1Q80A

Solution structure and dynamics of nereis sarcoplasmic calcium binding protein
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
174
structure length
174
Chain Sequence
b'SDLWVQKMKTYFNRIDFDKDGAITRMDFESMAERFAKESEMKAEHAKVLMDSLTGVWDNFLTAVAGGKGIDETTFINSMKEMVKNPEAKSVVEGPLPLFFRAVDTNEDNNISRDEYGIFFGMLGLDKTMAPASFDAIDTNNDGLLSLEEFVIAGSDFFMNDGDSTNKVFWGPLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sarcoplasmic calcium-binding protein
publication title Solution structure and internal dynamics of NSCP, a compact calcium-binding protein.
pubmed doi rcsb
source organism Neanthes diversicolor
molecule tags Metal binding protein
total genus 60
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2003-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1q80A00
4I5JA 2WCFA 1BU3A 1G8IA 1CMGA 4YI8A 4ZCVA 5CPVA 2LVJA 5J3XA 4BY5A 4GGFA 2BKHB 4HREE 1S6IA 2PSRA 3RM1A 1BMOA 1RFJA 1NX0A 1QLKA 1RTP1 2WNDA 1QV1A 3CR2A 1KSOA 1YUUA 1XFVO 2ZKMX 1IGVA 3KO0A 4OKHA 1S5GY 3DVMA 1XFYO 2LC5A 1ALVA 1J7QA 1QX5B 3D0YB 3I5IB 2PASA 1NUBA 3FWCA 1BG1A 1DF0A 1TNPA 1FBVA 1NPQA 1S36A 2OPOA 4XJKB 1K95A 2EGDA 3IQOA 1JF2A 2F3ZA 4GNKB 1K2HA 1SK6D 2M29A 2KFFA 1G33A 1M31A 1PALA 1FI6A 4NQGA 4UPGA 1B7TZ 1OMRA 3SG4A 1GJYA 2ZFDA 1QJTA 5HKYA 2CBLA 2F33A 5GQQC 2M97A 1ZACA 2MJWB 1S1EA 2KI4B 2LE9B 1BJFA 3SG3A 3GK4X 1A29A 1Y1XA 3NSLA 1SR6C 1J1DA 4GFTA 3BQ3A 2KOTA 1AJ5A 4GGNA 5CSJA 4C0JA 1XFWO 3C1VA 1NIWA 2TN4A 2LVIA 2L5XB 2SCPA 3I5FC 1N2DA 2VRGA 3CZTX 1CDLA 4DUQA 2E6WA 3DF0A 4GUKA 5JOLA 3OP0A 1LVCD 2M8UA 1TNQA 4ORBB 3LCPC 3NXAA 3VRNA 1TRFA 2JT3A 3JTDC 3PM8A 1LINA 3TZ1A 5KU1A 1TCFA 2JTZA 2JTTA 2KFHA 4NDBA 3VRQA 2HETA 3DVKA 1LKJA 3TDZA 1R2UA 1F55A 2EC6B 2K7CA 2O5GA 1KFUL 3I5GB 5DKQA 2BL0C 1BLQA 2LLTA 1EXRA 1KK7Y 3PALA 2LMVA 5PALA 1TCOB 1F54A 1KK8C 2M3WA 1SKTA 2JQ6A 1DJHA 1CM1A 1MXEA 3DD4A 2PRUA 2HQWA 2K7DA 2LUCA 2LVVA 3K21A 3CR5X 1DJXA 3O2PA 1D1OA 1UHJA 3TS5B 1S5GZ 1CMFA 2BBMA 2K7BA 4YGAA 1YTZC 2F2OA 4N1FA 5DKRA 5AEQA 2AMIA 1WLZA 2MRDA 1PSRA 2LMUA 1IJ6A 3JVTC 1YX7A 4WRIA 3TDUA 1N0YA 4IL1A 2KNEA 3IF7A 3HCMA 2WCBA 5TNCA 2G9BA 1ZOTB 2WC8A 2M49B 1B1GA 4WQ2A 2CTNA 3PLFB 2HQ8A 1WRKA 3MSEB 1FPWA 3D10A 3FS7A 2KAXA 5AANA 1UUSA 4Q04A 1QX7A 4QJ5B 1S3PA 1OQPA 2Y4QA 2AUCA 1SL8A 1KFUS 1KQVA 3GOFA 1RJVA 1TNXA 2O60A 3CS1A 3DVEA 1J7PA 3OHMB 2Y1NA 1J1EA 3AKBA 5G08A 4L9MA 1TIZA 1S6CA 3EVRA 2ZNDA 2H2KA 2K8MB 1CDPA 1AP4A 1AJ4A 3A4UB 1YRTB 1NYAA 1XVJA 2R2IA 2MBXA 1QVIY 5HLVA 3WXAA 5AERA 4I5LB 1GGZA 1K93D 1ZMZA 5CSFA 2KYFA 3KPXA 1KK7Z 5DKNA 1N65A 1UURA 1CFDA 4MZKA 2LAPA 4JQ0D 4OR9B 4CFRA 2NZ0A 2BCXA 4NDDA 3WHTB 1F70A 2FCEA 2JWWA 3PN7C 2KI4C 4USLA 4AQJA 1KFXS 2F8PA 1WDCB 2OTGB 2PVBA 5I2LA 1Y6WA 4A4BA 1R6PA 2CXJA 4MRYA 4ZCUA 1DF0B 1OZSA 3DVJA 2JULA 2JNXA 1Y1UA 2ZRSA 4OVNF 3O4YA 1QV0A 1RWYA 2GV5A 1OMVA 1KCYA 1WLMA 4QJ3B 1C7WA 5FYXA 1SL7A 1AVSA 4YGDB 2EC6C 3I5GC 3BYAA 5ER4X 1EG3A 2M0RA 1QIVA 3ICBA 4GBAA 5K89A 2ZN8A 1HQVA 1K94A 2BKIB 4AOMA 1JWDA 1SRAA 3DF0B 1CLLA 4WQ3A 1OSAA 2CT9A 2K2FA 1DJGA 1Q80A 1L2OB 1JF0A 2IS9A 3EVVA 1SMGA 3TS5C 1YRUB 3SG6A 2LV7A 3ZNIA 2L98A 1J7RA 1LA0A 1AHRA 2GGMA 4N5XA 3SG2A 4CLNA 2QPTA 2JOJA 1YVHA 2M9GA 5BPJA 4HRGA 1B9AA 1S26D 3RLZA 1IJ5A 1SNLA 1UHHA 4PE1A 1L7ZA 1TN4A 5CSNA 2ZNEA 3CR4X 3D0YA 1UHNA 4JPZB 1MXLC 1MQ1A 1DGUA 2LLUA 3KHEA 4PE0A 4XJKA 1S6JA 3EKJA 1K90D 1QIWA 2I94A 2JC2A 3PATA 4MBEA 4QJ4B 1PRWA 4HSZA 2Y5IA 4M2PA 2ZN9A 1VRKA 1JFJA 2FJUB 2OS8C 4YGBB 4D1EA 1UWOA 3EK8A 1QTXA 4PHNA 3WNXB 4DCKA 2KI6D 4U8DA 1FI5A 3OX5A 4JWQA 1YUSA 5ER5A 1NP8A 4PCWA 3SIAA 3CWGA 1F4OA 1YX8A 1M45A 4CFQA 3F45A 3SIBA 2WORA 1CM4A 1BR4B 4MEWA 1YUTA 4NDCA 2ZRTA 5HLOA 2M7LA 2K0JA 3EK7A 2LP3A 3O6BA 1SCVA 1CDMA 2KSPA 2HF5A 3EVUA 1QATA 2G2BA 1M46A 1NCXA 1OOJA 3IQQA 3PSRA 3ZWHA 4CIDA 1JUOA 2WOSA 4YI9A 5I2QA 2WCEA 1F4QA 1YVLA 2KQYA 4TNCA 1SY9A 4MVFA 1DJWA 1OZOA 1X02A 1WDCC 2OTGC 2M1UA 1EG4A 3AKAA 1FW4A 1QXPA 4PALA 1CFCA 1MF8B 4YRUA 3JTDB 1U5IA 5KSZA 1NX2A 2MLEC 4DIRA 2NXQA 2BBNA 4CPVA 1ZFSA 2LANA 1TOPA 1QS7A 1A75A 1OMDA 1EH2A 1NWDA 2AAOA 1XFUO 1EL4A 1K9KA 1PULA 1HT9A 3KEVA 3I5IC 2MA2A 2LUXA 3FIAA 1LA3A 3PFVA 5D7FA 2COLB 1KK8B 1KQMB 1ALWA 1QX2A 2KDHA 1PVAA 5HKWA 4FQOA 3TUYB 2KYCA 4OV2A 4E68A 2BCBA 4MZJA 1K9UA 4ORAB 1GQMA 4MSPA 4OCIA 4N1GA 2BE6A 1ODBA 4ETOA 5B8IB 2I2RE 4PE7A 2LLSA 4YGEB 5AFPA 5JJGA 3BOWA 1M63B 2B1UA 3BUOB 4MN0A 4DS7A 2FOTA 1GGWA 3LK0A 2LVKA 3KF9A 1UHKA 3EKHA 2LNKA 5IBWA 5F6TA 1RROA 1DT7B 2JT0A 5I2OA 4P5OE 1A03A 3FWBA 2DOQA 4C0KA 2LHIA 1C07A 2KBMA 1F8HA 3O78A 2L51A 3BUMB 2I18A 4MLWA 1BODA 1CFFA 2L0PA 1PK0D 1IKUA 4P2YB 5HYDA 2BECA 1WRZA 2QACA 5D69A 4F0ZB 1NCZA 2MHHA 1DTLA 3BUWB 1DJZA 3I5HB 4A4CA 1DVIA 1JSAA 1CTRA 2JXLA 3SG7A 1SCMB 1XK4C 1CLBA 1H8BA 3OB2B 2PMYA 2D8NA 2EHBA 1SPYA 1IQ5A 4PHJA 4AQIA 3VGOA 2L4HA 1C7VA 1RECA 4GAOA 2K61A 1QVIZ 1JFKA 2P6BB 3GK2A 4MZLA 4I5NB 1MHOA 1Y1AA 2KAYA 2KHNA 2JT8A 2JU0A 1KWOB 2KQ6A 3M0WA 2MAZA 5HKZA 1WRLA 2LCPA 2HPSA 3OB1B 1BR1B 3WHUB 1UP5A 2GGZA 2Q91A 1IQ3A 1EJ3A 3PN7B 4PHMA 1DMOA 2H61C 1F71A 1B8RA 2L4IA 4M2QA 2KI6C 3QRXA 4ICBA 1BOCA 1WY9A 4R1EA 1QASA 2CNPA 1SL9A 1IG5A 1M39A 1BT6A 3CTNA 2JRFA 3AAJA 2L2EA 5I8NA 3H4SE 4DRWA 1OE9B 1ZUZA 1TTXA 3CGAA 3SG5A 1RK9A 1J55A 3VROA 1K8UA 4M2OA 1A2XA 1W7IB 1DJYA 5AXIA 1CFPA 1CKKA 3CLNA 1XYDA 1CLMA 1PSBA 2M7NA 3NSIA 1TNWA 3AAKA 4XYNA 1MWNA 4BY4A 3VRRA 1K96A 1CNPA 2ISDA 3LK1A 2LMTA 5CSIA 2JNFA 1B4CA 1KSMA 1NSHA 3VRPA 2SASA 2BCAA 1KQMC 4GGFC 2CCMA 2E30A 2KBIA 2PALA 3TUYC 1SR6B 4GPLB 1A4PA 1IH0A 2JZIA 1SBJA 1JC2A 1H4BA 2MLFC 1U5IB 2LM5A 3I5FB 1MUXA 2Y1MA 1XK4A 4MRXA 1YURA 3BXKA 1FF1A 1AUIB 1K9PA 3LLEA 3A8RA 3GK1A 1A75B 2NCOA 1Y0VH 1J7OA 1CB1A 2LP2A 4YBHB 2I7AA 1UHIA 1B47A 1BF5A 1YR5A 2F2PA 2FCDA 1AK8A 2L50A 1JBAA 3NSOA 2NCPA 2KGBC 3BUNB 2NLNA 1NCYA 2A4JA 1KFXL 1SYMA 3HX4A 2BL0B 1DGVA 1CDNA 4C0LA 2M1KB 4PDZA 5KTYA 2JPTA 2RGIA 4YGCB 2JXCA 2K7OA 3SJSA 1NX3A 1V1GA 3BOWB 2H61A 2F3YA 3LL8B 2OS8B 1MR8A 1IWQA 2Q4UA 1B7TY 1W7JB 3I5HC 4ORCB 2KGRA 1XA5A 2KAVA 1SCMC 1IRJA 1PVBA 1XFZO 1DJIA 2KFGA 2LHLA 1G4YR 3NSKA 4HRHA 1QLSA 1V1FA 1L2OC 1SW8A 1B8LA 1NX1A 2BE4A 3JVTB 1B8CA 3OX6A 1XFXO 4PHKA 1KWOC 4I5KA 2V53A 2K2AA 3BUXB 1E8AA 3TDIA 1XO5A 1LXFC 3E3RA 4FTGA 3EK4A 4PE4A
chains in the Genus database with same CATH superfamily
4I5JA 2WCFA 1BU3A 1G8IA 3OGNA 1CMGA 4YI8A 4ZCVA 5CPVA 2LVJA 5J3XA 4BY5A 4GGFA 2BKHB 4HREE 1S6IA 2P71A 2PSRA 3RM1A 1BMOA 1OOGA 1RFJA 1NX0A 1QLKA 1RTP1 2WNDA 3UNWA 1ORGA 1QV1A 3CR2A 1KSOA 1YUUA 1XFVO 2ZKMX 1IGVA 3KO0A 4OKHA 1S5GY 3NGVA 3DVMA 1XFYO 2LC5A 1ALVA 1J7QA 1QX5B 3D0YB 1IIOA 3I5IB 2PASA 1NUBA 2QEHA 3FWCA 1DF0A 1TNPA 1FBVA 1BG1A 1NPQA 1S36A 2OPOA 4XJKB 1K95A 1QWVA 2EGDA 3IQOA 1JF2A 2F3ZA 4GNKB 1K2HA 1SK6D 2M29A 2KFFA 1G33A 1M31A 1PALA 1FI6A 4NQGA 3CYZA 3SS5A 1B7TZ 1OMRA 3SG4A 1GJYA 2ZFDA 1QJTA 4UPGA 2CBLA 2F33A 3CDNA 5HKYA 5GQQC 2M97A 1ZACA 2MJWB 1S1EA 2KI4B 2LE9B 1BJFA 3S0GA 3SG3A 3GK4X 1A29A 1Y1XA 3CZ2A 3NSLA 1SR6C 1J1DA 4GFTA 3BQ3A 2KOTA 1AJ5A 4GGNA 5CSJA 3SS4A 4C0JA 1XFWO 3C1VA 1NIWA 2TN4A 2LVIA 2L5XB 2SCPA 3I5FC 1N2DA 2VRGA 3CZTX 1CDLA 4DUQA 2E6WA 3DF0A 4GUKA 5JOLA 3OP0A 1LVCD 2M8UA 3D77A 2QEOA 1TNQA 4ORBB 3LCPC 4KYNA 3NXAA 3VRNA 1TRFA 2JT3A 3JTDC 3PM8A 1LINA 3TZ1A 3R1OA 1TCFA 2JTZA 2JTTA 5HL1A 5KU1A 2KFHA 4NDBA 3VRQA 3FE6A 2HETA 3DVKA 1LKJA 4JD9A 3TDZA 1R2UA 3PM2A 3D74A 2EC6B 1F55A 2K7CA 2O5GA 1KFUL 2ERBA 3I5GB 5DKQA 2BL0C 3PJIA 1BLQA 2LLTA 1EXRA 1KK7Y 3PALA 2LMVA 5PALA 1TCOB 1F54A 1KK8C 2M3WA 1SKTA 2JQ6A 1OOHA 1DJHA 1CM1A 1MXEA 3DD4A 2PRUA 3QMEA 2HQWA 2K7DA 2LUCA 2LVVA 3K21A 1Z2CB 3CR5X 1DJXA 3O2PA 1D1OA 1UHJA 2PQLA 3TS5B 3RZSA 1OOFA 1S5GZ 1CMFA 2BBMA 2K7BA 4YGAA 1YTZC 2F2OA 3NHTA 4N1FA 5DKRA 5AEQA 2AMIA 1WLZA 2MRDA 1PSRA 2LMUA 1IJ6A 3JVTC 1YX7A 4WRIA 3TDUA 5FI6A 1N0YA 3DY9A 4IL1A 2KNEA 3IF7A 3HCMA 2WCBA 5TNCA 2G9BA 1ZOTB 2WC8A 2M49B 1B1GA 4WQ2A 2CTNA 3PLFB 2HQ8A 3BFAA 1WRKA 3MSEB 5I94A 1FPWA 3D10A 3FS7A 2KAXA 5AANA 1UUSA 4Q04A 1QX7A 4QJ5B 1S3PA 1OQPA 3D73A 2Y4QA 1SL8A 2AUCA 1KFUS 1KQVA 3GOFA 1RJVA 1TNXA 2O60A 3CS1A 3DVEA 1J7PA 3OHMB 3D76A 2Y1NA 1J1EA 3AKBA 5G08A 4L9MA 1TIZA 1S6CA 1P28A 2K60A 3EVRA 2ZNDA 2H2KA 2K8MB 4INWA 1CDPA 1AP4A 1AJ4A 3A4UB 1YRTB 1NYAA 1XVJA 2R2IA 3R1VA 1QVIY 5HLVA 2MBXA 3WXAA 5AERA 4I5LB 1GGZA 1K93D 1ZMZA 5CSFA 2KYFA 3KPXA 1KK7Z 5DKNA 1N65A 1UURA 1CFDA 3B88A 4MZKA 2LAPA 4JQ0D 4OR9B 4CFRA 2NZ0A 2BCXA 4NDDA 3WHTB 1F70A 2WCJA 2FCEA 2JWWA 3PN7C 2KI4C 4USLA 4AQJA 1GM0A 1KFXS 3O4XA 2F8PA 1WDCB 2OTGB 2PVBA 5I2LA 1Y6WA 4A4BA 1R6PA 2CXJA 4MRYA 4ZCUA 1DF0B 1OZSA 3DVJA 2JULA 1DC1A 2JNXA 1Y1UA 2ZRSA 4OVNF 3O4YA 1QV0A 1RWYA 2GV5A 1OMVA 4PT1A 1KCYA 1WLMA 4QJ3B 1C7WA 5FYXA 1SL7A 1AVSA 4YGDB 3IVTA 2EC6C 3I5GC 3BYAA 5ER4X 1EG3A 3DZTA 2M0RA 1QIVA 3ICBA 4GBAA 5K89A 2ZN8A 1HQVA 1K94A 2BKIB 4AOMA 1JWDA 1SRAA 3DF0B 1CLLA 4WQ3A 1OSAA 2CT9A 2K2FA 5FI2A 1DJGA 1Q80A 1L2OB 1JF0A 2IS9A 1TWOA 3EVVA 1SMGA 3R72A 3TS5C 1YRUB 3SG6A 2LV7A 3ZNIA 2L98A 1J7RA 3B87A 1LA0A 1AHRA 2GGMA 4N5XA 3SG2A 4CLNA 2QPTA 2WCLA 2JOJA 4OZDA 1YVHA 2M9GA 5BPJA 4HRGA 1B9AA 1S26D 3RLZA 1IJ5A 1SNLA 1UHHA 4PE1A 1L7ZA 1TN4A 5CSNA 2ZNEA 3D78A 3CR4X 2WC6A 3D0YA 1UHNA 4JPZB 1MXLC 1MQ1A 1DGUA 2LLUA 3KHEA 4PE0A 4XJKA 3NHIA 1S6JA 3EKJA 1K90D 1QIWA 2I94A 2JC2A 3PATA 4MBEA 4QJ4B 1PRWA 4HSZA 5FI7A 1T14A 2GTEA 2Y5IA 4M2PA 2ZN9A 1VRKA 1JFJA 2FJUB 2OS8C 4YGBB 4D1EA 1UWOA 3EK8A 1QTXA 4PHNA 3WNXB 4DCKA 2KI6D 4U8DA 1FI5A 3OX5A 4JWQA 1YUSA 5ER5A 1NP8A 3CZ0A 4PCWA 3UO9A 3SIAA 3CWGA 1F4OA 1YX8A 1M45A 4CFQA 3F45A 1DELA 4INXA 1Z4HA 2WORA 3SIBA 1CM4A 1BR4B 4MEWA 1YUTA 4NDCA 2ZRTA 5HLOA 2M7LA 2K0JA 3EK7A 2LP3A 3DXLA 3O6BA 1SCVA 1CDMA 2KSPA 2HF5A 3EVUA 1QATA 2G2BA 1M46A 1NCXA 1OOJA 3DYEA 3IQQA 3PSRA 3ZWHA 1JUOA 2FJYA 2WOSA 4YI9A 4CIDA 2WCEA 5I2QA 1F4QA 1YVLA 2KQYA 4TNCA 1SY9A 4MVFA 1C3ZA 1DJWA 1OZOA 4FQTA 1X02A 1WDCC 2KLEA 3S0EA 2OTGC 2M1UA 1EG4A 2WC5A 1FW4A 1QXPA 3AKAA 4PALA 1MF8B 5DICA 4YRUA 1CFCA 3JTDB 1U5IA 5KSZA 3V2LA 1NX2A 2MLEC 4DIRA 2NXQA 3FE9A 2BBNA 4CPVA 2P70A 1ZFSA 2LANA 1TOPA 1QS7A 1A75A 1OMDA 1EH2A 1DQEA 1NWDA 3L4AA 3EG5B 2AAOA 1XFUO 1EL4A 1K9KA 3R1PA 1PULA 1HT9A 3KEVA 3I5IC 2MA2A 2LUXA 3FIAA 1LA3A 3CABA 3PFVA 2COLB 1KK8B 1KQMB 1ALWA 1QX2A 2KDHA 1PVAA 5HKWA 4FQOA 3TUYB 2KYCA 4OV2A 4E68A 2BCBA 4MZJA 1K9UA 4ORAB 1GQMA 4MSPA 4OCIA 4N1GA 2BE6A 1ODBA 3FE8A 4ETOA 5B8IB 2I2RE 4PE7A 2LLSA 4YGEB 5AFPA 5JJGA 3BOWA 1M63B 2B1UA 3BUOB 4MN0A 4DS7A 3BFBA 2FOTA 1GGWA 3LK0A 2LVKA 3KF9A 1UHKA 3EKHA 2LNKA 5IBWA 3Q8IA 5F6TA 1RROA 1DT7B 2JT0A 5I2OA 4P5OE 1A03A 3FWBA 2DOQA 4C0KA 2LHIA 1C07A 2KBMA 1F8HA 1TUZA 2L51A 3BUMB 2I18A 3O78A 4MLWA 1BODA 1CFFA 2L0PA 1PK0D 1IKUA 4P2YB 5HYDA 2BECA 1WRZA 2QACA 5D69A 4F0ZB 1NCZA 2MHHA 1DTLA 2WCHA 2BNXA 3BUWB 1DJZA 3I5HB 4A4CA 1DVIA 3OBVA 1JSAA 1CTRA 2JXLA 3SG7A 1SCMB 1XK4C 1CLBA 1H8BA 3OB2B 2PMYA 2D8NA 2EHBA 4IJ7A 1SPYA 1IQ5A 4PHJA 4AQIA 3VGOA 1SSEB 2L4HA 1C7VA 1RECA 1LS8A 2K61A 1QVIZ 2PYQA 1JFKA 2P6BB 3D75A 3B7AA 4GAOA 3GK2A 4MZLA 3S0BA 4I5NB 1MHOA 1Y1AA 2KAYA 2KHNA 2JT8A 2JU0A 1KWOB 2KQ6A 3K1EA 3M0WA 3L4LA 2MAZA 5HKZA 1WRLA 2LCPA 2HPSA 2KLDA 1BR1B 3OB1B 1UP5A 3WHUB 2GGZA 2Q91A 3SS3A 1IQ3A 1EJ3A 3PN7B 4PHMA 1C3YA 2H61C 1DMOA 1F71A 1B8RA 1TUJA 2L4IA 4M2QA 2KI6C 3QRXA 4ICBA 1BOCA 2WCKA 1WY9A 4R1EA 1QASA 2CNPA 1SL9A 1IG5A 1M39A 5D3OA 1BT6A 3CTNA 2JRFA 1OW4A 3AAJA 2H8VA 2L2EA 5I8NA 3H4SE 2QEVA 4DRWA 1OE9B 1ZUZA 1TTXA 3CGAA 3SG5A 1RK9A 1J55A 3VROA 1K8UA 4M2OA 1A2XA 3BJHA 3CZ1A 1W7IB 1DJYA 5AXIA 1CFPA 1CKKA 3CLNA 1XYDA 1CLMA 1PSBA 2M7NA 3B86A 1TNWA 3AAKA 3N7HA 3NSIA 4XYNA 1MWNA 4BY4A 3VRRA 1K96A 1CNPA 2ISDA 3LK1A 2LMTA 5CSIA 2JNFA 1B4CA 1KSMA 1NSHA 2L5YA 3VRPA 2SASA 2BCAA 1KQMC 4GGFC 2CCMA 2E30A 2KBIA 2YGUA 2PALA 3TUYC 1SR6B 4GPLB 1A4PA 2JPOA 1IH0A 2QEBA 2JZIA 1SBJA 1JC2A 1H4BA 2MLFC 1U5IB 2KPHA 2LM5A 5D7FA 3I5FB 2QDIA 1MUXA 2Y1MA 1XK4A 3S0FA 4MRXA 1YURA 3BXKA 1FF1A 2BAPA 1AUIB 1K9PA 3LLEA 3A8RA 3GK1A 1A75B 2NCOA 1Y0VH 1J7OA 1CB1A 2LP2A 4YBHB 2I7AA 5EL2A 1UHIA 1B47A 1BF5A 1YR5A 2F2PA 2FCDA 1AK8A 1OOIX 2L50A 1JBAA 3NSOA 2NCPA 2KGBC 3BUNB 2NLNA 1NCYA 2A4JA 1KFXL 1DEKA 1SYMA 3HX4A 2BL0B 3VB1A 1DGVA 1CDNA 4C0LA 2M1KB 4PDZA 5KTYA 2JPTA 2RGIA 4YGCB 2JXCA 2K7OA 3SJSA 1NX3A 1V1GA 3BOWB 2H61A 2F3YA 3LL8B 2OS8B 1MR8A 1IWQA 2Q4UA 1B7TY 1W7JB 3I5HC 4ORCB 2KGRA 3S0DA 1XA5A 2KAVA 2WCMA 1SCMC 1IRJA 3B6XA 1PVBA 3S0AA 1XFZO 1DJIA 2KFGA 2LHLA 1G4YR 3L47A 3NSKA 4HRHA 1QLSA 1V1FA 1L2OC 2L2CA 1SW8A 1B8LA 1NX1A 2BE4A 3JVTB 1B8CA 4JKTA 3OX6A 1W9ZA 1XFXO 4PHKA 1KWOC 4I5KA 2V53A 3BFHA 2K2AA 3BUXB 1E8AA 3TDIA 1XO5A 1LXFC 1XFRA 3E3RA 4F7FA 4FTGA 3EK4A 4PE4A
chains in the Genus database with same CATH topology
4I5JA 2WCFA 1BU3A 1G8IA 1CMGA 4YI8A 4ZCVA 5CPVA 2LVJA 5J3XA 4BY5A 4GGFA 2BKHB 4HREE 1S6IA 2PSRA 3RM1A 1BMOA 1RFJA 1NX0A 1QLKA 1RTP1 2WNDA 1QV1A 3CR2A 1KSOA 1YUUA 1XFVO 2ZKMX 1IGVA 3KO0A 4OKHA 1S5GY 3DVMA 1XFYO 2LC5A 1ALVA 1J7QA 1QX5B 3D0YB 3I5IB 2PASA 1NUBA 3FWCA 1BG1A 1DF0A 1TNPA 1FBVA 1NPQA 1S36A 2OPOA 4XJKB 1K95A 2EGDA 3IQOA 1JF2A 2F3ZA 4GNKB 1K2HA 1SK6D 2M29A 2KFFA 1G33A 1M31A 1PALA 1FI6A 4NQGA 4UPGA 1B7TZ 1OMRA 3SG4A 1GJYA 2ZFDA 1QJTA 5HKYA 2CBLA 2F33A 5GQQC 2M97A 1ZACA 2MJWB 1S1EA 2KI4B 2LE9B 1BJFA 3SG3A 3GK4X 1A29A 1Y1XA 3NSLA 1SR6C 1J1DA 4GFTA 3BQ3A 2KOTA 1AJ5A 4GGNA 5CSJA 4C0JA 1XFWO 3C1VA 1NIWA 2TN4A 2LVIA 2L5XB 2SCPA 3I5FC 1N2DA 2VRGA 3CZTX 1CDLA 4DUQA 2E6WA 3DF0A 4GUKA 5JOLA 3OP0A 1LVCD 2M8UA 1TNQA 4ORBB 3LCPC 3NXAA 3VRNA 1TRFA 2JT3A 3JTDC 3PM8A 1LINA 3TZ1A 5KU1A 1TCFA 2JTZA 2JTTA 2KFHA 4NDBA 3VRQA 2HETA 3DVKA 1LKJA 3TDZA 1R2UA 1F55A 2EC6B 2K7CA 2O5GA 1KFUL 3I5GB 5DKQA 2BL0C 1BLQA 2LLTA 1EXRA 1KK7Y 3PALA 2LMVA 5PALA 1TCOB 1F54A 1KK8C 2M3WA 1SKTA 2JQ6A 1DJHA 1CM1A 1MXEA 3DD4A 2PRUA 2HQWA 2K7DA 2LUCA 2LVVA 3K21A 3CR5X 1DJXA 3O2PA 1D1OA 1UHJA 3TS5B 1S5GZ 1CMFA 2BBMA 2K7BA 4YGAA 1YTZC 2F2OA 4N1FA 5DKRA 5AEQA 2AMIA 1WLZA 2MRDA 1PSRA 2LMUA 1IJ6A 3JVTC 1YX7A 4WRIA 3TDUA 1N0YA 4IL1A 2KNEA 3IF7A 3HCMA 2WCBA 5TNCA 2G9BA 1ZOTB 2WC8A 2M49B 1B1GA 4WQ2A 2CTNA 3PLFB 2HQ8A 1WRKA 3MSEB 1FPWA 3D10A 3FS7A 2KAXA 5AANA 1UUSA 4Q04A 1QX7A 4QJ5B 1S3PA 1OQPA 2Y4QA 2AUCA 1SL8A 1KFUS 1KQVA 3GOFA 1RJVA 1TNXA 2O60A 3CS1A 3DVEA 1J7PA 3OHMB 2Y1NA 1J1EA 3AKBA 5G08A 4L9MA 1TIZA 1S6CA 3EVRA 2ZNDA 2H2KA 2K8MB 1CDPA 1AP4A 1AJ4A 3A4UB 1YRTB 1NYAA 1XVJA 2R2IA 2MBXA 1QVIY 5HLVA 3WXAA 5AERA 4I5LB 1GGZA 1K93D 1ZMZA 5CSFA 2KYFA 3KPXA 1KK7Z 5DKNA 1N65A 1UURA 1CFDA 4MZKA 2LAPA 4JQ0D 4OR9B 4CFRA 2NZ0A 2BCXA 4NDDA 3WHTB 1F70A 2FCEA 2JWWA 3PN7C 2KI4C 4USLA 4AQJA 1KFXS 2F8PA 1WDCB 2OTGB 2PVBA 5I2LA 1Y6WA 4A4BA 1R6PA 2CXJA 4MRYA 4ZCUA 1DF0B 1OZSA 3DVJA 2JULA 2JNXA 1Y1UA 2ZRSA 4OVNF 3O4YA 1QV0A 1RWYA 2GV5A 1OMVA 1KCYA 1WLMA 4QJ3B 1C7WA 5FYXA 1SL7A 1AVSA 4YGDB 2EC6C 3I5GC 3BYAA 5ER4X 1EG3A 2M0RA 1QIVA 3ICBA 4GBAA 5K89A 2ZN8A 1HQVA 1K94A 2BKIB 4AOMA 1JWDA 1SRAA 3DF0B 1CLLA 4WQ3A 1OSAA 2CT9A 2K2FA 1DJGA 1Q80A 1L2OB 1JF0A 2IS9A 3EVVA 1SMGA 3TS5C 1YRUB 3SG6A 2LV7A 3ZNIA 2L98A 1J7RA 1LA0A 1AHRA 2GGMA 4N5XA 3SG2A 4CLNA 2QPTA 2JOJA 1YVHA 2M9GA 5BPJA 4HRGA 1B9AA 1S26D 3RLZA 1IJ5A 1SNLA 1UHHA 4PE1A 1L7ZA 1TN4A 5CSNA 2ZNEA 3CR4X 3D0YA 1UHNA 4JPZB 1MXLC 1MQ1A 1DGUA 2LLUA 3KHEA 4PE0A 4XJKA 1S6JA 3EKJA 1K90D 1QIWA 2I94A 2JC2A 3PATA 4MBEA 4QJ4B 1PRWA 4HSZA 2Y5IA 4M2PA 2ZN9A 1VRKA 1JFJA 2FJUB 2OS8C 4YGBB 4D1EA 1UWOA 3EK8A 1QTXA 4PHNA 3WNXB 4DCKA 2KI6D 4U8DA 1FI5A 3OX5A 4JWQA 1YUSA 5ER5A 1NP8A 4PCWA 3SIAA 3CWGA 1F4OA 1YX8A 1M45A 4CFQA 3F45A 3SIBA 2WORA 1CM4A 1BR4B 4MEWA 1YUTA 4NDCA 2ZRTA 5HLOA 2M7LA 2K0JA 3EK7A 2LP3A 3O6BA 1SCVA 1CDMA 2KSPA 2HF5A 3EVUA 1QATA 2G2BA 1M46A 1NCXA 1OOJA 3IQQA 3PSRA 3ZWHA 4CIDA 1JUOA 2WOSA 4YI9A 5I2QA 2WCEA 1F4QA 1YVLA 2KQYA 4TNCA 1SY9A 4MVFA 1DJWA 1OZOA 1X02A 1WDCC 2OTGC 2M1UA 1EG4A 3AKAA 1FW4A 1QXPA 4PALA 1CFCA 1MF8B 4YRUA 3JTDB 1U5IA 5KSZA 1NX2A 2MLEC 4DIRA 2NXQA 2BBNA 4CPVA 1ZFSA 2LANA 1TOPA 1QS7A 1A75A 1OMDA 1EH2A 1NWDA 2AAOA 1XFUO 1EL4A 1K9KA 1PULA 1HT9A 3KEVA 3I5IC 2MA2A 2LUXA 3FIAA 1LA3A 3PFVA 5D7FA 2COLB 1KK8B 1KQMB 1ALWA 1QX2A 2KDHA 1PVAA 5HKWA 4FQOA 3TUYB 2KYCA 4OV2A 4E68A 2BCBA 4MZJA 1K9UA 4ORAB 1GQMA 4MSPA 4OCIA 4N1GA 2BE6A 1ODBA 4ETOA 5B8IB 2I2RE 4PE7A 2LLSA 4YGEB 5AFPA 5JJGA 3BOWA 1M63B 2B1UA 3BUOB 4MN0A 4DS7A 2FOTA 1GGWA 3LK0A 2LVKA 3KF9A 1UHKA 3EKHA 2LNKA 5IBWA 5F6TA 1RROA 1DT7B 2JT0A 5I2OA 4P5OE 1A03A 3FWBA 2DOQA 4C0KA 2LHIA 1C07A 2KBMA 1F8HA 3O78A 2L51A 3BUMB 2I18A 4MLWA 1BODA 1CFFA 2L0PA 1PK0D 1IKUA 4P2YB 5HYDA 2BECA 1WRZA 2QACA 5D69A 4F0ZB 1NCZA 2MHHA 1DTLA 3BUWB 1DJZA 3I5HB 4A4CA 1DVIA 1JSAA 1CTRA 2JXLA 3SG7A 1SCMB 1XK4C 1CLBA 1H8BA 3OB2B 2PMYA 2D8NA 2EHBA 1SPYA 1IQ5A 4PHJA 4AQIA 3VGOA 2L4HA 1C7VA 1RECA 4GAOA 2K61A 1QVIZ 1JFKA 2P6BB 3GK2A 4MZLA 4I5NB 1MHOA 1Y1AA 2KAYA 2KHNA 2JT8A 2JU0A 1KWOB 2KQ6A 3M0WA 2MAZA 5HKZA 1WRLA 2LCPA 2HPSA 3OB1B 1BR1B 3WHUB 1UP5A 2GGZA 2Q91A 1IQ3A 1EJ3A 3PN7B 4PHMA 1DMOA 2H61C 1F71A 1B8RA 2L4IA 4M2QA 2KI6C 3QRXA 4ICBA 1BOCA 1WY9A 4R1EA 1QASA 2CNPA 1SL9A 1IG5A 1M39A 1BT6A 3CTNA 2JRFA 3AAJA 2L2EA 5I8NA 3H4SE 4DRWA 1OE9B 1ZUZA 1TTXA 3CGAA 3SG5A 1RK9A 1J55A 3VROA 1K8UA 4M2OA 1A2XA 1W7IB 1DJYA 5AXIA 1CFPA 1CKKA 3CLNA 1XYDA 1CLMA 1PSBA 2M7NA 3NSIA 1TNWA 3AAKA 4XYNA 1MWNA 4BY4A 3VRRA 1K96A 1CNPA 2ISDA 3LK1A 2LMTA 5CSIA 2JNFA 1B4CA 1KSMA 1NSHA 3VRPA 2SASA 2BCAA 1KQMC 4GGFC 2CCMA 2E30A 2KBIA 2PALA 3TUYC 1SR6B 4GPLB 1A4PA 1IH0A 2JZIA 1SBJA 1JC2A 1H4BA 2MLFC 1U5IB 2LM5A 3I5FB 1MUXA 2Y1MA 1XK4A 4MRXA 1YURA 3BXKA 1FF1A 1AUIB 1K9PA 3LLEA 3A8RA 3GK1A 1A75B 2NCOA 1Y0VH 1J7OA 1CB1A 2LP2A 4YBHB 2I7AA 1UHIA 1B47A 1BF5A 1YR5A 2F2PA 2FCDA 1AK8A 2L50A 1JBAA 3NSOA 2NCPA 2KGBC 3BUNB 2NLNA 1NCYA 2A4JA 1KFXL 1SYMA 3HX4A 2BL0B 1DGVA 1CDNA 4C0LA 2M1KB 4PDZA 5KTYA 2JPTA 2RGIA 4YGCB 2JXCA 2K7OA 3SJSA 1NX3A 1V1GA 3BOWB 2H61A 2F3YA 3LL8B 2OS8B 1MR8A 1IWQA 2Q4UA 1B7TY 1W7JB 3I5HC 4ORCB 2KGRA 1XA5A 2KAVA 1SCMC 1IRJA 1PVBA 1XFZO 1DJIA 2KFGA 2LHLA 1G4YR 3NSKA 4HRHA 1QLSA 1V1FA 1L2OC 1SW8A 1B8LA 1NX1A 2BE4A 3JVTB 1B8CA 3OX6A 1XFXO 4PHKA 1KWOC 4I5KA 2V53A 2K2AA 3BUXB 1E8AA 3TDIA 1XO5A 1LXFC 3E3RA 4FTGA 3EK4A 4PE4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I5J A;  2WCF A;  1BU3 A;  1G8I A;  1CMG A;  4YI8 A;  4ZCV A;  5CPV A;  2LVJ A;  5J3X A;  4BY5 A;  4GGF A;  2BKH B;  4HRE E;  1S6I A;  2PSR A;  3RM1 A;  1BMO A;  1RFJ A;  1NX0 A;  1QLK A;  1RTP 1;  2WND A;  1QV1 A;  3CR2 A;  1KSO A;  1YUU A;  1XFV O;  2ZKM X;  1IGV A;  3KO0 A;  4OKH A;  1S5G Y;  3DVM A;  1XFY O;  2LC5 A;  1ALV A;  1J7Q A;  1QX5 B;  3D0Y B;  3I5I B;  2PAS A;  1NUB A;  3FWC A;  1BG1 A;  1DF0 A;  1TNP A;  1FBV A;  1NPQ A;  1S36 A;  2OPO A;  4XJK B;  1K95 A;  2EGD A;  3IQO A;  1JF2 A;  2F3Z A;  4GNK B;  1K2H A;  1SK6 D;  2M29 A;  2KFF A;  1G33 A;  1M31 A;  1PAL A;  1FI6 A;  4NQG A;  4UPG A;  1B7T Z;  1OMR A;  3SG4 A;  1GJY A;  2ZFD A;  1QJT A;  5HKY A;  2CBL A;  2F33 A;  5GQQ C;  2M97 A;  1ZAC A;  2MJW B;  1S1E A;  2KI4 B;  2LE9 B;  1BJF A;  3SG3 A;  3GK4 X;  1A29 A;  1Y1X A;  3NSL A;  1SR6 C;  1J1D A;  4GFT A;  3BQ3 A;  2KOT A;  1AJ5 A;  4GGN A;  5CSJ A;  4C0J A;  1XFW O;  3C1V A;  1NIW A;  2TN4 A;  2LVI A;  2L5X B;  2SCP A;  3I5F C;  1N2D A;  2VRG A;  3CZT X;  1CDL A;  4DUQ A;  2E6W A;  3DF0 A;  4GUK A;  5JOL A;  3OP0 A;  1LVC D;  2M8U A;  1TNQ A;  4ORB B;  3LCP C;  3NXA A;  3VRN A;  1TRF A;  2JT3 A;  3JTD C;  3PM8 A;  1LIN A;  3TZ1 A;  5KU1 A;  1TCF A;  2JTZ A;  2JTT A;  2KFH A;  4NDB A;  3VRQ A;  2HET A;  3DVK A;  1LKJ A;  3TDZ A;  1R2U A;  1F55 A;  2EC6 B;  2K7C A;  2O5G A;  1KFU L;  3I5G B;  5DKQ A;  2BL0 C;  1BLQ A;  2LLT A;  1EXR A;  1KK7 Y;  3PAL A;  2LMV A;  5PAL A;  1TCO B;  1F54 A;  1KK8 C;  2M3W A;  1SKT A;  2JQ6 A;  1DJH A;  1CM1 A;  1MXE A;  3DD4 A;  2PRU A;  2HQW A;  2K7D A;  2LUC A;  2LVV A;  3K21 A;  3CR5 X;  1DJX A;  3O2P A;  1D1O A;  1UHJ A;  3TS5 B;  1S5G Z;  1CMF A;  2BBM A;  2K7B A;  4YGA A;  1YTZ C;  2F2O A;  4N1F A;  5DKR A;  5AEQ A;  2AMI A;  1WLZ A;  2MRD A;  1PSR A;  2LMU A;  1IJ6 A;  3JVT C;  1YX7 A;  4WRI A;  3TDU A;  1N0Y A;  4IL1 A;  2KNE A;  3IF7 A;  3HCM A;  2WCB A;  5TNC A;  2G9B A;  1ZOT B;  2WC8 A;  2M49 B;  1B1G A;  4WQ2 A;  2CTN A;  3PLF B;  2HQ8 A;  1WRK A;  3MSE B;  1FPW A;  3D10 A;  3FS7 A;  2KAX A;  5AAN A;  1UUS A;  4Q04 A;  1QX7 A;  4QJ5 B;  1S3P A;  1OQP A;  2Y4Q A;  2AUC A;  1SL8 A;  1KFU S;  1KQV A;  3GOF A;  1RJV A;  1TNX A;  2O60 A;  3CS1 A;  3DVE A;  1J7P A;  3OHM B;  2Y1N A;  1J1E A;  3AKB A;  5G08 A;  4L9M A;  1TIZ A;  1S6C A;  3EVR A;  2ZND A;  2H2K A;  2K8M B;  1CDP A;  1AP4 A;  1AJ4 A;  3A4U B;  1YRT B;  1NYA A;  1XVJ A;  2R2I A;  2MBX A;  1QVI Y;  5HLV A;  3WXA A;  5AER A;  4I5L B;  1GGZ A;  1K93 D;  1ZMZ A;  5CSF A;  2KYF A;  3KPX A;  1KK7 Z;  5DKN A;  1N65 A;  1UUR A;  1CFD A;  4MZK A;  2LAP A;  4JQ0 D;  4OR9 B;  4CFR A;  2NZ0 A;  2BCX A;  4NDD A;  3WHT B;  1F70 A;  2FCE A;  2JWW A;  3PN7 C;  2KI4 C;  4USL A;  4AQJ A;  1KFX S;  2F8P A;  1WDC B;  2OTG B;  2PVB A;  5I2L A;  1Y6W A;  4A4B A;  1R6P A;  2CXJ A;  4MRY A;  4ZCU A;  1DF0 B;  1OZS A;  3DVJ A;  2JUL A;  2JNX A;  1Y1U A;  2ZRS A;  4OVN F;  3O4Y A;  1QV0 A;  1RWY A;  2GV5 A;  1OMV A;  1KCY A;  1WLM A;  4QJ3 B;  1C7W A;  5FYX A;  1SL7 A;  1AVS A;  4YGD B;  2EC6 C;  3I5G C;  3BYA A;  5ER4 X;  1EG3 A;  2M0R A;  1QIV A;  3ICB A;  4GBA A;  5K89 A;  2ZN8 A;  1HQV A;  1K94 A;  2BKI B;  4AOM A;  1JWD A;  1SRA A;  3DF0 B;  1CLL A;  4WQ3 A;  1OSA A;  2CT9 A;  2K2F A;  1DJG A;  1Q80 A;  1L2O B;  1JF0 A;  2IS9 A;  3EVV A;  1SMG A;  3TS5 C;  1YRU B;  3SG6 A;  2LV7 A;  3ZNI A;  2L98 A;  1J7R A;  1LA0 A;  1AHR A;  2GGM A;  4N5X A;  3SG2 A;  4CLN A;  2QPT A;  2JOJ A;  1YVH A;  2M9G A;  5BPJ A;  4HRG A;  1B9A A;  1S26 D;  3RLZ A;  1IJ5 A;  1SNL A;  1UHH A;  4PE1 A;  1L7Z A;  1TN4 A;  5CSN A;  2ZNE A;  3CR4 X;  3D0Y A;  1UHN A;  4JPZ B;  1MXL C;  1MQ1 A;  1DGU A;  2LLU A;  3KHE A;  4PE0 A;  4XJK A;  1S6J A;  3EKJ A;  1K90 D;  1QIW A;  2I94 A;  2JC2 A;  3PAT A;  4MBE A;  4QJ4 B;  1PRW A;  4HSZ A;  2Y5I A;  4M2P A;  2ZN9 A;  1VRK A;  1JFJ A;  2FJU B;  2OS8 C;  4YGB B;  4D1E A;  1UWO A;  3EK8 A;  1QTX A;  4PHN A;  3WNX B;  4DCK A;  2KI6 D;  4U8D A;  1FI5 A;  3OX5 A;  4JWQ A;  1YUS A;  5ER5 A;  1NP8 A;  4PCW A;  3SIA A;  3CWG A;  1F4O A;  1YX8 A;  1M45 A;  4CFQ A;  3F45 A;  3SIB A;  2WOR A;  1CM4 A;  1BR4 B;  4MEW A;  1YUT A;  4NDC A;  2ZRT A;  5HLO A;  2M7L A;  2K0J A;  3EK7 A;  2LP3 A;  3O6B A;  1SCV A;  1CDM A;  2KSP A;  2HF5 A;  3EVU A;  1QAT A;  2G2B A;  1M46 A;  1NCX A;  1OOJ A;  3IQQ A;  3PSR A;  3ZWH A;  4CID A;  1JUO A;  2WOS A;  4YI9 A;  5I2Q A;  2WCE A;  1F4Q A;  1YVL A;  2KQY A;  4TNC A;  1SY9 A;  4MVF A;  1DJW A;  1OZO A;  1X02 A;  1WDC C;  2OTG C;  2M1U A;  1EG4 A;  3AKA A;  1FW4 A;  1QXP A;  4PAL A;  1CFC A;  1MF8 B;  4YRU A;  3JTD B;  1U5I A;  5KSZ A;  1NX2 A;  2MLE C;  4DIR A;  2NXQ A;  2BBN A;  4CPV A;  1ZFS A;  2LAN A;  1TOP A;  1QS7 A;  1A75 A;  1OMD A;  1EH2 A;  1NWD A;  2AAO A;  1XFU O;  1EL4 A;  1K9K A;  1PUL A;  1HT9 A;  3KEV A;  3I5I C;  2MA2 A;  2LUX A;  3FIA A;  1LA3 A;  3PFV A;  5D7F A;  2COL B;  1KK8 B;  1KQM B;  1ALW A;  1QX2 A;  2KDH A;  1PVA A;  5HKW A;  4FQO A;  3TUY B;  2KYC A;  4OV2 A;  4E68 A;  2BCB A;  4MZJ A;  1K9U A;  4ORA B;  1GQM A;  4MSP A;  4OCI A;  4N1G A;  2BE6 A;  1ODB A;  4ETO A;  5B8I B;  2I2R E;  4PE7 A;  2LLS A;  4YGE B;  5AFP A;  5JJG A;  3BOW A;  1M63 B;  2B1U A;  3BUO B;  4MN0 A;  4DS7 A;  2FOT A;  1GGW A;  3LK0 A;  2LVK A;  3KF9 A;  1UHK A;  3EKH A;  2LNK A;  5IBW A;  5F6T A;  1RRO A;  1DT7 B;  2JT0 A;  5I2O A;  4P5O E;  1A03 A;  3FWB A;  2DOQ A;  4C0K A;  2LHI A;  1C07 A;  2KBM A;  1F8H A;  3O78 A;  2L51 A;  3BUM B;  2I18 A;  4MLW A;  1BOD A;  1CFF A;  2L0P A;  1PK0 D;  1IKU A;  4P2Y B;  5HYD A;  2BEC A;  1WRZ A;  2QAC A;  5D69 A;  4F0Z B;  1NCZ A;  2MHH A;  1DTL A;  3BUW B;  1DJZ A;  3I5H B;  4A4C A;  1DVI A;  1JSA A;  1CTR A;  2JXL A;  3SG7 A;  1SCM B;  1XK4 C;  1CLB A;  1H8B A;  3OB2 B;  2PMY A;  2D8N A;  2EHB A;  1SPY A;  1IQ5 A;  4PHJ A;  4AQI A;  3VGO A;  2L4H A;  1C7V A;  1REC A;  4GAO A;  2K61 A;  1QVI Z;  1JFK A;  2P6B B;  3GK2 A;  4MZL A;  4I5N B;  1MHO A;  1Y1A A;  2KAY A;  2KHN A;  2JT8 A;  2JU0 A;  1KWO B;  2KQ6 A;  3M0W A;  2MAZ A;  5HKZ A;  1WRL A;  2LCP A;  2HPS A;  3OB1 B;  1BR1 B;  3WHU B;  1UP5 A;  2GGZ A;  2Q91 A;  1IQ3 A;  1EJ3 A;  3PN7 B;  4PHM A;  1DMO A;  2H61 C;  1F71 A;  1B8R A;  2L4I A;  4M2Q A;  2KI6 C;  3QRX A;  4ICB A;  1BOC A;  1WY9 A;  4R1E A;  1QAS A;  2CNP A;  1SL9 A;  1IG5 A;  1M39 A;  1BT6 A;  3CTN A;  2JRF A;  3AAJ A;  2L2E A;  5I8N A;  3H4S E;  4DRW A;  1OE9 B;  1ZUZ A;  1TTX A;  3CGA A;  3SG5 A;  1RK9 A;  1J55 A;  3VRO A;  1K8U A;  4M2O A;  1A2X A;  1W7I B;  1DJY A;  5AXI A;  1CFP A;  1CKK A;  3CLN A;  1XYD A;  1CLM A;  1PSB A;  2M7N A;  3NSI A;  1TNW A;  3AAK A;  4XYN A;  1MWN A;  4BY4 A;  3VRR A;  1K96 A;  1CNP A;  2ISD A;  3LK1 A;  2LMT A;  5CSI A;  2JNF A;  1B4C A;  1KSM A;  1NSH A;  3VRP A;  2SAS A;  2BCA A;  1KQM C;  4GGF C;  2CCM A;  2E30 A;  2KBI A;  2PAL A;  3TUY C;  1SR6 B;  4GPL B;  1A4P A;  1IH0 A;  2JZI A;  1SBJ A;  1JC2 A;  1H4B A;  2MLF C;  1U5I B;  2LM5 A;  3I5F B;  1MUX A;  2Y1M A;  1XK4 A;  4MRX A;  1YUR A;  3BXK A;  1FF1 A;  1AUI B;  1K9P A;  3LLE A;  3A8R A;  3GK1 A;  1A75 B;  2NCO A;  1Y0V H;  1J7O A;  1CB1 A;  2LP2 A;  4YBH B;  2I7A A;  1UHI A;  1B47 A;  1BF5 A;  1YR5 A;  2F2P A;  2FCD A;  1AK8 A;  2L50 A;  1JBA A;  3NSO A;  2NCP A;  2KGB C;  3BUN B;  2NLN A;  1NCY A;  2A4J A;  1KFX L;  1SYM A;  3HX4 A;  2BL0 B;  1DGV A;  1CDN A;  4C0L A;  2M1K B;  4PDZ A;  5KTY A;  2JPT A;  2RGI A;  4YGC B;  2JXC A;  2K7O A;  3SJS A;  1NX3 A;  1V1G A;  3BOW B;  2H61 A;  2F3Y A;  3LL8 B;  2OS8 B;  1MR8 A;  1IWQ A;  2Q4U A;  1B7T Y;  1W7J B;  3I5H C;  4ORC B;  2KGR A;  1XA5 A;  2KAV A;  1SCM C;  1IRJ A;  1PVB A;  1XFZ O;  1DJI A;  2KFG A;  2LHL A;  1G4Y R;  3NSK A;  4HRH A;  1QLS A;  1V1F A;  1L2O C;  1SW8 A;  1B8L A;  1NX1 A;  2BE4 A;  3JVT B;  1B8C A;  3OX6 A;  1XFX O;  4PHK A;  1KWO C;  4I5K A;  2V53 A;  2K2A A;  3BUX B;  1E8A A;  3TDI A;  1XO5 A;  1LXF C;  3E3R A;  4FTG A;  3EK4 A;  4PE4 A; 
#chains in the Genus database with same CATH topology
 4I5J A;  2WCF A;  1BU3 A;  1G8I A;  3OGN A;  1CMG A;  4YI8 A;  4ZCV A;  5CPV A;  2LVJ A;  5J3X A;  4BY5 A;  4GGF A;  2BKH B;  4HRE E;  1S6I A;  2P71 A;  2PSR A;  3RM1 A;  1BMO A;  1OOG A;  1RFJ A;  1NX0 A;  1QLK A;  1RTP 1;  2WND A;  3UNW A;  1ORG A;  1QV1 A;  3CR2 A;  1KSO A;  1YUU A;  1XFV O;  2ZKM X;  1IGV A;  3KO0 A;  4OKH A;  1S5G Y;  3NGV A;  3DVM A;  1XFY O;  2LC5 A;  1ALV A;  1J7Q A;  1QX5 B;  3D0Y B;  1IIO A;  3I5I B;  2PAS A;  1NUB A;  2QEH A;  3FWC A;  1DF0 A;  1TNP A;  1FBV A;  1BG1 A;  1NPQ A;  1S36 A;  2OPO A;  4XJK B;  1K95 A;  1QWV A;  2EGD A;  3IQO A;  1JF2 A;  2F3Z A;  4GNK B;  1K2H A;  1SK6 D;  2M29 A;  2KFF A;  1G33 A;  1M31 A;  1PAL A;  1FI6 A;  4NQG A;  3CYZ A;  3SS5 A;  1B7T Z;  1OMR A;  3SG4 A;  1GJY A;  2ZFD A;  1QJT A;  4UPG A;  2CBL A;  2F33 A;  3CDN A;  5HKY A;  5GQQ C;  2M97 A;  1ZAC A;  2MJW B;  1S1E A;  2KI4 B;  2LE9 B;  1BJF A;  3S0G A;  3SG3 A;  3GK4 X;  1A29 A;  1Y1X A;  3CZ2 A;  3NSL A;  1SR6 C;  1J1D A;  4GFT A;  3BQ3 A;  2KOT A;  1AJ5 A;  4GGN A;  5CSJ A;  3SS4 A;  4C0J A;  1XFW O;  3C1V A;  1NIW A;  2TN4 A;  2LVI A;  2L5X B;  2SCP A;  3I5F C;  1N2D A;  2VRG A;  3CZT X;  1CDL A;  4DUQ A;  2E6W A;  3DF0 A;  4GUK A;  5JOL A;  3OP0 A;  1LVC D;  2M8U A;  3D77 A;  2QEO A;  1TNQ A;  4ORB B;  3LCP C;  4KYN A;  3NXA A;  3VRN A;  1TRF A;  2JT3 A;  3JTD C;  3PM8 A;  1LIN A;  3TZ1 A;  3R1O A;  1TCF A;  2JTZ A;  2JTT A;  5HL1 A;  5KU1 A;  2KFH A;  4NDB A;  3VRQ A;  3FE6 A;  2HET A;  3DVK A;  1LKJ A;  4JD9 A;  3TDZ A;  1R2U A;  3PM2 A;  3D74 A;  2EC6 B;  1F55 A;  2K7C A;  2O5G A;  1KFU L;  2ERB A;  3I5G B;  5DKQ A;  2BL0 C;  3PJI A;  1BLQ A;  2LLT A;  1EXR A;  1KK7 Y;  3PAL A;  2LMV A;  5PAL A;  1TCO B;  1F54 A;  1KK8 C;  2M3W A;  1SKT A;  2JQ6 A;  1OOH A;  1DJH A;  1CM1 A;  1MXE A;  3DD4 A;  2PRU A;  3QME A;  2HQW A;  2K7D A;  2LUC A;  2LVV A;  3K21 A;  1Z2C B;  3CR5 X;  1DJX A;  3O2P A;  1D1O A;  1UHJ A;  2PQL A;  3TS5 B;  3RZS A;  1OOF A;  1S5G Z;  1CMF A;  2BBM A;  2K7B A;  4YGA A;  1YTZ C;  2F2O A;  3NHT A;  4N1F A;  5DKR A;  5AEQ A;  2AMI A;  1WLZ A;  2MRD A;  1PSR A;  2LMU A;  1IJ6 A;  3JVT C;  1YX7 A;  4WRI A;  3TDU A;  5FI6 A;  1N0Y A;  3DY9 A;  4IL1 A;  2KNE A;  3IF7 A;  3HCM A;  2WCB A;  5TNC A;  2G9B A;  1ZOT B;  2WC8 A;  2M49 B;  1B1G A;  4WQ2 A;  2CTN A;  3PLF B;  2HQ8 A;  3BFA A;  1WRK A;  3MSE B;  5I94 A;  1FPW A;  3D10 A;  3FS7 A;  2KAX A;  5AAN A;  1UUS A;  4Q04 A;  1QX7 A;  4QJ5 B;  1S3P A;  1OQP A;  3D73 A;  2Y4Q A;  1SL8 A;  2AUC A;  1KFU S;  1KQV A;  3GOF A;  1RJV A;  1TNX A;  2O60 A;  3CS1 A;  3DVE A;  1J7P A;  3OHM B;  3D76 A;  2Y1N A;  1J1E A;  3AKB A;  5G08 A;  4L9M A;  1TIZ A;  1S6C A;  1P28 A;  2K60 A;  3EVR A;  2ZND A;  2H2K A;  2K8M B;  4INW A;  1CDP A;  1AP4 A;  1AJ4 A;  3A4U B;  1YRT B;  1NYA A;  1XVJ A;  2R2I A;  3R1V A;  1QVI Y;  5HLV A;  2MBX A;  3WXA A;  5AER A;  4I5L B;  1GGZ A;  1K93 D;  1ZMZ A;  5CSF A;  2KYF A;  3KPX A;  1KK7 Z;  5DKN A;  1N65 A;  1UUR A;  1CFD A;  3B88 A;  4MZK A;  2LAP A;  4JQ0 D;  4OR9 B;  4CFR A;  2NZ0 A;  2BCX A;  4NDD A;  3WHT B;  1F70 A;  2WCJ A;  2FCE A;  2JWW A;  3PN7 C;  2KI4 C;  4USL A;  4AQJ A;  1GM0 A;  1KFX S;  3O4X A;  2F8P A;  1WDC B;  2OTG B;  2PVB A;  5I2L A;  1Y6W A;  4A4B A;  1R6P A;  2CXJ A;  4MRY A;  4ZCU A;  1DF0 B;  1OZS A;  3DVJ A;  2JUL A;  1DC1 A;  2JNX A;  1Y1U A;  2ZRS A;  4OVN F;  3O4Y A;  1QV0 A;  1RWY A;  2GV5 A;  1OMV A;  4PT1 A;  1KCY A;  1WLM A;  4QJ3 B;  1C7W A;  5FYX A;  1SL7 A;  1AVS A;  4YGD B;  3IVT A;  2EC6 C;  3I5G C;  3BYA A;  5ER4 X;  1EG3 A;  3DZT A;  2M0R A;  1QIV A;  3ICB A;  4GBA A;  5K89 A;  2ZN8 A;  1HQV A;  1K94 A;  2BKI B;  4AOM A;  1JWD A;  1SRA A;  3DF0 B;  1CLL A;  4WQ3 A;  1OSA A;  2CT9 A;  2K2F A;  5FI2 A;  1DJG A;  1Q80 A;  1L2O B;  1JF0 A;  2IS9 A;  1TWO A;  3EVV A;  1SMG A;  3R72 A;  3TS5 C;  1YRU B;  3SG6 A;  2LV7 A;  3ZNI A;  2L98 A;  1J7R A;  3B87 A;  1LA0 A;  1AHR A;  2GGM A;  4N5X A;  3SG2 A;  4CLN A;  2QPT A;  2WCL A;  2JOJ A;  4OZD A;  1YVH A;  2M9G A;  5BPJ A;  4HRG A;  1B9A A;  1S26 D;  3RLZ A;  1IJ5 A;  1SNL A;  1UHH A;  4PE1 A;  1L7Z A;  1TN4 A;  5CSN A;  2ZNE A;  3D78 A;  3CR4 X;  2WC6 A;  3D0Y A;  1UHN A;  4JPZ B;  1MXL C;  1MQ1 A;  1DGU A;  2LLU A;  3KHE A;  4PE0 A;  4XJK A;  3NHI A;  1S6J A;  3EKJ A;  1K90 D;  1QIW A;  2I94 A;  2JC2 A;  3PAT A;  4MBE A;  4QJ4 B;  1PRW A;  4HSZ A;  5FI7 A;  1T14 A;  2GTE A;  2Y5I A;  4M2P A;  2ZN9 A;  1VRK A;  1JFJ A;  2FJU B;  2OS8 C;  4YGB B;  4D1E A;  1UWO A;  3EK8 A;  1QTX A;  4PHN A;  3WNX B;  4DCK A;  2KI6 D;  4U8D A;  1FI5 A;  3OX5 A;  4JWQ A;  1YUS A;  5ER5 A;  1NP8 A;  3CZ0 A;  4PCW A;  3UO9 A;  3SIA A;  3CWG A;  1F4O A;  1YX8 A;  1M45 A;  4CFQ A;  3F45 A;  1DEL A;  4INX A;  1Z4H A;  2WOR A;  3SIB A;  1CM4 A;  1BR4 B;  4MEW A;  1YUT A;  4NDC A;  2ZRT A;  5HLO A;  2M7L A;  2K0J A;  3EK7 A;  2LP3 A;  3DXL A;  3O6B A;  1SCV A;  1CDM A;  2KSP A;  2HF5 A;  3EVU A;  1QAT A;  2G2B A;  1M46 A;  1NCX A;  1OOJ A;  3DYE A;  3IQQ A;  3PSR A;  3ZWH A;  1JUO A;  2FJY A;  2WOS A;  4YI9 A;  4CID A;  2WCE A;  5I2Q A;  1F4Q A;  1YVL A;  2KQY A;  4TNC A;  1SY9 A;  4MVF A;  1C3Z A;  1DJW A;  1OZO A;  4FQT A;  1X02 A;  1WDC C;  2KLE A;  3S0E A;  2OTG C;  2M1U A;  1EG4 A;  2WC5 A;  1FW4 A;  1QXP A;  3AKA A;  4PAL A;  1MF8 B;  5DIC A;  4YRU A;  1CFC A;  3JTD B;  1U5I A;  5KSZ A;  3V2L A;  1NX2 A;  2MLE C;  4DIR A;  2NXQ A;  3FE9 A;  2BBN A;  4CPV A;  2P70 A;  1ZFS A;  2LAN A;  1TOP A;  1QS7 A;  1A75 A;  1OMD A;  1EH2 A;  1DQE A;  1NWD A;  3L4A A;  3EG5 B;  2AAO A;  1XFU O;  1EL4 A;  1K9K A;  3R1P A;  1PUL A;  1HT9 A;  3KEV A;  3I5I C;  2MA2 A;  2LUX A;  3FIA A;  1LA3 A;  3CAB A;  3PFV A;  2COL B;  1KK8 B;  1KQM B;  1ALW A;  1QX2 A;  2KDH A;  1PVA A;  5HKW A;  4FQO A;  3TUY B;  2KYC A;  4OV2 A;  4E68 A;  2BCB A;  4MZJ A;  1K9U A;  4ORA B;  1GQM A;  4MSP A;  4OCI A;  4N1G A;  2BE6 A;  1ODB A;  3FE8 A;  4ETO A;  5B8I B;  2I2R E;  4PE7 A;  2LLS A;  4YGE B;  5AFP A;  5JJG A;  3BOW A;  1M63 B;  2B1U A;  3BUO B;  4MN0 A;  4DS7 A;  3BFB A;  2FOT A;  1GGW A;  3LK0 A;  2LVK A;  3KF9 A;  1UHK A;  3EKH A;  2LNK A;  5IBW A;  3Q8I A;  5F6T A;  1RRO A;  1DT7 B;  2JT0 A;  5I2O A;  4P5O E;  1A03 A;  3FWB A;  2DOQ A;  4C0K A;  2LHI A;  1C07 A;  2KBM A;  1F8H A;  1TUZ A;  2L51 A;  3BUM B;  2I18 A;  3O78 A;  4MLW A;  1BOD A;  1CFF A;  2L0P A;  1PK0 D;  1IKU A;  4P2Y B;  5HYD A;  2BEC A;  1WRZ A;  2QAC A;  5D69 A;  4F0Z B;  1NCZ A;  2MHH A;  1DTL A;  2WCH A;  2BNX A;  3BUW B;  1DJZ A;  3I5H B;  4A4C A;  1DVI A;  3OBV A;  1JSA A;  1CTR A;  2JXL A;  3SG7 A;  1SCM B;  1XK4 C;  1CLB A;  1H8B A;  3OB2 B;  2PMY A;  2D8N A;  2EHB A;  4IJ7 A;  1SPY A;  1IQ5 A;  4PHJ A;  4AQI A;  3VGO A;  1SSE B;  2L4H A;  1C7V A;  1REC A;  1LS8 A;  2K61 A;  1QVI Z;  2PYQ A;  1JFK A;  2P6B B;  3D75 A;  3B7A A;  4GAO A;  3GK2 A;  4MZL A;  3S0B A;  4I5N B;  1MHO A;  1Y1A A;  2KAY A;  2KHN A;  2JT8 A;  2JU0 A;  1KWO B;  2KQ6 A;  3K1E A;  3M0W A;  3L4L A;  2MAZ A;  5HKZ A;  1WRL A;  2LCP A;  2HPS A;  2KLD A;  1BR1 B;  3OB1 B;  1UP5 A;  3WHU B;  2GGZ A;  2Q91 A;  3SS3 A;  1IQ3 A;  1EJ3 A;  3PN7 B;  4PHM A;  1C3Y A;  2H61 C;  1DMO A;  1F71 A;  1B8R A;  1TUJ A;  2L4I A;  4M2Q A;  2KI6 C;  3QRX A;  4ICB A;  1BOC A;  2WCK A;  1WY9 A;  4R1E A;  1QAS A;  2CNP A;  1SL9 A;  1IG5 A;  1M39 A;  5D3O A;  1BT6 A;  3CTN A;  2JRF A;  1OW4 A;  3AAJ A;  2H8V A;  2L2E A;  5I8N A;  3H4S E;  2QEV A;  4DRW A;  1OE9 B;  1ZUZ A;  1TTX A;  3CGA A;  3SG5 A;  1RK9 A;  1J55 A;  3VRO A;  1K8U A;  4M2O A;  1A2X A;  3BJH A;  3CZ1 A;  1W7I B;  1DJY A;  5AXI A;  1CFP A;  1CKK A;  3CLN A;  1XYD A;  1CLM A;  1PSB A;  2M7N A;  3B86 A;  1TNW A;  3AAK A;  3N7H A;  3NSI A;  4XYN A;  1MWN A;  4BY4 A;  3VRR A;  1K96 A;  1CNP A;  2ISD A;  3LK1 A;  2LMT A;  5CSI A;  2JNF A;  1B4C A;  1KSM A;  1NSH A;  2L5Y A;  3VRP A;  2SAS A;  2BCA A;  1KQM C;  4GGF C;  2CCM A;  2E30 A;  2KBI A;  2YGU A;  2PAL A;  3TUY C;  1SR6 B;  4GPL B;  1A4P A;  2JPO A;  1IH0 A;  2QEB A;  2JZI A;  1SBJ A;  1JC2 A;  1H4B A;  2MLF C;  1U5I B;  2KPH A;  2LM5 A;  5D7F A;  3I5F B;  2QDI A;  1MUX A;  2Y1M A;  1XK4 A;  3S0F A;  4MRX A;  1YUR A;  3BXK A;  1FF1 A;  2BAP A;  1AUI B;  1K9P A;  3LLE A;  3A8R A;  3GK1 A;  1A75 B;  2NCO A;  1Y0V H;  1J7O A;  1CB1 A;  2LP2 A;  4YBH B;  2I7A A;  5EL2 A;  1UHI A;  1B47 A;  1BF5 A;  1YR5 A;  2F2P A;  2FCD A;  1AK8 A;  1OOI X;  2L50 A;  1JBA A;  3NSO A;  2NCP A;  2KGB C;  3BUN B;  2NLN A;  1NCY A;  2A4J A;  1KFX L;  1DEK A;  1SYM A;  3HX4 A;  2BL0 B;  3VB1 A;  1DGV A;  1CDN A;  4C0L A;  2M1K B;  4PDZ A;  5KTY A;  2JPT A;  2RGI A;  4YGC B;  2JXC A;  2K7O A;  3SJS A;  1NX3 A;  1V1G A;  3BOW B;  2H61 A;  2F3Y A;  3LL8 B;  2OS8 B;  1MR8 A;  1IWQ A;  2Q4U A;  1B7T Y;  1W7J B;  3I5H C;  4ORC B;  2KGR A;  3S0D A;  1XA5 A;  2KAV A;  2WCM A;  1SCM C;  1IRJ A;  3B6X A;  1PVB A;  3S0A A;  1XFZ O;  1DJI A;  2KFG A;  2LHL A;  1G4Y R;  3L47 A;  3NSK A;  4HRH A;  1QLS A;  1V1F A;  1L2O C;  2L2C A;  1SW8 A;  1B8L A;  1NX1 A;  2BE4 A;  3JVT B;  1B8C A;  4JKT A;  3OX6 A;  1W9Z A;  1XFX O;  4PHK A;  1KWO C;  4I5K A;  2V53 A;  3BFH A;  2K2A A;  3BUX B;  1E8A A;  3TDI A;  1XO5 A;  1LXF C;  1XFR A;  3E3R A;  4F7F A;  4FTG A;  3EK4 A;  4PE4 A; 
#chains in the Genus database with same CATH homology
 4I5J A;  2WCF A;  1BU3 A;  1G8I A;  1CMG A;  4YI8 A;  4ZCV A;  5CPV A;  2LVJ A;  5J3X A;  4BY5 A;  4GGF A;  2BKH B;  4HRE E;  1S6I A;  2PSR A;  3RM1 A;  1BMO A;  1RFJ A;  1NX0 A;  1QLK A;  1RTP 1;  2WND A;  1QV1 A;  3CR2 A;  1KSO A;  1YUU A;  1XFV O;  2ZKM X;  1IGV A;  3KO0 A;  4OKH A;  1S5G Y;  3DVM A;  1XFY O;  2LC5 A;  1ALV A;  1J7Q A;  1QX5 B;  3D0Y B;  3I5I B;  2PAS A;  1NUB A;  3FWC A;  1BG1 A;  1DF0 A;  1TNP A;  1FBV A;  1NPQ A;  1S36 A;  2OPO A;  4XJK B;  1K95 A;  2EGD A;  3IQO A;  1JF2 A;  2F3Z A;  4GNK B;  1K2H A;  1SK6 D;  2M29 A;  2KFF A;  1G33 A;  1M31 A;  1PAL A;  1FI6 A;  4NQG A;  4UPG A;  1B7T Z;  1OMR A;  3SG4 A;  1GJY A;  2ZFD A;  1QJT A;  5HKY A;  2CBL A;  2F33 A;  5GQQ C;  2M97 A;  1ZAC A;  2MJW B;  1S1E A;  2KI4 B;  2LE9 B;  1BJF A;  3SG3 A;  3GK4 X;  1A29 A;  1Y1X A;  3NSL A;  1SR6 C;  1J1D A;  4GFT A;  3BQ3 A;  2KOT A;  1AJ5 A;  4GGN A;  5CSJ A;  4C0J A;  1XFW O;  3C1V A;  1NIW A;  2TN4 A;  2LVI A;  2L5X B;  2SCP A;  3I5F C;  1N2D A;  2VRG A;  3CZT X;  1CDL A;  4DUQ A;  2E6W A;  3DF0 A;  4GUK A;  5JOL A;  3OP0 A;  1LVC D;  2M8U A;  1TNQ A;  4ORB B;  3LCP C;  3NXA A;  3VRN A;  1TRF A;  2JT3 A;  3JTD C;  3PM8 A;  1LIN A;  3TZ1 A;  5KU1 A;  1TCF A;  2JTZ A;  2JTT A;  2KFH A;  4NDB A;  3VRQ A;  2HET A;  3DVK A;  1LKJ A;  3TDZ A;  1R2U A;  1F55 A;  2EC6 B;  2K7C A;  2O5G A;  1KFU L;  3I5G B;  5DKQ A;  2BL0 C;  1BLQ A;  2LLT A;  1EXR A;  1KK7 Y;  3PAL A;  2LMV A;  5PAL A;  1TCO B;  1F54 A;  1KK8 C;  2M3W A;  1SKT A;  2JQ6 A;  1DJH A;  1CM1 A;  1MXE A;  3DD4 A;  2PRU A;  2HQW A;  2K7D A;  2LUC A;  2LVV A;  3K21 A;  3CR5 X;  1DJX A;  3O2P A;  1D1O A;  1UHJ A;  3TS5 B;  1S5G Z;  1CMF A;  2BBM A;  2K7B A;  4YGA A;  1YTZ C;  2F2O A;  4N1F A;  5DKR A;  5AEQ A;  2AMI A;  1WLZ A;  2MRD A;  1PSR A;  2LMU A;  1IJ6 A;  3JVT C;  1YX7 A;  4WRI A;  3TDU A;  1N0Y A;  4IL1 A;  2KNE A;  3IF7 A;  3HCM A;  2WCB A;  5TNC A;  2G9B A;  1ZOT B;  2WC8 A;  2M49 B;  1B1G A;  4WQ2 A;  2CTN A;  3PLF B;  2HQ8 A;  1WRK A;  3MSE B;  1FPW A;  3D10 A;  3FS7 A;  2KAX A;  5AAN A;  1UUS A;  4Q04 A;  1QX7 A;  4QJ5 B;  1S3P A;  1OQP A;  2Y4Q A;  2AUC A;  1SL8 A;  1KFU S;  1KQV A;  3GOF A;  1RJV A;  1TNX A;  2O60 A;  3CS1 A;  3DVE A;  1J7P A;  3OHM B;  2Y1N A;  1J1E A;  3AKB A;  5G08 A;  4L9M A;  1TIZ A;  1S6C A;  3EVR A;  2ZND A;  2H2K A;  2K8M B;  1CDP A;  1AP4 A;  1AJ4 A;  3A4U B;  1YRT B;  1NYA A;  1XVJ A;  2R2I A;  2MBX A;  1QVI Y;  5HLV A;  3WXA A;  5AER A;  4I5L B;  1GGZ A;  1K93 D;  1ZMZ A;  5CSF A;  2KYF A;  3KPX A;  1KK7 Z;  5DKN A;  1N65 A;  1UUR A;  1CFD A;  4MZK A;  2LAP A;  4JQ0 D;  4OR9 B;  4CFR A;  2NZ0 A;  2BCX A;  4NDD A;  3WHT B;  1F70 A;  2FCE A;  2JWW A;  3PN7 C;  2KI4 C;  4USL A;  4AQJ A;  1KFX S;  2F8P A;  1WDC B;  2OTG B;  2PVB A;  5I2L A;  1Y6W A;  4A4B A;  1R6P A;  2CXJ A;  4MRY A;  4ZCU A;  1DF0 B;  1OZS A;  3DVJ A;  2JUL A;  2JNX A;  1Y1U A;  2ZRS A;  4OVN F;  3O4Y A;  1QV0 A;  1RWY A;  2GV5 A;  1OMV A;  1KCY A;  1WLM A;  4QJ3 B;  1C7W A;  5FYX A;  1SL7 A;  1AVS A;  4YGD B;  2EC6 C;  3I5G C;  3BYA A;  5ER4 X;  1EG3 A;  2M0R A;  1QIV A;  3ICB A;  4GBA A;  5K89 A;  2ZN8 A;  1HQV A;  1K94 A;  2BKI B;  4AOM A;  1JWD A;  1SRA A;  3DF0 B;  1CLL A;  4WQ3 A;  1OSA A;  2CT9 A;  2K2F A;  1DJG A;  1Q80 A;  1L2O B;  1JF0 A;  2IS9 A;  3EVV A;  1SMG A;  3TS5 C;  1YRU B;  3SG6 A;  2LV7 A;  3ZNI A;  2L98 A;  1J7R A;  1LA0 A;  1AHR A;  2GGM A;  4N5X A;  3SG2 A;  4CLN A;  2QPT A;  2JOJ A;  1YVH A;  2M9G A;  5BPJ A;  4HRG A;  1B9A A;  1S26 D;  3RLZ A;  1IJ5 A;  1SNL A;  1UHH A;  4PE1 A;  1L7Z A;  1TN4 A;  5CSN A;  2ZNE A;  3CR4 X;  3D0Y A;  1UHN A;  4JPZ B;  1MXL C;  1MQ1 A;  1DGU A;  2LLU A;  3KHE A;  4PE0 A;  4XJK A;  1S6J A;  3EKJ A;  1K90 D;  1QIW A;  2I94 A;  2JC2 A;  3PAT A;  4MBE A;  4QJ4 B;  1PRW A;  4HSZ A;  2Y5I A;  4M2P A;  2ZN9 A;  1VRK A;  1JFJ A;  2FJU B;  2OS8 C;  4YGB B;  4D1E A;  1UWO A;  3EK8 A;  1QTX A;  4PHN A;  3WNX B;  4DCK A;  2KI6 D;  4U8D A;  1FI5 A;  3OX5 A;  4JWQ A;  1YUS A;  5ER5 A;  1NP8 A;  4PCW A;  3SIA A;  3CWG A;  1F4O A;  1YX8 A;  1M45 A;  4CFQ A;  3F45 A;  3SIB A;  2WOR A;  1CM4 A;  1BR4 B;  4MEW A;  1YUT A;  4NDC A;  2ZRT A;  5HLO A;  2M7L A;  2K0J A;  3EK7 A;  2LP3 A;  3O6B A;  1SCV A;  1CDM A;  2KSP A;  2HF5 A;  3EVU A;  1QAT A;  2G2B A;  1M46 A;  1NCX A;  1OOJ A;  3IQQ A;  3PSR A;  3ZWH A;  4CID A;  1JUO A;  2WOS A;  4YI9 A;  5I2Q A;  2WCE A;  1F4Q A;  1YVL A;  2KQY A;  4TNC A;  1SY9 A;  4MVF A;  1DJW A;  1OZO A;  1X02 A;  1WDC C;  2OTG C;  2M1U A;  1EG4 A;  3AKA A;  1FW4 A;  1QXP A;  4PAL A;  1CFC A;  1MF8 B;  4YRU A;  3JTD B;  1U5I A;  5KSZ A;  1NX2 A;  2MLE C;  4DIR A;  2NXQ A;  2BBN A;  4CPV A;  1ZFS A;  2LAN A;  1TOP A;  1QS7 A;  1A75 A;  1OMD A;  1EH2 A;  1NWD A;  2AAO A;  1XFU O;  1EL4 A;  1K9K A;  1PUL A;  1HT9 A;  3KEV A;  3I5I C;  2MA2 A;  2LUX A;  3FIA A;  1LA3 A;  3PFV A;  5D7F A;  2COL B;  1KK8 B;  1KQM B;  1ALW A;  1QX2 A;  2KDH A;  1PVA A;  5HKW A;  4FQO A;  3TUY B;  2KYC A;  4OV2 A;  4E68 A;  2BCB A;  4MZJ A;  1K9U A;  4ORA B;  1GQM A;  4MSP A;  4OCI A;  4N1G A;  2BE6 A;  1ODB A;  4ETO A;  5B8I B;  2I2R E;  4PE7 A;  2LLS A;  4YGE B;  5AFP A;  5JJG A;  3BOW A;  1M63 B;  2B1U A;  3BUO B;  4MN0 A;  4DS7 A;  2FOT A;  1GGW A;  3LK0 A;  2LVK A;  3KF9 A;  1UHK A;  3EKH A;  2LNK A;  5IBW A;  5F6T A;  1RRO A;  1DT7 B;  2JT0 A;  5I2O A;  4P5O E;  1A03 A;  3FWB A;  2DOQ A;  4C0K A;  2LHI A;  1C07 A;  2KBM A;  1F8H A;  3O78 A;  2L51 A;  3BUM B;  2I18 A;  4MLW A;  1BOD A;  1CFF A;  2L0P A;  1PK0 D;  1IKU A;  4P2Y B;  5HYD A;  2BEC A;  1WRZ A;  2QAC A;  5D69 A;  4F0Z B;  1NCZ A;  2MHH A;  1DTL A;  3BUW B;  1DJZ A;  3I5H B;  4A4C A;  1DVI A;  1JSA A;  1CTR A;  2JXL A;  3SG7 A;  1SCM B;  1XK4 C;  1CLB A;  1H8B A;  3OB2 B;  2PMY A;  2D8N A;  2EHB A;  1SPY A;  1IQ5 A;  4PHJ A;  4AQI A;  3VGO A;  2L4H A;  1C7V A;  1REC A;  4GAO A;  2K61 A;  1QVI Z;  1JFK A;  2P6B B;  3GK2 A;  4MZL A;  4I5N B;  1MHO A;  1Y1A A;  2KAY A;  2KHN A;  2JT8 A;  2JU0 A;  1KWO B;  2KQ6 A;  3M0W A;  2MAZ A;  5HKZ A;  1WRL A;  2LCP A;  2HPS A;  3OB1 B;  1BR1 B;  3WHU B;  1UP5 A;  2GGZ A;  2Q91 A;  1IQ3 A;  1EJ3 A;  3PN7 B;  4PHM A;  1DMO A;  2H61 C;  1F71 A;  1B8R A;  2L4I A;  4M2Q A;  2KI6 C;  3QRX A;  4ICB A;  1BOC A;  1WY9 A;  4R1E A;  1QAS A;  2CNP A;  1SL9 A;  1IG5 A;  1M39 A;  1BT6 A;  3CTN A;  2JRF A;  3AAJ A;  2L2E A;  5I8N A;  3H4S E;  4DRW A;  1OE9 B;  1ZUZ A;  1TTX A;  3CGA A;  3SG5 A;  1RK9 A;  1J55 A;  3VRO A;  1K8U A;  4M2O A;  1A2X A;  1W7I B;  1DJY A;  5AXI A;  1CFP A;  1CKK A;  3CLN A;  1XYD A;  1CLM A;  1PSB A;  2M7N A;  3NSI A;  1TNW A;  3AAK A;  4XYN A;  1MWN A;  4BY4 A;  3VRR A;  1K96 A;  1CNP A;  2ISD A;  3LK1 A;  2LMT A;  5CSI A;  2JNF A;  1B4C A;  1KSM A;  1NSH A;  3VRP A;  2SAS A;  2BCA A;  1KQM C;  4GGF C;  2CCM A;  2E30 A;  2KBI A;  2PAL A;  3TUY C;  1SR6 B;  4GPL B;  1A4P A;  1IH0 A;  2JZI A;  1SBJ A;  1JC2 A;  1H4B A;  2MLF C;  1U5I B;  2LM5 A;  3I5F B;  1MUX A;  2Y1M A;  1XK4 A;  4MRX A;  1YUR A;  3BXK A;  1FF1 A;  1AUI B;  1K9P A;  3LLE A;  3A8R A;  3GK1 A;  1A75 B;  2NCO A;  1Y0V H;  1J7O A;  1CB1 A;  2LP2 A;  4YBH B;  2I7A A;  1UHI A;  1B47 A;  1BF5 A;  1YR5 A;  2F2P A;  2FCD A;  1AK8 A;  2L50 A;  1JBA A;  3NSO A;  2NCP A;  2KGB C;  3BUN B;  2NLN A;  1NCY A;  2A4J A;  1KFX L;  1SYM A;  3HX4 A;  2BL0 B;  1DGV A;  1CDN A;  4C0L A;  2M1K B;  4PDZ A;  5KTY A;  2JPT A;  2RGI A;  4YGC B;  2JXC A;  2K7O A;  3SJS A;  1NX3 A;  1V1G A;  3BOW B;  2H61 A;  2F3Y A;  3LL8 B;  2OS8 B;  1MR8 A;  1IWQ A;  2Q4U A;  1B7T Y;  1W7J B;  3I5H C;  4ORC B;  2KGR A;  1XA5 A;  2KAV A;  1SCM C;  1IRJ A;  1PVB A;  1XFZ O;  1DJI A;  2KFG A;  2LHL A;  1G4Y R;  3NSK A;  4HRH A;  1QLS A;  1V1F A;  1L2O C;  1SW8 A;  1B8L A;  1NX1 A;  2BE4 A;  3JVT B;  1B8C A;  3OX6 A;  1XFX O;  4PHK A;  1KWO C;  4I5K A;  2V53 A;  2K2A A;  3BUX B;  1E8A A;  3TDI A;  1XO5 A;  1LXF C;  3E3R A;  4FTG A;  3EK4 A;  4PE4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...