3A8RA

The structure of the n-terminal regulatory domain of a plant nadph oxidase
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
166
structure length
166
Chain Sequence
TKSSAAVALKGLQFVTAKVGNDGWAAVEKRFNQLQVDGVLLRSRFGKCIGMDGSDEFAVQMFDSLARKRGIVKQVLTKDELKDFYEQLTDQGFDNRLRTFFDMVDKNADGRLTAEEVKEIIALSASANKLSKIKERADEYTALIMEELDPTNLGYIEMEDLEALLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title The structure of the N-terminal regulatory domain of a plant NADPH oxidase and its functional implications
pubmed doi rcsb
source organism Oryza sativa japonica group
molecule tags Calcium binding protein
total genus 61
structure length 166
sequence length 166
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3a8rA01
2JWWA 2LHLA 1KQMC 4ZCVA 1UUSA 4D1EA 3AAJA 2K61A 1XFWO 2KSPA 4MVFA 3KF9A 3KEVA 3SG7A 2H2KA 1CFDA 1R6PA 4XJKA 1W7JB 2ZRSA 2L4IA 3CR4X 4GFTA 1WLZA 3DVJA 2M29A 1BLQA 1PK0D 1ZUZA 1CFCA 2F2PA 4YBHB 1SL7A 1UHJA 1DJZA 1YUUA 2KHNA 3D10A 2M7LA 2OS8B 1EJ3A 4MEWA 1QX2A 2K7OA 1QLSA 2KI6D 1PVBA 3SIBA 2MLFC 1XO5A 2LE9B 2LVKA 4I5JA 5DKNA 3I5IC 3PALA 1ALWA 2LUXA 1FPWA 3TZ1A 1QXPA 3GK1A 4XJKB 2JNXA 5AXIA 1CDMA 1K9PA 5ER4X 1S6IA 3BXKA 2ZFDA 1CDLA 4HRHA 3TS5B 1LINA 5I8NA 2FCDA 2KFGA 2WCBA 2LLUA 4GBAA 2K7BA 1M46A 2LP2A 2LLTA 2JTTA 5TNCA 1N65A 2JZIA 5CSIA 2ZRTA 2BBNA 3OB1B 2PRUA 2I2RE 3MSEB 2HQWA 4M2PA 4F0ZB 1BG1A 1IH0A 1PRWA 1F54A 2LUCA 2KOTA 1M39A 2LANA 1MHOA 1SRAA 5CSFA 3GOFA 2M9GA 1V1GA 3LL8B 2M3WA 3DD4A 2HPSA 3A4UB 3VRPA 1ZOTB 2LNKA 3GK4X 1SY9A 2JT3A 2L98A 1S1EA 2JXLA 2MBXA 2P6BB 1UHKA 1JFJA 1IGVA 1B8CA 1UURA 3FWBA 2FJUB 3TS5C 2CT9A 1Y6WA 1KK7Z 4GUKA 3VRNA 1CMGA 1K90D 4OKHA 4GNKB 1FI6A 1SR6B 1Y1AA 2WC8A 1B1GA 4PE1A 4YGAA 1NIWA 1FW4A 1J55A 2OPOA 3QRXA 3KHEA 1CM1A 2SCPA 1L2OB 2A4JA 2KDHA 4I5NB 1IQ5A 1DJGA 3LCPC 4DIRA 1RTP1 3LK1A 2Y1NA 3DVKA 5G08A 2CTNA 3PATA 4YGDB 3A8RA 2L50A 3I5GC 3O78A 4N5XA 4A4BA 2JOJA 4DCKA 3TDUA 4YGBB 1ODBA 1F71A 4P5OE 4ICBA 1TCFA 4E68A 1H8BA 1TTXA 2OTGB 4CLNA 1J7RA 1OOJA 5ER5A 1B4CA 1E8AA 1WDCB 4I5LB 2M49B 2B1UA 4UPGA 1R2UA 1MUXA 1KK8C 1YR5A 4WQ3A 4YGCB 4PE0A 1A29A 1N0YA 4PHMA 1CMFA 3E3RA 3ICBA 4QJ4B 2FOTA 1K9KA 1AJ4A 4I5KA 1JF2A 2Q4UA 4PHNA 1JBAA 2M0RA 3K21A 1G4YR 3NSIA 3PFVA 2Y5IA 4ZCUA 1OMVA 3O6BA 3BQ3A 1J1DA 1NX1A 4CIDA 1TN4A 1YX7A 1OMRA 2CBLA 1GGWA 1DJYA 1KSOA 1MXEA 2I94A 3AKBA 3AAKA 2OTGC 1AP4A 3TDZA 3M0WA 1IG5A 5I2OA 3BYAA 5HKWA 1DTLA 2IS9A 4MRYA 1PALA 2ISDA 1CLLA 3BUXB 1RJVA 2BL0C 1DGUA 1AK8A 5F6TA 3RM1A 2JPTA 2LLSA 1NUBA 3I5FB 1DVIA 4IL1A 1QS7A 2KBMA 2LC5A 4PDZA 3SG4A 4CFQA 1J7OA 2CCMA 1JUOA 2EC6C 4XYNA 5HLOA 2HF5A 2I7AA 4MZJA 2LVJA 1F70A 1A2XA 2WNDA 3CTNA 1XVJA 1OZSA 1S5GZ 1G33A 2KI6C 1WRZA 2TN4A 1Q80A 1SPYA 1KCYA 2L51A 2ZN8A 1YUTA 1LXFC 4BY5A 2F3YA 2KAYA 1TRFA 2G2BA 2LMUA 2KAXA 5IBWA 1F4QA 2ZN9A 1NCXA 2O60A 1EL4A 3I5FC 5D7FA 3CLNA 5DKRA 2K0JA 4PE7A 1DJXA 2JT0A 2QACA 3I5HB 2AUCA 2MRDA 2F2OA 2KNEA 1IJ6A 5FYXA 4MBEA 4YI8A 3SG6A 2F3ZA 2M1UA 2VRGA 1EG3A 2JT8A 3EVRA 1IQ3A 4WQ2A 4YRUA 1AHRA 1WLMA 2GGMA 3CR5X 1DJIA 4YI9A 2OS8C 1XA5A 3TUYB 1N2DA 4WRIA 1MQ1A 2O5GA 1JSAA 4HREE 1SL9A 5HYDA 5K89A 1QJTA 3DVMA 4HRGA 2NCOA 1J1EA 4A4CA 4DUQA 1CTRA 2BE6A 1NX2A 2F33A 3NSLA 1NYAA 5J3XA 1UP5A 5KTYA 2EHBA 2K7CA 3C1VA 2LM5A 2KFFA 1B47A 2M7NA 1GQMA 3VGOA 5HLVA 1KWOB 3SG3A 2CNPA 1QLKA 2EGDA 2HQ8A 2KGBC 4AQIA 2JU0A 1XYDA 1A4PA 2BCXA 1QIWA 4M2OA 1TIZA 1PSRA 4GAOA 5B8IB 3CR2A 4GGFA 5HKZA 2LHIA 4QJ3B 1Y1UA 1NCYA 4ORCB 2Q91A 2WORA 3KO0A 3FS7A 2QPTA 4DRWA 1QV1A 2JULA 1OSAA 2L2EA 2I18A 1RECA 4MN0A 1UHIA 2KYFA 2AAOA 2H61A 1IWQA 2PVBA 1XFVO 3CZTX 1H4BA 1SL8A 1UWOA 5I2QA 1F4OA 5KU1A 1BF5A 2GGZA 1NPQA 1SR6C 1YX8A 4CFRA 4NDBA 1YURA 3OB2B 1L2OC 5JJGA 1LKJA 3SIAA 1YVHA 1NX3A 4R1EA 1SCMB 1HQVA 1BR1B 3TDIA 1WRKA 1L7ZA 1X02A 1QVIY 3VROA 1WRLA 2COLB 3IQQA 3LLEA 4PE4A 1MWNA 4PCWA 2MLEC 4JQ0D 1BU3A 1BMOA 4OV2A 1KQVA 3SJSA 3SG2A 2LAPA 3JTDB 1G8IA 2L4HA 4GGNA 1B9AA 1OMDA 3D0YA 1SW8A 5AEQA 1D1OA 1B8RA 5GQQC 2HETA 5BPJA 1Y0VH 4GGFC 1V1FA 1OZOA 1BOCA 5PALA 1WDCC 4OCIA 1K2HA 1S6CA 2MHHA 1S3PA 4MZKA 2LMVA 1DJHA 4FTGA 1CFFA 1CKKA 2L0PA 2H61C 1KQMB 1RROA 3D0YB 2KGRA 2WCFA 5AERA 1CLMA 1GJYA 1K9UA 1WY9A 2GV5A 3NSOA 3O2PA 1S6JA 5HKYA 4GPLB 1J7PA 2JQ6A 1ZFSA 1NX0A 3NXAA 3ZNIA 5CSNA 1QX7A 1AUIB 3PLFB 2JXCA 1W7IB 1HT9A 2KBIA 2LVIA 1Y1XA 1MXLC 1XFXO 3IQOA 3DF0A 4FQOA 2PMYA 2MJWB 1EXRA 5AFPA 1JC2A 2BCBA 3EK7A 1LA0A 2Y4QA 1CLBA 4C0KA 1SCVA 1TCOB 1PULA 1J7QA 1NWDA 4PHJA 2LMTA 4C0LA 2V53A 3JVTB 1XFYO 1EH2A 3EK4A 3PN7B 4M2QA 1CDPA 1XK4A 2L5XB 2ZKMX 4PHKA 3DF0B 4USLA 2BE4A 2R2IA 5AANA 2NCPA 4YGEB 1CFPA 1SYMA 1FI5A 2JTZA 1IJ5A 1TNPA 3RLZA 1B7TY 1K94A 1LVCD 2MAZA 1KFXL 1UHHA 1NP8A 2JC2A 2BKHB 2K2AA 2PASA 1B8LA 5CSJA 1TOPA 4MZLA 4TNCA 2M1KB 2ZNDA 3PSRA 1K8UA 1RFJA 1KK7Y 3BUWB 3VRRA 1QASA 1QTXA 3FWCA 1S26D 1YUSA 3F45A 2D8NA 4MRXA 1A03A 4OVNF 4ETOA 4OR9B 4C0JA 1SBJA 2MA2A 3JVTC 3NSKA 3EVVA 1DGVA 3PN7C 3H4SE 4QJ5B 4P2YB 1CDNA 1ALVA 2Y1MA 1BR4B 2K2FA 1NCZA 4NQGA 1BJFA 1EG4A 2LCPA 1JWDA 1M31A 3I5HC 3OX5A 1QX5B 1DF0A 1A75A 3WHUB 4AQJA 1M45A 4ORAB 1VRKA 2SASA 1XK4C 2WCEA 1KSMA 4L9MA 1CNPA 3CWGA 1B7TZ 1RWYA 2FCEA 4NDCA 3WXAA 3TUYC 3I5GB 3KPXA 3BUOB 3VRQA 2NXQA 2KQ6A 4CPVA 1BT6A 4MSPA 4DS7A 1DF0B 2BBMA 1A75B 4Q04A 2DOQA 2K8MB 3HCMA 1SNLA 1AJ5A 2AMIA 1K96A 2JRFA 1F55A 5KSZA 1LA3A 1TNWA 1OQPA 3WHTB 1KWOC 2K7DA 1F8HA 1KK8B 1JFKA 3BOWA 1AVSA 3ZWHA 1QATA 1U5IA 3OX6A 2LP3A 1FF1A 1ZACA 2NLNA 1PSBA 2LV7A 4JPZB 1DMOA 2CXJA 3PM8A 1SMGA 1PVAA 1XFUO 1TNQA 2PSRA 1K93D 3EVUA 1K95A 1SKTA 3BUMB 1CB1A 2KFHA 3AKAA 1MF8B 3CGAA 1YTZC 3BOWB 1DJWA 2KAVA 1U5IB 2KQYA 1IRJA 3EK8A 2E6WA 1ZMZA 1YVLA 3EKHA 2BCAA 1M63B 4N1GA 1KFUS 1C7VA 2BL0B 4MLWA 1GGZA 2KI4B 3LK0A 2M8UA 2ZNEA 3IF7A 1IKUA 1UHNA 1XFZO 3WNXB 1QIVA 4PALA 1S36A 2BKIB 3OP0A 1DT7B 3DVEA 1SCMC 5JOLA 1OE9B 3HX4A 4NDDA 1S5GY 1MR8A 2EC6B 1C07A 1C7WA 1YRUB 2PALA 1CM4A 2NZ0A 4BY4A 1TNXA 3JTDC 1KFXS 5D69A 1QVIZ 2RGIA 3BUNB 2LVVA 1FBVA 5I2LA 2JNFA 1BODA 2BECA 3O4YA 3CS1A 1JF0A 1NSHA 1QV0A 1YRTB 2KYCA 1SK6D 2E30A 5CPVA 4AOMA 4U8DA 2M97A 5DKQA 3EKJA 2G9BA 3I5IB 3OHMB 4N1FA 3SG5A 2KI4C 3GK2A 3FIAA 1KFUL 2F8PA 4HSZA 2WOSA 1RK9A 4ORBB 4JWQA
chains in the Genus database with same CATH superfamily
2JWWA 2LHLA 3DYEA 1KQMC 3CDNA 4ZCVA 1UUSA 4D1EA 3AAJA 2K61A 1XFWO 2KSPA 4MVFA 3KF9A 4IJ7A 1GM0A 3KEVA 3SG7A 2H2KA 1CFDA 1R6PA 4XJKA 2PQLA 5HL1A 1W7JB 2ZRSA 2L4IA 3CR4X 1OOFA 4GFTA 1WLZA 3DVJA 3QMEA 1W9ZA 2M29A 1BLQA 1PK0D 1ZUZA 1CFCA 2F2PA 2QEOA 1SL7A 4YBHB 1UHJA 1DJZA 1YUUA 2KHNA 3D10A 2M7LA 2OS8B 1EJ3A 4MEWA 1QX2A 2K7OA 1QLSA 2KI6D 1PVBA 3SIBA 2MLFC 1XO5A 2LE9B 2LVKA 4I5JA 5DKNA 3I5IC 3PALA 1ALWA 2LUXA 1FPWA 3TZ1A 1QXPA 3GK1A 4XJKB 2JNXA 5EL2A 5AXIA 1CDMA 3B88A 1K9PA 5ER4X 1S6IA 3BXKA 2ZFDA 1CDLA 4HRHA 3TS5B 1LINA 5I8NA 2FCDA 2KFGA 2WCBA 2LLUA 2BNXA 4GBAA 2K7BA 1M46A 2LP2A 2LLTA 2JTTA 5TNCA 1N65A 2JZIA 5CSIA 2ZRTA 2BBNA 3OB1B 2PRUA 2I2RE 3MSEB 2HQWA 3CZ1A 3NHIA 3DY9A 4M2PA 4F0ZB 1BG1A 1IH0A 1PRWA 1F54A 2LUCA 2KOTA 3SS4A 1M39A 2LANA 1MHOA 1SRAA 3B6XA 5CSFA 3GOFA 2M9GA 1V1GA 3PJIA 1ORGA 3LL8B 2M3WA 2PYQA 3DD4A 2HPSA 3A4UB 3VRPA 1ZOTB 2ERBA 2LNKA 3GK4X 1SY9A 2JT3A 2L98A 1S1EA 2JXLA 2MBXA 2P6BB 1UHKA 4INWA 2WC5A 1IGVA 1JFJA 1B8CA 1UURA 3FWBA 2FJUB 3TS5C 2CT9A 1Y6WA 1KK7Z 4GUKA 3VRNA 1CMGA 1K90D 5D3OA 4OKHA 4GNKB 1FI6A 1SR6B 1Y1AA 2WC8A 1B1GA 4PE1A 4YGAA 1NIWA 1FW4A 1J55A 2OPOA 3QRXA 3KHEA 1CM1A 2SCPA 1L2OB 2A4JA 2KDHA 4I5NB 1IQ5A 1DJGA 3LCPC 4DIRA 1RTP1 3D73A 3FE6A 3LK1A 2Y1NA 3DVKA 5G08A 2CTNA 3PATA 2L2CA 4YGDB 3A8RA 2L50A 3I5GC 4JD9A 3O78A 4N5XA 4A4BA 2JOJA 3L47A 4DCKA 3RZSA 3TDUA 4YGBB 1ODBA 1F71A 4P5OE 4ICBA 1TCFA 4E68A 1H8BA 1TTXA 2OTGB 4CLNA 1J7RA 1OOJA 5ER5A 1B4CA 1E8AA 1WDCB 4I5LB 2M49B 2B1UA 4UPGA 1R2UA 1MUXA 1KK8C 1YR5A 4WQ3A 3S0DA 4YGCB 4PE0A 1A29A 1N0YA 4PHMA 1CMFA 3E3RA 3ICBA 4QJ4B 2FOTA 1K9KA 1AJ4A 4I5KA 1JF2A 4INXA 2Q4UA 4PHNA 1DC1A 1JBAA 2M0RA 3K21A 1G4YR 3NSIA 3PFVA 2Y5IA 4ZCUA 1OMVA 2WC6A 1QWVA 3O4XA 3O6BA 3BQ3A 1J1DA 1NX1A 5FI7A 1TN4A 1YX7A 1OMRA 2CBLA 4CIDA 1GGWA 1DJYA 1KSOA 1MXEA 2H8VA 2I94A 3AAKA 3AKBA 2OTGC 3FE8A 1AP4A 3TDZA 3OGNA 3M0WA 1IG5A 2QEBA 5I2OA 3BYAA 5HKWA 1DTLA 3S0EA 2IS9A 4MRYA 1PALA 2ISDA 2WCLA 1C3YA 1CLLA 3BUXB 1RJVA 2BL0C 1DGUA 1AK8A 3FE9A 3BFAA 5F6TA 3RM1A 2JPTA 2LLSA 1NUBA 3I5FB 1DVIA 1OOGA 4IL1A 1QS7A 2KBMA 2LC5A 3K1EA 4PDZA 3SG4A 4CFQA 1J7OA 2CCMA 1IIOA 1JUOA 2EC6C 4XYNA 5HLOA 2HF5A 2I7AA 2QDIA 4MZJA 2LVJA 1F70A 1A2XA 2WNDA 3CTNA 1XVJA 1OZSA 3CZ0A 1S5GZ 1G33A 2KI6C 1WRZA 2TN4A 3B7AA 1Q80A 1SPYA 1KCYA 2L51A 2ZN8A 1YUTA 1LXFC 4BY5A 2F3YA 2KAYA 3EG5B 1TRFA 2G2BA 2LMUA 2WCKA 2KAXA 5IBWA 1F4QA 2ZN9A 1NCXA 2O60A 3IVTA 1EL4A 3I5FC 5D7FA 3CLNA 5DKRA 2K0JA 2FJYA 2WCJA 4PE7A 1DJXA 2JT0A 2QACA 3I5HB 2AUCA 2MRDA 2F2OA 2KNEA 5I94A 1IJ6A 5FYXA 4MBEA 4YI8A 3S0GA 2F3ZA 3SG6A 2M1UA 2VRGA 1EG3A 2JT8A 3EVRA 4F7FA 1IQ3A 4WQ2A 4YRUA 1AHRA 1WLMA 2GGMA 3CR5X 1T14A 1DJIA 4YI9A 4PT1A 2OS8C 1XA5A 3TUYB 1N2DA 4WRIA 1MQ1A 2O5GA 1JSAA 4HREE 3BJHA 1SL9A 5HYDA 5K89A 1QJTA 3DVMA 4HRGA 2NCOA 1J1EA 4A4CA 4DUQA 1CTRA 1DQEA 2BE6A 1NX2A 2F33A 3NSLA 1NYAA 5J3XA 1UP5A 5KTYA 1Z2CB 2EHBA 2K7CA 3C1VA 2LM5A 2KFFA 3VB1A 1DEKA 2KLDA 1B47A 2M7NA 1GQMA 3VGOA 5HLVA 2BAPA 1KWOB 3SG3A 2CNPA 1QLKA 2EGDA 2HQ8A 2KGBC 4AQIA 2JU0A 1DELA 1XYDA 1A4PA 2BCXA 1QIWA 4M2OA 3D74A 1TIZA 1PSRA 4GAOA 5B8IB 3CR2A 4GGFA 5HKZA 2LHIA 4QJ3B 1Y1UA 1NCYA 4ORCB 2Q91A 2WORA 3KO0A 3S0AA 3FS7A 2QPTA 4DRWA 1QV1A 3DXLA 2JULA 1OSAA 2L2EA 4JKTA 2I18A 3R1VA 5FI2A 1RECA 4MN0A 2K60A 1UHIA 2KYFA 2AAOA 2H61A 3BFHA 1IWQA 2PVBA 1XFVO 3CZTX 1H4BA 1SL8A 1UWOA 5I2QA 1F4OA 5KU1A 1BF5A 2GGZA 1NPQA 1P28A 1SR6C 1YX8A 4CFRA 4NDBA 1YURA 3OB2B 1L2OC 5JJGA 1LKJA 3SIAA 1YVHA 1NX3A 4R1EA 1SCMB 1HQVA 1LS8A 1BR1B 3TDIA 1WRKA 1L7ZA 1X02A 1QVIY 4FQTA 3VROA 2WCHA 1WRLA 2COLB 3IQQA 3LLEA 4PE4A 1MWNA 4PCWA 2MLEC 4JQ0D 1BU3A 1BMOA 4OV2A 1KQVA 3SJSA 3CABA 3SG2A 2LAPA 3JTDB 1G8IA 2L4HA 4GGNA 1B9AA 1OMDA 3D0YA 1SW8A 3N7HA 5AEQA 1D1OA 1B8RA 5GQQC 2HETA 5BPJA 1Y0VH 4GGFC 1V1FA 1OZOA 3Q8IA 1BOCA 3NGVA 5PALA 1WDCC 4OCIA 1K2HA 2GTEA 1S6CA 2MHHA 1S3PA 4MZKA 3L4AA 2LMVA 1DJHA 4FTGA 1CFFA 1CKKA 2L0PA 2H61C 2QEVA 1KQMB 1RROA 3D0YB 2KGRA 2WCFA 5AERA 3D77A 1CLMA 1GJYA 1K9UA 1WY9A 2GV5A 2KLEA 3NSOA 3O2PA 1S6JA 3SS3A 5HKYA 4GPLB 1J7PA 2JQ6A 1ZFSA 1NX0A 3NXAA 3ZNIA 3UNWA 2JPOA 5CSNA 1QX7A 1AUIB 3PLFB 2JXCA 1W7IB 1HT9A 2KBIA 2LVIA 1Y1XA 1MXLC 1XFXO 3IQOA 3DF0A 2WCMA 2KPHA 3R1PA 4FQOA 2PMYA 2MJWB 1EXRA 5AFPA 1JC2A 2BCBA 3EK7A 1LA0A 2Y4QA 1CLBA 4C0KA 1SCVA 1TCOB 1PULA 1J7QA 1NWDA 4PHJA 2LMTA 3V2LA 4C0LA 2V53A 2YGUA 3JVTB 1XFYO 1EH2A 3EK4A 3PN7B 4M2QA 1CDPA 1XK4A 2L5XB 2ZKMX 3B87A 3DF0B 4PHKA 4USLA 2BE4A 2R2IA 5AANA 2NCPA 4YGEB 1CFPA 1SYMA 1FI5A 1OOHA 2JTZA 1IJ5A 1TNPA 3RLZA 1B7TY 1K94A 1LVCD 2MAZA 1KFXL 1UHHA 1NP8A 2JC2A 2BKHB 2K2AA 2PASA 1B8LA 5CSJA 1TOPA 4MZLA 4TNCA 2M1KB 2ZNDA 3PSRA 2QEHA 1K8UA 1RFJA 1KK7Y 3BUWB 3VRRA 1QASA 1QTXA 3FWCA 1S26D 1YUSA 3F45A 2D8NA 4MRXA 1A03A 4OVNF 4ETOA 4OR9B 4C0JA 3S0BA 1SBJA 2MA2A 3JVTC 3NSKA 3EVVA 1DGVA 3PN7C 3H4SE 3D78A 4P2YB 4QJ5B 1ALVA 2Y1MA 1CDNA 4OZDA 1BR4B 3R72A 2K2FA 1NCZA 4NQGA 1BJFA 1EG4A 2LCPA 1JWDA 1M31A 3I5HC 3OX5A 1QX5B 1DF0A 1A75A 3WHUB 4AQJA 1M45A 4ORAB 1VRKA 2SASA 1XK4C 2WCEA 1KSMA 3PM2A 4L9MA 1CNPA 3CWGA 1B7TZ 3UO9A 1RWYA 2FCEA 4NDCA 3WXAA 3TUYC 1OW4A 3I5GB 1SSEB 3BUOB 3KPXA 3VRQA 2NXQA 2KQ6A 4CPVA 1BT6A 4MSPA 3OBVA 4DS7A 1DF0B 2BBMA 1A75B 4Q04A 2DOQA 2K8MB 2P70A 4KYNA 3HCMA 1SNLA 1AJ5A 2AMIA 1K96A 2JRFA 1F55A 1TWOA 1TUZA 5KSZA 1TUJA 3L4LA 1LA3A 1TNWA 1OQPA 3BFBA 3WHTB 1KWOC 2K7DA 1F8HA 1KK8B 1JFKA 3BOWA 1AVSA 3ZWHA 1QATA 1U5IA 3OX6A 2LP3A 1FF1A 1ZACA 2NLNA 1PSBA 2LV7A 4JPZB 1DMOA 2CXJA 3PM8A 3CYZA 1SMGA 1PVAA 1XFUO 1TNQA 2PSRA 3NHTA 1K93D 3EVUA 1K95A 1SKTA 3BUMB 1XFRA 2KFHA 3AKAA 1MF8B 3CGAA 1CB1A 1YTZC 3BOWB 3B86A 1DJWA 2L5YA 2KAVA 1U5IB 2KQYA 1IRJA 3EK8A 2E6WA 1ZMZA 1YVLA 3D75A 3EKHA 2BCAA 2P71A 1M63B 3R1OA 4N1GA 3CZ2A 1KFUS 1C7VA 2BL0B 4MLWA 1GGZA 2KI4B 3LK0A 2M8UA 2ZNEA 3IF7A 1IKUA 1UHNA 1XFZO 5FI6A 1QIVA 3WNXB 4PALA 1S36A 2BKIB 5DICA 3OP0A 1DT7B 3DVEA 1C3ZA 1SCMC 5JOLA 1OE9B 3HX4A 4NDDA 1S5GY 1MR8A 3D76A 3DZTA 2EC6B 1C07A 1C7WA 1YRUB 2PALA 1CM4A 3S0FA 2NZ0A 4BY4A 1TNXA 3JTDC 1KFXS 1OOIX 5D69A 3SS5A 1QVIZ 1Z4HA 2RGIA 3BUNB 2LVVA 1FBVA 5I2LA 2JNFA 1BODA 2BECA 3O4YA 3CS1A 1JF0A 1NSHA 1QV0A 1YRTB 2KYCA 1SK6D 2E30A 5CPVA 4AOMA 4U8DA 2M97A 5DKQA 3EKJA 2G9BA 3I5IB 3OHMB 4N1FA 3SG5A 2KI4C 3GK2A 3FIAA 1KFUL 2F8PA 4HSZA 2WOSA 1RK9A 4ORBB 4JWQA
chains in the Genus database with same CATH topology
2JWWA 2LHLA 1KQMC 4ZCVA 1UUSA 4D1EA 3AAJA 2K61A 1XFWO 2KSPA 4MVFA 3KF9A 3KEVA 3SG7A 2H2KA 1CFDA 1R6PA 4XJKA 1W7JB 2ZRSA 2L4IA 3CR4X 4GFTA 1WLZA 3DVJA 2M29A 1BLQA 1PK0D 1ZUZA 1CFCA 2F2PA 4YBHB 1SL7A 1UHJA 1DJZA 1YUUA 2KHNA 3D10A 2M7LA 2OS8B 1EJ3A 4MEWA 1QX2A 2K7OA 1QLSA 2KI6D 1PVBA 3SIBA 2MLFC 1XO5A 2LE9B 2LVKA 4I5JA 5DKNA 3I5IC 3PALA 1ALWA 2LUXA 1FPWA 3TZ1A 1QXPA 3GK1A 4XJKB 2JNXA 5AXIA 1CDMA 1K9PA 5ER4X 1S6IA 3BXKA 2ZFDA 1CDLA 4HRHA 3TS5B 1LINA 5I8NA 2FCDA 2KFGA 2WCBA 2LLUA 4GBAA 2K7BA 1M46A 2LP2A 2LLTA 2JTTA 5TNCA 1N65A 2JZIA 5CSIA 2ZRTA 2BBNA 3OB1B 2PRUA 2I2RE 3MSEB 2HQWA 4M2PA 4F0ZB 1BG1A 1IH0A 1PRWA 1F54A 2LUCA 2KOTA 1M39A 2LANA 1MHOA 1SRAA 5CSFA 3GOFA 2M9GA 1V1GA 3LL8B 2M3WA 3DD4A 2HPSA 3A4UB 3VRPA 1ZOTB 2LNKA 3GK4X 1SY9A 2JT3A 2L98A 1S1EA 2JXLA 2MBXA 2P6BB 1UHKA 1JFJA 1IGVA 1B8CA 1UURA 3FWBA 2FJUB 3TS5C 2CT9A 1Y6WA 1KK7Z 4GUKA 3VRNA 1CMGA 1K90D 4OKHA 4GNKB 1FI6A 1SR6B 1Y1AA 2WC8A 1B1GA 4PE1A 4YGAA 1NIWA 1FW4A 1J55A 2OPOA 3QRXA 3KHEA 1CM1A 2SCPA 1L2OB 2A4JA 2KDHA 4I5NB 1IQ5A 1DJGA 3LCPC 4DIRA 1RTP1 3LK1A 2Y1NA 3DVKA 5G08A 2CTNA 3PATA 4YGDB 3A8RA 2L50A 3I5GC 3O78A 4N5XA 4A4BA 2JOJA 4DCKA 3TDUA 4YGBB 1ODBA 1F71A 4P5OE 4ICBA 1TCFA 4E68A 1H8BA 1TTXA 2OTGB 4CLNA 1J7RA 1OOJA 5ER5A 1B4CA 1E8AA 1WDCB 4I5LB 2M49B 2B1UA 4UPGA 1R2UA 1MUXA 1KK8C 1YR5A 4WQ3A 4YGCB 4PE0A 1A29A 1N0YA 4PHMA 1CMFA 3E3RA 3ICBA 4QJ4B 2FOTA 1K9KA 1AJ4A 4I5KA 1JF2A 2Q4UA 4PHNA 1JBAA 2M0RA 3K21A 1G4YR 3NSIA 3PFVA 2Y5IA 4ZCUA 1OMVA 3O6BA 3BQ3A 1J1DA 1NX1A 4CIDA 1TN4A 1YX7A 1OMRA 2CBLA 1GGWA 1DJYA 1KSOA 1MXEA 2I94A 3AKBA 3AAKA 2OTGC 1AP4A 3TDZA 3M0WA 1IG5A 5I2OA 3BYAA 5HKWA 1DTLA 2IS9A 4MRYA 1PALA 2ISDA 1CLLA 3BUXB 1RJVA 2BL0C 1DGUA 1AK8A 5F6TA 3RM1A 2JPTA 2LLSA 1NUBA 3I5FB 1DVIA 4IL1A 1QS7A 2KBMA 2LC5A 4PDZA 3SG4A 4CFQA 1J7OA 2CCMA 1JUOA 2EC6C 4XYNA 5HLOA 2HF5A 2I7AA 4MZJA 2LVJA 1F70A 1A2XA 2WNDA 3CTNA 1XVJA 1OZSA 1S5GZ 1G33A 2KI6C 1WRZA 2TN4A 1Q80A 1SPYA 1KCYA 2L51A 2ZN8A 1YUTA 1LXFC 4BY5A 2F3YA 2KAYA 1TRFA 2G2BA 2LMUA 2KAXA 5IBWA 1F4QA 2ZN9A 1NCXA 2O60A 1EL4A 3I5FC 5D7FA 3CLNA 5DKRA 2K0JA 4PE7A 1DJXA 2JT0A 2QACA 3I5HB 2AUCA 2MRDA 2F2OA 2KNEA 1IJ6A 5FYXA 4MBEA 4YI8A 3SG6A 2F3ZA 2M1UA 2VRGA 1EG3A 2JT8A 3EVRA 1IQ3A 4WQ2A 4YRUA 1AHRA 1WLMA 2GGMA 3CR5X 1DJIA 4YI9A 2OS8C 1XA5A 3TUYB 1N2DA 4WRIA 1MQ1A 2O5GA 1JSAA 4HREE 1SL9A 5HYDA 5K89A 1QJTA 3DVMA 4HRGA 2NCOA 1J1EA 4A4CA 4DUQA 1CTRA 2BE6A 1NX2A 2F33A 3NSLA 1NYAA 5J3XA 1UP5A 5KTYA 2EHBA 2K7CA 3C1VA 2LM5A 2KFFA 1B47A 2M7NA 1GQMA 3VGOA 5HLVA 1KWOB 3SG3A 2CNPA 1QLKA 2EGDA 2HQ8A 2KGBC 4AQIA 2JU0A 1XYDA 1A4PA 2BCXA 1QIWA 4M2OA 1TIZA 1PSRA 4GAOA 5B8IB 3CR2A 4GGFA 5HKZA 2LHIA 4QJ3B 1Y1UA 1NCYA 4ORCB 2Q91A 2WORA 3KO0A 3FS7A 2QPTA 4DRWA 1QV1A 2JULA 1OSAA 2L2EA 2I18A 1RECA 4MN0A 1UHIA 2KYFA 2AAOA 2H61A 1IWQA 2PVBA 1XFVO 3CZTX 1H4BA 1SL8A 1UWOA 5I2QA 1F4OA 5KU1A 1BF5A 2GGZA 1NPQA 1SR6C 1YX8A 4CFRA 4NDBA 1YURA 3OB2B 1L2OC 5JJGA 1LKJA 3SIAA 1YVHA 1NX3A 4R1EA 1SCMB 1HQVA 1BR1B 3TDIA 1WRKA 1L7ZA 1X02A 1QVIY 3VROA 1WRLA 2COLB 3IQQA 3LLEA 4PE4A 1MWNA 4PCWA 2MLEC 4JQ0D 1BU3A 1BMOA 4OV2A 1KQVA 3SJSA 3SG2A 2LAPA 3JTDB 1G8IA 2L4HA 4GGNA 1B9AA 1OMDA 3D0YA 1SW8A 5AEQA 1D1OA 1B8RA 5GQQC 2HETA 5BPJA 1Y0VH 4GGFC 1V1FA 1OZOA 1BOCA 5PALA 1WDCC 4OCIA 1K2HA 1S6CA 2MHHA 1S3PA 4MZKA 2LMVA 1DJHA 4FTGA 1CFFA 1CKKA 2L0PA 2H61C 1KQMB 1RROA 3D0YB 2KGRA 2WCFA 5AERA 1CLMA 1GJYA 1K9UA 1WY9A 2GV5A 3NSOA 3O2PA 1S6JA 5HKYA 4GPLB 1J7PA 2JQ6A 1ZFSA 1NX0A 3NXAA 3ZNIA 5CSNA 1QX7A 1AUIB 3PLFB 2JXCA 1W7IB 1HT9A 2KBIA 2LVIA 1Y1XA 1MXLC 1XFXO 3IQOA 3DF0A 4FQOA 2PMYA 2MJWB 1EXRA 5AFPA 1JC2A 2BCBA 3EK7A 1LA0A 2Y4QA 1CLBA 4C0KA 1SCVA 1TCOB 1PULA 1J7QA 1NWDA 4PHJA 2LMTA 4C0LA 2V53A 3JVTB 1XFYO 1EH2A 3EK4A 3PN7B 4M2QA 1CDPA 1XK4A 2L5XB 2ZKMX 4PHKA 3DF0B 4USLA 2BE4A 2R2IA 5AANA 2NCPA 4YGEB 1CFPA 1SYMA 1FI5A 2JTZA 1IJ5A 1TNPA 3RLZA 1B7TY 1K94A 1LVCD 2MAZA 1KFXL 1UHHA 1NP8A 2JC2A 2BKHB 2K2AA 2PASA 1B8LA 5CSJA 1TOPA 4MZLA 4TNCA 2M1KB 2ZNDA 3PSRA 1K8UA 1RFJA 1KK7Y 3BUWB 3VRRA 1QASA 1QTXA 3FWCA 1S26D 1YUSA 3F45A 2D8NA 4MRXA 1A03A 4OVNF 4ETOA 4OR9B 4C0JA 1SBJA 2MA2A 3JVTC 3NSKA 3EVVA 1DGVA 3PN7C 3H4SE 4QJ5B 4P2YB 1CDNA 1ALVA 2Y1MA 1BR4B 2K2FA 1NCZA 4NQGA 1BJFA 1EG4A 2LCPA 1JWDA 1M31A 3I5HC 3OX5A 1QX5B 1DF0A 1A75A 3WHUB 4AQJA 1M45A 4ORAB 1VRKA 2SASA 1XK4C 2WCEA 1KSMA 4L9MA 1CNPA 3CWGA 1B7TZ 1RWYA 2FCEA 4NDCA 3WXAA 3TUYC 3I5GB 3KPXA 3BUOB 3VRQA 2NXQA 2KQ6A 4CPVA 1BT6A 4MSPA 4DS7A 1DF0B 2BBMA 1A75B 4Q04A 2DOQA 2K8MB 3HCMA 1SNLA 1AJ5A 2AMIA 1K96A 2JRFA 1F55A 5KSZA 1LA3A 1TNWA 1OQPA 3WHTB 1KWOC 2K7DA 1F8HA 1KK8B 1JFKA 3BOWA 1AVSA 3ZWHA 1QATA 1U5IA 3OX6A 2LP3A 1FF1A 1ZACA 2NLNA 1PSBA 2LV7A 4JPZB 1DMOA 2CXJA 3PM8A 1SMGA 1PVAA 1XFUO 1TNQA 2PSRA 1K93D 3EVUA 1K95A 1SKTA 3BUMB 1CB1A 2KFHA 3AKAA 1MF8B 3CGAA 1YTZC 3BOWB 1DJWA 2KAVA 1U5IB 2KQYA 1IRJA 3EK8A 2E6WA 1ZMZA 1YVLA 3EKHA 2BCAA 1M63B 4N1GA 1KFUS 1C7VA 2BL0B 4MLWA 1GGZA 2KI4B 3LK0A 2M8UA 2ZNEA 3IF7A 1IKUA 1UHNA 1XFZO 3WNXB 1QIVA 4PALA 1S36A 2BKIB 3OP0A 1DT7B 3DVEA 1SCMC 5JOLA 1OE9B 3HX4A 4NDDA 1S5GY 1MR8A 2EC6B 1C07A 1C7WA 1YRUB 2PALA 1CM4A 2NZ0A 4BY4A 1TNXA 3JTDC 1KFXS 5D69A 1QVIZ 2RGIA 3BUNB 2LVVA 1FBVA 5I2LA 2JNFA 1BODA 2BECA 3O4YA 3CS1A 1JF0A 1NSHA 1QV0A 1YRTB 2KYCA 1SK6D 2E30A 5CPVA 4AOMA 4U8DA 2M97A 5DKQA 3EKJA 2G9BA 3I5IB 3OHMB 4N1FA 3SG5A 2KI4C 3GK2A 3FIAA 1KFUL 2F8PA 4HSZA 2WOSA 1RK9A 4ORBB 4JWQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JWW A;  2LHL A;  1KQM C;  4ZCV A;  1UUS A;  4D1E A;  3AAJ A;  2K61 A;  1XFW O;  2KSP A;  4MVF A;  3KF9 A;  3KEV A;  3SG7 A;  2H2K A;  1CFD A;  1R6P A;  4XJK A;  1W7J B;  2ZRS A;  2L4I A;  3CR4 X;  4GFT A;  1WLZ A;  3DVJ A;  2M29 A;  1BLQ A;  1PK0 D;  1ZUZ A;  1CFC A;  2F2P A;  4YBH B;  1SL7 A;  1UHJ A;  1DJZ A;  1YUU A;  2KHN A;  3D10 A;  2M7L A;  2OS8 B;  1EJ3 A;  4MEW A;  1QX2 A;  2K7O A;  1QLS A;  2KI6 D;  1PVB A;  3SIB A;  2MLF C;  1XO5 A;  2LE9 B;  2LVK A;  4I5J A;  5DKN A;  3I5I C;  3PAL A;  1ALW A;  2LUX A;  1FPW A;  3TZ1 A;  1QXP A;  3GK1 A;  4XJK B;  2JNX A;  5AXI A;  1CDM A;  1K9P A;  5ER4 X;  1S6I A;  3BXK A;  2ZFD A;  1CDL A;  4HRH A;  3TS5 B;  1LIN A;  5I8N A;  2FCD A;  2KFG A;  2WCB A;  2LLU A;  4GBA A;  2K7B A;  1M46 A;  2LP2 A;  2LLT A;  2JTT A;  5TNC A;  1N65 A;  2JZI A;  5CSI A;  2ZRT A;  2BBN A;  3OB1 B;  2PRU A;  2I2R E;  3MSE B;  2HQW A;  4M2P A;  4F0Z B;  1BG1 A;  1IH0 A;  1PRW A;  1F54 A;  2LUC A;  2KOT A;  1M39 A;  2LAN A;  1MHO A;  1SRA A;  5CSF A;  3GOF A;  2M9G A;  1V1G A;  3LL8 B;  2M3W A;  3DD4 A;  2HPS A;  3A4U B;  3VRP A;  1ZOT B;  2LNK A;  3GK4 X;  1SY9 A;  2JT3 A;  2L98 A;  1S1E A;  2JXL A;  2MBX A;  2P6B B;  1UHK A;  1JFJ A;  1IGV A;  1B8C A;  1UUR A;  3FWB A;  2FJU B;  3TS5 C;  2CT9 A;  1Y6W A;  1KK7 Z;  4GUK A;  3VRN A;  1CMG A;  1K90 D;  4OKH A;  4GNK B;  1FI6 A;  1SR6 B;  1Y1A A;  2WC8 A;  1B1G A;  4PE1 A;  4YGA A;  1NIW A;  1FW4 A;  1J55 A;  2OPO A;  3QRX A;  3KHE A;  1CM1 A;  2SCP A;  1L2O B;  2A4J A;  2KDH A;  4I5N B;  1IQ5 A;  1DJG A;  3LCP C;  4DIR A;  1RTP 1;  3LK1 A;  2Y1N A;  3DVK A;  5G08 A;  2CTN A;  3PAT A;  4YGD B;  3A8R A;  2L50 A;  3I5G C;  3O78 A;  4N5X A;  4A4B A;  2JOJ A;  4DCK A;  3TDU A;  4YGB B;  1ODB A;  1F71 A;  4P5O E;  4ICB A;  1TCF A;  4E68 A;  1H8B A;  1TTX A;  2OTG B;  4CLN A;  1J7R A;  1OOJ A;  5ER5 A;  1B4C A;  1E8A A;  1WDC B;  4I5L B;  2M49 B;  2B1U A;  4UPG A;  1R2U A;  1MUX A;  1KK8 C;  1YR5 A;  4WQ3 A;  4YGC B;  4PE0 A;  1A29 A;  1N0Y A;  4PHM A;  1CMF A;  3E3R A;  3ICB A;  4QJ4 B;  2FOT A;  1K9K A;  1AJ4 A;  4I5K A;  1JF2 A;  2Q4U A;  4PHN A;  1JBA A;  2M0R A;  3K21 A;  1G4Y R;  3NSI A;  3PFV A;  2Y5I A;  4ZCU A;  1OMV A;  3O6B A;  3BQ3 A;  1J1D A;  1NX1 A;  4CID A;  1TN4 A;  1YX7 A;  1OMR A;  2CBL A;  1GGW A;  1DJY A;  1KSO A;  1MXE A;  2I94 A;  3AKB A;  3AAK A;  2OTG C;  1AP4 A;  3TDZ A;  3M0W A;  1IG5 A;  5I2O A;  3BYA A;  5HKW A;  1DTL A;  2IS9 A;  4MRY A;  1PAL A;  2ISD A;  1CLL A;  3BUX B;  1RJV A;  2BL0 C;  1DGU A;  1AK8 A;  5F6T A;  3RM1 A;  2JPT A;  2LLS A;  1NUB A;  3I5F B;  1DVI A;  4IL1 A;  1QS7 A;  2KBM A;  2LC5 A;  4PDZ A;  3SG4 A;  4CFQ A;  1J7O A;  2CCM A;  1JUO A;  2EC6 C;  4XYN A;  5HLO A;  2HF5 A;  2I7A A;  4MZJ A;  2LVJ A;  1F70 A;  1A2X A;  2WND A;  3CTN A;  1XVJ A;  1OZS A;  1S5G Z;  1G33 A;  2KI6 C;  1WRZ A;  2TN4 A;  1Q80 A;  1SPY A;  1KCY A;  2L51 A;  2ZN8 A;  1YUT A;  1LXF C;  4BY5 A;  2F3Y A;  2KAY A;  1TRF A;  2G2B A;  2LMU A;  2KAX A;  5IBW A;  1F4Q A;  2ZN9 A;  1NCX A;  2O60 A;  1EL4 A;  3I5F C;  5D7F A;  3CLN A;  5DKR A;  2K0J A;  4PE7 A;  1DJX A;  2JT0 A;  2QAC A;  3I5H B;  2AUC A;  2MRD A;  2F2O A;  2KNE A;  1IJ6 A;  5FYX A;  4MBE A;  4YI8 A;  3SG6 A;  2F3Z A;  2M1U A;  2VRG A;  1EG3 A;  2JT8 A;  3EVR A;  1IQ3 A;  4WQ2 A;  4YRU A;  1AHR A;  1WLM A;  2GGM A;  3CR5 X;  1DJI A;  4YI9 A;  2OS8 C;  1XA5 A;  3TUY B;  1N2D A;  4WRI A;  1MQ1 A;  2O5G A;  1JSA A;  4HRE E;  1SL9 A;  5HYD A;  5K89 A;  1QJT A;  3DVM A;  4HRG A;  2NCO A;  1J1E A;  4A4C A;  4DUQ A;  1CTR A;  2BE6 A;  1NX2 A;  2F33 A;  3NSL A;  1NYA A;  5J3X A;  1UP5 A;  5KTY A;  2EHB A;  2K7C A;  3C1V A;  2LM5 A;  2KFF A;  1B47 A;  2M7N A;  1GQM A;  3VGO A;  5HLV A;  1KWO B;  3SG3 A;  2CNP A;  1QLK A;  2EGD A;  2HQ8 A;  2KGB C;  4AQI A;  2JU0 A;  1XYD A;  1A4P A;  2BCX A;  1QIW A;  4M2O A;  1TIZ A;  1PSR A;  4GAO A;  5B8I B;  3CR2 A;  4GGF A;  5HKZ A;  2LHI A;  4QJ3 B;  1Y1U A;  1NCY A;  4ORC B;  2Q91 A;  2WOR A;  3KO0 A;  3FS7 A;  2QPT A;  4DRW A;  1QV1 A;  2JUL A;  1OSA A;  2L2E A;  2I18 A;  1REC A;  4MN0 A;  1UHI A;  2KYF A;  2AAO A;  2H61 A;  1IWQ A;  2PVB A;  1XFV O;  3CZT X;  1H4B A;  1SL8 A;  1UWO A;  5I2Q A;  1F4O A;  5KU1 A;  1BF5 A;  2GGZ A;  1NPQ A;  1SR6 C;  1YX8 A;  4CFR A;  4NDB A;  1YUR A;  3OB2 B;  1L2O C;  5JJG A;  1LKJ A;  3SIA A;  1YVH A;  1NX3 A;  4R1E A;  1SCM B;  1HQV A;  1BR1 B;  3TDI A;  1WRK A;  1L7Z A;  1X02 A;  1QVI Y;  3VRO A;  1WRL A;  2COL B;  3IQQ A;  3LLE A;  4PE4 A;  1MWN A;  4PCW A;  2MLE C;  4JQ0 D;  1BU3 A;  1BMO A;  4OV2 A;  1KQV A;  3SJS A;  3SG2 A;  2LAP A;  3JTD B;  1G8I A;  2L4H A;  4GGN A;  1B9A A;  1OMD A;  3D0Y A;  1SW8 A;  5AEQ A;  1D1O A;  1B8R A;  5GQQ C;  2HET A;  5BPJ A;  1Y0V H;  4GGF C;  1V1F A;  1OZO A;  1BOC A;  5PAL A;  1WDC C;  4OCI A;  1K2H A;  1S6C A;  2MHH A;  1S3P A;  4MZK A;  2LMV A;  1DJH A;  4FTG A;  1CFF A;  1CKK A;  2L0P A;  2H61 C;  1KQM B;  1RRO A;  3D0Y B;  2KGR A;  2WCF A;  5AER A;  1CLM A;  1GJY A;  1K9U A;  1WY9 A;  2GV5 A;  3NSO A;  3O2P A;  1S6J A;  5HKY A;  4GPL B;  1J7P A;  2JQ6 A;  1ZFS A;  1NX0 A;  3NXA A;  3ZNI A;  5CSN A;  1QX7 A;  1AUI B;  3PLF B;  2JXC A;  1W7I B;  1HT9 A;  2KBI A;  2LVI A;  1Y1X A;  1MXL C;  1XFX O;  3IQO A;  3DF0 A;  4FQO A;  2PMY A;  2MJW B;  1EXR A;  5AFP A;  1JC2 A;  2BCB A;  3EK7 A;  1LA0 A;  2Y4Q A;  1CLB A;  4C0K A;  1SCV A;  1TCO B;  1PUL A;  1J7Q A;  1NWD A;  4PHJ A;  2LMT A;  4C0L A;  2V53 A;  3JVT B;  1XFY O;  1EH2 A;  3EK4 A;  3PN7 B;  4M2Q A;  1CDP A;  1XK4 A;  2L5X B;  2ZKM X;  4PHK A;  3DF0 B;  4USL A;  2BE4 A;  2R2I A;  5AAN A;  2NCP A;  4YGE B;  1CFP A;  1SYM A;  1FI5 A;  2JTZ A;  1IJ5 A;  1TNP A;  3RLZ A;  1B7T Y;  1K94 A;  1LVC D;  2MAZ A;  1KFX L;  1UHH A;  1NP8 A;  2JC2 A;  2BKH B;  2K2A A;  2PAS A;  1B8L A;  5CSJ A;  1TOP A;  4MZL A;  4TNC A;  2M1K B;  2ZND A;  3PSR A;  1K8U A;  1RFJ A;  1KK7 Y;  3BUW B;  3VRR A;  1QAS A;  1QTX A;  3FWC A;  1S26 D;  1YUS A;  3F45 A;  2D8N A;  4MRX A;  1A03 A;  4OVN F;  4ETO A;  4OR9 B;  4C0J A;  1SBJ A;  2MA2 A;  3JVT C;  3NSK A;  3EVV A;  1DGV A;  3PN7 C;  3H4S E;  4QJ5 B;  4P2Y B;  1CDN A;  1ALV A;  2Y1M A;  1BR4 B;  2K2F A;  1NCZ A;  4NQG A;  1BJF A;  1EG4 A;  2LCP A;  1JWD A;  1M31 A;  3I5H C;  3OX5 A;  1QX5 B;  1DF0 A;  1A75 A;  3WHU B;  4AQJ A;  1M45 A;  4ORA B;  1VRK A;  2SAS A;  1XK4 C;  2WCE A;  1KSM A;  4L9M A;  1CNP A;  3CWG A;  1B7T Z;  1RWY A;  2FCE A;  4NDC A;  3WXA A;  3TUY C;  3I5G B;  3KPX A;  3BUO B;  3VRQ A;  2NXQ A;  2KQ6 A;  4CPV A;  1BT6 A;  4MSP A;  4DS7 A;  1DF0 B;  2BBM A;  1A75 B;  4Q04 A;  2DOQ A;  2K8M B;  3HCM A;  1SNL A;  1AJ5 A;  2AMI A;  1K96 A;  2JRF A;  1F55 A;  5KSZ A;  1LA3 A;  1TNW A;  1OQP A;  3WHT B;  1KWO C;  2K7D A;  1F8H A;  1KK8 B;  1JFK A;  3BOW A;  1AVS A;  3ZWH A;  1QAT A;  1U5I A;  3OX6 A;  2LP3 A;  1FF1 A;  1ZAC A;  2NLN A;  1PSB A;  2LV7 A;  4JPZ B;  1DMO A;  2CXJ A;  3PM8 A;  1SMG A;  1PVA A;  1XFU O;  1TNQ A;  2PSR A;  1K93 D;  3EVU A;  1K95 A;  1SKT A;  3BUM B;  1CB1 A;  2KFH A;  3AKA A;  1MF8 B;  3CGA A;  1YTZ C;  3BOW B;  1DJW A;  2KAV A;  1U5I B;  2KQY A;  1IRJ A;  3EK8 A;  2E6W A;  1ZMZ A;  1YVL A;  3EKH A;  2BCA A;  1M63 B;  4N1G A;  1KFU S;  1C7V A;  2BL0 B;  4MLW A;  1GGZ A;  2KI4 B;  3LK0 A;  2M8U A;  2ZNE A;  3IF7 A;  1IKU A;  1UHN A;  1XFZ O;  3WNX B;  1QIV A;  4PAL A;  1S36 A;  2BKI B;  3OP0 A;  1DT7 B;  3DVE A;  1SCM C;  5JOL A;  1OE9 B;  3HX4 A;  4NDD A;  1S5G Y;  1MR8 A;  2EC6 B;  1C07 A;  1C7W A;  1YRU B;  2PAL A;  1CM4 A;  2NZ0 A;  4BY4 A;  1TNX A;  3JTD C;  1KFX S;  5D69 A;  1QVI Z;  2RGI A;  3BUN B;  2LVV A;  1FBV A;  5I2L A;  2JNF A;  1BOD A;  2BEC A;  3O4Y A;  3CS1 A;  1JF0 A;  1NSH A;  1QV0 A;  1YRT B;  2KYC A;  1SK6 D;  2E30 A;  5CPV A;  4AOM A;  4U8D A;  2M97 A;  5DKQ A;  3EKJ A;  2G9B A;  3I5I B;  3OHM B;  4N1F A;  3SG5 A;  2KI4 C;  3GK2 A;  3FIA A;  1KFU L;  2F8P A;  4HSZ A;  2WOS A;  1RK9 A;  4ORB B;  4JWQ A; 
#chains in the Genus database with same CATH topology
 2JWW A;  2LHL A;  3DYE A;  1KQM C;  3CDN A;  4ZCV A;  1UUS A;  4D1E A;  3AAJ A;  2K61 A;  1XFW O;  2KSP A;  4MVF A;  3KF9 A;  4IJ7 A;  1GM0 A;  3KEV A;  3SG7 A;  2H2K A;  1CFD A;  1R6P A;  4XJK A;  2PQL A;  5HL1 A;  1W7J B;  2ZRS A;  2L4I A;  3CR4 X;  1OOF A;  4GFT A;  1WLZ A;  3DVJ A;  3QME A;  1W9Z A;  2M29 A;  1BLQ A;  1PK0 D;  1ZUZ A;  1CFC A;  2F2P A;  2QEO A;  1SL7 A;  4YBH B;  1UHJ A;  1DJZ A;  1YUU A;  2KHN A;  3D10 A;  2M7L A;  2OS8 B;  1EJ3 A;  4MEW A;  1QX2 A;  2K7O A;  1QLS A;  2KI6 D;  1PVB A;  3SIB A;  2MLF C;  1XO5 A;  2LE9 B;  2LVK A;  4I5J A;  5DKN A;  3I5I C;  3PAL A;  1ALW A;  2LUX A;  1FPW A;  3TZ1 A;  1QXP A;  3GK1 A;  4XJK B;  2JNX A;  5EL2 A;  5AXI A;  1CDM A;  3B88 A;  1K9P A;  5ER4 X;  1S6I A;  3BXK A;  2ZFD A;  1CDL A;  4HRH A;  3TS5 B;  1LIN A;  5I8N A;  2FCD A;  2KFG A;  2WCB A;  2LLU A;  2BNX A;  4GBA A;  2K7B A;  1M46 A;  2LP2 A;  2LLT A;  2JTT A;  5TNC A;  1N65 A;  2JZI A;  5CSI A;  2ZRT A;  2BBN A;  3OB1 B;  2PRU A;  2I2R E;  3MSE B;  2HQW A;  3CZ1 A;  3NHI A;  3DY9 A;  4M2P A;  4F0Z B;  1BG1 A;  1IH0 A;  1PRW A;  1F54 A;  2LUC A;  2KOT A;  3SS4 A;  1M39 A;  2LAN A;  1MHO A;  1SRA A;  3B6X A;  5CSF A;  3GOF A;  2M9G A;  1V1G A;  3PJI A;  1ORG A;  3LL8 B;  2M3W A;  2PYQ A;  3DD4 A;  2HPS A;  3A4U B;  3VRP A;  1ZOT B;  2ERB A;  2LNK A;  3GK4 X;  1SY9 A;  2JT3 A;  2L98 A;  1S1E A;  2JXL A;  2MBX A;  2P6B B;  1UHK A;  4INW A;  2WC5 A;  1IGV A;  1JFJ A;  1B8C A;  1UUR A;  3FWB A;  2FJU B;  3TS5 C;  2CT9 A;  1Y6W A;  1KK7 Z;  4GUK A;  3VRN A;  1CMG A;  1K90 D;  5D3O A;  4OKH A;  4GNK B;  1FI6 A;  1SR6 B;  1Y1A A;  2WC8 A;  1B1G A;  4PE1 A;  4YGA A;  1NIW A;  1FW4 A;  1J55 A;  2OPO A;  3QRX A;  3KHE A;  1CM1 A;  2SCP A;  1L2O B;  2A4J A;  2KDH A;  4I5N B;  1IQ5 A;  1DJG A;  3LCP C;  4DIR A;  1RTP 1;  3D73 A;  3FE6 A;  3LK1 A;  2Y1N A;  3DVK A;  5G08 A;  2CTN A;  3PAT A;  2L2C A;  4YGD B;  3A8R A;  2L50 A;  3I5G C;  4JD9 A;  3O78 A;  4N5X A;  4A4B A;  2JOJ A;  3L47 A;  4DCK A;  3RZS A;  3TDU A;  4YGB B;  1ODB A;  1F71 A;  4P5O E;  4ICB A;  1TCF A;  4E68 A;  1H8B A;  1TTX A;  2OTG B;  4CLN A;  1J7R A;  1OOJ A;  5ER5 A;  1B4C A;  1E8A A;  1WDC B;  4I5L B;  2M49 B;  2B1U A;  4UPG A;  1R2U A;  1MUX A;  1KK8 C;  1YR5 A;  4WQ3 A;  3S0D A;  4YGC B;  4PE0 A;  1A29 A;  1N0Y A;  4PHM A;  1CMF A;  3E3R A;  3ICB A;  4QJ4 B;  2FOT A;  1K9K A;  1AJ4 A;  4I5K A;  1JF2 A;  4INX A;  2Q4U A;  4PHN A;  1DC1 A;  1JBA A;  2M0R A;  3K21 A;  1G4Y R;  3NSI A;  3PFV A;  2Y5I A;  4ZCU A;  1OMV A;  2WC6 A;  1QWV A;  3O4X A;  3O6B A;  3BQ3 A;  1J1D A;  1NX1 A;  5FI7 A;  1TN4 A;  1YX7 A;  1OMR A;  2CBL A;  4CID A;  1GGW A;  1DJY A;  1KSO A;  1MXE A;  2H8V A;  2I94 A;  3AAK A;  3AKB A;  2OTG C;  3FE8 A;  1AP4 A;  3TDZ A;  3OGN A;  3M0W A;  1IG5 A;  2QEB A;  5I2O A;  3BYA A;  5HKW A;  1DTL A;  3S0E A;  2IS9 A;  4MRY A;  1PAL A;  2ISD A;  2WCL A;  1C3Y A;  1CLL A;  3BUX B;  1RJV A;  2BL0 C;  1DGU A;  1AK8 A;  3FE9 A;  3BFA A;  5F6T A;  3RM1 A;  2JPT A;  2LLS A;  1NUB A;  3I5F B;  1DVI A;  1OOG A;  4IL1 A;  1QS7 A;  2KBM A;  2LC5 A;  3K1E A;  4PDZ A;  3SG4 A;  4CFQ A;  1J7O A;  2CCM A;  1IIO A;  1JUO A;  2EC6 C;  4XYN A;  5HLO A;  2HF5 A;  2I7A A;  2QDI A;  4MZJ A;  2LVJ A;  1F70 A;  1A2X A;  2WND A;  3CTN A;  1XVJ A;  1OZS A;  3CZ0 A;  1S5G Z;  1G33 A;  2KI6 C;  1WRZ A;  2TN4 A;  3B7A A;  1Q80 A;  1SPY A;  1KCY A;  2L51 A;  2ZN8 A;  1YUT A;  1LXF C;  4BY5 A;  2F3Y A;  2KAY A;  3EG5 B;  1TRF A;  2G2B A;  2LMU A;  2WCK A;  2KAX A;  5IBW A;  1F4Q A;  2ZN9 A;  1NCX A;  2O60 A;  3IVT A;  1EL4 A;  3I5F C;  5D7F A;  3CLN A;  5DKR A;  2K0J A;  2FJY A;  2WCJ A;  4PE7 A;  1DJX A;  2JT0 A;  2QAC A;  3I5H B;  2AUC A;  2MRD A;  2F2O A;  2KNE A;  5I94 A;  1IJ6 A;  5FYX A;  4MBE A;  4YI8 A;  3S0G A;  2F3Z A;  3SG6 A;  2M1U A;  2VRG A;  1EG3 A;  2JT8 A;  3EVR A;  4F7F A;  1IQ3 A;  4WQ2 A;  4YRU A;  1AHR A;  1WLM A;  2GGM A;  3CR5 X;  1T14 A;  1DJI A;  4YI9 A;  4PT1 A;  2OS8 C;  1XA5 A;  3TUY B;  1N2D A;  4WRI A;  1MQ1 A;  2O5G A;  1JSA A;  4HRE E;  3BJH A;  1SL9 A;  5HYD A;  5K89 A;  1QJT A;  3DVM A;  4HRG A;  2NCO A;  1J1E A;  4A4C A;  4DUQ A;  1CTR A;  1DQE A;  2BE6 A;  1NX2 A;  2F33 A;  3NSL A;  1NYA A;  5J3X A;  1UP5 A;  5KTY A;  1Z2C B;  2EHB A;  2K7C A;  3C1V A;  2LM5 A;  2KFF A;  3VB1 A;  1DEK A;  2KLD A;  1B47 A;  2M7N A;  1GQM A;  3VGO A;  5HLV A;  2BAP A;  1KWO B;  3SG3 A;  2CNP A;  1QLK A;  2EGD A;  2HQ8 A;  2KGB C;  4AQI A;  2JU0 A;  1DEL A;  1XYD A;  1A4P A;  2BCX A;  1QIW A;  4M2O A;  3D74 A;  1TIZ A;  1PSR A;  4GAO A;  5B8I B;  3CR2 A;  4GGF A;  5HKZ A;  2LHI A;  4QJ3 B;  1Y1U A;  1NCY A;  4ORC B;  2Q91 A;  2WOR A;  3KO0 A;  3S0A A;  3FS7 A;  2QPT A;  4DRW A;  1QV1 A;  3DXL A;  2JUL A;  1OSA A;  2L2E A;  4JKT A;  2I18 A;  3R1V A;  5FI2 A;  1REC A;  4MN0 A;  2K60 A;  1UHI A;  2KYF A;  2AAO A;  2H61 A;  3BFH A;  1IWQ A;  2PVB A;  1XFV O;  3CZT X;  1H4B A;  1SL8 A;  1UWO A;  5I2Q A;  1F4O A;  5KU1 A;  1BF5 A;  2GGZ A;  1NPQ A;  1P28 A;  1SR6 C;  1YX8 A;  4CFR A;  4NDB A;  1YUR A;  3OB2 B;  1L2O C;  5JJG A;  1LKJ A;  3SIA A;  1YVH A;  1NX3 A;  4R1E A;  1SCM B;  1HQV A;  1LS8 A;  1BR1 B;  3TDI A;  1WRK A;  1L7Z A;  1X02 A;  1QVI Y;  4FQT A;  3VRO A;  2WCH A;  1WRL A;  2COL B;  3IQQ A;  3LLE A;  4PE4 A;  1MWN A;  4PCW A;  2MLE C;  4JQ0 D;  1BU3 A;  1BMO A;  4OV2 A;  1KQV A;  3SJS A;  3CAB A;  3SG2 A;  2LAP A;  3JTD B;  1G8I A;  2L4H A;  4GGN A;  1B9A A;  1OMD A;  3D0Y A;  1SW8 A;  3N7H A;  5AEQ A;  1D1O A;  1B8R A;  5GQQ C;  2HET A;  5BPJ A;  1Y0V H;  4GGF C;  1V1F A;  1OZO A;  3Q8I A;  1BOC A;  3NGV A;  5PAL A;  1WDC C;  4OCI A;  1K2H A;  2GTE A;  1S6C A;  2MHH A;  1S3P A;  4MZK A;  3L4A A;  2LMV A;  1DJH A;  4FTG A;  1CFF A;  1CKK A;  2L0P A;  2H61 C;  2QEV A;  1KQM B;  1RRO A;  3D0Y B;  2KGR A;  2WCF A;  5AER A;  3D77 A;  1CLM A;  1GJY A;  1K9U A;  1WY9 A;  2GV5 A;  2KLE A;  3NSO A;  3O2P A;  1S6J A;  3SS3 A;  5HKY A;  4GPL B;  1J7P A;  2JQ6 A;  1ZFS A;  1NX0 A;  3NXA A;  3ZNI A;  3UNW A;  2JPO A;  5CSN A;  1QX7 A;  1AUI B;  3PLF B;  2JXC A;  1W7I B;  1HT9 A;  2KBI A;  2LVI A;  1Y1X A;  1MXL C;  1XFX O;  3IQO A;  3DF0 A;  2WCM A;  2KPH A;  3R1P A;  4FQO A;  2PMY A;  2MJW B;  1EXR A;  5AFP A;  1JC2 A;  2BCB A;  3EK7 A;  1LA0 A;  2Y4Q A;  1CLB A;  4C0K A;  1SCV A;  1TCO B;  1PUL A;  1J7Q A;  1NWD A;  4PHJ A;  2LMT A;  3V2L A;  4C0L A;  2V53 A;  2YGU A;  3JVT B;  1XFY O;  1EH2 A;  3EK4 A;  3PN7 B;  4M2Q A;  1CDP A;  1XK4 A;  2L5X B;  2ZKM X;  3B87 A;  3DF0 B;  4PHK A;  4USL A;  2BE4 A;  2R2I A;  5AAN A;  2NCP A;  4YGE B;  1CFP A;  1SYM A;  1FI5 A;  1OOH A;  2JTZ A;  1IJ5 A;  1TNP A;  3RLZ A;  1B7T Y;  1K94 A;  1LVC D;  2MAZ A;  1KFX L;  1UHH A;  1NP8 A;  2JC2 A;  2BKH B;  2K2A A;  2PAS A;  1B8L A;  5CSJ A;  1TOP A;  4MZL A;  4TNC A;  2M1K B;  2ZND A;  3PSR A;  2QEH A;  1K8U A;  1RFJ A;  1KK7 Y;  3BUW B;  3VRR A;  1QAS A;  1QTX A;  3FWC A;  1S26 D;  1YUS A;  3F45 A;  2D8N A;  4MRX A;  1A03 A;  4OVN F;  4ETO A;  4OR9 B;  4C0J A;  3S0B A;  1SBJ A;  2MA2 A;  3JVT C;  3NSK A;  3EVV A;  1DGV A;  3PN7 C;  3H4S E;  3D78 A;  4P2Y B;  4QJ5 B;  1ALV A;  2Y1M A;  1CDN A;  4OZD A;  1BR4 B;  3R72 A;  2K2F A;  1NCZ A;  4NQG A;  1BJF A;  1EG4 A;  2LCP A;  1JWD A;  1M31 A;  3I5H C;  3OX5 A;  1QX5 B;  1DF0 A;  1A75 A;  3WHU B;  4AQJ A;  1M45 A;  4ORA B;  1VRK A;  2SAS A;  1XK4 C;  2WCE A;  1KSM A;  3PM2 A;  4L9M A;  1CNP A;  3CWG A;  1B7T Z;  3UO9 A;  1RWY A;  2FCE A;  4NDC A;  3WXA A;  3TUY C;  1OW4 A;  3I5G B;  1SSE B;  3BUO B;  3KPX A;  3VRQ A;  2NXQ A;  2KQ6 A;  4CPV A;  1BT6 A;  4MSP A;  3OBV A;  4DS7 A;  1DF0 B;  2BBM A;  1A75 B;  4Q04 A;  2DOQ A;  2K8M B;  2P70 A;  4KYN A;  3HCM A;  1SNL A;  1AJ5 A;  2AMI A;  1K96 A;  2JRF A;  1F55 A;  1TWO A;  1TUZ A;  5KSZ A;  1TUJ A;  3L4L A;  1LA3 A;  1TNW A;  1OQP A;  3BFB A;  3WHT B;  1KWO C;  2K7D A;  1F8H A;  1KK8 B;  1JFK A;  3BOW A;  1AVS A;  3ZWH A;  1QAT A;  1U5I A;  3OX6 A;  2LP3 A;  1FF1 A;  1ZAC A;  2NLN A;  1PSB A;  2LV7 A;  4JPZ B;  1DMO A;  2CXJ A;  3PM8 A;  3CYZ A;  1SMG A;  1PVA A;  1XFU O;  1TNQ A;  2PSR A;  3NHT A;  1K93 D;  3EVU A;  1K95 A;  1SKT A;  3BUM B;  1XFR A;  2KFH A;  3AKA A;  1MF8 B;  3CGA A;  1CB1 A;  1YTZ C;  3BOW B;  3B86 A;  1DJW A;  2L5Y A;  2KAV A;  1U5I B;  2KQY A;  1IRJ A;  3EK8 A;  2E6W A;  1ZMZ A;  1YVL A;  3D75 A;  3EKH A;  2BCA A;  2P71 A;  1M63 B;  3R1O A;  4N1G A;  3CZ2 A;  1KFU S;  1C7V A;  2BL0 B;  4MLW A;  1GGZ A;  2KI4 B;  3LK0 A;  2M8U A;  2ZNE A;  3IF7 A;  1IKU A;  1UHN A;  1XFZ O;  5FI6 A;  1QIV A;  3WNX B;  4PAL A;  1S36 A;  2BKI B;  5DIC A;  3OP0 A;  1DT7 B;  3DVE A;  1C3Z A;  1SCM C;  5JOL A;  1OE9 B;  3HX4 A;  4NDD A;  1S5G Y;  1MR8 A;  3D76 A;  3DZT A;  2EC6 B;  1C07 A;  1C7W A;  1YRU B;  2PAL A;  1CM4 A;  3S0F A;  2NZ0 A;  4BY4 A;  1TNX A;  3JTD C;  1KFX S;  1OOI X;  5D69 A;  3SS5 A;  1QVI Z;  1Z4H A;  2RGI A;  3BUN B;  2LVV A;  1FBV A;  5I2L A;  2JNF A;  1BOD A;  2BEC A;  3O4Y A;  3CS1 A;  1JF0 A;  1NSH A;  1QV0 A;  1YRT B;  2KYC A;  1SK6 D;  2E30 A;  5CPV A;  4AOM A;  4U8D A;  2M97 A;  5DKQ A;  3EKJ A;  2G9B A;  3I5I B;  3OHM B;  4N1F A;  3SG5 A;  2KI4 C;  3GK2 A;  3FIA A;  1KFU L;  2F8P A;  4HSZ A;  2WOS A;  1RK9 A;  4ORB B;  4JWQ A; 
#chains in the Genus database with same CATH homology
 2JWW A;  2LHL A;  1KQM C;  4ZCV A;  1UUS A;  4D1E A;  3AAJ A;  2K61 A;  1XFW O;  2KSP A;  4MVF A;  3KF9 A;  3KEV A;  3SG7 A;  2H2K A;  1CFD A;  1R6P A;  4XJK A;  1W7J B;  2ZRS A;  2L4I A;  3CR4 X;  4GFT A;  1WLZ A;  3DVJ A;  2M29 A;  1BLQ A;  1PK0 D;  1ZUZ A;  1CFC A;  2F2P A;  4YBH B;  1SL7 A;  1UHJ A;  1DJZ A;  1YUU A;  2KHN A;  3D10 A;  2M7L A;  2OS8 B;  1EJ3 A;  4MEW A;  1QX2 A;  2K7O A;  1QLS A;  2KI6 D;  1PVB A;  3SIB A;  2MLF C;  1XO5 A;  2LE9 B;  2LVK A;  4I5J A;  5DKN A;  3I5I C;  3PAL A;  1ALW A;  2LUX A;  1FPW A;  3TZ1 A;  1QXP A;  3GK1 A;  4XJK B;  2JNX A;  5AXI A;  1CDM A;  1K9P A;  5ER4 X;  1S6I A;  3BXK A;  2ZFD A;  1CDL A;  4HRH A;  3TS5 B;  1LIN A;  5I8N A;  2FCD A;  2KFG A;  2WCB A;  2LLU A;  4GBA A;  2K7B A;  1M46 A;  2LP2 A;  2LLT A;  2JTT A;  5TNC A;  1N65 A;  2JZI A;  5CSI A;  2ZRT A;  2BBN A;  3OB1 B;  2PRU A;  2I2R E;  3MSE B;  2HQW A;  4M2P A;  4F0Z B;  1BG1 A;  1IH0 A;  1PRW A;  1F54 A;  2LUC A;  2KOT A;  1M39 A;  2LAN A;  1MHO A;  1SRA A;  5CSF A;  3GOF A;  2M9G A;  1V1G A;  3LL8 B;  2M3W A;  3DD4 A;  2HPS A;  3A4U B;  3VRP A;  1ZOT B;  2LNK A;  3GK4 X;  1SY9 A;  2JT3 A;  2L98 A;  1S1E A;  2JXL A;  2MBX A;  2P6B B;  1UHK A;  1JFJ A;  1IGV A;  1B8C A;  1UUR A;  3FWB A;  2FJU B;  3TS5 C;  2CT9 A;  1Y6W A;  1KK7 Z;  4GUK A;  3VRN A;  1CMG A;  1K90 D;  4OKH A;  4GNK B;  1FI6 A;  1SR6 B;  1Y1A A;  2WC8 A;  1B1G A;  4PE1 A;  4YGA A;  1NIW A;  1FW4 A;  1J55 A;  2OPO A;  3QRX A;  3KHE A;  1CM1 A;  2SCP A;  1L2O B;  2A4J A;  2KDH A;  4I5N B;  1IQ5 A;  1DJG A;  3LCP C;  4DIR A;  1RTP 1;  3LK1 A;  2Y1N A;  3DVK A;  5G08 A;  2CTN A;  3PAT A;  4YGD B;  3A8R A;  2L50 A;  3I5G C;  3O78 A;  4N5X A;  4A4B A;  2JOJ A;  4DCK A;  3TDU A;  4YGB B;  1ODB A;  1F71 A;  4P5O E;  4ICB A;  1TCF A;  4E68 A;  1H8B A;  1TTX A;  2OTG B;  4CLN A;  1J7R A;  1OOJ A;  5ER5 A;  1B4C A;  1E8A A;  1WDC B;  4I5L B;  2M49 B;  2B1U A;  4UPG A;  1R2U A;  1MUX A;  1KK8 C;  1YR5 A;  4WQ3 A;  4YGC B;  4PE0 A;  1A29 A;  1N0Y A;  4PHM A;  1CMF A;  3E3R A;  3ICB A;  4QJ4 B;  2FOT A;  1K9K A;  1AJ4 A;  4I5K A;  1JF2 A;  2Q4U A;  4PHN A;  1JBA A;  2M0R A;  3K21 A;  1G4Y R;  3NSI A;  3PFV A;  2Y5I A;  4ZCU A;  1OMV A;  3O6B A;  3BQ3 A;  1J1D A;  1NX1 A;  4CID A;  1TN4 A;  1YX7 A;  1OMR A;  2CBL A;  1GGW A;  1DJY A;  1KSO A;  1MXE A;  2I94 A;  3AKB A;  3AAK A;  2OTG C;  1AP4 A;  3TDZ A;  3M0W A;  1IG5 A;  5I2O A;  3BYA A;  5HKW A;  1DTL A;  2IS9 A;  4MRY A;  1PAL A;  2ISD A;  1CLL A;  3BUX B;  1RJV A;  2BL0 C;  1DGU A;  1AK8 A;  5F6T A;  3RM1 A;  2JPT A;  2LLS A;  1NUB A;  3I5F B;  1DVI A;  4IL1 A;  1QS7 A;  2KBM A;  2LC5 A;  4PDZ A;  3SG4 A;  4CFQ A;  1J7O A;  2CCM A;  1JUO A;  2EC6 C;  4XYN A;  5HLO A;  2HF5 A;  2I7A A;  4MZJ A;  2LVJ A;  1F70 A;  1A2X A;  2WND A;  3CTN A;  1XVJ A;  1OZS A;  1S5G Z;  1G33 A;  2KI6 C;  1WRZ A;  2TN4 A;  1Q80 A;  1SPY A;  1KCY A;  2L51 A;  2ZN8 A;  1YUT A;  1LXF C;  4BY5 A;  2F3Y A;  2KAY A;  1TRF A;  2G2B A;  2LMU A;  2KAX A;  5IBW A;  1F4Q A;  2ZN9 A;  1NCX A;  2O60 A;  1EL4 A;  3I5F C;  5D7F A;  3CLN A;  5DKR A;  2K0J A;  4PE7 A;  1DJX A;  2JT0 A;  2QAC A;  3I5H B;  2AUC A;  2MRD A;  2F2O A;  2KNE A;  1IJ6 A;  5FYX A;  4MBE A;  4YI8 A;  3SG6 A;  2F3Z A;  2M1U A;  2VRG A;  1EG3 A;  2JT8 A;  3EVR A;  1IQ3 A;  4WQ2 A;  4YRU A;  1AHR A;  1WLM A;  2GGM A;  3CR5 X;  1DJI A;  4YI9 A;  2OS8 C;  1XA5 A;  3TUY B;  1N2D A;  4WRI A;  1MQ1 A;  2O5G A;  1JSA A;  4HRE E;  1SL9 A;  5HYD A;  5K89 A;  1QJT A;  3DVM A;  4HRG A;  2NCO A;  1J1E A;  4A4C A;  4DUQ A;  1CTR A;  2BE6 A;  1NX2 A;  2F33 A;  3NSL A;  1NYA A;  5J3X A;  1UP5 A;  5KTY A;  2EHB A;  2K7C A;  3C1V A;  2LM5 A;  2KFF A;  1B47 A;  2M7N A;  1GQM A;  3VGO A;  5HLV A;  1KWO B;  3SG3 A;  2CNP A;  1QLK A;  2EGD A;  2HQ8 A;  2KGB C;  4AQI A;  2JU0 A;  1XYD A;  1A4P A;  2BCX A;  1QIW A;  4M2O A;  1TIZ A;  1PSR A;  4GAO A;  5B8I B;  3CR2 A;  4GGF A;  5HKZ A;  2LHI A;  4QJ3 B;  1Y1U A;  1NCY A;  4ORC B;  2Q91 A;  2WOR A;  3KO0 A;  3FS7 A;  2QPT A;  4DRW A;  1QV1 A;  2JUL A;  1OSA A;  2L2E A;  2I18 A;  1REC A;  4MN0 A;  1UHI A;  2KYF A;  2AAO A;  2H61 A;  1IWQ A;  2PVB A;  1XFV O;  3CZT X;  1H4B A;  1SL8 A;  1UWO A;  5I2Q A;  1F4O A;  5KU1 A;  1BF5 A;  2GGZ A;  1NPQ A;  1SR6 C;  1YX8 A;  4CFR A;  4NDB A;  1YUR A;  3OB2 B;  1L2O C;  5JJG A;  1LKJ A;  3SIA A;  1YVH A;  1NX3 A;  4R1E A;  1SCM B;  1HQV A;  1BR1 B;  3TDI A;  1WRK A;  1L7Z A;  1X02 A;  1QVI Y;  3VRO A;  1WRL A;  2COL B;  3IQQ A;  3LLE A;  4PE4 A;  1MWN A;  4PCW A;  2MLE C;  4JQ0 D;  1BU3 A;  1BMO A;  4OV2 A;  1KQV A;  3SJS A;  3SG2 A;  2LAP A;  3JTD B;  1G8I A;  2L4H A;  4GGN A;  1B9A A;  1OMD A;  3D0Y A;  1SW8 A;  5AEQ A;  1D1O A;  1B8R A;  5GQQ C;  2HET A;  5BPJ A;  1Y0V H;  4GGF C;  1V1F A;  1OZO A;  1BOC A;  5PAL A;  1WDC C;  4OCI A;  1K2H A;  1S6C A;  2MHH A;  1S3P A;  4MZK A;  2LMV A;  1DJH A;  4FTG A;  1CFF A;  1CKK A;  2L0P A;  2H61 C;  1KQM B;  1RRO A;  3D0Y B;  2KGR A;  2WCF A;  5AER A;  1CLM A;  1GJY A;  1K9U A;  1WY9 A;  2GV5 A;  3NSO A;  3O2P A;  1S6J A;  5HKY A;  4GPL B;  1J7P A;  2JQ6 A;  1ZFS A;  1NX0 A;  3NXA A;  3ZNI A;  5CSN A;  1QX7 A;  1AUI B;  3PLF B;  2JXC A;  1W7I B;  1HT9 A;  2KBI A;  2LVI A;  1Y1X A;  1MXL C;  1XFX O;  3IQO A;  3DF0 A;  4FQO A;  2PMY A;  2MJW B;  1EXR A;  5AFP A;  1JC2 A;  2BCB A;  3EK7 A;  1LA0 A;  2Y4Q A;  1CLB A;  4C0K A;  1SCV A;  1TCO B;  1PUL A;  1J7Q A;  1NWD A;  4PHJ A;  2LMT A;  4C0L A;  2V53 A;  3JVT B;  1XFY O;  1EH2 A;  3EK4 A;  3PN7 B;  4M2Q A;  1CDP A;  1XK4 A;  2L5X B;  2ZKM X;  4PHK A;  3DF0 B;  4USL A;  2BE4 A;  2R2I A;  5AAN A;  2NCP A;  4YGE B;  1CFP A;  1SYM A;  1FI5 A;  2JTZ A;  1IJ5 A;  1TNP A;  3RLZ A;  1B7T Y;  1K94 A;  1LVC D;  2MAZ A;  1KFX L;  1UHH A;  1NP8 A;  2JC2 A;  2BKH B;  2K2A A;  2PAS A;  1B8L A;  5CSJ A;  1TOP A;  4MZL A;  4TNC A;  2M1K B;  2ZND A;  3PSR A;  1K8U A;  1RFJ A;  1KK7 Y;  3BUW B;  3VRR A;  1QAS A;  1QTX A;  3FWC A;  1S26 D;  1YUS A;  3F45 A;  2D8N A;  4MRX A;  1A03 A;  4OVN F;  4ETO A;  4OR9 B;  4C0J A;  1SBJ A;  2MA2 A;  3JVT C;  3NSK A;  3EVV A;  1DGV A;  3PN7 C;  3H4S E;  4QJ5 B;  4P2Y B;  1CDN A;  1ALV A;  2Y1M A;  1BR4 B;  2K2F A;  1NCZ A;  4NQG A;  1BJF A;  1EG4 A;  2LCP A;  1JWD A;  1M31 A;  3I5H C;  3OX5 A;  1QX5 B;  1DF0 A;  1A75 A;  3WHU B;  4AQJ A;  1M45 A;  4ORA B;  1VRK A;  2SAS A;  1XK4 C;  2WCE A;  1KSM A;  4L9M A;  1CNP A;  3CWG A;  1B7T Z;  1RWY A;  2FCE A;  4NDC A;  3WXA A;  3TUY C;  3I5G B;  3KPX A;  3BUO B;  3VRQ A;  2NXQ A;  2KQ6 A;  4CPV A;  1BT6 A;  4MSP A;  4DS7 A;  1DF0 B;  2BBM A;  1A75 B;  4Q04 A;  2DOQ A;  2K8M B;  3HCM A;  1SNL A;  1AJ5 A;  2AMI A;  1K96 A;  2JRF A;  1F55 A;  5KSZ A;  1LA3 A;  1TNW A;  1OQP A;  3WHT B;  1KWO C;  2K7D A;  1F8H A;  1KK8 B;  1JFK A;  3BOW A;  1AVS A;  3ZWH A;  1QAT A;  1U5I A;  3OX6 A;  2LP3 A;  1FF1 A;  1ZAC A;  2NLN A;  1PSB A;  2LV7 A;  4JPZ B;  1DMO A;  2CXJ A;  3PM8 A;  1SMG A;  1PVA A;  1XFU O;  1TNQ A;  2PSR A;  1K93 D;  3EVU A;  1K95 A;  1SKT A;  3BUM B;  1CB1 A;  2KFH A;  3AKA A;  1MF8 B;  3CGA A;  1YTZ C;  3BOW B;  1DJW A;  2KAV A;  1U5I B;  2KQY A;  1IRJ A;  3EK8 A;  2E6W A;  1ZMZ A;  1YVL A;  3EKH A;  2BCA A;  1M63 B;  4N1G A;  1KFU S;  1C7V A;  2BL0 B;  4MLW A;  1GGZ A;  2KI4 B;  3LK0 A;  2M8U A;  2ZNE A;  3IF7 A;  1IKU A;  1UHN A;  1XFZ O;  3WNX B;  1QIV A;  4PAL A;  1S36 A;  2BKI B;  3OP0 A;  1DT7 B;  3DVE A;  1SCM C;  5JOL A;  1OE9 B;  3HX4 A;  4NDD A;  1S5G Y;  1MR8 A;  2EC6 B;  1C07 A;  1C7W A;  1YRU B;  2PAL A;  1CM4 A;  2NZ0 A;  4BY4 A;  1TNX A;  3JTD C;  1KFX S;  5D69 A;  1QVI Z;  2RGI A;  3BUN B;  2LVV A;  1FBV A;  5I2L A;  2JNF A;  1BOD A;  2BEC A;  3O4Y A;  3CS1 A;  1JF0 A;  1NSH A;  1QV0 A;  1YRT B;  2KYC A;  1SK6 D;  2E30 A;  5CPV A;  4AOM A;  4U8D A;  2M97 A;  5DKQ A;  3EKJ A;  2G9B A;  3I5I B;  3OHM B;  4N1F A;  3SG5 A;  2KI4 C;  3GK2 A;  3FIA A;  1KFU L;  2F8P A;  4HSZ A;  2WOS A;  1RK9 A;  4ORB B;  4JWQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...