3A8RA

The structure of the n-terminal regulatory domain of a plant nadph oxidase
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
166
structure length
166
Chain Sequence
TKSSAAVALKGLQFVTAKVGNDGWAAVEKRFNQLQVDGVLLRSRFGKCIGMDGSDEFAVQMFDSLARKRGIVKQVLTKDELKDFYEQLTDQGFDNRLRTFFDMVDKNADGRLTAEEVKEIIALSASANKLSKIKERADEYTALIMEELDPTNLGYIEMEDLEALLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of the N-terminal regulatory domain of a plant NADPH oxidase and its functional implications
pubmed doi rcsb
source organism Oryza sativa japonica group
molecule tags Calcium binding protein
molecule keywords Putative uncharacterized protein
total genus 61
structure length 166
sequence length 166
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3a8rA01
1CDMA 2BBMA 2PSRA 3SG6A 4PHJA 3O78A 1ALWA 2JULA 2KAVA 3CR5X 2WCEA 1ODBA 1U5IA 2LVIA 3I5FB 2BL0B 2NZ0A 1DJXA 2ISDA 3PALA 4P2YB 3EK4A 2ZN8A 3DVKA 2LMVA 4GAOA 2MLEC 1S26D 1TNWA 1QX5B 4I5JA 1QX7A 1K94A 2MLFC 5CSJA 1EG3A 1NP8A 1RWYA 1GJYA 1F70A 1G33A 3PM8A 2I94A 3DF0B 1B4CA 1JUOA 2I7AA 1EH2A 3TDUA 1UHIA 2AAOA 1RECA 1ZOTB 2JTZA 1DT7B 3SIAA 5D7FA 1SMGA 1BU3A 1M63B 1QV0A 1OZSA 2PMYA 2Y1MA 1KCYA 4D1EA 3EK7A 3JVTB 1NIWA 2E30A 3PLFB 1YTZC 1Q80A 1CMFA 4YGAA 1DJZA 4OVNF 1L2OB 4OV2A 2LE9B 1KK7Y 2V53A 1NCZA 1NWDA 4JPZB 3CGAA 1WRLA 4AOMA 2BCBA 2M7LA 2G9BA 1YRUB 1SL8A 1BR4B 4GBAA 1CDPA 1SCVA 2JZIA 3JTDB 1WY9A 2FOTA 3FS7A 1OMRA 2JXCA 3NSKA 2KI4B 2BE6A 1DF0A 3NSLA 4OR9B 4MBEA 2KI6D 2M29A 4JQ0D 4MLWA 1DJIA 4QJ5B 4PE4A 4GGFC 1MXEA 1B47A 3I5HB 1ZMZA 2GGZA 1L7ZA 2KFGA 1QIWA 3PATA 1U5IB 1K9UA 5FYXA 2K2AA 3LK1A 1PALA 2K8MB 3WHTB 3LL8B 1IWQA 2BE4A 5CSFA 3OHMB 2F2PA 4I5LB 3CR4X 4PE1A 3CR2A 4OCIA 2WCFA 2DOQA 1DJHA 1SYMA 3DD4A 1YVLA 1RK9A 3BOWA 1QLKA 3A8RA 4GPLB 1H4BA 3SG2A 2R2IA 2K0JA 3AKAA 1SR6B 2MRDA 4ORBB 5HLOA 5KSZA 2JQ6A 5DKNA 1LKJA 4F0ZB 4MEWA 2F3ZA 4DUQA 1KFXS 2LMTA 1NUBA 4MZJA 1E8AA 1JFJA 1UHHA 1R6PA 1MR8A 1XK4A 2MA2A 2KI4C 2M49B 2KYFA 5AFPA 1N0YA 1FI6A 1Y6WA 2LCPA 5CSNA 1BR1B 2WCBA 1KFUL 2ZNEA 5JJGA 1DVIA 2LP3A 2LVVA 2Q91A 1D1OA 5DKRA 3VROA 4WRIA 3SG4A 4MZLA 2KOTA 1XK4C 2LNKA 1OMDA 4HREE 4HSZA 4HRHA 3FIAA 1PRWA 2HQWA 1CM4A 1DF0B 3FWBA 2B1UA 3JVTC 1BMOA 5BPJA 1B1GA 1J7OA 2JT0A 1RTP1 3D0YB 3SIBA 2OPOA 4YI8A 1PK0D 3C1VA 1S6CA 2ZRTA 3OB1B 3O4YA 2KQ6A 2LANA 4NDDA 1BG1A 1IKUA 1TIZA 1CDNA 3BYAA 1WLZA 1XO5A 2JNXA 1MWNA 5I2LA 4ICBA 4YBHB 4DIRA 1NCYA 3I5IB 1J1DA 3PN7B 4AQIA 5HKWA 4YI9A 1KWOB 1F8HA 1NX2A 4PALA 5AERA 1OMVA 1N65A 2BL0C 3WNXB 1DJWA 1V1GA 3OX6A 1SL7A 3PFVA 1GQMA 1CDLA 1F4QA 1LXFC 1EJ3A 1EG4A 1ZFSA 2GGMA 2M1UA 4JWQA 4ORCB 4QJ4B 2L2EA 1NSHA 1QIVA 1S1EA 1KFXL 2JOJA 1NCXA 2Y4QA 4AQJA 1IQ3A 2G2BA 1LA0A 1S6JA 1KFUS 1CFFA 1CLLA 1QJTA 1UHKA 3D10A 4GFTA 2LLUA 4TNCA 4ZCVA 2JU0A 1UWOA 2KAXA 3TS5B 1SRAA 2LP2A 1QASA 1QTXA 1BOCA 2KBMA 4PE0A 3CLNA 2ZRSA 1SCMC 1S5GY 2TN4A 4MVFA 1AHRA 4GGNA 4P5OE 1K2HA 1XVJA 2EGDA 3E3RA 4M2QA 1M39A 3VRPA 2K7DA 2LVJA 4N5XA 5HLVA 1SK6D 2KFHA 5D69A 1UP5A 1M31A 4QJ3B 1EL4A 1TCOB 2F2OA 2Y5IA 3NSOA 1IH0A 2BBNA 4C0LA 3WXAA 1TTXA 1UURA 2KNEA 4YRUA 2K2FA 2GV5A 1K96A 1ZACA 1XFWO 3CWGA 1QLSA 2OTGB 1M45A 2F8PA 4HRGA 5CSIA 5I2OA 3BUOB 1SNLA 2BKIB 1BT6A 2EC6C 2JXLA 2ZN9A 5F6TA 2ZKMX 1CLBA 1B8RA 3CS1A 3DVJA 4CPVA 1A03A 2VRGA 1KK8B 4GUKA 1DGUA 3AKBA 1EXRA 3CTNA 3LCPC 1BLQA 1IRJA 2MHHA 1PSBA 1SPYA 5DKQA 1B8CA 1XFXO 4DRWA 5I2QA 1CKKA 1WLMA 5I8NA 4A4CA 1JBAA 2PALA 2WNDA 1X02A 4MZKA 3SJSA 1YRTB 1JC2A 1G4YR 1J7RA 1PVBA 3BUNB 2CCMA 1NX1A 1B8LA 2JT3A 1S36A 1TNXA 3NXAA 4CFRA 1XFVO 1QATA 3EVUA 3KF9A 2KGRA 4FQOA 4PDZA 2WORA 3AAKA 4Q04A 1J7PA 1Y0VH 4CIDA 2F33A 2PRUA 3OB2B 3TS5C 2HF5A 1XFYO 3F45A 1MQ1A 2H2KA 2M3WA 1F71A 2L98A 1K8UA 1C7WA 4PHNA 4XJKA 1H8BA 1NX0A 1XYDA 3GOFA 4U8DA 2HETA 2LLSA 4XYNA 3EKHA 5K89A 1CFCA 4NDBA 1QVIY 1TRFA 4ZCUA 1JF2A 3VGOA 1QX2A 3TZ1A 1CMGA 4USLA 3GK4X 3BXKA 3EVVA 2KFFA 2WC8A 4MN0A 1F55A 1AJ5A 2KBIA 2HPSA 2NLNA 1TN4A 3BQ3A 1A75A 4DS7A 3I5IC 2Q4UA 1K95A 1QVIZ 4R1EA 1UHJA 1DTLA 5HKYA 4WQ2A 2KAYA 4PHMA 5AANA 4YGCB 2M1KB 1B7TY 2Y1NA 1LINA 1NX3A 4N1FA 5JOLA 1N2DA 3I5GB 5J3XA 1FF1A 3FWCA 1WRZA 2FCDA 1W7JB 2P6BB 2MBXA 3GK1A 1TNPA 2HQ8A 2COLB 1NPQA 3AAJA 2KI6C 1B7TZ 4I5KA 2CT9A 2L4HA 2M97A 2O60A 2WOSA 3RM1A 3IQQA 2M8UA 3DF0A 1V1FA 1KQMB 1SKTA 1TCFA 2JTTA 4M2OA 2SCPA 1YUUA 2BCAA 1S6IA 2LLTA 4GGFA 4E68A 5HKZA 1JSAA 1FBVA 1MHOA 1YVHA 4PE7A 1MXLC 2K7CA 1QXPA 2EHBA 1YX7A 2JT8A 4YGDB 1BODA 1SY9A 1KWOC 3OX5A 1OOJA 3KPXA 5HYDA 3PN7C 3VRQA 1XFZO 2L51A 2ZNDA 1C07A 1WDCC 2SASA 5CPVA 2FJUB 1CLMA 2JPTA 1WDCB 1Y1XA 2PVBA 4ORAB 5TNCA 2KYCA 1KK7Z 5PALA 2BKHB 2AUCA 1ZUZA 1QV1A 1B9AA 1JF0A 2I2RE 2ZFDA 4DCKA 1BJFA 1SR6C 1S3PA 4N1GA 1SW8A 1K9PA 3BUXB 3DVMA 4OKHA 5GQQC 1J55A 4FTGA 1A4PA 2LHLA 4GNKB 1AUIB 1A29A 1PVAA 1KQMC 4CFQA 1F54A 1HT9A 2A4JA 1IQ5A 2JRFA 3LLEA 1AVSA 2BECA 2PASA 1IJ6A 2F3YA 2KDHA 4MRYA 1GGZA 2M7NA 1J1EA 2L0PA 3KO0A 1RFJA 1LA3A 2MJWB 4PCWA 3I5HC 1BF5A 2H61C 2K7OA 5IBWA 1OSAA 1NYAA 1R2UA 5ER5A 3KEVA 1AK8A 2LHIA 2NCOA 1RROA 2L5XB 3JTDC 4IL1A 2MAZA 5KTYA 2K7BA 1J7QA 1LVCD 1FW4A 1Y1AA 4WQ3A 2K61A 2H61A 2QACA 1CNPA 2CTNA 5G08A 2I18A 3MSEB 2LM5A 3BUMB 3VRRA 4A4BA 3K21A 2RGIA 1CFDA 1JFKA 3CZTX 3O6BA 2LV7A 1G8IA 3ICBA 1OQPA 1YUSA 3H4SE 1MF8B 2KHNA 1WRKA 2JWWA 3BOWB 1IG5A 3I5GC 1K9KA 1IJ5A 1Y1UA 1KSMA 3RLZA 1K93D 3DVEA 1YUTA 1YR5A 5AEQA 4ETOA 5ER4X 1DJGA 5B8IB 1GGWA 4C0KA 1SBJA 2KSPA 1VRKA 2M9GA 2FCEA 2LAPA 1XA5A 2LUCA 3QRXA 3SG5A 4NQGA 4UPGA 1PSRA 2JC2A 2CBLA 4C0JA 3SG3A 1QS7A 4I5NB 1KQVA 1SL9A 3EK8A 2AMIA 1AJ4A 3NSIA 1DGVA 4YGBB 3VRNA 1CB1A 3EVRA 2E6WA 3WHUB 1CFPA 1UUSA 1OE9B 1A2XA 3ZWHA 1L2OC 1PULA 2LC5A 2KGBC 3IF7A 2IS9A 2LVKA 1W7IB 1RJVA 2BCXA 2OTGC 5AXIA 3TDZA 1S5GZ 3GK2A 2KQYA 1JWDA 3BUWB 2M0RA 3EKJA 3HCMA 1C7VA 3HX4A 1OZOA 2L50A 2OS8C 3LK0A 1DMOA 3KHEA 3OP0A 2O5GA 1AP4A 1K90D 1FI5A 2QPTA 1YURA 3ZNIA 1TOPA 2NCPA 3O2PA 4XJKB 2LMUA 3TUYC 1F4OA 3A4UB 1SCMB 3D0YA 3TUYB 4BY4A 1MUXA 4PHKA 1DJYA 1TNQA 3SG7A 2JNFA 2CXJA 4NDCA 3M0WA 1YX8A 1UHNA 2OS8B 4MRXA 1A75B 1CM1A 3PSRA 1HQVA 4BY5A 1M46A 3I5FC 2L4IA 3IQOA 4CLNA 1KSOA 2LUXA 1KK8C 4YGEB 2NXQA 1CTRA 4M2PA 4L9MA 4MSPA 3TDIA 5KU1A 1FPWA 2CNPA 2EC6B 1IGVA 1XFUO 2D8NA 1ALVA
chains in the Genus database with same CATH superfamily
1CDMA 2BBMA 2PSRA 3SG6A 4PHJA 3O78A 1ALWA 2JULA 2KAVA 3CR5X 2WCEA 1ODBA 1U5IA 4F7FA 2LVIA 2WC6A 3I5FB 2BL0B 2NZ0A 1DJXA 2ISDA 3PALA 4P2YB 3SS5A 3EK4A 2ZN8A 3DVKA 2LMVA 4GAOA 2MLEC 1S26D 1TNWA 1QX5B 4I5JA 1QX7A 1K94A 2MLFC 5CSJA 1EG3A 1NP8A 1RWYA 1GJYA 1LS8A 1F70A 1G33A 3PM8A 2I94A 3DF0B 1B4CA 1JUOA 2I7AA 1EH2A 3TDUA 1UHIA 2AAOA 1RECA 1ZOTB 2JTZA 1DT7B 3SIAA 5D7FA 1SMGA 3R1PA 1BU3A 1M63B 1QV0A 1OZSA 2PMYA 2PQLA 2Y1MA 3FE8A 4D1EA 1KCYA 3EK7A 3JVTB 1NIWA 2E30A 3PLFB 5DICA 1YTZC 3N7HA 1Q80A 4JD9A 1CMFA 4YGAA 1DJZA 4OVNF 1L2OB 4OV2A 2LE9B 1KK7Y 2V53A 1NCZA 1NWDA 4JPZB 3CGAA 1WRLA 4FQTA 4AOMA 2BCBA 2M7LA 2G9BA 1YRUB 1SL8A 1BR4B 4GBAA 1CDPA 1SCVA 2JZIA 3D77A 3JTDB 3PM2A 1WY9A 2FOTA 3FS7A 1OMRA 3D74A 4INWA 2JXCA 3NSKA 2KI4B 2BE6A 1DF0A 3NSLA 4OR9B 4MBEA 3S0GA 2KI6D 2M29A 4JQ0D 4MLWA 1DJIA 4QJ5B 4PE4A 4GGFC 1TWOA 1MXEA 1B47A 3I5HB 1ZMZA 2GGZA 1L7ZA 2KFGA 1QIWA 3BFAA 1U5IB 3PATA 2FJYA 1K9UA 5D3OA 2K2AA 3LK1A 1PALA 5FYXA 2K8MB 3WHTB 3LL8B 1IWQA 2BE4A 5CSFA 2P71A 3OHMB 2F2PA 4I5LB 3CR4X 4PE1A 3CR2A 3OBVA 4OCIA 5I94A 2WCFA 3CZ1A 2DOQA 1DJHA 1SYMA 3DD4A 1YVLA 3NHTA 1RK9A 3BOWA 2QEBA 1QLKA 3A8RA 4GPLB 1H4BA 3SG2A 2R2IA 2K0JA 3AKAA 1SR6B 2MRDA 4ORBB 3S0FA 3D76A 5HLOA 5KSZA 2JQ6A 5DKNA 1LKJA 4F0ZB 4MEWA 2F3ZA 4DUQA 1KFXS 2LMTA 1NUBA 4MZJA 1E8AA 1JFJA 1UHHA 1R6PA 1MR8A 1XK4A 2MA2A 2KI4C 5HL1A 2M49B 2KYFA 5AFPA 1N0YA 1FI6A 1Y6WA 2LCPA 1DQEA 5CSNA 3D75A 2QDIA 1BR1B 2WCBA 1KFUL 2ZNEA 5JJGA 1DVIA 2LP3A 2LVVA 3CYZA 2Q91A 1D1OA 5DKRA 3VROA 4WRIA 3R1OA 4MZLA 2KOTA 1XK4C 3SG4A 2LNKA 1TUJA 1OMDA 4HREE 2WCHA 4HSZA 4HRHA 3FIAA 1PRWA 2HQWA 1CM4A 1DF0B 1IIOA 3FWBA 2B1UA 3JVTC 1BMOA 3B7AA 5BPJA 1B1GA 1J7OA 2JT0A 1RTP1 3D0YB 3SIBA 2OPOA 4YI8A 1PK0D 3C1VA 1C3ZA 1S6CA 2ZRTA 3OB1B 3O4YA 2KQ6A 2LANA 4NDDA 1BG1A 1IKUA 1TIZA 1CDNA 3BYAA 1WLZA 4KYNA 1XO5A 3CABA 2JNXA 3BFBA 1MWNA 5I2LA 4ICBA 4YBHB 4DIRA 1NCYA 2L2CA 3I5IB 1J1DA 3PN7B 4AQIA 1OW4A 5HKWA 2KPHA 4YI9A 1KWOB 1F8HA 1NX2A 4PALA 5FI6A 5AERA 1OMVA 1N65A 2BL0C 3WNXB 2WCMA 1DJWA 1V1GA 3OX6A 1SL7A 3NHIA 3PFVA 1GQMA 1CDLA 1F4QA 1LXFC 1EJ3A 1EG4A 1ZFSA 2GGMA 2M1UA 4JWQA 4ORCB 4QJ4B 1DELA 3O4XA 2L2EA 1NSHA 1QIVA 1S1EA 1KFXL 2JOJA 1NCXA 2Y4QA 3S0EA 4AQJA 2G2BA 1IQ3A 1LA0A 1S6JA 1KFUS 1CFFA 1CLLA 1QJTA 1UHKA 3D10A 4GFTA 2LLUA 4TNCA 5FI7A 1TUZA 2JU0A 1UWOA 2KAXA 4ZCVA 3TS5B 1SRAA 2LP2A 1QASA 1QTXA 1BOCA 2KBMA 3B6XA 4PE0A 1W9ZA 3CLNA 2ZRSA 1SCMC 1S5GY 2TN4A 4MVFA 1AHRA 4GGNA 4P5OE 3V2LA 1K2HA 1XVJA 2EGDA 3E3RA 4M2QA 1M39A 3VRPA 1Z2CB 2K7DA 2LVJA 4N5XA 5HLVA 1SK6D 2KFHA 5D69A 3DXLA 1UP5A 1M31A 2WCJA 4QJ3B 1EL4A 1TCOB 2F2OA 2Y5IA 3NSOA 1IH0A 2BBNA 4C0LA 3WXAA 1TTXA 1UURA 2KNEA 4YRUA 2K2FA 1ZACA 1K96A 2GV5A 1XFWO 3CWGA 1QLSA 2K60A 1M45A 2F8PA 2OTGB 4HRGA 5CSIA 3BUOB 5I2OA 1SNLA 2BKIB 1BT6A 2EC6C 2JXLA 2ZN9A 5F6TA 2ZKMX 1CLBA 1B8RA 3CS1A 2H8VA 3DVJA 4CPVA 1A03A 3L47A 2VRGA 1KK8B 4GUKA 1DGUA 3AKBA 1EXRA 3CTNA 3LCPC 1BLQA 1IRJA 2MHHA 1PSBA 1SPYA 5DKQA 1B8CA 1XFXO 4DRWA 5I2QA 1CKKA 1WLMA 5I8NA 4A4CA 1JBAA 2PALA 2WNDA 3CDNA 3VB1A 1X02A 4MZKA 3SJSA 1YRTB 1JC2A 1G4YR 1J7RA 1PVBA 3BUNB 2CCMA 1NX1A 1B8LA 2JT3A 1S36A 1TNXA 3NXAA 4CFRA 3B87A 1XFVO 1QATA 3EVUA 3KF9A 2KGRA 4FQOA 4PDZA 2WORA 2WCKA 3AAKA 4Q04A 3DZTA 1J7PA 2QEOA 1Y0VH 4CIDA 2F33A 2PRUA 3OB2B 3TS5C 2HF5A 1XFYO 3F45A 1MQ1A 2H2KA 2M3WA 1F71A 2L98A 1K8UA 1C7WA 4PHNA 4XJKA 1H8BA 1NX0A 3IVTA 1XYDA 3GOFA 4U8DA 2HETA 2LLSA 4XYNA 3EKHA 5K89A 1CFCA 4NDBA 3FE6A 1QVIY 1TRFA 4ZCUA 1JF2A 1C3YA 3VGOA 1QX2A 3TZ1A 1CMGA 4USLA 3GK4X 1P28A 3BXKA 3EVVA 2KFFA 2WC8A 4MN0A 1F55A 1AJ5A 2KBIA 2HPSA 2NLNA 4JKTA 1TN4A 3BQ3A 1A75A 4DS7A 3I5IC 2Q4UA 1K95A 1QVIZ 4R1EA 1UHJA 1DTLA 5HKYA 4WQ2A 2KAYA 4PHMA 2BAPA 3PJIA 5AANA 4YGCB 2M1KB 1B7TY 1QWVA 2Y1NA 1LINA 3K1EA 1NX3A 4N1FA 5JOLA 1N2DA 3I5GB 5J3XA 1FF1A 3FWCA 1WRZA 2FCDA 5EL2A 1OOGA 1W7JB 1SSEB 2KLEA 2P6BB 3GK1A 2MBXA 1TNPA 2HQ8A 2COLB 1NPQA 3AAJA 2KI6C 1B7TZ 4I5KA 3RZSA 2CT9A 2L4HA 2M97A 3UNWA 2O60A 3DYEA 2WOSA 3RM1A 3IQQA 2M8UA 3B88A 1V1FA 3DF0A 1KQMB 1SKTA 1TCFA 2JTTA 4M2OA 2SCPA 5FI2A 1YUUA 2BCAA 1S6IA 2LLTA 3FE9A 3D73A 4GGFA 5HKZA 4E68A 1JSAA 1FBVA 1MHOA 1YVHA 2WCLA 4PE7A 1MXLC 2JPOA 2K7CA 1QXPA 2EHBA 1YX7A 2JT8A 4YGDB 1BODA 1SY9A 1KWOC 1DEKA 3OX5A 1OOJA 3KPXA 5HYDA 3PN7C 3VRQA 1XFZO 2L51A 2ZNDA 1C07A 1WDCC 2SASA 5CPVA 2FJUB 1CLMA 2WC5A 2JPTA 1WDCB 1Y1XA 3Q8IA 4IJ7A 2PVBA 4ORAB 5TNCA 2KYCA 1KK7Z 5PALA 2BKHB 2AUCA 1ZUZA 4INXA 1QV1A 1B9AA 1JF0A 2I2RE 2BNXA 2ZFDA 3CZ2A 4DCKA 1BJFA 1SR6C 1S3PA 4N1GA 1SW8A 1K9PA 3BUXB 3DVMA 4OKHA 5GQQC 1J55A 4FTGA 3BJHA 1A4PA 2LHLA 4GNKB 1AUIB 1A29A 1PVAA 1KQMC 4CFQA 1F54A 2L5YA 1HT9A 1IQ5A 2A4JA 2JRFA 3LLEA 3R1VA 1AVSA 2BECA 2PASA 1IJ6A 2F3YA 2KDHA 4MRYA 1GGZA 1OOFA 2M7NA 1J1EA 2L0PA 3KO0A 1RFJA 1LA3A 2MJWB 4PCWA 3I5HC 2PYQA 2KLDA 3D78A 2YGUA 1BF5A 2H61C 2K7OA 3S0AA 5IBWA 1OSAA 1NYAA 3L4LA 3BFHA 1R2UA 5ER5A 3KEVA 1AK8A 3S0BA 2LHIA 2NCOA 1RROA 2L5XB 3JTDC 4IL1A 2MAZA 5KTYA 2K7BA 1J7QA 1LVCD 1FW4A 1Y1AA 1Z4HA 4WQ3A 2K61A 2H61A 2QACA 1CNPA 2CTNA 5G08A 2I18A 3EG5B 3MSEB 2LM5A 3BUMB 3VRRA 4A4BA 2GTEA 3K21A 1ORGA 3R72A 2RGIA 1CFDA 1JFKA 3CZTX 3O6BA 2LV7A 1G8IA 3ICBA 1OQPA 1YUSA 3H4SE 1MF8B 2KHNA 3SS4A 1WRKA 1T14A 2JWWA 3BOWB 4OZDA 1IG5A 3I5GC 1K9KA 1IJ5A 1Y1UA 1KSMA 3RLZA 1K93D 1OOIX 1YUTA 1YR5A 3DVEA 5AEQA 4ETOA 2ERBA 5ER4X 1DJGA 5B8IB 1GGWA 4C0KA 1SBJA 2KSPA 1VRKA 2M9GA 2FCEA 2LAPA 3L4AA 1XA5A 2LUCA 3QRXA 3SG5A 4NQGA 4UPGA 1PSRA 2JC2A 2CBLA 4C0JA 3SG3A 1QS7A 1GM0A 4I5NB 1KQVA 1SL9A 3EK8A 4PT1A 2AMIA 1AJ4A 3NSIA 1DGVA 4YGBB 3VRNA 1CB1A 3EVRA 2E6WA 3WHUB 1CFPA 1UUSA 1OE9B 1A2XA 3NGVA 3ZWHA 1L2OC 1PULA 2LC5A 2KGBC 3IF7A 2IS9A 2LVKA 1W7IB 2BCXA 1RJVA 2OTGC 1OOHA 5AXIA 3TDZA 1S5GZ 3GK2A 1DC1A 2KQYA 1JWDA 3BUWB 2QEHA 2M0RA 3EKJA 3HCMA 1C7VA 3B86A 3HX4A 1OZOA 2L50A 2OS8C 3LK0A 2P70A 1DMOA 3CZ0A 1XFRA 2O5GA 3KHEA 3OP0A 1AP4A 1K90D 1FI5A 3S0DA 2QPTA 1YURA 3DY9A 3ZNIA 1TOPA 3OGNA 2NCPA 3O2PA 4XJKB 2LMUA 3TUYC 1F4OA 3A4UB 1SCMB 3D0YA 3TUYB 4BY4A 1MUXA 4PHKA 1DJYA 1TNQA 3SG7A 2JNFA 2CXJA 4NDCA 3M0WA 2QEVA 1YX8A 1UHNA 2OS8B 4MRXA 1A75B 3QMEA 1CM1A 3PSRA 1HQVA 4BY5A 1M46A 3I5FC 3UO9A 2L4IA 3IQOA 4CLNA 1KSOA 2LUXA 1KK8C 4YGEB 2NXQA 1CTRA 4M2PA 4L9MA 4MSPA 3TDIA 5KU1A 1FPWA 3SS3A 2CNPA 2EC6B 1IGVA 1XFUO 2D8NA 1ALVA
chains in the Genus database with same CATH topology
1CDMA 2BBMA 2PSRA 3SG6A 4PHJA 3O78A 1ALWA 2JULA 2KAVA 3CR5X 2WCEA 1ODBA 1U5IA 2LVIA 3I5FB 2BL0B 2NZ0A 1DJXA 2ISDA 3PALA 4P2YB 3EK4A 2ZN8A 3DVKA 2LMVA 4GAOA 2MLEC 1S26D 1TNWA 1QX5B 4I5JA 1QX7A 1K94A 2MLFC 5CSJA 1EG3A 1NP8A 1RWYA 1GJYA 1F70A 1G33A 3PM8A 2I94A 3DF0B 1B4CA 1JUOA 2I7AA 1EH2A 3TDUA 1UHIA 2AAOA 1RECA 1ZOTB 2JTZA 1DT7B 3SIAA 5D7FA 1SMGA 1BU3A 1M63B 1QV0A 1OZSA 2PMYA 2Y1MA 1KCYA 4D1EA 3EK7A 3JVTB 1NIWA 2E30A 3PLFB 1YTZC 1Q80A 1CMFA 4YGAA 1DJZA 4OVNF 1L2OB 4OV2A 2LE9B 1KK7Y 2V53A 1NCZA 1NWDA 4JPZB 3CGAA 1WRLA 4AOMA 2BCBA 2M7LA 2G9BA 1YRUB 1SL8A 1BR4B 4GBAA 1CDPA 1SCVA 2JZIA 3JTDB 1WY9A 2FOTA 3FS7A 1OMRA 2JXCA 3NSKA 2KI4B 2BE6A 1DF0A 3NSLA 4OR9B 4MBEA 2KI6D 2M29A 4JQ0D 4MLWA 1DJIA 4QJ5B 4PE4A 4GGFC 1MXEA 1B47A 3I5HB 1ZMZA 2GGZA 1L7ZA 2KFGA 1QIWA 3PATA 1U5IB 1K9UA 5FYXA 2K2AA 3LK1A 1PALA 2K8MB 3WHTB 3LL8B 1IWQA 2BE4A 5CSFA 3OHMB 2F2PA 4I5LB 3CR4X 4PE1A 3CR2A 4OCIA 2WCFA 2DOQA 1DJHA 1SYMA 3DD4A 1YVLA 1RK9A 3BOWA 1QLKA 3A8RA 4GPLB 1H4BA 3SG2A 2R2IA 2K0JA 3AKAA 1SR6B 2MRDA 4ORBB 5HLOA 5KSZA 2JQ6A 5DKNA 1LKJA 4F0ZB 4MEWA 2F3ZA 4DUQA 1KFXS 2LMTA 1NUBA 4MZJA 1E8AA 1JFJA 1UHHA 1R6PA 1MR8A 1XK4A 2MA2A 2KI4C 2M49B 2KYFA 5AFPA 1N0YA 1FI6A 1Y6WA 2LCPA 5CSNA 1BR1B 2WCBA 1KFUL 2ZNEA 5JJGA 1DVIA 2LP3A 2LVVA 2Q91A 1D1OA 5DKRA 3VROA 4WRIA 3SG4A 4MZLA 2KOTA 1XK4C 2LNKA 1OMDA 4HREE 4HSZA 4HRHA 3FIAA 1PRWA 2HQWA 1CM4A 1DF0B 3FWBA 2B1UA 3JVTC 1BMOA 5BPJA 1B1GA 1J7OA 2JT0A 1RTP1 3D0YB 3SIBA 2OPOA 4YI8A 1PK0D 3C1VA 1S6CA 2ZRTA 3OB1B 3O4YA 2KQ6A 2LANA 4NDDA 1BG1A 1IKUA 1TIZA 1CDNA 3BYAA 1WLZA 1XO5A 2JNXA 1MWNA 5I2LA 4ICBA 4YBHB 4DIRA 1NCYA 3I5IB 1J1DA 3PN7B 4AQIA 5HKWA 4YI9A 1KWOB 1F8HA 1NX2A 4PALA 5AERA 1OMVA 1N65A 2BL0C 3WNXB 1DJWA 1V1GA 3OX6A 1SL7A 3PFVA 1GQMA 1CDLA 1F4QA 1LXFC 1EJ3A 1EG4A 1ZFSA 2GGMA 2M1UA 4JWQA 4ORCB 4QJ4B 2L2EA 1NSHA 1QIVA 1S1EA 1KFXL 2JOJA 1NCXA 2Y4QA 4AQJA 1IQ3A 2G2BA 1LA0A 1S6JA 1KFUS 1CFFA 1CLLA 1QJTA 1UHKA 3D10A 4GFTA 2LLUA 4TNCA 4ZCVA 2JU0A 1UWOA 2KAXA 3TS5B 1SRAA 2LP2A 1QASA 1QTXA 1BOCA 2KBMA 4PE0A 3CLNA 2ZRSA 1SCMC 1S5GY 2TN4A 4MVFA 1AHRA 4GGNA 4P5OE 1K2HA 1XVJA 2EGDA 3E3RA 4M2QA 1M39A 3VRPA 2K7DA 2LVJA 4N5XA 5HLVA 1SK6D 2KFHA 5D69A 1UP5A 1M31A 4QJ3B 1EL4A 1TCOB 2F2OA 2Y5IA 3NSOA 1IH0A 2BBNA 4C0LA 3WXAA 1TTXA 1UURA 2KNEA 4YRUA 2K2FA 2GV5A 1K96A 1ZACA 1XFWO 3CWGA 1QLSA 2OTGB 1M45A 2F8PA 4HRGA 5CSIA 5I2OA 3BUOB 1SNLA 2BKIB 1BT6A 2EC6C 2JXLA 2ZN9A 5F6TA 2ZKMX 1CLBA 1B8RA 3CS1A 3DVJA 4CPVA 1A03A 2VRGA 1KK8B 4GUKA 1DGUA 3AKBA 1EXRA 3CTNA 3LCPC 1BLQA 1IRJA 2MHHA 1PSBA 1SPYA 5DKQA 1B8CA 1XFXO 4DRWA 5I2QA 1CKKA 1WLMA 5I8NA 4A4CA 1JBAA 2PALA 2WNDA 1X02A 4MZKA 3SJSA 1YRTB 1JC2A 1G4YR 1J7RA 1PVBA 3BUNB 2CCMA 1NX1A 1B8LA 2JT3A 1S36A 1TNXA 3NXAA 4CFRA 1XFVO 1QATA 3EVUA 3KF9A 2KGRA 4FQOA 4PDZA 2WORA 3AAKA 4Q04A 1J7PA 1Y0VH 4CIDA 2F33A 2PRUA 3OB2B 3TS5C 2HF5A 1XFYO 3F45A 1MQ1A 2H2KA 2M3WA 1F71A 2L98A 1K8UA 1C7WA 4PHNA 4XJKA 1H8BA 1NX0A 1XYDA 3GOFA 4U8DA 2HETA 2LLSA 4XYNA 3EKHA 5K89A 1CFCA 4NDBA 1QVIY 1TRFA 4ZCUA 1JF2A 3VGOA 1QX2A 3TZ1A 1CMGA 4USLA 3GK4X 3BXKA 3EVVA 2KFFA 2WC8A 4MN0A 1F55A 1AJ5A 2KBIA 2HPSA 2NLNA 1TN4A 3BQ3A 1A75A 4DS7A 3I5IC 2Q4UA 1K95A 1QVIZ 4R1EA 1UHJA 1DTLA 5HKYA 4WQ2A 2KAYA 4PHMA 5AANA 4YGCB 2M1KB 1B7TY 2Y1NA 1LINA 1NX3A 4N1FA 5JOLA 1N2DA 3I5GB 5J3XA 1FF1A 3FWCA 1WRZA 2FCDA 1W7JB 2P6BB 2MBXA 3GK1A 1TNPA 2HQ8A 2COLB 1NPQA 3AAJA 2KI6C 1B7TZ 4I5KA 2CT9A 2L4HA 2M97A 2O60A 2WOSA 3RM1A 3IQQA 2M8UA 3DF0A 1V1FA 1KQMB 1SKTA 1TCFA 2JTTA 4M2OA 2SCPA 1YUUA 2BCAA 1S6IA 2LLTA 4GGFA 4E68A 5HKZA 1JSAA 1FBVA 1MHOA 1YVHA 4PE7A 1MXLC 2K7CA 1QXPA 2EHBA 1YX7A 2JT8A 4YGDB 1BODA 1SY9A 1KWOC 3OX5A 1OOJA 3KPXA 5HYDA 3PN7C 3VRQA 1XFZO 2L51A 2ZNDA 1C07A 1WDCC 2SASA 5CPVA 2FJUB 1CLMA 2JPTA 1WDCB 1Y1XA 2PVBA 4ORAB 5TNCA 2KYCA 1KK7Z 5PALA 2BKHB 2AUCA 1ZUZA 1QV1A 1B9AA 1JF0A 2I2RE 2ZFDA 4DCKA 1BJFA 1SR6C 1S3PA 4N1GA 1SW8A 1K9PA 3BUXB 3DVMA 4OKHA 5GQQC 1J55A 4FTGA 1A4PA 2LHLA 4GNKB 1AUIB 1A29A 1PVAA 1KQMC 4CFQA 1F54A 1HT9A 2A4JA 1IQ5A 2JRFA 3LLEA 1AVSA 2BECA 2PASA 1IJ6A 2F3YA 2KDHA 4MRYA 1GGZA 2M7NA 1J1EA 2L0PA 3KO0A 1RFJA 1LA3A 2MJWB 4PCWA 3I5HC 1BF5A 2H61C 2K7OA 5IBWA 1OSAA 1NYAA 1R2UA 5ER5A 3KEVA 1AK8A 2LHIA 2NCOA 1RROA 2L5XB 3JTDC 4IL1A 2MAZA 5KTYA 2K7BA 1J7QA 1LVCD 1FW4A 1Y1AA 4WQ3A 2K61A 2H61A 2QACA 1CNPA 2CTNA 5G08A 2I18A 3MSEB 2LM5A 3BUMB 3VRRA 4A4BA 3K21A 2RGIA 1CFDA 1JFKA 3CZTX 3O6BA 2LV7A 1G8IA 3ICBA 1OQPA 1YUSA 3H4SE 1MF8B 2KHNA 1WRKA 2JWWA 3BOWB 1IG5A 3I5GC 1K9KA 1IJ5A 1Y1UA 1KSMA 3RLZA 1K93D 3DVEA 1YUTA 1YR5A 5AEQA 4ETOA 5ER4X 1DJGA 5B8IB 1GGWA 4C0KA 1SBJA 2KSPA 1VRKA 2M9GA 2FCEA 2LAPA 1XA5A 2LUCA 3QRXA 3SG5A 4NQGA 4UPGA 1PSRA 2JC2A 2CBLA 4C0JA 3SG3A 1QS7A 4I5NB 1KQVA 1SL9A 3EK8A 2AMIA 1AJ4A 3NSIA 1DGVA 4YGBB 3VRNA 1CB1A 3EVRA 2E6WA 3WHUB 1CFPA 1UUSA 1OE9B 1A2XA 3ZWHA 1L2OC 1PULA 2LC5A 2KGBC 3IF7A 2IS9A 2LVKA 1W7IB 1RJVA 2BCXA 2OTGC 5AXIA 3TDZA 1S5GZ 3GK2A 2KQYA 1JWDA 3BUWB 2M0RA 3EKJA 3HCMA 1C7VA 3HX4A 1OZOA 2L50A 2OS8C 3LK0A 1DMOA 3KHEA 3OP0A 2O5GA 1AP4A 1K90D 1FI5A 2QPTA 1YURA 3ZNIA 1TOPA 2NCPA 3O2PA 4XJKB 2LMUA 3TUYC 1F4OA 3A4UB 1SCMB 3D0YA 3TUYB 4BY4A 1MUXA 4PHKA 1DJYA 1TNQA 3SG7A 2JNFA 2CXJA 4NDCA 3M0WA 1YX8A 1UHNA 2OS8B 4MRXA 1A75B 1CM1A 3PSRA 1HQVA 4BY5A 1M46A 3I5FC 2L4IA 3IQOA 4CLNA 1KSOA 2LUXA 1KK8C 4YGEB 2NXQA 1CTRA 4M2PA 4L9MA 4MSPA 3TDIA 5KU1A 1FPWA 2CNPA 2EC6B 1IGVA 1XFUO 2D8NA 1ALVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CDM A;  2BBM A;  2PSR A;  3SG6 A;  4PHJ A;  3O78 A;  1ALW A;  2JUL A;  2KAV A;  3CR5 X;  2WCE A;  1ODB A;  1U5I A;  2LVI A;  3I5F B;  2BL0 B;  2NZ0 A;  1DJX A;  2ISD A;  3PAL A;  4P2Y B;  3EK4 A;  2ZN8 A;  3DVK A;  2LMV A;  4GAO A;  2MLE C;  1S26 D;  1TNW A;  1QX5 B;  4I5J A;  1QX7 A;  1K94 A;  2MLF C;  5CSJ A;  1EG3 A;  1NP8 A;  1RWY A;  1GJY A;  1F70 A;  1G33 A;  3PM8 A;  2I94 A;  3DF0 B;  1B4C A;  1JUO A;  2I7A A;  1EH2 A;  3TDU A;  1UHI A;  2AAO A;  1REC A;  1ZOT B;  2JTZ A;  1DT7 B;  3SIA A;  5D7F A;  1SMG A;  1BU3 A;  1M63 B;  1QV0 A;  1OZS A;  2PMY A;  2Y1M A;  1KCY A;  4D1E A;  3EK7 A;  3JVT B;  1NIW A;  2E30 A;  3PLF B;  1YTZ C;  1Q80 A;  1CMF A;  4YGA A;  1DJZ A;  4OVN F;  1L2O B;  4OV2 A;  2LE9 B;  1KK7 Y;  2V53 A;  1NCZ A;  1NWD A;  4JPZ B;  3CGA A;  1WRL A;  4AOM A;  2BCB A;  2M7L A;  2G9B A;  1YRU B;  1SL8 A;  1BR4 B;  4GBA A;  1CDP A;  1SCV A;  2JZI A;  3JTD B;  1WY9 A;  2FOT A;  3FS7 A;  1OMR A;  2JXC A;  3NSK A;  2KI4 B;  2BE6 A;  1DF0 A;  3NSL A;  4OR9 B;  4MBE A;  2KI6 D;  2M29 A;  4JQ0 D;  4MLW A;  1DJI A;  4QJ5 B;  4PE4 A;  4GGF C;  1MXE A;  1B47 A;  3I5H B;  1ZMZ A;  2GGZ A;  1L7Z A;  2KFG A;  1QIW A;  3PAT A;  1U5I B;  1K9U A;  5FYX A;  2K2A A;  3LK1 A;  1PAL A;  2K8M B;  3WHT B;  3LL8 B;  1IWQ A;  2BE4 A;  5CSF A;  3OHM B;  2F2P A;  4I5L B;  3CR4 X;  4PE1 A;  3CR2 A;  4OCI A;  2WCF A;  2DOQ A;  1DJH A;  1SYM A;  3DD4 A;  1YVL A;  1RK9 A;  3BOW A;  1QLK A;  3A8R A;  4GPL B;  1H4B A;  3SG2 A;  2R2I A;  2K0J A;  3AKA A;  1SR6 B;  2MRD A;  4ORB B;  5HLO A;  5KSZ A;  2JQ6 A;  5DKN A;  1LKJ A;  4F0Z B;  4MEW A;  2F3Z A;  4DUQ A;  1KFX S;  2LMT A;  1NUB A;  4MZJ A;  1E8A A;  1JFJ A;  1UHH A;  1R6P A;  1MR8 A;  1XK4 A;  2MA2 A;  2KI4 C;  2M49 B;  2KYF A;  5AFP A;  1N0Y A;  1FI6 A;  1Y6W A;  2LCP A;  5CSN A;  1BR1 B;  2WCB A;  1KFU L;  2ZNE A;  5JJG A;  1DVI A;  2LP3 A;  2LVV A;  2Q91 A;  1D1O A;  5DKR A;  3VRO A;  4WRI A;  3SG4 A;  4MZL A;  2KOT A;  1XK4 C;  2LNK A;  1OMD A;  4HRE E;  4HSZ A;  4HRH A;  3FIA A;  1PRW A;  2HQW A;  1CM4 A;  1DF0 B;  3FWB A;  2B1U A;  3JVT C;  1BMO A;  5BPJ A;  1B1G A;  1J7O A;  2JT0 A;  1RTP 1;  3D0Y B;  3SIB A;  2OPO A;  4YI8 A;  1PK0 D;  3C1V A;  1S6C A;  2ZRT A;  3OB1 B;  3O4Y A;  2KQ6 A;  2LAN A;  4NDD A;  1BG1 A;  1IKU A;  1TIZ A;  1CDN A;  3BYA A;  1WLZ A;  1XO5 A;  2JNX A;  1MWN A;  5I2L A;  4ICB A;  4YBH B;  4DIR A;  1NCY A;  3I5I B;  1J1D A;  3PN7 B;  4AQI A;  5HKW A;  4YI9 A;  1KWO B;  1F8H A;  1NX2 A;  4PAL A;  5AER A;  1OMV A;  1N65 A;  2BL0 C;  3WNX B;  1DJW A;  1V1G A;  3OX6 A;  1SL7 A;  3PFV A;  1GQM A;  1CDL A;  1F4Q A;  1LXF C;  1EJ3 A;  1EG4 A;  1ZFS A;  2GGM A;  2M1U A;  4JWQ A;  4ORC B;  4QJ4 B;  2L2E A;  1NSH A;  1QIV A;  1S1E A;  1KFX L;  2JOJ A;  1NCX A;  2Y4Q A;  4AQJ A;  1IQ3 A;  2G2B A;  1LA0 A;  1S6J A;  1KFU S;  1CFF A;  1CLL A;  1QJT A;  1UHK A;  3D10 A;  4GFT A;  2LLU A;  4TNC A;  4ZCV A;  2JU0 A;  1UWO A;  2KAX A;  3TS5 B;  1SRA A;  2LP2 A;  1QAS A;  1QTX A;  1BOC A;  2KBM A;  4PE0 A;  3CLN A;  2ZRS A;  1SCM C;  1S5G Y;  2TN4 A;  4MVF A;  1AHR A;  4GGN A;  4P5O E;  1K2H A;  1XVJ A;  2EGD A;  3E3R A;  4M2Q A;  1M39 A;  3VRP A;  2K7D A;  2LVJ A;  4N5X A;  5HLV A;  1SK6 D;  2KFH A;  5D69 A;  1UP5 A;  1M31 A;  4QJ3 B;  1EL4 A;  1TCO B;  2F2O A;  2Y5I A;  3NSO A;  1IH0 A;  2BBN A;  4C0L A;  3WXA A;  1TTX A;  1UUR A;  2KNE A;  4YRU A;  2K2F A;  2GV5 A;  1K96 A;  1ZAC A;  1XFW O;  3CWG A;  1QLS A;  2OTG B;  1M45 A;  2F8P A;  4HRG A;  5CSI A;  5I2O A;  3BUO B;  1SNL A;  2BKI B;  1BT6 A;  2EC6 C;  2JXL A;  2ZN9 A;  5F6T A;  2ZKM X;  1CLB A;  1B8R A;  3CS1 A;  3DVJ A;  4CPV A;  1A03 A;  2VRG A;  1KK8 B;  4GUK A;  1DGU A;  3AKB A;  1EXR A;  3CTN A;  3LCP C;  1BLQ A;  1IRJ A;  2MHH A;  1PSB A;  1SPY A;  5DKQ A;  1B8C A;  1XFX O;  4DRW A;  5I2Q A;  1CKK A;  1WLM A;  5I8N A;  4A4C A;  1JBA A;  2PAL A;  2WND A;  1X02 A;  4MZK A;  3SJS A;  1YRT B;  1JC2 A;  1G4Y R;  1J7R A;  1PVB A;  3BUN B;  2CCM A;  1NX1 A;  1B8L A;  2JT3 A;  1S36 A;  1TNX A;  3NXA A;  4CFR A;  1XFV O;  1QAT A;  3EVU A;  3KF9 A;  2KGR A;  4FQO A;  4PDZ A;  2WOR A;  3AAK A;  4Q04 A;  1J7P A;  1Y0V H;  4CID A;  2F33 A;  2PRU A;  3OB2 B;  3TS5 C;  2HF5 A;  1XFY O;  3F45 A;  1MQ1 A;  2H2K A;  2M3W A;  1F71 A;  2L98 A;  1K8U A;  1C7W A;  4PHN A;  4XJK A;  1H8B A;  1NX0 A;  1XYD A;  3GOF A;  4U8D A;  2HET A;  2LLS A;  4XYN A;  3EKH A;  5K89 A;  1CFC A;  4NDB A;  1QVI Y;  1TRF A;  4ZCU A;  1JF2 A;  3VGO A;  1QX2 A;  3TZ1 A;  1CMG A;  4USL A;  3GK4 X;  3BXK A;  3EVV A;  2KFF A;  2WC8 A;  4MN0 A;  1F55 A;  1AJ5 A;  2KBI A;  2HPS A;  2NLN A;  1TN4 A;  3BQ3 A;  1A75 A;  4DS7 A;  3I5I C;  2Q4U A;  1K95 A;  1QVI Z;  4R1E A;  1UHJ A;  1DTL A;  5HKY A;  4WQ2 A;  2KAY A;  4PHM A;  5AAN A;  4YGC B;  2M1K B;  1B7T Y;  2Y1N A;  1LIN A;  1NX3 A;  4N1F A;  5JOL A;  1N2D A;  3I5G B;  5J3X A;  1FF1 A;  3FWC A;  1WRZ A;  2FCD A;  1W7J B;  2P6B B;  2MBX A;  3GK1 A;  1TNP A;  2HQ8 A;  2COL B;  1NPQ A;  3AAJ A;  2KI6 C;  1B7T Z;  4I5K A;  2CT9 A;  2L4H A;  2M97 A;  2O60 A;  2WOS A;  3RM1 A;  3IQQ A;  2M8U A;  3DF0 A;  1V1F A;  1KQM B;  1SKT A;  1TCF A;  2JTT A;  4M2O A;  2SCP A;  1YUU A;  2BCA A;  1S6I A;  2LLT A;  4GGF A;  4E68 A;  5HKZ A;  1JSA A;  1FBV A;  1MHO A;  1YVH A;  4PE7 A;  1MXL C;  2K7C A;  1QXP A;  2EHB A;  1YX7 A;  2JT8 A;  4YGD B;  1BOD A;  1SY9 A;  1KWO C;  3OX5 A;  1OOJ A;  3KPX A;  5HYD A;  3PN7 C;  3VRQ A;  1XFZ O;  2L51 A;  2ZND A;  1C07 A;  1WDC C;  2SAS A;  5CPV A;  2FJU B;  1CLM A;  2JPT A;  1WDC B;  1Y1X A;  2PVB A;  4ORA B;  5TNC A;  2KYC A;  1KK7 Z;  5PAL A;  2BKH B;  2AUC A;  1ZUZ A;  1QV1 A;  1B9A A;  1JF0 A;  2I2R E;  2ZFD A;  4DCK A;  1BJF A;  1SR6 C;  1S3P A;  4N1G A;  1SW8 A;  1K9P A;  3BUX B;  3DVM A;  4OKH A;  5GQQ C;  1J55 A;  4FTG A;  1A4P A;  2LHL A;  4GNK B;  1AUI B;  1A29 A;  1PVA A;  1KQM C;  4CFQ A;  1F54 A;  1HT9 A;  2A4J A;  1IQ5 A;  2JRF A;  3LLE A;  1AVS A;  2BEC A;  2PAS A;  1IJ6 A;  2F3Y A;  2KDH A;  4MRY A;  1GGZ A;  2M7N A;  1J1E A;  2L0P A;  3KO0 A;  1RFJ A;  1LA3 A;  2MJW B;  4PCW A;  3I5H C;  1BF5 A;  2H61 C;  2K7O A;  5IBW A;  1OSA A;  1NYA A;  1R2U A;  5ER5 A;  3KEV A;  1AK8 A;  2LHI A;  2NCO A;  1RRO A;  2L5X B;  3JTD C;  4IL1 A;  2MAZ A;  5KTY A;  2K7B A;  1J7Q A;  1LVC D;  1FW4 A;  1Y1A A;  4WQ3 A;  2K61 A;  2H61 A;  2QAC A;  1CNP A;  2CTN A;  5G08 A;  2I18 A;  3MSE B;  2LM5 A;  3BUM B;  3VRR A;  4A4B A;  3K21 A;  2RGI A;  1CFD A;  1JFK A;  3CZT X;  3O6B A;  2LV7 A;  1G8I A;  3ICB A;  1OQP A;  1YUS A;  3H4S E;  1MF8 B;  2KHN A;  1WRK A;  2JWW A;  3BOW B;  1IG5 A;  3I5G C;  1K9K A;  1IJ5 A;  1Y1U A;  1KSM A;  3RLZ A;  1K93 D;  3DVE A;  1YUT A;  1YR5 A;  5AEQ A;  4ETO A;  5ER4 X;  1DJG A;  5B8I B;  1GGW A;  4C0K A;  1SBJ A;  2KSP A;  1VRK A;  2M9G A;  2FCE A;  2LAP A;  1XA5 A;  2LUC A;  3QRX A;  3SG5 A;  4NQG A;  4UPG A;  1PSR A;  2JC2 A;  2CBL A;  4C0J A;  3SG3 A;  1QS7 A;  4I5N B;  1KQV A;  1SL9 A;  3EK8 A;  2AMI A;  1AJ4 A;  3NSI A;  1DGV A;  4YGB B;  3VRN A;  1CB1 A;  3EVR A;  2E6W A;  3WHU B;  1CFP A;  1UUS A;  1OE9 B;  1A2X A;  3ZWH A;  1L2O C;  1PUL A;  2LC5 A;  2KGB C;  3IF7 A;  2IS9 A;  2LVK A;  1W7I B;  1RJV A;  2BCX A;  2OTG C;  5AXI A;  3TDZ A;  1S5G Z;  3GK2 A;  2KQY A;  1JWD A;  3BUW B;  2M0R A;  3EKJ A;  3HCM A;  1C7V A;  3HX4 A;  1OZO A;  2L50 A;  2OS8 C;  3LK0 A;  1DMO A;  3KHE A;  3OP0 A;  2O5G A;  1AP4 A;  1K90 D;  1FI5 A;  2QPT A;  1YUR A;  3ZNI A;  1TOP A;  2NCP A;  3O2P A;  4XJK B;  2LMU A;  3TUY C;  1F4O A;  3A4U B;  1SCM B;  3D0Y A;  3TUY B;  4BY4 A;  1MUX A;  4PHK A;  1DJY A;  1TNQ A;  3SG7 A;  2JNF A;  2CXJ A;  4NDC A;  3M0W A;  1YX8 A;  1UHN A;  2OS8 B;  4MRX A;  1A75 B;  1CM1 A;  3PSR A;  1HQV A;  4BY5 A;  1M46 A;  3I5F C;  2L4I A;  3IQO A;  4CLN A;  1KSO A;  2LUX A;  1KK8 C;  4YGE B;  2NXQ A;  1CTR A;  4M2P A;  4L9M A;  4MSP A;  3TDI A;  5KU1 A;  1FPW A;  2CNP A;  2EC6 B;  1IGV A;  1XFU O;  2D8N A;  1ALV A; 
#chains in the Genus database with same CATH topology
 1CDM A;  2BBM A;  2PSR A;  3SG6 A;  4PHJ A;  3O78 A;  1ALW A;  2JUL A;  2KAV A;  3CR5 X;  2WCE A;  1ODB A;  1U5I A;  4F7F A;  2LVI A;  2WC6 A;  3I5F B;  2BL0 B;  2NZ0 A;  1DJX A;  2ISD A;  3PAL A;  4P2Y B;  3SS5 A;  3EK4 A;  2ZN8 A;  3DVK A;  2LMV A;  4GAO A;  2MLE C;  1S26 D;  1TNW A;  1QX5 B;  4I5J A;  1QX7 A;  1K94 A;  2MLF C;  5CSJ A;  1EG3 A;  1NP8 A;  1RWY A;  1GJY A;  1LS8 A;  1F70 A;  1G33 A;  3PM8 A;  2I94 A;  3DF0 B;  1B4C A;  1JUO A;  2I7A A;  1EH2 A;  3TDU A;  1UHI A;  2AAO A;  1REC A;  1ZOT B;  2JTZ A;  1DT7 B;  3SIA A;  5D7F A;  1SMG A;  3R1P A;  1BU3 A;  1M63 B;  1QV0 A;  1OZS A;  2PMY A;  2PQL A;  2Y1M A;  3FE8 A;  4D1E A;  1KCY A;  3EK7 A;  3JVT B;  1NIW A;  2E30 A;  3PLF B;  5DIC A;  1YTZ C;  3N7H A;  1Q80 A;  4JD9 A;  1CMF A;  4YGA A;  1DJZ A;  4OVN F;  1L2O B;  4OV2 A;  2LE9 B;  1KK7 Y;  2V53 A;  1NCZ A;  1NWD A;  4JPZ B;  3CGA A;  1WRL A;  4FQT A;  4AOM A;  2BCB A;  2M7L A;  2G9B A;  1YRU B;  1SL8 A;  1BR4 B;  4GBA A;  1CDP A;  1SCV A;  2JZI A;  3D77 A;  3JTD B;  3PM2 A;  1WY9 A;  2FOT A;  3FS7 A;  1OMR A;  3D74 A;  4INW A;  2JXC A;  3NSK A;  2KI4 B;  2BE6 A;  1DF0 A;  3NSL A;  4OR9 B;  4MBE A;  3S0G A;  2KI6 D;  2M29 A;  4JQ0 D;  4MLW A;  1DJI A;  4QJ5 B;  4PE4 A;  4GGF C;  1TWO A;  1MXE A;  1B47 A;  3I5H B;  1ZMZ A;  2GGZ A;  1L7Z A;  2KFG A;  1QIW A;  3BFA A;  1U5I B;  3PAT A;  2FJY A;  1K9U A;  5D3O A;  2K2A A;  3LK1 A;  1PAL A;  5FYX A;  2K8M B;  3WHT B;  3LL8 B;  1IWQ A;  2BE4 A;  5CSF A;  2P71 A;  3OHM B;  2F2P A;  4I5L B;  3CR4 X;  4PE1 A;  3CR2 A;  3OBV A;  4OCI A;  5I94 A;  2WCF A;  3CZ1 A;  2DOQ A;  1DJH A;  1SYM A;  3DD4 A;  1YVL A;  3NHT A;  1RK9 A;  3BOW A;  2QEB A;  1QLK A;  3A8R A;  4GPL B;  1H4B A;  3SG2 A;  2R2I A;  2K0J A;  3AKA A;  1SR6 B;  2MRD A;  4ORB B;  3S0F A;  3D76 A;  5HLO A;  5KSZ A;  2JQ6 A;  5DKN A;  1LKJ A;  4F0Z B;  4MEW A;  2F3Z A;  4DUQ A;  1KFX S;  2LMT A;  1NUB A;  4MZJ A;  1E8A A;  1JFJ A;  1UHH A;  1R6P A;  1MR8 A;  1XK4 A;  2MA2 A;  2KI4 C;  5HL1 A;  2M49 B;  2KYF A;  5AFP A;  1N0Y A;  1FI6 A;  1Y6W A;  2LCP A;  1DQE A;  5CSN A;  3D75 A;  2QDI A;  1BR1 B;  2WCB A;  1KFU L;  2ZNE A;  5JJG A;  1DVI A;  2LP3 A;  2LVV A;  3CYZ A;  2Q91 A;  1D1O A;  5DKR A;  3VRO A;  4WRI A;  3R1O A;  4MZL A;  2KOT A;  1XK4 C;  3SG4 A;  2LNK A;  1TUJ A;  1OMD A;  4HRE E;  2WCH A;  4HSZ A;  4HRH A;  3FIA A;  1PRW A;  2HQW A;  1CM4 A;  1DF0 B;  1IIO A;  3FWB A;  2B1U A;  3JVT C;  1BMO A;  3B7A A;  5BPJ A;  1B1G A;  1J7O A;  2JT0 A;  1RTP 1;  3D0Y B;  3SIB A;  2OPO A;  4YI8 A;  1PK0 D;  3C1V A;  1C3Z A;  1S6C A;  2ZRT A;  3OB1 B;  3O4Y A;  2KQ6 A;  2LAN A;  4NDD A;  1BG1 A;  1IKU A;  1TIZ A;  1CDN A;  3BYA A;  1WLZ A;  4KYN A;  1XO5 A;  3CAB A;  2JNX A;  3BFB A;  1MWN A;  5I2L A;  4ICB A;  4YBH B;  4DIR A;  1NCY A;  2L2C A;  3I5I B;  1J1D A;  3PN7 B;  4AQI A;  1OW4 A;  5HKW A;  2KPH A;  4YI9 A;  1KWO B;  1F8H A;  1NX2 A;  4PAL A;  5FI6 A;  5AER A;  1OMV A;  1N65 A;  2BL0 C;  3WNX B;  2WCM A;  1DJW A;  1V1G A;  3OX6 A;  1SL7 A;  3NHI A;  3PFV A;  1GQM A;  1CDL A;  1F4Q A;  1LXF C;  1EJ3 A;  1EG4 A;  1ZFS A;  2GGM A;  2M1U A;  4JWQ A;  4ORC B;  4QJ4 B;  1DEL A;  3O4X A;  2L2E A;  1NSH A;  1QIV A;  1S1E A;  1KFX L;  2JOJ A;  1NCX A;  2Y4Q A;  3S0E A;  4AQJ A;  2G2B A;  1IQ3 A;  1LA0 A;  1S6J A;  1KFU S;  1CFF A;  1CLL A;  1QJT A;  1UHK A;  3D10 A;  4GFT A;  2LLU A;  4TNC A;  5FI7 A;  1TUZ A;  2JU0 A;  1UWO A;  2KAX A;  4ZCV A;  3TS5 B;  1SRA A;  2LP2 A;  1QAS A;  1QTX A;  1BOC A;  2KBM A;  3B6X A;  4PE0 A;  1W9Z A;  3CLN A;  2ZRS A;  1SCM C;  1S5G Y;  2TN4 A;  4MVF A;  1AHR A;  4GGN A;  4P5O E;  3V2L A;  1K2H A;  1XVJ A;  2EGD A;  3E3R A;  4M2Q A;  1M39 A;  3VRP A;  1Z2C B;  2K7D A;  2LVJ A;  4N5X A;  5HLV A;  1SK6 D;  2KFH A;  5D69 A;  3DXL A;  1UP5 A;  1M31 A;  2WCJ A;  4QJ3 B;  1EL4 A;  1TCO B;  2F2O A;  2Y5I A;  3NSO A;  1IH0 A;  2BBN A;  4C0L A;  3WXA A;  1TTX A;  1UUR A;  2KNE A;  4YRU A;  2K2F A;  1ZAC A;  1K96 A;  2GV5 A;  1XFW O;  3CWG A;  1QLS A;  2K60 A;  1M45 A;  2F8P A;  2OTG B;  4HRG A;  5CSI A;  3BUO B;  5I2O A;  1SNL A;  2BKI B;  1BT6 A;  2EC6 C;  2JXL A;  2ZN9 A;  5F6T A;  2ZKM X;  1CLB A;  1B8R A;  3CS1 A;  2H8V A;  3DVJ A;  4CPV A;  1A03 A;  3L47 A;  2VRG A;  1KK8 B;  4GUK A;  1DGU A;  3AKB A;  1EXR A;  3CTN A;  3LCP C;  1BLQ A;  1IRJ A;  2MHH A;  1PSB A;  1SPY A;  5DKQ A;  1B8C A;  1XFX O;  4DRW A;  5I2Q A;  1CKK A;  1WLM A;  5I8N A;  4A4C A;  1JBA A;  2PAL A;  2WND A;  3CDN A;  3VB1 A;  1X02 A;  4MZK A;  3SJS A;  1YRT B;  1JC2 A;  1G4Y R;  1J7R A;  1PVB A;  3BUN B;  2CCM A;  1NX1 A;  1B8L A;  2JT3 A;  1S36 A;  1TNX A;  3NXA A;  4CFR A;  3B87 A;  1XFV O;  1QAT A;  3EVU A;  3KF9 A;  2KGR A;  4FQO A;  4PDZ A;  2WOR A;  2WCK A;  3AAK A;  4Q04 A;  3DZT A;  1J7P A;  2QEO A;  1Y0V H;  4CID A;  2F33 A;  2PRU A;  3OB2 B;  3TS5 C;  2HF5 A;  1XFY O;  3F45 A;  1MQ1 A;  2H2K A;  2M3W A;  1F71 A;  2L98 A;  1K8U A;  1C7W A;  4PHN A;  4XJK A;  1H8B A;  1NX0 A;  3IVT A;  1XYD A;  3GOF A;  4U8D A;  2HET A;  2LLS A;  4XYN A;  3EKH A;  5K89 A;  1CFC A;  4NDB A;  3FE6 A;  1QVI Y;  1TRF A;  4ZCU A;  1JF2 A;  1C3Y A;  3VGO A;  1QX2 A;  3TZ1 A;  1CMG A;  4USL A;  3GK4 X;  1P28 A;  3BXK A;  3EVV A;  2KFF A;  2WC8 A;  4MN0 A;  1F55 A;  1AJ5 A;  2KBI A;  2HPS A;  2NLN A;  4JKT A;  1TN4 A;  3BQ3 A;  1A75 A;  4DS7 A;  3I5I C;  2Q4U A;  1K95 A;  1QVI Z;  4R1E A;  1UHJ A;  1DTL A;  5HKY A;  4WQ2 A;  2KAY A;  4PHM A;  2BAP A;  3PJI A;  5AAN A;  4YGC B;  2M1K B;  1B7T Y;  1QWV A;  2Y1N A;  1LIN A;  3K1E A;  1NX3 A;  4N1F A;  5JOL A;  1N2D A;  3I5G B;  5J3X A;  1FF1 A;  3FWC A;  1WRZ A;  2FCD A;  5EL2 A;  1OOG A;  1W7J B;  1SSE B;  2KLE A;  2P6B B;  3GK1 A;  2MBX A;  1TNP A;  2HQ8 A;  2COL B;  1NPQ A;  3AAJ A;  2KI6 C;  1B7T Z;  4I5K A;  3RZS A;  2CT9 A;  2L4H A;  2M97 A;  3UNW A;  2O60 A;  3DYE A;  2WOS A;  3RM1 A;  3IQQ A;  2M8U A;  3B88 A;  1V1F A;  3DF0 A;  1KQM B;  1SKT A;  1TCF A;  2JTT A;  4M2O A;  2SCP A;  5FI2 A;  1YUU A;  2BCA A;  1S6I A;  2LLT A;  3FE9 A;  3D73 A;  4GGF A;  5HKZ A;  4E68 A;  1JSA A;  1FBV A;  1MHO A;  1YVH A;  2WCL A;  4PE7 A;  1MXL C;  2JPO A;  2K7C A;  1QXP A;  2EHB A;  1YX7 A;  2JT8 A;  4YGD B;  1BOD A;  1SY9 A;  1KWO C;  1DEK A;  3OX5 A;  1OOJ A;  3KPX A;  5HYD A;  3PN7 C;  3VRQ A;  1XFZ O;  2L51 A;  2ZND A;  1C07 A;  1WDC C;  2SAS A;  5CPV A;  2FJU B;  1CLM A;  2WC5 A;  2JPT A;  1WDC B;  1Y1X A;  3Q8I A;  4IJ7 A;  2PVB A;  4ORA B;  5TNC A;  2KYC A;  1KK7 Z;  5PAL A;  2BKH B;  2AUC A;  1ZUZ A;  4INX A;  1QV1 A;  1B9A A;  1JF0 A;  2I2R E;  2BNX A;  2ZFD A;  3CZ2 A;  4DCK A;  1BJF A;  1SR6 C;  1S3P A;  4N1G A;  1SW8 A;  1K9P A;  3BUX B;  3DVM A;  4OKH A;  5GQQ C;  1J55 A;  4FTG A;  3BJH A;  1A4P A;  2LHL A;  4GNK B;  1AUI B;  1A29 A;  1PVA A;  1KQM C;  4CFQ A;  1F54 A;  2L5Y A;  1HT9 A;  1IQ5 A;  2A4J A;  2JRF A;  3LLE A;  3R1V A;  1AVS A;  2BEC A;  2PAS A;  1IJ6 A;  2F3Y A;  2KDH A;  4MRY A;  1GGZ A;  1OOF A;  2M7N A;  1J1E A;  2L0P A;  3KO0 A;  1RFJ A;  1LA3 A;  2MJW B;  4PCW A;  3I5H C;  2PYQ A;  2KLD A;  3D78 A;  2YGU A;  1BF5 A;  2H61 C;  2K7O A;  3S0A A;  5IBW A;  1OSA A;  1NYA A;  3L4L A;  3BFH A;  1R2U A;  5ER5 A;  3KEV A;  1AK8 A;  3S0B A;  2LHI A;  2NCO A;  1RRO A;  2L5X B;  3JTD C;  4IL1 A;  2MAZ A;  5KTY A;  2K7B A;  1J7Q A;  1LVC D;  1FW4 A;  1Y1A A;  1Z4H A;  4WQ3 A;  2K61 A;  2H61 A;  2QAC A;  1CNP A;  2CTN A;  5G08 A;  2I18 A;  3EG5 B;  3MSE B;  2LM5 A;  3BUM B;  3VRR A;  4A4B A;  2GTE A;  3K21 A;  1ORG A;  3R72 A;  2RGI A;  1CFD A;  1JFK A;  3CZT X;  3O6B A;  2LV7 A;  1G8I A;  3ICB A;  1OQP A;  1YUS A;  3H4S E;  1MF8 B;  2KHN A;  3SS4 A;  1WRK A;  1T14 A;  2JWW A;  3BOW B;  4OZD A;  1IG5 A;  3I5G C;  1K9K A;  1IJ5 A;  1Y1U A;  1KSM A;  3RLZ A;  1K93 D;  1OOI X;  1YUT A;  1YR5 A;  3DVE A;  5AEQ A;  4ETO A;  2ERB A;  5ER4 X;  1DJG A;  5B8I B;  1GGW A;  4C0K A;  1SBJ A;  2KSP A;  1VRK A;  2M9G A;  2FCE A;  2LAP A;  3L4A A;  1XA5 A;  2LUC A;  3QRX A;  3SG5 A;  4NQG A;  4UPG A;  1PSR A;  2JC2 A;  2CBL A;  4C0J A;  3SG3 A;  1QS7 A;  1GM0 A;  4I5N B;  1KQV A;  1SL9 A;  3EK8 A;  4PT1 A;  2AMI A;  1AJ4 A;  3NSI A;  1DGV A;  4YGB B;  3VRN A;  1CB1 A;  3EVR A;  2E6W A;  3WHU B;  1CFP A;  1UUS A;  1OE9 B;  1A2X A;  3NGV A;  3ZWH A;  1L2O C;  1PUL A;  2LC5 A;  2KGB C;  3IF7 A;  2IS9 A;  2LVK A;  1W7I B;  2BCX A;  1RJV A;  2OTG C;  1OOH A;  5AXI A;  3TDZ A;  1S5G Z;  3GK2 A;  1DC1 A;  2KQY A;  1JWD A;  3BUW B;  2QEH A;  2M0R A;  3EKJ A;  3HCM A;  1C7V A;  3B86 A;  3HX4 A;  1OZO A;  2L50 A;  2OS8 C;  3LK0 A;  2P70 A;  1DMO A;  3CZ0 A;  1XFR A;  2O5G A;  3KHE A;  3OP0 A;  1AP4 A;  1K90 D;  1FI5 A;  3S0D A;  2QPT A;  1YUR A;  3DY9 A;  3ZNI A;  1TOP A;  3OGN A;  2NCP A;  3O2P A;  4XJK B;  2LMU A;  3TUY C;  1F4O A;  3A4U B;  1SCM B;  3D0Y A;  3TUY B;  4BY4 A;  1MUX A;  4PHK A;  1DJY A;  1TNQ A;  3SG7 A;  2JNF A;  2CXJ A;  4NDC A;  3M0W A;  2QEV A;  1YX8 A;  1UHN A;  2OS8 B;  4MRX A;  1A75 B;  3QME A;  1CM1 A;  3PSR A;  1HQV A;  4BY5 A;  1M46 A;  3I5F C;  3UO9 A;  2L4I A;  3IQO A;  4CLN A;  1KSO A;  2LUX A;  1KK8 C;  4YGE B;  2NXQ A;  1CTR A;  4M2P A;  4L9M A;  4MSP A;  3TDI A;  5KU1 A;  1FPW A;  3SS3 A;  2CNP A;  2EC6 B;  1IGV A;  1XFU O;  2D8N A;  1ALV A; 
#chains in the Genus database with same CATH homology
 1CDM A;  2BBM A;  2PSR A;  3SG6 A;  4PHJ A;  3O78 A;  1ALW A;  2JUL A;  2KAV A;  3CR5 X;  2WCE A;  1ODB A;  1U5I A;  2LVI A;  3I5F B;  2BL0 B;  2NZ0 A;  1DJX A;  2ISD A;  3PAL A;  4P2Y B;  3EK4 A;  2ZN8 A;  3DVK A;  2LMV A;  4GAO A;  2MLE C;  1S26 D;  1TNW A;  1QX5 B;  4I5J A;  1QX7 A;  1K94 A;  2MLF C;  5CSJ A;  1EG3 A;  1NP8 A;  1RWY A;  1GJY A;  1F70 A;  1G33 A;  3PM8 A;  2I94 A;  3DF0 B;  1B4C A;  1JUO A;  2I7A A;  1EH2 A;  3TDU A;  1UHI A;  2AAO A;  1REC A;  1ZOT B;  2JTZ A;  1DT7 B;  3SIA A;  5D7F A;  1SMG A;  1BU3 A;  1M63 B;  1QV0 A;  1OZS A;  2PMY A;  2Y1M A;  1KCY A;  4D1E A;  3EK7 A;  3JVT B;  1NIW A;  2E30 A;  3PLF B;  1YTZ C;  1Q80 A;  1CMF A;  4YGA A;  1DJZ A;  4OVN F;  1L2O B;  4OV2 A;  2LE9 B;  1KK7 Y;  2V53 A;  1NCZ A;  1NWD A;  4JPZ B;  3CGA A;  1WRL A;  4AOM A;  2BCB A;  2M7L A;  2G9B A;  1YRU B;  1SL8 A;  1BR4 B;  4GBA A;  1CDP A;  1SCV A;  2JZI A;  3JTD B;  1WY9 A;  2FOT A;  3FS7 A;  1OMR A;  2JXC A;  3NSK A;  2KI4 B;  2BE6 A;  1DF0 A;  3NSL A;  4OR9 B;  4MBE A;  2KI6 D;  2M29 A;  4JQ0 D;  4MLW A;  1DJI A;  4QJ5 B;  4PE4 A;  4GGF C;  1MXE A;  1B47 A;  3I5H B;  1ZMZ A;  2GGZ A;  1L7Z A;  2KFG A;  1QIW A;  3PAT A;  1U5I B;  1K9U A;  5FYX A;  2K2A A;  3LK1 A;  1PAL A;  2K8M B;  3WHT B;  3LL8 B;  1IWQ A;  2BE4 A;  5CSF A;  3OHM B;  2F2P A;  4I5L B;  3CR4 X;  4PE1 A;  3CR2 A;  4OCI A;  2WCF A;  2DOQ A;  1DJH A;  1SYM A;  3DD4 A;  1YVL A;  1RK9 A;  3BOW A;  1QLK A;  3A8R A;  4GPL B;  1H4B A;  3SG2 A;  2R2I A;  2K0J A;  3AKA A;  1SR6 B;  2MRD A;  4ORB B;  5HLO A;  5KSZ A;  2JQ6 A;  5DKN A;  1LKJ A;  4F0Z B;  4MEW A;  2F3Z A;  4DUQ A;  1KFX S;  2LMT A;  1NUB A;  4MZJ A;  1E8A A;  1JFJ A;  1UHH A;  1R6P A;  1MR8 A;  1XK4 A;  2MA2 A;  2KI4 C;  2M49 B;  2KYF A;  5AFP A;  1N0Y A;  1FI6 A;  1Y6W A;  2LCP A;  5CSN A;  1BR1 B;  2WCB A;  1KFU L;  2ZNE A;  5JJG A;  1DVI A;  2LP3 A;  2LVV A;  2Q91 A;  1D1O A;  5DKR A;  3VRO A;  4WRI A;  3SG4 A;  4MZL A;  2KOT A;  1XK4 C;  2LNK A;  1OMD A;  4HRE E;  4HSZ A;  4HRH A;  3FIA A;  1PRW A;  2HQW A;  1CM4 A;  1DF0 B;  3FWB A;  2B1U A;  3JVT C;  1BMO A;  5BPJ A;  1B1G A;  1J7O A;  2JT0 A;  1RTP 1;  3D0Y B;  3SIB A;  2OPO A;  4YI8 A;  1PK0 D;  3C1V A;  1S6C A;  2ZRT A;  3OB1 B;  3O4Y A;  2KQ6 A;  2LAN A;  4NDD A;  1BG1 A;  1IKU A;  1TIZ A;  1CDN A;  3BYA A;  1WLZ A;  1XO5 A;  2JNX A;  1MWN A;  5I2L A;  4ICB A;  4YBH B;  4DIR A;  1NCY A;  3I5I B;  1J1D A;  3PN7 B;  4AQI A;  5HKW A;  4YI9 A;  1KWO B;  1F8H A;  1NX2 A;  4PAL A;  5AER A;  1OMV A;  1N65 A;  2BL0 C;  3WNX B;  1DJW A;  1V1G A;  3OX6 A;  1SL7 A;  3PFV A;  1GQM A;  1CDL A;  1F4Q A;  1LXF C;  1EJ3 A;  1EG4 A;  1ZFS A;  2GGM A;  2M1U A;  4JWQ A;  4ORC B;  4QJ4 B;  2L2E A;  1NSH A;  1QIV A;  1S1E A;  1KFX L;  2JOJ A;  1NCX A;  2Y4Q A;  4AQJ A;  1IQ3 A;  2G2B A;  1LA0 A;  1S6J A;  1KFU S;  1CFF A;  1CLL A;  1QJT A;  1UHK A;  3D10 A;  4GFT A;  2LLU A;  4TNC A;  4ZCV A;  2JU0 A;  1UWO A;  2KAX A;  3TS5 B;  1SRA A;  2LP2 A;  1QAS A;  1QTX A;  1BOC A;  2KBM A;  4PE0 A;  3CLN A;  2ZRS A;  1SCM C;  1S5G Y;  2TN4 A;  4MVF A;  1AHR A;  4GGN A;  4P5O E;  1K2H A;  1XVJ A;  2EGD A;  3E3R A;  4M2Q A;  1M39 A;  3VRP A;  2K7D A;  2LVJ A;  4N5X A;  5HLV A;  1SK6 D;  2KFH A;  5D69 A;  1UP5 A;  1M31 A;  4QJ3 B;  1EL4 A;  1TCO B;  2F2O A;  2Y5I A;  3NSO A;  1IH0 A;  2BBN A;  4C0L A;  3WXA A;  1TTX A;  1UUR A;  2KNE A;  4YRU A;  2K2F A;  2GV5 A;  1K96 A;  1ZAC A;  1XFW O;  3CWG A;  1QLS A;  2OTG B;  1M45 A;  2F8P A;  4HRG A;  5CSI A;  5I2O A;  3BUO B;  1SNL A;  2BKI B;  1BT6 A;  2EC6 C;  2JXL A;  2ZN9 A;  5F6T A;  2ZKM X;  1CLB A;  1B8R A;  3CS1 A;  3DVJ A;  4CPV A;  1A03 A;  2VRG A;  1KK8 B;  4GUK A;  1DGU A;  3AKB A;  1EXR A;  3CTN A;  3LCP C;  1BLQ A;  1IRJ A;  2MHH A;  1PSB A;  1SPY A;  5DKQ A;  1B8C A;  1XFX O;  4DRW A;  5I2Q A;  1CKK A;  1WLM A;  5I8N A;  4A4C A;  1JBA A;  2PAL A;  2WND A;  1X02 A;  4MZK A;  3SJS A;  1YRT B;  1JC2 A;  1G4Y R;  1J7R A;  1PVB A;  3BUN B;  2CCM A;  1NX1 A;  1B8L A;  2JT3 A;  1S36 A;  1TNX A;  3NXA A;  4CFR A;  1XFV O;  1QAT A;  3EVU A;  3KF9 A;  2KGR A;  4FQO A;  4PDZ A;  2WOR A;  3AAK A;  4Q04 A;  1J7P A;  1Y0V H;  4CID A;  2F33 A;  2PRU A;  3OB2 B;  3TS5 C;  2HF5 A;  1XFY O;  3F45 A;  1MQ1 A;  2H2K A;  2M3W A;  1F71 A;  2L98 A;  1K8U A;  1C7W A;  4PHN A;  4XJK A;  1H8B A;  1NX0 A;  1XYD A;  3GOF A;  4U8D A;  2HET A;  2LLS A;  4XYN A;  3EKH A;  5K89 A;  1CFC A;  4NDB A;  1QVI Y;  1TRF A;  4ZCU A;  1JF2 A;  3VGO A;  1QX2 A;  3TZ1 A;  1CMG A;  4USL A;  3GK4 X;  3BXK A;  3EVV A;  2KFF A;  2WC8 A;  4MN0 A;  1F55 A;  1AJ5 A;  2KBI A;  2HPS A;  2NLN A;  1TN4 A;  3BQ3 A;  1A75 A;  4DS7 A;  3I5I C;  2Q4U A;  1K95 A;  1QVI Z;  4R1E A;  1UHJ A;  1DTL A;  5HKY A;  4WQ2 A;  2KAY A;  4PHM A;  5AAN A;  4YGC B;  2M1K B;  1B7T Y;  2Y1N A;  1LIN A;  1NX3 A;  4N1F A;  5JOL A;  1N2D A;  3I5G B;  5J3X A;  1FF1 A;  3FWC A;  1WRZ A;  2FCD A;  1W7J B;  2P6B B;  2MBX A;  3GK1 A;  1TNP A;  2HQ8 A;  2COL B;  1NPQ A;  3AAJ A;  2KI6 C;  1B7T Z;  4I5K A;  2CT9 A;  2L4H A;  2M97 A;  2O60 A;  2WOS A;  3RM1 A;  3IQQ A;  2M8U A;  3DF0 A;  1V1F A;  1KQM B;  1SKT A;  1TCF A;  2JTT A;  4M2O A;  2SCP A;  1YUU A;  2BCA A;  1S6I A;  2LLT A;  4GGF A;  4E68 A;  5HKZ A;  1JSA A;  1FBV A;  1MHO A;  1YVH A;  4PE7 A;  1MXL C;  2K7C A;  1QXP A;  2EHB A;  1YX7 A;  2JT8 A;  4YGD B;  1BOD A;  1SY9 A;  1KWO C;  3OX5 A;  1OOJ A;  3KPX A;  5HYD A;  3PN7 C;  3VRQ A;  1XFZ O;  2L51 A;  2ZND A;  1C07 A;  1WDC C;  2SAS A;  5CPV A;  2FJU B;  1CLM A;  2JPT A;  1WDC B;  1Y1X A;  2PVB A;  4ORA B;  5TNC A;  2KYC A;  1KK7 Z;  5PAL A;  2BKH B;  2AUC A;  1ZUZ A;  1QV1 A;  1B9A A;  1JF0 A;  2I2R E;  2ZFD A;  4DCK A;  1BJF A;  1SR6 C;  1S3P A;  4N1G A;  1SW8 A;  1K9P A;  3BUX B;  3DVM A;  4OKH A;  5GQQ C;  1J55 A;  4FTG A;  1A4P A;  2LHL A;  4GNK B;  1AUI B;  1A29 A;  1PVA A;  1KQM C;  4CFQ A;  1F54 A;  1HT9 A;  2A4J A;  1IQ5 A;  2JRF A;  3LLE A;  1AVS A;  2BEC A;  2PAS A;  1IJ6 A;  2F3Y A;  2KDH A;  4MRY A;  1GGZ A;  2M7N A;  1J1E A;  2L0P A;  3KO0 A;  1RFJ A;  1LA3 A;  2MJW B;  4PCW A;  3I5H C;  1BF5 A;  2H61 C;  2K7O A;  5IBW A;  1OSA A;  1NYA A;  1R2U A;  5ER5 A;  3KEV A;  1AK8 A;  2LHI A;  2NCO A;  1RRO A;  2L5X B;  3JTD C;  4IL1 A;  2MAZ A;  5KTY A;  2K7B A;  1J7Q A;  1LVC D;  1FW4 A;  1Y1A A;  4WQ3 A;  2K61 A;  2H61 A;  2QAC A;  1CNP A;  2CTN A;  5G08 A;  2I18 A;  3MSE B;  2LM5 A;  3BUM B;  3VRR A;  4A4B A;  3K21 A;  2RGI A;  1CFD A;  1JFK A;  3CZT X;  3O6B A;  2LV7 A;  1G8I A;  3ICB A;  1OQP A;  1YUS A;  3H4S E;  1MF8 B;  2KHN A;  1WRK A;  2JWW A;  3BOW B;  1IG5 A;  3I5G C;  1K9K A;  1IJ5 A;  1Y1U A;  1KSM A;  3RLZ A;  1K93 D;  3DVE A;  1YUT A;  1YR5 A;  5AEQ A;  4ETO A;  5ER4 X;  1DJG A;  5B8I B;  1GGW A;  4C0K A;  1SBJ A;  2KSP A;  1VRK A;  2M9G A;  2FCE A;  2LAP A;  1XA5 A;  2LUC A;  3QRX A;  3SG5 A;  4NQG A;  4UPG A;  1PSR A;  2JC2 A;  2CBL A;  4C0J A;  3SG3 A;  1QS7 A;  4I5N B;  1KQV A;  1SL9 A;  3EK8 A;  2AMI A;  1AJ4 A;  3NSI A;  1DGV A;  4YGB B;  3VRN A;  1CB1 A;  3EVR A;  2E6W A;  3WHU B;  1CFP A;  1UUS A;  1OE9 B;  1A2X A;  3ZWH A;  1L2O C;  1PUL A;  2LC5 A;  2KGB C;  3IF7 A;  2IS9 A;  2LVK A;  1W7I B;  1RJV A;  2BCX A;  2OTG C;  5AXI A;  3TDZ A;  1S5G Z;  3GK2 A;  2KQY A;  1JWD A;  3BUW B;  2M0R A;  3EKJ A;  3HCM A;  1C7V A;  3HX4 A;  1OZO A;  2L50 A;  2OS8 C;  3LK0 A;  1DMO A;  3KHE A;  3OP0 A;  2O5G A;  1AP4 A;  1K90 D;  1FI5 A;  2QPT A;  1YUR A;  3ZNI A;  1TOP A;  2NCP A;  3O2P A;  4XJK B;  2LMU A;  3TUY C;  1F4O A;  3A4U B;  1SCM B;  3D0Y A;  3TUY B;  4BY4 A;  1MUX A;  4PHK A;  1DJY A;  1TNQ A;  3SG7 A;  2JNF A;  2CXJ A;  4NDC A;  3M0W A;  1YX8 A;  1UHN A;  2OS8 B;  4MRX A;  1A75 B;  1CM1 A;  3PSR A;  1HQV A;  4BY5 A;  1M46 A;  3I5F C;  2L4I A;  3IQO A;  4CLN A;  1KSO A;  2LUX A;  1KK8 C;  4YGE B;  2NXQ A;  1CTR A;  4M2P A;  4L9M A;  4MSP A;  3TDI A;  5KU1 A;  1FPW A;  2CNP A;  2EC6 B;  1IGV A;  1XFU O;  2D8N A;  1ALV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...