;  1LKJ A;  3EVV A;  1AJ4 A;  1MHO A;  3OX6 A;  1K8U A;  1CM1 A;  1F4O A;  2KI6 D;  2PAS A;  1PVA A;  3KEV A;  1NP8 A;  4CFR A;  3SG6 A;  4YGC B;  3KO0 A;  5HYD A;  2KI4 B;  3LLE A;  1K94 A;  1Q80 A;  5AAN A;  2SAS A;  2QPT A;  4GGF A;  2SCP A;  3JTD B;  2BE6 A;  4I5N B;  1GGW A;  1J1E A;  4AOM A;  2LLT A;  2OTG B;  5FYX A;  5BPJ A;  1E8A A;  1RFJ A;  4PHJ A;  1KQM B;  1TOP A;  4MZK A;  4YGA A;  2O5G A;  3A4U B;  3IF7 A;  3BQ3 A;  1B7T Y;  4TNC A;  1BR4 B;  4WQ3 A;  1Y0V H;  3BUX B;  4GGF C;  2Y5I A;  5CSF A;  1UWO A;  1C7V A;  1B8C A;  3PAT A;  5G08 A;  4DS7 A;  2JT3 A;  1PRW A;  1GQM A;  1CM4 A;  1RK9 A;  1TNW A;  2ZN8 A;  1M39 A;  4HRG A;  1QLS A;  1CKK A;  1SCM C;  1KFX S;  1QV1 A;  1WDC C;  2HPS A;  2MLF C;  3EVU A;  2CBL A;  2CXJ A;  2IS9 A;  5HKY A;  1B8R A;  1TIZ A;  2F3Y A;  5HKZ A;  2EC6 C;  2KAV A;  2MAZ A;  1PAL A;  4MZL A;  2E6W A;  1KWO B;  2LP2 A;  4A4C A;  3KPX A;  1FI6 A;  4C0L A;  3C1V A;  4N5X A;  1MXL C;  1SNL A;  2K7O A;  2CCM A;  1NCY A;  1K9U A;  3CS1 A;  2NCO A;  2JNF A;  1H8B A;  2WOS A;  4PE0 A;  4F0Z B;  1QAT A;  1D1O A;  1S6J A;  2AMI A;  1AHR A;  2EHB A;  1CFC A;  1IQ3 A;  1BMO A;  3OB2 B;  1NCX A;  1S36 A;  1QTX A;  1NX3 A;  2G2B A;  3LL8 B;  4N1G A;  2FOT A;  2PMY A;  5D7F A;  4GPL B;  1BU3 A;  3TDI A;  1KK7 Y;  2JTT A;  3O78 A;  3F45 A;  1KK8 C;  2LHL A;  2ZFD A;  1UHH A;  5TNC A;  1F70 A;  1JF0 A;  1YTZ C;  3PFV A;  1K95 A;  4I5L B;  1RWY A;  2A4J A;  5KSZ A;  1YX7 A;  2KFH A;  4OR9 B;  4A4B A;  2WND A;  2PRU A;  2F8P A;  1V1G A;  3E3R A;  3TS5 C;  2BL0 B;  4L9M A;  2M7L A;  3O4Y A;  3VGO A;  1WRZ A;  2LVK A;  1EG3 A;  2GV5 A;  3CGA A;  1UUR A;  5IBW A;  1SL7 A;  1QX7 A;  1U5I A;  3BUW B;  3I5F C;  1IGV A;  2FCD A;  3IQO A;  4AQJ A;  1EG4 A;  1K9K A;  2JQ6 A;  1EH2 A;  3I5G B;  5I2O A;  4XJK A;  2L5X B;  4CID A;  1AJ5 A;  1Y1A A;  1NIW A;  2LUX A;  5AFP A;  3ZNI A;  4DRW A;  1UP5 A;  1KFU L;  1RTP 1;  3EK4 A;  4YGE B;  1XFW O;  1TNQ A;  3O6B A;  3CTN A;  1JF2 A;  3GK4 X;  1DF0 B;  1M63 B;  3BUM B;  1SBJ A;  1A75 A;  3AAJ A;  5F6T A;  1BLQ A;  3CZT X;  1J7O A;  1AP4 A;  1IQ5 A;  4PAL A;  2F3Z A;  1J7Q A;  2G9B A;  4D1E A;  3NSK A;  2BEC A;  2WCE A;  4ICB A;  4ZCU A;  5I2L A;  3HCM A;  1DJY A;  4BY4 A;  1PUL A;  3PLF B;  4NDD A;  3FWB A;  3TDU A;  3OX5 A;  1YX8 A;  2KQY A;  1MF8 B;  3OHM B;  2BCX A;  3AAK A;  1XFY O;  2KDH A;  1TTX A;  2L98 A;  2HF5 A;  4ORA B;  1N65 A;  4YBH B;  1L2O C;  1W7J B;  2Y4Q A;  2LC5 A;  3GK1 A;  5K89 A;  1OMV A;  1IH0 A;  1BJF A;  1FW4 A;  2KBM A;  1QAS A;  3SJS A;  1QIV A;  4WQ2 A;  2GGZ A;  4OCI A;  2V53 A;  3DVK A;  2OS8 B;  1DJI A;  4P5O E;  5ER4 X;  2ZNE A;  4MRY A;  2P6B B;  3D10 A;  2H61 A;  1JFJ A;  1KQV A;  4NDB A;  1XA5 A;  1F71 A;  2ZND A;  1OQP A;  1WLM A;  2RGI A;  4CFQ A;  5CSN A;  3BUO B;  3BXK A;  1QX5 B;  1LA0 A;  2COL B;  2H61 C;  2K7D A;  5AEQ A;  3PM8 A;  2PVB A;  5AER A;  4ORB B;  2WCF A;  2Y1M A;  1CDM A;  2KFF A;  4NDC A;  4MZJ A;  2K7B A;  1AUI B;  5CSI A;  1K93 D;  3SIB A;  3LK1 A;  2K2A A;  4FQO A;  4QJ3 B;  1WRL A;  1WRK A;  2NCP A;  5B8I B;  3PSR A;  1F8H A;  1S6C A;  2KFG A;  1DGV A;  1M46 A;  2KBI A;  1SL8 A;  2I18 A;  1XFV O;  1SW8 A;  3DF0 B;  1C7W A;  2M49 B;  1KFX L;  1S1E A;  1FI5 A;  1DT7 B;  4CPV A;  1DJX A;  2Q4U A;  2JUL A;  1CFP A;  2L2E A;  4UPG A;  5AXI A;  4PE1 A;  1XYD A;  1ZUZ A;  3JVT C;  1WY9 A;  1Y1X A;  3K21 A;  2JOJ A;  1B9A A;  1SPY A;  1NSH A;  3A8R A;  3DVJ A;  1YVH A;  2LE9 B;  3M0W A;  5DKR A;  3RM1 A;  3VRN A;  1CDL A;  4NQG A;  4PHN A;  1PK0 D;  3DVM A;  1YUT A;  5KU1 A;  1S5G Z;  2CNP A;  4DUQ A;  2BBN A;  3H4S E;  1MWN A;  3O2P A;  3PAL A;  2ZRT A;  3VRR A;  2M0R A;  1B4C A;  2JWW A;  1LXF C;  1SY9 A;  1OOJ A;  3FS7 A;  3D0Y A;  1S26 D;  5D69 A;  4M2O A;  1R2U A;  3EKJ A;  1DF0 A;  1UHK A;  2LNK A;  1FBV A;  1C07 A;  2MLE C;  3BYA A;  2JZI A;  3PN7 C;  1CDN A;  3TUY C;  3IQQ A;  1QXP A;  2LLS A;  2M97 A;  4GNK B;  2LVV A;  1SK6 D;  4CLN A;  4JWQ A;  2MBX A;  1QJT A;  2KHN A;  1OMD A;  3BOW A;  1UHJ A;  3I5H C;  1SCM B;  1WDC B;  2F33 A;  3SG7 A;  3WHU B;  3I5I C;  4GFT A;  1QVI Z;  1W7I B;  1TRF A;  2EC6 B;  2MA2 A;  3DVE A;  1NYA A;  1QX2 A;  1XFU O;  1BOD A;  2LCP A;  2LVI A;  4FTG A;  1JUO A;  4MSP A;  1R6P A;  1SMG A;  2KOT A;  2L51 A;  1JBA A;  1CLM A;  5I2Q A;  3NSL A;  1MR8 A;  1SR6 C;  2F2O A;  1CB1 A;  3SG4 A;  1YRT B;  2VRG A;  2L4I A;  4MBE A;  1DJH A;  1AVS A;  4YGB B;  2KYC A;  1IG5 A;  1CNP A;  1N2D A;  3AKB A;  3FWC A;  3CR5 X;  1CFF A;  4I5K A;  4WRI A;  5GQQ C;  1NX2 A;  1KCY A;  1PSB A;  2MHH A;  1KFU S;  2LMV A;  1MUX A;  1SL9 A;  1SYM A;  1KK8 B;  3OB1 B;  2NXQ A;  3FIA A;  2KI4 C;  1DGU A;  1Y6W A;  4AQI A;  2AAO A;  3JTD C;  3SG3 A;  4GBA A;  3TS5 B;  4M2P A;  4IL1 A;  1CMF A;  1DJW A;  2OTG C;  4GAO A;  3HX4 A;  1KQM C;  1DTL A;  1ODB A;  1V1F A;  2KGB C;  2NZ0 A;  2ZKM X;  4ETO A;  1K2H A;  4YI8 A;  1DJZ A;  3I5F B;  3LK0 A;  3TZ1 A;  3VRQ A;  3WHT B;  4BY5 A;  4PHK A;  1PSR A;  1M45 A;  2MJW B;  4ORC B;  2WC8 A;  5KTY A;  3NSI A;  1MXE A;  1IKU A;  2BKH B;  2KGR A;  1DVI A;  2O60 A;  1BF5 A;  3ZWH A;  3CR2 A;  2ISD A;  1NX1 A;  2KQ6 A;  1S5G Y;  1YR5 A;  4Q04 A;  4OVN F;  5I8N A;  1LA3 A;  4MVF A;  1K90 D;  2BKI B;  1L7Z A;  4XJK B;  1KWO C;  2KI6 C;  4QJ5 B;  1EJ3 A;  3ICB A;  1EXR A;  2Q91 A;  1UUS A;  1YVL A;  2GGM A;  3EKH A;  1UHN A;  4GGN A;  2JPT A;  4OKH A;  3WXA A;  1K96 A;  2BBM A;  1G33 A;  2H2K A;  2I7A A;  1S6I A;  1J55 A;  5DKN A;  1G4Y R;  1KSM A;  2HET A;  2PAL A;  2KSP A;  1A75 B;  2BCA A;  4YI9 A;  1GJY A;  1S3P A;  4MRX A;  2LAN A;  3SG5 A;  1A2X A;  2M8U A;  2L4H A;  1QV0 A;  4HSZ A;  1JC2 A;  1QIW A;  1F54 A;  3KF9 A;  1L2O B;  1FPW A;  2M3W A;  2LV7 A;  4JQ0 D;  4C0J A;  2KAY A;  2NLN A;  4PE7 A;  3OP0 A;  1QVI Y;  3CWG A;  1EL4 A;  1REC A;  2BCB A;  1B1G A;  1FF1 A;  1UHI A;  3BUN B;  5PAL A;  4JPZ B;  2CTN A;  2HQ8 A;  2LUC A;  4M2Q A;  1IJ5 A;  2BL0 C;  4HRE E;  4DIR A;  1B8L A;  3GK2 A;  1JWD A;  3QRX A;  4YGD B;  1IJ6 A;  5HLO A;  1CDP A;  1XFX O;  4MLW A;  3GOF A;  1WLZ A;  1YUS A;  1XK4 A;  2JT8 A;  1QS7 A;  1ZFS A;  2Y1N A;  3WNX B;  1K9P A;  1PVB A;  3LCP C;  2OPO A;  2EGD A;  3I5G C;  3NSO A;  4QJ4 B;  2LP3 A;  3DD4 A;  1AK8 A;  1IWQ A;  2E30 A;  2KYF A;  3VRP A;  2L50 A;  2K61 A;  1JFK A;  1OZS A;  2DOQ A;  1XFZ O;  2LAP A;  1DJG A;  4E68 A;  2JXL A;  2M29 A;  3EVR A;  1B47 A;  3SG2 A;  1XK4 C;  5CSJ A;  2K7C A;  1ZAC A;  1YRU B;  2B1U A;  1CLB A;  2ZN9 A;  5DKQ A;  4C0K A;  2D8N A;  1CFD A;  1G8I A;  2JT0 A;  1OSA A;  1HQV A;  3SIA A;  2WOR A;  5CPV A;  2I2R E;  1H4B A;  1HT9 A;  1NCZ A;  2K2F A;  2FCE A;  4PCW A;  1B7T Z;  1BT6 A;  1BOC A;  4OV2 A;  3EK7 A;  3JVT B;  4MEW A;  1SCV A;  2K0J A;  1TN4 A;  2JRF A;  2JC2 A;  3VRO A;  4HRH A;  2PSR A;  1BR1 B; 
#chains in the Genus database with same CATH topology
 5HKW A;  2BE4 A;  3TDZ A;  1QLK A;  2AUC A;  2KAX A;  3DY9 A;  2QAC A;  4GUK A;  4N1F A;  1RJV A;  3AKA A;  1XO5 A;  2QEB A;  4R1E A;  1N0Y A;  1OZO A;  1J1D A;  1TCF A;  1Z2C B;  2OS8 C;  3CLN A;  3KHE A;  5HLV A;  3BJH A;  4ZCV A;  5J3X A;  2LHI A;  5DIC A;  1DC1 A;  1CLL A;  1OMR A;  1XVJ A;  4PDZ A;  5JOL A;  1OE9 B;  1F4Q A;  2LVJ A;  2KNE A;  4USL A;  1NX0 A;  1MQ1 A;  3VB1 A;  1A03 A;  2L0P A;  1A29 A;  2LLU A;  1A4P A;  1F55 A;  2I94 A;  1NWD A;  1YUR A;  3CR4 X;  3NGV A;  3PN7 B;  2JXC A;  3TUY B;  5JJG A;  3D0Y B;  2JNX A;  4U8D A;  3B7A A;  4PHM A;  3NXA A;  3RLZ A;  2HQW A;  1M31 A;  1C3Y A;  1KSO A;  1LVC D;  1LIN A;  2F2P A;  1TUJ A;  1RRO A;  2M1K B;  2M1U A;  3EK8 A;  2LMU A;  2WCB A;  2JU0 A;  1ALV A;  1YUU A;  1NUB A;  1ZMZ A;  3I5H B;  2JTZ A;  3I5I B;  1CMG A;  2M7N A;  1KK7 Z;  3DF0 A;  5ER5 A;  1CTR A;  1J7R A;  3B86 A;  3BFH A;  1ALW A;  1TNX A;  3CYZ A;  4DCK A;  1SKT A;  1J7P A;  1IRJ A;  2LM5 A;  2CT9 A;  3BOW B;  1SR6 B;  1U5I B;  4MN0 A;  2R2I A;  1SRA A;  1X02 A;  1TCO B;  2TN4 A;  4XYN A;  1VRK A;  4YRU A;  4PE4 A;  2MRD A;  2K8M B;  1Y1U A;  1BG1 A;  1GGZ A;  1TNP A;  1JSA A;  4P2Y B;  4I5J A;  3K1E A;  2LMT A;  3FE9 A;  1DMO A;  3CZ0 A;  1NPQ A;  3S0D A;  2FJU B;  2M9G A;  3MSE B;  3R72 A;  2ZRS A;  1ZOT B;  1LKJ A;  3EVV A;  1AJ4 A;  1MHO A;  3OX6 A;  1K8U A;  2QEH A;  1CM1 A;  1F4O A;  2KI6 D;  2PAS A;  1PVA A;  3KEV A;  1NP8 A;  4CFR A;  3SG6 A;  4YGC B;  3KO0 A;  5HYD A;  2KI4 B;  3LLE A;  1K94 A;  1Q80 A;  5AAN A;  2SAS A;  2QPT A;  4GGF A;  2SCP A;  3JTD B;  2BE6 A;  4I5N B;  4IJ7 A;  1J1E A;  4AOM A;  2LLT A;  1GGW A;  2OTG B;  5FYX A;  5BPJ A;  1E8A A;  1RFJ A;  4PHJ A;  1DQE A;  1KQM B;  1TOP A;  4MZK A;  4YGA A;  2O5G A;  3A4U B;  3CDN A;  3IF7 A;  3PM2 A;  3BQ3 A;  1B7T Y;  4TNC A;  1BR4 B;  2ERB A;  4WQ3 A;  1Y0V H;  3BUX B;  4GGF C;  2Y5I A;  3FE6 A;  1UWO A;  5CSF A;  1C7V A;  1B8C A;  3PAT A;  5G08 A;  4DS7 A;  2JT3 A;  1PRW A;  1GQM A;  1CM4 A;  1RK9 A;  1TNW A;  2ZN8 A;  1M39 A;  4HRG A;  1QLS A;  1CKK A;  1LS8 A;  1SCM C;  1KFX S;  1QV1 A;  1WDC C;  2HPS A;  2MLF C;  3EVU A;  3D77 A;  2CBL A;  2CXJ A;  2IS9 A;  5FI6 A;  1B8R A;  1TIZ A;  5HKY A;  2F3Y A;  5HKZ A;  2EC6 C;  2KLD A;  2KAV A;  2MAZ A;  4JD9 A;  3Q8I A;  1PAL A;  4MZL A;  2E6W A;  1KWO B;  3CAB A;  2LP2 A;  4A4C A;  3KPX A;  3B87 A;  1FI6 A;  4C0L A;  3C1V A;  4N5X A;  3S0E A;  1MXL C;  1SNL A;  2K7O A;  3DYE A;  1NCY A;  2CCM A;  1K9U A;  3CS1 A;  2NCO A;  2JNF A;  4FQT A;  2JPO A;  2WOS A;  1H8B A;  4PE0 A;  4F0Z B;  1QAT A;  3R1V A;  1D1O A;  1S6J A;  2AMI A;  1AHR A;  2EHB A;  3UO9 A;  1CFC A;  1IQ3 A;  1DEL A;  1BMO A;  3OB2 B;  2QEO A;  1NCX A;  1S36 A;  1QTX A;  1NX3 A;  2G2B A;  3LL8 B;  4N1G A;  2P71 A;  2FOT A;  2PMY A;  5D7F A;  3D75 A;  4GPL B;  1BU3 A;  3TDI A;  1KK7 Y;  2JTT A;  3O78 A;  3F45 A;  3R1O A;  1KK8 C;  2LHL A;  2BAP A;  1UHH A;  2ZFD A;  5TNC A;  1F70 A;  1JF0 A;  1YTZ C;  3PFV A;  1K95 A;  4I5L B;  1RWY A;  2A4J A;  5KSZ A;  1YX7 A;  2KFH A;  4OR9 B;  4A4B A;  2WND A;  2PRU A;  2F8P A;  1V1G A;  3D76 A;  3E3R A;  2BL0 B;  4L9M A;  2M7L A;  3TS5 C;  3O4Y A;  3VGO A;  3V2L A;  1WRZ A;  2LVK A;  1EG3 A;  2GV5 A;  3CGA A;  1UUR A;  5IBW A;  3D78 A;  1SL7 A;  1QX7 A;  1U5I A;  3BUW B;  3I5F C;  1IGV A;  2FCD A;  3IQO A;  3D74 A;  4AQJ A;  1EG4 A;  1K9K A;  2JQ6 A;  1EH2 A;  3I5G B;  4PT1 A;  4XJK A;  5I2O A;  2L5X B;  4CID A;  1AJ5 A;  1Y1A A;  5I94 A;  1NIW A;  2LUX A;  5AFP A;  3ZNI A;  4DRW A;  1UP5 A;  1KFU L;  1RTP 1;  3NHT A;  3B6X A;  3EK4 A;  4YGE B;  1XFW O;  1TNQ A;  3O6B A;  3CTN A;  1JF2 A;  3GK4 X;  1DF0 B;  1M63 B;  3BUM B;  1SBJ A;  1A75 A;  3AAJ A;  5F6T A;  1BLQ A;  3CZT X;  1J7O A;  1AP4 A;  1IQ5 A;  4PAL A;  2F3Z A;  1J7Q A;  2G9B A;  4D1E A;  3NSK A;  2BEC A;  2WCE A;  4ICB A;  4ZCU A;  5I2L A;  3HCM A;  1DJY A;  4BY4 A;  3SS5 A;  1PUL A;  3PLF B;  4NDD A;  3FWB A;  3TDU A;  3OX5 A;  1YX8 A;  2KQY A;  3CZ2 A;  1MF8 B;  3OHM B;  2BCX A;  4OZD A;  3AAK A;  1XFY O;  2KDH A;  1TTX A;  2L98 A;  2HF5 A;  4ORA B;  1N65 A;  4YBH B;  1L2O C;  1W7J B;  2L2C A;  2LC5 A;  2Y4Q A;  3GK1 A;  5K89 A;  1OMV A;  1IH0 A;  1BJF A;  1FW4 A;  2KBM A;  1QAS A;  3SJS A;  1QIV A;  4WQ2 A;  2GGZ A;  4OCI A;  2PYQ A;  2V53 A;  3BFB A;  3DVK A;  2OS8 B;  1DJI A;  4P5O E;  5ER4 X;  2ZNE A;  4MRY A;  2P6B B;  3D10 A;  2H61 A;  1JFJ A;  1KQV A;  4NDB A;  2FJY A;  1XA5 A;  1F71 A;  2ZND A;  1OQP A;  1WLM A;  2RGI A;  4CFQ A;  5CSN A;  3BUO B;  3BXK A;  3UNW A;  1QX5 B;  1LA0 A;  2COL B;  2H61 C;  2K7D A;  5AEQ A;  3PM8 A;  2PVB A;  5AER A;  4ORB B;  2WCF A;  2Y1M A;  3R1P A;  1CDM A;  2KFF A;  4NDC A;  4MZJ A;  2K7B A;  1AUI B;  5CSI A;  1K93 D;  3SIB A;  3LK1 A;  2K2A A;  4FQO A;  3L4L A;  4QJ3 B;  3RZS A;  2WCH A;  1WRL A;  1WRK A;  2NCP A;  5B8I B;  3PSR A;  2H8V A;  1F8H A;  1S6C A;  2KFG A;  1DGV A;  1M46 A;  2KBI A;  1SL8 A;  2I18 A;  1XFV O;  1SW8 A;  3DF0 B;  4JKT A;  1P28 A;  1C7W A;  2M49 B;  1KFX L;  1S1E A;  1FI5 A;  1DT7 B;  4CPV A;  1DJX A;  2Q4U A;  2JUL A;  1CFP A;  2L2E A;  4UPG A;  5AXI A;  4PE1 A;  1ZUZ A;  1XYD A;  3JVT C;  1WY9 A;  1Y1X A;  3S0G A;  3K21 A;  2JOJ A;  1B9A A;  1SPY A;  1NSH A;  3A8R A;  3DVJ A;  1YVH A;  2LE9 B;  3M0W A;  5DKR A;  3RM1 A;  3VRN A;  1CDL A;  4NQG A;  4PHN A;  1PK0 D;  3DVM A;  1YUT A;  5KU1 A;  1S5G Z;  2CNP A;  4DUQ A;  2BBN A;  3H4S E;  1MWN A;  3O2P A;  3PAL A;  2ZRT A;  5EL2 A;  3VRR A;  2M0R A;  1B4C A;  2JWW A;  1LXF C;  1SY9 A;  3SS3 A;  1OOJ A;  3FS7 A;  3D0Y A;  1S26 D;  5D69 A;  1W9Z A;  2KLE A;  1R2U A;  3EKJ A;  4M2O A;  1DF0 A;  1UHK A;  3S0B A;  2LNK A;  4KYN A;  1FBV A;  1C07 A;  2MLE C;  3BYA A;  2JZI A;  3PN7 C;  1CDN A;  3TUY C;  3IQQ A;  1QXP A;  2LLS A;  3PJI A;  2M97 A;  4GNK B;  2LVV A;  3D73 A;  1SK6 D;  4CLN A;  4JWQ A;  2MBX A;  1QJT A;  2KHN A;  1OMD A;  3BOW A;  1UHJ A;  3I5H C;  1SCM B;  3IVT A;  1WDC B;  2F33 A;  3SG7 A;  3WHU B;  3I5I C;  4GFT A;  1QVI Z;  1W7I B;  1TRF A;  2EC6 B;  2MA2 A;  3DVE A;  1NYA A;  1QX2 A;  1XFU O;  1BOD A;  2LCP A;  2LVI A;  4FTG A;  1JUO A;  3DZT A;  3L4A A;  4MSP A;  3OGN A;  1R6P A;  1SMG A;  2KOT A;  2L51 A;  1JBA A;  1CLM A;  3OBV A;  5I2Q A;  3NSL A;  3EG5 B;  1MR8 A;  1SR6 C;  2F2O A;  3O4X A;  1CB1 A;  3SG4 A;  3DXL A;  1YRT B;  2VRG A;  2L4I A;  3FE8 A;  1XFR A;  4MBE A;  1DJH A;  1AVS A;  2L5Y A;  4YGB B;  2KYC A;  1IG5 A;  1CNP A;  1N2D A;  3AKB A;  3FWC A;  3QME A;  3CR5 X;  1CFF A;  2WC6 A;  4I5K A;  4WRI A;  5GQQ C;  1NX2 A;  1KCY A;  1PSB A;  2MHH A;  3B88 A;  1KFU S;  2LMV A;  1MUX A;  1SL9 A;  1SYM A;  2P70 A;  1KK8 B;  1OOI X;  2K60 A;  3CZ1 A;  3OB1 B;  2NXQ A;  3FIA A;  2KI4 C;  1DGU A;  1Y6W A;  4AQI A;  2AAO A;  3JTD C;  3SG3 A;  4GBA A;  3TS5 B;  4M2P A;  4IL1 A;  1CMF A;  1DJW A;  2OTG C;  4GAO A;  3HX4 A;  1KQM C;  1DTL A;  1ODB A;  1QWV A;  1V1F A;  2KGB C;  2PQL A;  2NZ0 A;  2ZKM X;  4ETO A;  1K2H A;  2WCK A;  1DJZ A;  3I5F B;  3LK0 A;  4YI8 A;  3TZ1 A;  3VRQ A;  3WHT B;  4BY5 A;  4PHK A;  1PSR A;  1M45 A;  2MJW B;  4ORC B;  2WC8 A;  3L47 A;  5KTY A;  3NSI A;  1MXE A;  1IKU A;  2WCJ A;  2BKH B;  2KGR A;  1DVI A;  2WC5 A;  2O60 A;  1BF5 A;  2QDI A;  3ZWH A;  3CR2 A;  3S0F A;  2ISD A;  1NX1 A;  4INX A;  2KQ6 A;  1S5G Y;  1YR5 A;  4Q04 A;  4OVN F;  5I8N A;  1LA3 A;  4MVF A;  1K90 D;  2BKI B;  1L7Z A;  4XJK B;  4F7F A;  1KWO C;  1T14 A;  2KI6 C;  4INW A;  1EJ3 A;  4QJ5 B;  3ICB A;  1TUZ A;  1EXR A;  2Q91 A;  2WCM A;  1UUS A;  1YVL A;  2GGM A;  1OOH A;  3EKH A;  1UHN A;  4GGN A;  2JPT A;  3SS4 A;  4OKH A;  3WXA A;  1K96 A;  2BBM A;  1G33 A;  2KPH A;  1OW4 A;  2H2K A;  2I7A A;  1S6I A;  1J55 A;  5DKN A;  1G4Y R;  1KSM A;  2HET A;  4QJ4 B;  2PAL A;  2KSP A;  1A75 B;  2BCA A;  4YI9 A;  1GJY A;  1S3P A;  4MRX A;  2LAN A;  2GTE A;  3SG5 A;  1A2X A;  2M8U A;  2L4H A;  1QV0 A;  4HSZ A;  1JC2 A;  5FI7 A;  1QIW A;  1F54 A;  3N7H A;  3KF9 A;  1L2O B;  1FPW A;  1SSE B;  2M3W A;  2LV7 A;  4JQ0 D;  4C0J A;  2YGU A;  2KAY A;  1OOG A;  2NLN A;  3OP0 A;  1QVI Y;  4PE7 A;  3CWG A;  1EL4 A;  1REC A;  2BCB A;  1B1G A;  1FF1 A;  1UHI A;  3BUN B;  5HL1 A;  5PAL A;  2WCL A;  4JPZ B;  2CTN A;  2BNX A;  1TWO A;  2HQ8 A;  2LUC A;  1IJ5 A;  2QEV A;  4M2Q A;  3S0A A;  2BL0 C;  4HRE E;  4DIR A;  1B8L A;  3GK2 A;  1JWD A;  1ORG A;  3QRX A;  4YGD B;  3BFA A;  1IJ6 A;  5HLO A;  1CDP A;  1XFX O;  4MLW A;  3GOF A;  1WLZ A;  1YUS A;  1XK4 A;  2JT8 A;  1QS7 A;  1ZFS A;  2Y1N A;  3WNX B;  1K9P A;  1OOF A;  1PVB A;  2OPO A;  2EGD A;  3I5G C;  3LCP C;  3NSO A;  2LP3 A;  5FI2 A;  3DD4 A;  1AK8 A;  1IWQ A;  2E30 A;  2KYF A;  3VRP A;  2L50 A;  2K61 A;  1JFK A;  1OZS A;  2DOQ A;  1XFZ O;  2LAP A;  1DJG A;  4E68 A;  2JXL A;  2M29 A;  3EVR A;  1B47 A;  3SG2 A;  1XK4 C;  5D3O A;  5CSJ A;  2K7C A;  1ZAC A;  1YRU B;  2B1U A;  1CLB A;  3NHI A;  2ZN9 A;  5DKQ A;  4C0K A;  2D8N A;  1CFD A;  1G8I A;  2JT0 A;  1OSA A;  1HQV A;  3SIA A;  2WOR A;  5CPV A;  2I2R E;  1H4B A;  1HT9 A;  1NCZ A;  2K2F A;  2FCE A;  4PCW A;  1B7T Z;  1BT6 A;  1BOC A;  1Z4H A;  1IIO A;  4OV2 A;  3EK7 A;  3JVT B;  4MEW A;  1C3Z A;  1DEK A;  1SCV A;  1TN4 A;  2JRF A;  2JC2 A;  2K0J A;  3VRO A;  1GM0 A;  4HRH A;  2PSR A;  1BR1 B; 
#chains in the Genus database with same CATH homology
 5HKW A;  2BE4 A;  3TDZ A;  1QLK A;  2AUC A;  2KAX A;  2QAC A;  4GUK A;  4N1F A;  1RJV A;  3AKA A;  1XO5 A;  4R1E A;  1N0Y A;  1OZO A;  1J1D A;  1TCF A;  2OS8 C;  3KHE A;  3CLN A;  5HLV A;  4ZCV A;  5J3X A;  2LHI A;  1CLL A;  1OMR A;  1XVJ A;  4PDZ A;  5JOL A;  1OE9 B;  1F4Q A;  2LVJ A;  2KNE A;  4USL A;  1NX0 A;  1MQ1 A;  1A03 A;  2L0P A;  1A29 A;  2LLU A;  1A4P A;  1F55 A;  2I94 A;  1NWD A;  1YUR A;  3CR4 X;  3PN7 B;  2JXC A;  3TUY B;  5JJG A;  3D0Y B;  2JNX A;  4U8D A;  4PHM A;  3NXA A;  3RLZ A;  2HQW A;  1M31 A;  1KSO A;  1LVC D;  1LIN A;  2F2P A;  1RRO A;  2M1K B;  2M1U A;  3EK8 A;  2LMU A;  2WCB A;  2JU0 A;  1ALV A;  1YUU A;  1NUB A;  1ZMZ A;  3I5H B;  2JTZ A;  3I5I B;  1CMG A;  2M7N A;  1KK7 Z;  3DF0 A;  5ER5 A;  1CTR A;  1J7R A;  1ALW A;  1TNX A;  4DCK A;  1SKT A;  1J7P A;  1IRJ A;  2LM5 A;  2CT9 A;  3BOW B;  1SR6 B;  1U5I B;  4MN0 A;  2R2I A;  1SRA A;  1X02 A;  1TCO B;  2TN4 A;  4XYN A;  1VRK A;  4YRU A;  4PE4 A;  2MRD A;  2K8M B;  1Y1U A;  1BG1 A;  1GGZ A;  1TNP A;  1JSA A;  4P2Y B;  4I5J A;  2LMT A;  1DMO A;  1NPQ A;  2FJU B;  2M9G A;  3MSE B;  2ZRS A;  1ZOT B;  1LKJ A;  3EVV A;  1AJ4 A;  1MHO A;  3OX6 A;  1K8U A;  1CM1 A;  1F4O A;  2KI6 D;  2PAS A;  1PVA A;  3KEV A;  1NP8 A;  4CFR A;  3SG6 A;  4YGC B;  3KO0 A;  5HYD A;  2KI4 B;  3LLE A;  1K94 A;  1Q80 A;  5AAN A;  2SAS A;  2QPT A;  4GGF A;  2SCP A;  3JTD B;  2BE6 A;  4I5N B;  1GGW A;  1J1E A;  4AOM A;  2LLT A;  2OTG B;  5FYX A;  5BPJ A;  1E8A A;  1RFJ A;  4PHJ A;  1KQM B;  1TOP A;  4MZK A;  4YGA A;  2O5G A;  3A4U B;  3IF7 A;  3BQ3 A;  1B7T Y;  4TNC A;  1BR4 B;  4WQ3 A;  1Y0V H;  3BUX B;  4GGF C;  2Y5I A;  5CSF A;  1UWO A;  1C7V A;  1B8C A;  3PAT A;  5G08 A;  4DS7 A;  2JT3 A;  1PRW A;  1GQM A;  1CM4 A;  1RK9 A;  1TNW A;  2ZN8 A;  1M39 A;  4HRG A;  1QLS A;  1CKK A;  1SCM C;  1KFX S;  1QV1 A;  1WDC C;  2HPS A;  2MLF C;  3EVU A;  2CBL A;  2CXJ A;  2IS9 A;  5HKY A;  1B8R A;  1TIZ A;  2F3Y A;  5HKZ A;  2EC6 C;  2KAV A;  2MAZ A;  1PAL A;  4MZL A;  2E6W A;  1KWO B;  2LP2 A;  4A4C A;  3KPX A;  1FI6 A;  4C0L A;  3C1V A;  4N5X A;  1MXL C;  1SNL A;  2K7O A;  2CCM A;  1NCY A;  1K9U A;  3CS1 A;  2NCO A;  2JNF A;  1H8B A;  2WOS A;  4PE0 A;  4F0Z B;  1QAT A;  1D1O A;  1S6J A;  2AMI A;  1AHR A;  2EHB A;  1CFC A;  1IQ3 A;  1BMO A;  3OB2 B;  1NCX A;  1S36 A;  1QTX A;  1NX3 A;  2G2B A;  3LL8 B;  4N1G A;  2FOT A;  2PMY A;  5D7F A;  4GPL B;  1BU3 A;  3TDI A;  1KK7 Y;  2JTT A;  3O78 A;  3F45 A;  1KK8 C;  2LHL A;  2ZFD A;  1UHH A;  5TNC A;  1F70 A;  1JF0 A;  1YTZ C;  3PFV A;  1K95 A;  4I5L B;  1RWY A;  2A4J A;  5KSZ A;  1YX7 A;  2KFH A;  4OR9 B;  4A4B A;  2WND A;  2PRU A;  2F8P A;  1V1G A;  3E3R A;  3TS5 C;  2BL0 B;  4L9M A;  2M7L A;  3O4Y A;  3VGO A;  1WRZ A;  2LVK A;  1EG3 A;  2GV5 A;  3CGA A;  1UUR A;  5IBW A;  1SL7 A;  1QX7 A;  1U5I A;  3BUW B;  3I5F C;  1IGV A;  2FCD A;  3IQO A;  4AQJ A;  1EG4 A;  1K9K A;  2JQ6 A;  1EH2 A;  3I5G B;  5I2O A;  4XJK A;  2L5X B;  4CID A;  1AJ5 A;  1Y1A A;  1NIW A;  2LUX A;  5AFP A;  3ZNI A;  4DRW A;  1UP5 A;  1KFU L;  1RTP 1;  3EK4 A;  4YGE B;  1XFW O;  1TNQ A;  3O6B A;  3CTN A;  1JF2 A;  3GK4 X;  1DF0 B;  1M63 B;  3BUM B;  1SBJ A;  1A75 A;  3AAJ A;  5F6T A;  1BLQ A;  3CZT X;  1J7O A;  1AP4 A;  1IQ5 A;  4PAL A;  2F3Z A;  1J7Q A;  2G9B A;  4D1E A;  3NSK A;  2BEC A;  2WCE A;  4ICB A;  4ZCU A;  5I2L A;  3HCM A;  1DJY A;  4BY4 A;  1PUL A;  3PLF B;  4NDD A;  3FWB A;  3TDU A;  3OX5 A;  1YX8 A;  2KQY A;  1MF8 B;  3OHM B;  2BCX A;  3AAK A;  1XFY O;  2KDH A;  1TTX A;  2L98 A;  2HF5 A;  4ORA B;  1N65 A;  4YBH B;  1L2O C;  1W7J B;  2Y4Q A;  2LC5 A;  3GK1 A;  5K89 A;  1OMV A;  1IH0 A;  1BJF A;  1FW4 A;  2KBM A;  1QAS A;  3SJS A;  1QIV A;  4WQ2 A;  2GGZ A;  4OCI A;  2V53 A;  3DVK A;  2OS8 B;  1DJI A;  4P5O E;  5ER4 X;  2ZNE A;  4MRY A;  2P6B B;  3D10 A;  2H61 A;  1JFJ A;  1KQV A;  4NDB A;  1XA5 A;  1F71 A;  2ZND A;  1OQP A;  1WLM A;  2RGI A;  4CFQ A;  5CSN A;  3BUO B;  3BXK A;  1QX5 B;  1LA0 A;  2COL B;  2H61 C;  2K7D A;  5AEQ A;  3PM8 A;  2PVB A;  5AER A;  4ORB B;  2WCF A;  2Y1M A;  1CDM A;  2KFF A;  4NDC A;  4MZJ A;  2K7B A;  1AUI B;  5CSI A;  1K93 D;  3SIB A;  3LK1 A;  2K2A A;  4FQO A;  4QJ3 B;  1WRL A;  1WRK A;  2NCP A;  5B8I B;  3PSR A;  1F8H A;  1S6C A;  2KFG A;  1DGV A;  1M46 A;  2KBI A;  1SL8 A;  2I18 A;  1XFV O;  1SW8 A;  3DF0 B;  1C7W A;  2M49 B;  1KFX L;  1S1E A;  1FI5 A;  1DT7 B;  4CPV A;  1DJX A;  2Q4U A;  2JUL A;  1CFP A;  2L2E A;  4UPG A;  5AXI A;  4PE1 A;  1XYD A;  1ZUZ A;  3JVT C;  1WY9 A;  1Y1X A;  3K21 A;  2JOJ A;  1B9A A;  1SPY A;  1NSH A;  3A8R A;  3DVJ A;  1YVH A;  2LE9 B;  3M0W A;  5DKR A;  3RM1 A;  3VRN A;  1CDL A;  4NQG A;  4PHN A;  1PK0 D;  3DVM A;  1YUT A;  5KU1 A;  1S5G Z;  2CNP A;  4DUQ A;  2BBN A;  3H4S E;  1MWN A;  3O2P A;  3PAL A;  2ZRT A;  3VRR A;  2M0R A;  1B4C A;  2JWW A;  1LXF C;  1SY9 A;  1OOJ A;  3FS7 A;  3D0Y A;  1S26 D;  5D69 A;  4M2O A;  1R2U A;  3EKJ A;  1DF0 A;  1UHK A;  2LNK A;  1FBV A;  1C07 A;  2MLE C;  3BYA A;  2JZI A;  3PN7 C;  1CDN A;  3TUY C;  3IQQ A;  1QXP A;  2LLS A;  2M97 A;  4GNK B;  2LVV A;  1SK6 D;  4CLN A;  4JWQ A;  2MBX A;  1QJT A;  2KHN A;  1OMD A;  3BOW A;  1UHJ A;  3I5H C;  1SCM B;  1WDC B;  2F33 A;  3SG7 A;  3WHU B;  3I5I C;  4GFT A;  1QVI Z;  1W7I B;  1TRF A;  2EC6 B;  2MA2 A;  3DVE A;  1NYA A;  1QX2 A;  1XFU O;  1BOD A;  2LCP A;  2LVI A;  4FTG A;  1JUO A;  4MSP A;  1R6P A;  1SMG A;  2KOT A;  2L51 A;  1JBA A;  1CLM A;  5I2Q A;  3NSL A;  1MR8 A;  1SR6 C;  2F2O A;  1CB1 A;  3SG4 A;  1YRT B;  2VRG A;  2L4I A;  4MBE A;  1DJH A;  1AVS A;  4YGB B;  2KYC A;  1IG5 A;  1CNP A;  1N2D A;  3AKB A;  3FWC A;  3CR5 X;  1CFF A;  4I5K A;  4WRI A;  5GQQ C;  1NX2 A;  1KCY A;  1PSB A;  2MHH A;  1KFU S;  2LMV A;  1MUX A;  1SL9 A;  1SYM A;  1KK8 B;  3OB1 B;  2NXQ A;  3FIA A;  2KI4 C;  1DGU A;  1Y6W A;  4AQI A;  2AAO A;  3JTD C;  3SG3 A;  4GBA A;  3TS5 B;  4M2P A;  4IL1 A;  1CMF A;  1DJW A;  2OTG C;  4GAO A;  3HX4 A;  1KQM C;  1DTL A;  1ODB A;  1V1F A;  2KGB C;  2NZ0 A;  2ZKM X;  4ETO A;  1K2H A;  4YI8 A;  1DJZ A;  3I5F B;  3LK0 A;  3TZ1 A;  3VRQ A;  3WHT B;  4BY5 A;  4PHK A;  1PSR A;  1M45 A;  2MJW B;  4ORC B;  2WC8 A;  5KTY A;  3NSI A;  1MXE A;  1IKU A;  2BKH B;  2KGR A;  1DVI A;  2O60 A;  1BF5 A;  3ZWH A;  3CR2 A;  2ISD A;  1NX1 A;  2KQ6 A;  1S5G Y;  1YR5 A;  4Q04 A;  4OVN F;  5I8N A;  1LA3 A;  4MVF A;  1K90 D;  2BKI B;  1L7Z A;  4XJK B;  1KWO C;  2KI6 C;  4QJ5 B;  1EJ3 A;  3ICB A;  1EXR A;  2Q91 A;  1UUS A;  1YVL A;  2GGM A;  3EKH A;  1UHN A;  4GGN A;  2JPT A;  4OKH A;  3WXA A;  1K96 A;  2BBM A;  1G33 A;  2H2K A;  2I7A A;  1S6I A;  1J55 A;  5DKN A;  1G4Y R;  1KSM A;  2HET A;  2PAL A;  2KSP A;  1A75 B;  2BCA A;  4YI9 A;  1GJY A;  1S3P A;  4MRX A;  2LAN A;  3SG5 A;  1A2X A;  2M8U A;  2L4H A;  1QV0 A;  4HSZ A;  1JC2 A;  1QIW A;  1F54 A;  3KF9 A;  1L2O B;  1FPW A;  2M3W A;  2LV7 A;  4JQ0 D;  4C0J A;  2KAY A;  2NLN A;  4PE7 A;  3OP0 A;  1QVI Y;  3CWG A;  1EL4 A;  1REC A;  2BCB A;  1B1G A;  1FF1 A;  1UHI A;  3BUN B;  5PAL A;  4JPZ B;  2CTN A;  2HQ8 A;  2LUC A;  4M2Q A;  1IJ5 A;  2BL0 C;  4HRE E;  4DIR A;  1B8L A;  3GK2 A;  1JWD A;  3QRX A;  4YGD B;  1IJ6 A;  5HLO A;  1CDP A;  1XFX O;  4MLW A;  3GOF A;  1WLZ A;  1YUS A;  1XK4 A;  2JT8 A;  1QS7 A;  1ZFS A;  2Y1N A;  3WNX B;  1K9P A;  1PVB A;  3LCP C;  2OPO A;  2EGD A;  3I5G C;  3NSO A;  4QJ4 B;  2LP3 A;  3DD4 A;  1AK8 A;  1IWQ A;  2E30 A;  2KYF A;  3VRP A;  2L50 A;  2K61 A;  1JFK A;  1OZS A;  2DOQ A;  1XFZ O;  2LAP A;  1DJG A;  4E68 A;  2JXL A;  2M29 A;  3EVR A;  1B47 A;  3SG2 A;  1XK4 C;  5CSJ A;  2K7C A;  1ZAC A;  1YRU B;  2B1U A;  1CLB A;  2ZN9 A;  5DKQ A;  4C0K A;  2D8N A;  1CFD A;  1G8I A;  2JT0 A;  1OSA A;  1HQV A;  3SIA A;  2WOR A;  5CPV A;  2I2R E;  1H4B A;  1HT9 A;  1NCZ A;  2K2F A;  2FCE A;  4PCW A;  1B7T Z;  1BT6 A;  1BOC A;  4OV2 A;  3EK7 A;  3JVT B;  4MEW A;  1SCV A;  2K0J A;  1TN4 A;  2JRF A;  2JC2 A;  3VRO A;  4HRH A;  2PSR A;  1BR1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...