3A8RA

The structure of the n-terminal regulatory domain of a plant nadph oxidase
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
166
structure length
166
Chain Sequence
b'TKSSAAVALKGLQFVTAKVGNDGWAAVEKRFNQLQVDGVLLRSRFGKCIGMDGSDEFAVQMFDSLARKRGIVKQVLTKDELKDFYEQLTDQGFDNRLRTFFDMVDKNADGRLTAEEVKEIIALSASANKLSKIKERADEYTALIMEELDPTNLGYIEMEDLEALLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title The structure of the N-terminal regulatory domain of a plant NADPH oxidase and its functional implications
pubmed doi rcsb
source organism Oryza sativa japonica group
molecule tags Calcium binding protein
total genus 61
structure length 166
sequence length 166
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3a8rA01
2OS8C 3TDUA 1CFCA 1CM4A 3DVKA 1RK9A 1S36A 3LK0A 4P5OE 1J7RA 1DT7B 2JPTA 1PULA 2KNEA 2LMTA 4GBAA 4U8DA 1C7WA 2MJWB 4OKHA 1K93D 4TNCA 1CDNA 2WORA 1QV1A 4GUKA 1QJTA 1KCYA 1RTP1 3NSKA 4WRIA 1XK4C 1NUBA 2BL0C 3WHTB 3I5GC 2MRDA 2BBNA 1NPQA 1B7TZ 2L5XB 3DVJA 3PSRA 1LINA 4DS7A 2K2FA 3HX4A 4GGFA 2KI6C 1J1DA 3BYAA 2LCPA 4GNKB 4DRWA 2Y4QA 1NCZA 1ZUZA 1IJ5A 1N0YA 1CDPA 3BXKA 2GGZA 4UPGA 1BR4B 1DJXA 1LKJA 1FI5A 4NDCA 3CZTX 4C0KA 3DF0B 4PE0A 3D10A 2M49B 4Q04A 3C1VA 1CFDA 1LA0A 5CSIA 5K89A 1F8HA 4I5KA 2PSRA 1VRKA 4MSPA 1IKUA 3AKBA 3K21A 3OHMB 3SG7A 2MLEC 4CFRA 1IH0A 2BCXA 2JRFA 2KAXA 4ORAB 1JUOA 1YX8A 4D1EA 3I5IC 1BG1A 1BMOA 4HSZA 1S6JA 1DVIA 2PASA 3NXAA 4MZJA 1EG4A 4YGAA 1N2DA 1QX2A 4HRHA 4YI9A 4MRXA 1MHOA 4P2YB 4XJKB 2KSPA 1OMDA 2ISDA 2CBLA 3VGOA 1CDMA 2NCPA 2L50A 3QRXA 5ER4X 2WNDA 1B8RA 2F3YA 5CSJA 2DOQA 5IBWA 1JWDA 3GOFA 2F8PA 4FTGA 3HCMA 2JTTA 2EC6C 1M46A 2WOSA 1XVJA 1F4OA 5B8IB 5JJGA 5I8NA 3JVTB 1CTRA 4AOMA 1GGZA 3SG2A 1CNPA 3CGAA 4M2PA 1NCXA 2M7LA 1GJYA 1SR6B 2KQ6A 2FCEA 1FPWA 1TN4A 2JQ6A 3PLFB 1J7OA 4A4BA 3CS1A 4XYNA 5FYXA 4PDZA 1G4YR 2NCOA 1Y1AA 1KSOA 2F3ZA 1QV0A 4PHNA 1OZSA 2JZIA 3O6BA 1XK4A 2G2BA 2KYFA 1PVBA 2FCDA 2OTGB 4MZKA 1B8LA 2MLFC 1M31A 1TIZA 2PMYA 1YRUB 3PM8A 2M9GA 1SYMA 1LVCD 3SIBA 1SK6D 3OX6A 4QJ3B 1G33A 1AHRA 4PHJA 1IG5A 1E8AA 2PALA 2ZKMX 2JU0A 4OCIA 2ZN8A 3RLZA 1CLMA 1J7PA 2M97A 5TNCA 1TTXA 4I5LB 2K7OA 2KDHA 3NSIA 1PRWA 4YRUA 3EKJA 1KWOC 3NSLA 3BQ3A 1XFWO 1OOJA 2JT0A 3TUYB 2I94A 1SY9A 1BODA 1B47A 1DJWA 2LE9B 2LLUA 3I5HB 4PCWA 5CSNA 4C0JA 5AERA 2WCBA 2KI4B 1BLQA 4JWQA 3TS5B 1EH2A 1L2OB 2KFHA 4N1GA 2ZFDA 1AJ4A 2LHLA 3AKAA 4MZLA 1XFYO 1K94A 1V1FA 2JNFA 1XYDA 2OPOA 1LXFC 4USLA 1EG3A 4JPZB 1M39A 1QVIY 1JBAA 1K9UA 1H8BA 2M1KB 2H2KA 2O5GA 1CFFA 1OSAA 1AP4A 2HETA 1SPYA 4PHKA 3FWCA 2BE6A 2H61C 2CXJA 1F55A 1K90D 3SJSA 1KQMB 2LANA 4JQ0D 2HF5A 3EK8A 1J1EA 3NSOA 2L0PA 1BR1B 1L7ZA 1PSRA 5DKNA 1F71A 3TZ1A 1A03A 2E30A 4OR9B 5J3XA 1IWQA 1LA3A 4YGCB 3KPXA 3VRPA 1N65A 2JTZA 1SW8A 1DJGA 1WRLA 4NDDA 1UP5A 1DGVA 3GK1A 2SASA 1WRZA 2BCBA 2ZNDA 1TNPA 4N1FA 2HQWA 1HT9A 1XFVO 2EGDA 1YX7A 2LVJA 1ZOTB 3KEVA 1R2UA 2FOTA 1AJ5A 2F33A 1SCMC 5PALA 2E6WA 5I2QA 3H4SE 3SIAA 3MSEB 1JFKA 4HRGA 3SG4A 2Q4UA 3BUOB 5HKYA 3IQQA 2LMUA 1TRFA 1K9PA 1TOPA 1WDCB 1NP8A 1YUSA 3DVEA 2I18A 5I2OA 1B7TY 2LVKA 1S6CA 2VRGA 4WQ2A 2QACA 3LCPC 2R2IA 3M0WA 1IGVA 2MHHA 2OS8B 3O2PA 4ORCB 5AXIA 2ZRTA 1A2XA 2BECA 2JULA 4PALA 3CTNA 1JSAA 1UHNA 1CFPA 1B9AA 2KAYA 1S5GZ 4BY5A 4YI8A 1UHHA 1YTZC 1YURA 4YGBB 1NX3A 4I5JA 3CLNA 4ORBB 2BE4A 2D8NA 1CMFA 3GK2A 2BL0B 1EXRA 4PE1A 4PE4A 1ODBA 2KBMA 1Y1XA 1MF8B 1IQ5A 2JNXA 2LUCA 2IS9A 2L98A 3I5FB 4YBHB 2H61A 3LK1A 1CKKA 2M29A 1A4PA 4AQIA 1ALWA 1QIWA 3TUYC 3IF7A 3OX5A 1NX1A 3WHUB 1ZACA 4AQJA 2KOTA 2F2OA 3I5HC 3LL8B 2NLNA 1KK7Z 1MR8A 2ZN9A 1QS7A 2L2EA 3FIAA 4FQOA 2QPTA 2K61A 1YVLA 3GK4X 1ALVA 1U5IA 1L2OC 1QATA 5GQQC 4CIDA 1MQ1A 3ZWHA 1CLLA 2Y1NA 4GAOA 2EHBA 2Y1MA 3I5IB 4CFQA 1S3PA 3D0YA 4GGFC 4L9MA 2HQ8A 1DJYA 2CNPA 4MEWA 4MRYA 5ER5A 2M8UA 1BT6A 2PVBA 1YUTA 3CR2A 1BU3A 3F45A 2NZ0A 1AUIB 1MXLC 1DJHA 3BUNB 1C07A 3BUWB 1F70A 1SL8A 3BUMB 1OZOA 2LAPA 1SL9A 2JXLA 5JOLA 1TNQA 2LC5A 1G8IA 1QX7A 1OE9B 2V53A 3SG6A 2K8MB 1DJIA 2M7NA 2NXQA 2KYCA 1DJZA 3A4UB 4A4CA 2LV7A 1TNXA 1X02A 1Y0VH 2KFGA 2Q91A 3BOWA 1JFJA 1QLSA 1JF2A 1SMGA 5KSZA 2AMIA 1NWDA 4ZCVA 1XFXO 1K95A 3WXAA 2K0JA 1QXPA 2KHNA 1S1EA 2BBMA 1J55A 4NQGA 1B4CA 5CSFA 1NX2A 2LM5A 1S26D 3EVUA 2JT8A 3PN7B 2G9BA 1RFJA 4YGEB 1RECA 1W7JB 2L4IA 1V1GA 5KU1A 2WC8A 5AANA 3SG3A 2LMVA 1DF0A 1KK8B 1A75A 2WCEA 2GV5A 1YVHA 1Q80A 1SRAA 1F54A 2M1UA 1QASA 1K9KA 4YGDB 3E3RA 1H4BA 3JTDB 1DTLA 1Y6WA 3OB2B 1R6PA 2ZNEA 1OMRA 3CWGA 1NX0A 1MUXA 2MA2A 1SKTA 2L4HA 3IQOA 1AVSA 3PFVA 5HKWA 5AFPA 1PALA 2CT9A 1FBVA 4I5NB 1YUUA 1XFUO 2AUCA 3OP0A 1W7IB 1J7QA 1ZFSA 1KFXS 2Y5IA 2LHIA 1CMGA 1KWOB 5G08A 3TDIA 1SL7A 2CCMA 1BJFA 2KFFA 1GQMA 2MBXA 1D1OA 5DKRA 3JVTC 4DCKA 1TCFA 4ETOA 1RJVA 1EJ3A 1SR6C 1UURA 2LP2A 3VRRA 1NYAA 1GGWA 1SBJA 2I7AA 3O4YA 1K96A 1CB1A 3PATA 2TN4A 1S6IA 3DD4A 5KTYA 3CR4X 1SCVA 3I5FC 2JT3A 2JWWA 1TCOB 1PVAA 2FJUB 2KBIA 1JC2A 1UWOA 3AAJA 3O78A 4DUQA 3SG5A 4E68A 1DGUA 1M63B 1KFXL 2OTGC 1QX5B 3EVRA 3FWBA 1EL4A 4M2OA 5D7FA 3VRQA 1B8CA 4NDBA 4QJ5B 4ICBA 3EK4A 2JOJA 1OQPA 1WLZA 1BOCA 3KF9A 3I5GB 1M45A 1C7VA 2A4JA 4QJ4B 2KQYA 3FS7A 2I2RE 3OB1B 1UHKA 3RM1A 2LLTA 3DF0A 1U5IB 1WRKA 1CM1A 1FF1A 1UHIA 1IJ6A 4DIRA 3ICBA 1CLBA 3BUXB 1JF0A 1WLMA 4GFTA 4ZCUA 3D0YB 1PK0D 5AEQA 5BPJA 2JC2A 4PE7A 1UUSA 2WCFA 2MAZA 4MVFA 4OVNF 2KI4C 1FI6A 3TS5C 1S5GY 1SCMB 1AK8A 4GPLB 4XJKA 5CPVA 1YR5A 2M3WA 2LUXA 4MLWA 4WQ3A 1KFUS 2K7BA 1K2HA 1KQVA 2BKHB 2GGMA 1NSHA 1TNWA 2BKIB 2RGIA 3VRNA 1PSBA 3ZNIA 1HQVA 3WNXB 2SCPA 3DVMA 1IRJA 2KI6D 1DMOA 2COLB 1QTXA 2K7CA 3BOWB 3PN7C 2CTNA 3A8RA 4C0LA 2ZRSA 1NIWA 3AAKA 2KAVA 1SNLA 2BCAA 1KQMC 2K7DA 3KO0A 1XO5A 1KK8C 3EKHA 1XFZO 2LVIA 4CLNA 1IQ3A 5HLOA 5HYDA 2AAOA 2EC6B 2KGRA 1QIVA 1Y1UA 4OV2A 1KK7Y 3JTDC 2PRUA 1QVIZ 1F4QA 1KFUL 4M2QA 2F2PA 2M0RA 4R1EA 3TDZA 1RROA 4N5XA 3VROA 1DF0B 1RWYA 1A75B 1OMVA 1YRTB 2O60A 5HLVA 1MWNA 1MXEA 1K8UA 3LLEA 5I2LA 2P6BB 3KHEA 5F6TA 2LVVA 2L51A 2LNKA 3CR5X 5DKQA 1UHJA 4MBEA 2B1UA 3PALA 2JXCA 1BF5A 4F0ZB 1ZMZA 1KSMA 3EVVA 5HKZA 4GGNA 1WY9A 1A29A 4IL1A 4MN0A 2LLSA 2KGBC 1B1GA 4PHMA 2HPSA 1NCYA 1WDCC 4BY4A 1QLKA 4CPVA 2K2AA 1XA5A 1FW4A 3EK7A 4HREE 5D69A 1CDLA 2LP3A
chains in the Genus database with same CATH superfamily
2OS8C 3TDUA 1CFCA 1CM4A 3DVKA 4OZDA 1RK9A 3L47A 1S36A 2P70A 3LK0A 4P5OE 1J7RA 1DT7B 2JPTA 1PULA 2KNEA 2LMTA 2WCLA 4GBAA 4U8DA 1C7WA 2MJWB 4OKHA 1K93D 4TNCA 1CDNA 2WORA 1QV1A 4GUKA 1QJTA 5FI7A 1KCYA 1RTP1 3NSKA 2KPHA 4WRIA 1XK4C 1NUBA 2BL0C 3WHTB 3I5GC 2MRDA 3R1PA 2BBNA 1NPQA 1GGWA 1B7TZ 2L5XB 3DVJA 3PSRA 1LINA 4DS7A 2K2FA 3HX4A 4GGFA 2KI6C 1J1DA 3BYAA 2LCPA 4GNKB 4DRWA 2BAPA 2Y4QA 1NCZA 1ZUZA 1IJ5A 1N0YA 1CDPA 3FE9A 3BXKA 2GGZA 5FI6A 4UPGA 1BR4B 1DJXA 1LKJA 1FI5A 4NDCA 3CZTX 4C0KA 3DF0B 4PE0A 3D10A 2M49B 3B88A 4Q04A 1Z2CB 3UO9A 3C1VA 1CFDA 1LA0A 5CSIA 5K89A 1F8HA 4I5KA 5I94A 2PSRA 1VRKA 2WC6A 4MSPA 1IKUA 3AKBA 3K21A 3OHMB 3SG7A 2MLEC 3BFHA 2FJYA 4CFRA 1IH0A 2BCXA 2JRFA 2KAXA 4ORAB 1JUOA 1YX8A 4D1EA 3I5IC 1BG1A 1BMOA 4HSZA 1S6JA 1DVIA 2PASA 3NXAA 4MZJA 1EG4A 4YGAA 1N2DA 1OOFA 1QX2A 4HRHA 4YI9A 4MRXA 1MHOA 4P2YB 4XJKB 2KSPA 3PM2A 1OMDA 2ISDA 2CBLA 3VGOA 1CDMA 2NCPA 2YGUA 2L50A 2QEOA 3QRXA 5ER4X 2WNDA 1B8RA 2F3YA 5CSJA 2DOQA 5IBWA 1JWDA 3GOFA 2F8PA 4FTGA 3HCMA 2JTTA 2EC6C 1M46A 2WOSA 1XVJA 1F4OA 5B8IB 5JJGA 5I8NA 3JVTB 1CTRA 4AOMA 1GGZA 2WCJA 3SG2A 1CNPA 3CGAA 4M2PA 1NCXA 2M7LA 1GJYA 3SS3A 1SR6B 2KQ6A 2FCEA 1FPWA 1TN4A 2JQ6A 3PLFB 1J7OA 4A4BA 3CS1A 4XYNA 5FYXA 4PDZA 1G4YR 2NCOA 1Y1AA 1KSOA 2F3ZA 1QV0A 4PHNA 3CDNA 1GM0A 1OZSA 2JZIA 3O6BA 1XK4A 2G2BA 2KYFA 1PVBA 2FCDA 2OTGB 4MZKA 5FI2A 1B8LA 3RZSA 3D78A 2MLFC 1M31A 1TIZA 2PMYA 1YRUB 3PM8A 2M9GA 1SYMA 1LVCD 3SIBA 1SK6D 3OX6A 3CZ1A 4QJ3B 1G33A 1AHRA 4PHJA 1IG5A 1E8AA 2P71A 2PALA 2ZKMX 2JU0A 4OCIA 2ZN8A 3L4LA 1CLMA 3RLZA 1TUZA 2M97A 5TNCA 1J7PA 1TTXA 2WCHA 2K7OA 2KDHA 4I5LB 3NSIA 1PRWA 4YRUA 1ORGA 3EKJA 1KWOC 3NSLA 1TWOA 3BQ3A 1XFWO 1OOJA 2JT0A 1DEKA 3TUYB 2I94A 1SY9A 1BODA 1B47A 3SS5A 1DJWA 2LE9B 2LLUA 2QEVA 3I5HB 4PCWA 5CSNA 4C0JA 5AERA 2WCBA 2KI4B 3V2LA 1BLQA 4JWQA 3TS5B 1EH2A 4JKTA 1C3YA 1L2OB 2KFHA 4N1GA 2ZFDA 1AJ4A 2LHLA 3AKAA 4MZLA 1XFYO 1K94A 1V1FA 2JNFA 1XYDA 2OPOA 3BFBA 1LXFC 4USLA 1EG3A 4JPZB 1M39A 1QVIY 1QWVA 1JBAA 1K9UA 1OOGA 1H8BA 2M1KB 1TUJA 2H2KA 2O5GA 1OSAA 1CFFA 1AP4A 2HETA 1SPYA 4PHKA 3FWCA 2BE6A 2H61C 2CXJA 1F55A 1K90D 3SJSA 1KQMB 2LANA 5EL2A 4JQ0D 2HF5A 3EK8A 1J1EA 3K1EA 2L0PA 1BR1B 1L7ZA 1PSRA 3NSOA 5DKNA 1F71A 3TZ1A 1A03A 2E30A 4OR9B 5J3XA 1IWQA 1LA3A 4YGCB 3KPXA 3VRPA 2JPOA 1N65A 2JTZA 1SW8A 1DJGA 1WRLA 4NDDA 3R1VA 1UP5A 1DGVA 3GK1A 2SASA 1WRZA 1OOHA 2BCBA 2ZNDA 1TNPA 4N1FA 2HQWA 3NHIA 1HT9A 1XFVO 2EGDA 1YX7A 4IJ7A 2LVJA 1ZOTB 3KEVA 1R2UA 2FOTA 1AJ5A 5ER5A 3FE6A 2F33A 1SCMC 5PALA 2E6WA 5I2QA 3H4SE 3SIAA 3Q8IA 3MSEB 1JFKA 4HRGA 4JD9A 2Q4UA 3BUOB 3SG4A 5HKYA 3IQQA 2LMUA 1P28A 1TRFA 2PQLA 1K9PA 1TOPA 1WDCB 1NP8A 1YUSA 2ERBA 3DVEA 2I18A 3B87A 5I2OA 1B7TY 2LVKA 1S6CA 2VRGA 4WQ2A 2QACA 3LCPC 2QDIA 2R2IA 3M0WA 1IGVA 2L2CA 2MHHA 2OS8B 3O2PA 4ORCB 5AXIA 2ZRTA 1A2XA 2BECA 2JULA 4PALA 3NGVA 3CTNA 1JSAA 1UHNA 1DELA 1CFPA 1B9AA 2KAYA 1S5GZ 4BY5A 4YI8A 1UHHA 1YTZC 3D76A 1YURA 4YGBB 1NX3A 4I5JA 3CLNA 4ORBB 2BE4A 2D8NA 1CMFA 3GK2A 2BL0B 1EXRA 4PE1A 4PE4A 1DC1A 1ODBA 5D3OA 2KBMA 1Y1XA 2WC5A 1MF8B 1IQ5A 3CABA 2JNXA 2LUCA 2IS9A 2L98A 3I5FB 4YBHB 2H61A 3LK1A 2PYQA 1CKKA 2M29A 1A4PA 4AQIA 1ALWA 1QIWA 3TUYC 3IF7A 3OX5A 1NX1A 3WHUB 1ZACA 4AQJA 2KOTA 2F2OA 3DZTA 3I5HC 3LL8B 2NLNA 1KK7Z 1MR8A 2ZN9A 1QS7A 2L2EA 3FIAA 4FQOA 2QPTA 2K61A 1YVLA 3GK4X 1ALVA 1U5IA 1L2OC 1QATA 5GQQC 4CIDA 1MQ1A 3ZWHA 1CLLA 2Y1NA 3SS4A 4GAOA 2EHBA 2Y1MA 3I5IB 4CFQA 1S3PA 3D0YA 4GGFC 4L9MA 2HQ8A 1DJYA 2CNPA 2QEHA 4MEWA 4MRYA 2M8UA 1BT6A 2PVBA 1YUTA 3CR2A 1BU3A 3F45A 2NZ0A 3R1OA 1AUIB 1MXLC 1DJHA 3BUNB 3BJHA 1C07A 3BUWB 3B7AA 1F70A 1SL8A 3BUMB 1OZOA 2LAPA 1SL9A 2JXLA 5JOLA 1TNQA 2LC5A 1G8IA 1QX7A 1OE9B 2V53A 3SG6A 2K8MB 1DJIA 2M7NA 2NXQA 2KYCA 3EG5B 1DJZA 3A4UB 4A4CA 2LV7A 1TNXA 1X02A 1Y0VH 2KFGA 2Q91A 3BOWA 3D77A 1JFJA 1QLSA 1JF2A 1SMGA 3B86A 3UNWA 3VB1A 5KSZA 2AMIA 1NWDA 4ZCVA 1XFXO 1K95A 3WXAA 2K0JA 1QXPA 2KHNA 1S1EA 2BBMA 1J55A 4NQGA 3CZ2A 1B4CA 5CSFA 1NX2A 2LM5A 1S26D 3EVUA 2JT8A 3PN7B 2G9BA 1RFJA 4YGEB 1RECA 1W7JB 2L4IA 1V1GA 5KU1A 2WC8A 5AANA 3SG3A 2LMVA 1DF0A 3OBVA 1KK8B 1A75A 2WCEA 2GV5A 1YVHA 1Q80A 1SRAA 1F54A 2M1UA 1QASA 1K9KA 4YGDB 3E3RA 1H4BA 3JTDB 1DTLA 1Y6WA 3OB2B 1R6PA 2ZNEA 1OMRA 3CWGA 5DICA 2KLEA 1NX0A 1MUXA 2MA2A 1SKTA 2L4HA 3IQOA 1AVSA 3PFVA 5HKWA 5AFPA 1PALA 2CT9A 3DYEA 1FBVA 2GTEA 4I5NB 1YUUA 1XFUO 2AUCA 2L5YA 3OP0A 1W7IB 1J7QA 1ZFSA 1KFXS 2Y5IA 2LHIA 1CMGA 1KWOB 3DXLA 5G08A 3TDIA 1SL7A 2CCMA 1BJFA 1DQEA 1GQMA 2KFFA 2MBXA 5DKRA 1D1OA 3JVTC 4FQTA 4KYNA 4DCKA 1TCFA 3NHTA 4ETOA 1RJVA 1EJ3A 1SR6C 1UURA 2LP2A 3VRRA 3D74A 1NYAA 3S0BA 1SBJA 2I7AA 3D73A 1K96A 3N7HA 3O4YA 3PATA 1CB1A 1W9ZA 1S6IA 1T14A 2TN4A 3DD4A 3PJIA 5KTYA 3CR4X 1SCVA 3I5FC 2JT3A 2QEBA 2WCKA 2JWWA 1TCOB 1PVAA 2FJUB 2KBIA 1JC2A 2K60A 1UWOA 3AAJA 3O78A 3DY9A 4DUQA 4PT1A 3SG5A 4E68A 1XFRA 1DGUA 1M63B 1KFXL 2OTGC 1QX5B 3EVRA 3FWBA 1EL4A 4M2OA 5D7FA 3VRQA 1B8CA 4NDBA 3CZ0A 4QJ5B 4ICBA 3O4XA 1OW4A 3EK4A 2JOJA 1OQPA 1WLZA 1BOCA 1OOIX 3KF9A 1IIOA 3I5GB 1M45A 1C7VA 2A4JA 4QJ4B 2KQYA 3FS7A 2I2RE 3OB1B 1UHKA 3RM1A 2LLTA 3DF0A 1U5IB 1WRKA 1CM1A 3D75A 1FF1A 1UHIA 1IJ6A 4DIRA 3ICBA 1CLBA 3BUXB 1JF0A 1WLMA 4GFTA 4ZCUA 2BNXA 3D0YB 3IVTA 1PK0D 5AEQA 5BPJA 2JC2A 4PE7A 3R72A 1UUSA 2WCFA 2MAZA 4MVFA 3CYZA 4OVNF 2KI4C 4INXA 1FI6A 3TS5C 1S5GY 1SCMB 1AK8A 4GPLB 4INWA 4XJKA 5CPVA 1YR5A 3OGNA 2M3WA 2LUXA 4MLWA 4WQ3A 1KFUS 2K7BA 1K2HA 3FE8A 1KQVA 2BKHB 2GGMA 1NSHA 1TNWA 2BKIB 2RGIA 3VRNA 1PSBA 3ZNIA 1HQVA 1SSEB 3WNXB 2SCPA 3DVMA 1IRJA 3S0FA 2KI6D 1DMOA 3S0AA 2COLB 1QTXA 2K7CA 3BOWB 3PN7C 2CTNA 3A8RA 4C0LA 3S0EA 1C3ZA 2KLDA 2ZRSA 1NIWA 3L4AA 3AAKA 2KAVA 1SNLA 2BCAA 1KQMC 2K7DA 3KO0A 1XO5A 1KK8C 3EKHA 1XFZO 2LVIA 4CLNA 1IQ3A 5HLOA 5HYDA 2AAOA 2EC6B 2KGRA 1QIVA 1Y1UA 4OV2A 1KK7Y 3JTDC 2PRUA 1Z4HA 1QVIZ 1F4QA 1KFUL 4M2QA 2F2PA 2M0RA 4R1EA 3TDZA 1RROA 4N5XA 1LS8A 2H8VA 1DF0B 3VROA 1RWYA 1A75B 1OMVA 1YRTB 2O60A 5HLVA 2WCMA 3QMEA 1MWNA 1MXEA 1K8UA 3LLEA 5I2LA 2P6BB 3KHEA 5F6TA 2LVVA 2L51A 2LNKA 3CR5X 5DKQA 1UHJA 4MBEA 2B1UA 3PALA 2JXCA 1BF5A 3S0GA 4F0ZB 1ZMZA 1KSMA 3EVVA 5HKZA 4GGNA 1WY9A 1A29A 4IL1A 4MN0A 2LLSA 2KGBC 1B1GA 4PHMA 2HPSA 3B6XA 3S0DA 1NCYA 5HL1A 3BFAA 1WDCC 4BY4A 1QLKA 4CPVA 2K2AA 1XA5A 1FW4A 3EK7A 4HREE 5D69A 1CDLA 4F7FA 2LP3A
chains in the Genus database with same CATH topology
2OS8C 3TDUA 1CFCA 1CM4A 3DVKA 1RK9A 1S36A 3LK0A 4P5OE 1J7RA 1DT7B 2JPTA 1PULA 2KNEA 2LMTA 4GBAA 4U8DA 1C7WA 2MJWB 4OKHA 1K93D 4TNCA 1CDNA 2WORA 1QV1A 4GUKA 1QJTA 1KCYA 1RTP1 3NSKA 4WRIA 1XK4C 1NUBA 2BL0C 3WHTB 3I5GC 2MRDA 2BBNA 1NPQA 1B7TZ 2L5XB 3DVJA 3PSRA 1LINA 4DS7A 2K2FA 3HX4A 4GGFA 2KI6C 1J1DA 3BYAA 2LCPA 4GNKB 4DRWA 2Y4QA 1NCZA 1ZUZA 1IJ5A 1N0YA 1CDPA 3BXKA 2GGZA 4UPGA 1BR4B 1DJXA 1LKJA 1FI5A 4NDCA 3CZTX 4C0KA 3DF0B 4PE0A 3D10A 2M49B 4Q04A 3C1VA 1CFDA 1LA0A 5CSIA 5K89A 1F8HA 4I5KA 2PSRA 1VRKA 4MSPA 1IKUA 3AKBA 3K21A 3OHMB 3SG7A 2MLEC 4CFRA 1IH0A 2BCXA 2JRFA 2KAXA 4ORAB 1JUOA 1YX8A 4D1EA 3I5IC 1BG1A 1BMOA 4HSZA 1S6JA 1DVIA 2PASA 3NXAA 4MZJA 1EG4A 4YGAA 1N2DA 1QX2A 4HRHA 4YI9A 4MRXA 1MHOA 4P2YB 4XJKB 2KSPA 1OMDA 2ISDA 2CBLA 3VGOA 1CDMA 2NCPA 2L50A 3QRXA 5ER4X 2WNDA 1B8RA 2F3YA 5CSJA 2DOQA 5IBWA 1JWDA 3GOFA 2F8PA 4FTGA 3HCMA 2JTTA 2EC6C 1M46A 2WOSA 1XVJA 1F4OA 5B8IB 5JJGA 5I8NA 3JVTB 1CTRA 4AOMA 1GGZA 3SG2A 1CNPA 3CGAA 4M2PA 1NCXA 2M7LA 1GJYA 1SR6B 2KQ6A 2FCEA 1FPWA 1TN4A 2JQ6A 3PLFB 1J7OA 4A4BA 3CS1A 4XYNA 5FYXA 4PDZA 1G4YR 2NCOA 1Y1AA 1KSOA 2F3ZA 1QV0A 4PHNA 1OZSA 2JZIA 3O6BA 1XK4A 2G2BA 2KYFA 1PVBA 2FCDA 2OTGB 4MZKA 1B8LA 2MLFC 1M31A 1TIZA 2PMYA 1YRUB 3PM8A 2M9GA 1SYMA 1LVCD 3SIBA 1SK6D 3OX6A 4QJ3B 1G33A 1AHRA 4PHJA 1IG5A 1E8AA 2PALA 2ZKMX 2JU0A 4OCIA 2ZN8A 3RLZA 1CLMA 1J7PA 2M97A 5TNCA 1TTXA 4I5LB 2K7OA 2KDHA 3NSIA 1PRWA 4YRUA 3EKJA 1KWOC 3NSLA 3BQ3A 1XFWO 1OOJA 2JT0A 3TUYB 2I94A 1SY9A 1BODA 1B47A 1DJWA 2LE9B 2LLUA 3I5HB 4PCWA 5CSNA 4C0JA 5AERA 2WCBA 2KI4B 1BLQA 4JWQA 3TS5B 1EH2A 1L2OB 2KFHA 4N1GA 2ZFDA 1AJ4A 2LHLA 3AKAA 4MZLA 1XFYO 1K94A 1V1FA 2JNFA 1XYDA 2OPOA 1LXFC 4USLA 1EG3A 4JPZB 1M39A 1QVIY 1JBAA 1K9UA 1H8BA 2M1KB 2H2KA 2O5GA 1CFFA 1OSAA 1AP4A 2HETA 1SPYA 4PHKA 3FWCA 2BE6A 2H61C 2CXJA 1F55A 1K90D 3SJSA 1KQMB 2LANA 4JQ0D 2HF5A 3EK8A 1J1EA 3NSOA 2L0PA 1BR1B 1L7ZA 1PSRA 5DKNA 1F71A 3TZ1A 1A03A 2E30A 4OR9B 5J3XA 1IWQA 1LA3A 4YGCB 3KPXA 3VRPA 1N65A 2JTZA 1SW8A 1DJGA 1WRLA 4NDDA 1UP5A 1DGVA 3GK1A 2SASA 1WRZA 2BCBA 2ZNDA 1TNPA 4N1FA 2HQWA 1HT9A 1XFVO 2EGDA 1YX7A 2LVJA 1ZOTB 3KEVA 1R2UA 2FOTA 1AJ5A 2F33A 1SCMC 5PALA 2E6WA 5I2QA 3H4SE 3SIAA 3MSEB 1JFKA 4HRGA 3SG4A 2Q4UA 3BUOB 5HKYA 3IQQA 2LMUA 1TRFA 1K9PA 1TOPA 1WDCB 1NP8A 1YUSA 3DVEA 2I18A 5I2OA 1B7TY 2LVKA 1S6CA 2VRGA 4WQ2A 2QACA 3LCPC 2R2IA 3M0WA 1IGVA 2MHHA 2OS8B 3O2PA 4ORCB 5AXIA 2ZRTA 1A2XA 2BECA 2JULA 4PALA 3CTNA 1JSAA 1UHNA 1CFPA 1B9AA 2KAYA 1S5GZ 4BY5A 4YI8A 1UHHA 1YTZC 1YURA 4YGBB 1NX3A 4I5JA 3CLNA 4ORBB 2BE4A 2D8NA 1CMFA 3GK2A 2BL0B 1EXRA 4PE1A 4PE4A 1ODBA 2KBMA 1Y1XA 1MF8B 1IQ5A 2JNXA 2LUCA 2IS9A 2L98A 3I5FB 4YBHB 2H61A 3LK1A 1CKKA 2M29A 1A4PA 4AQIA 1ALWA 1QIWA 3TUYC 3IF7A 3OX5A 1NX1A 3WHUB 1ZACA 4AQJA 2KOTA 2F2OA 3I5HC 3LL8B 2NLNA 1KK7Z 1MR8A 2ZN9A 1QS7A 2L2EA 3FIAA 4FQOA 2QPTA 2K61A 1YVLA 3GK4X 1ALVA 1U5IA 1L2OC 1QATA 5GQQC 4CIDA 1MQ1A 3ZWHA 1CLLA 2Y1NA 4GAOA 2EHBA 2Y1MA 3I5IB 4CFQA 1S3PA 3D0YA 4GGFC 4L9MA 2HQ8A 1DJYA 2CNPA 4MEWA 4MRYA 5ER5A 2M8UA 1BT6A 2PVBA 1YUTA 3CR2A 1BU3A 3F45A 2NZ0A 1AUIB 1MXLC 1DJHA 3BUNB 1C07A 3BUWB 1F70A 1SL8A 3BUMB 1OZOA 2LAPA 1SL9A 2JXLA 5JOLA 1TNQA 2LC5A 1G8IA 1QX7A 1OE9B 2V53A 3SG6A 2K8MB 1DJIA 2M7NA 2NXQA 2KYCA 1DJZA 3A4UB 4A4CA 2LV7A 1TNXA 1X02A 1Y0VH 2KFGA 2Q91A 3BOWA 1JFJA 1QLSA 1JF2A 1SMGA 5KSZA 2AMIA 1NWDA 4ZCVA 1XFXO 1K95A 3WXAA 2K0JA 1QXPA 2KHNA 1S1EA 2BBMA 1J55A 4NQGA 1B4CA 5CSFA 1NX2A 2LM5A 1S26D 3EVUA 2JT8A 3PN7B 2G9BA 1RFJA 4YGEB 1RECA 1W7JB 2L4IA 1V1GA 5KU1A 2WC8A 5AANA 3SG3A 2LMVA 1DF0A 1KK8B 1A75A 2WCEA 2GV5A 1YVHA 1Q80A 1SRAA 1F54A 2M1UA 1QASA 1K9KA 4YGDB 3E3RA 1H4BA 3JTDB 1DTLA 1Y6WA 3OB2B 1R6PA 2ZNEA 1OMRA 3CWGA 1NX0A 1MUXA 2MA2A 1SKTA 2L4HA 3IQOA 1AVSA 3PFVA 5HKWA 5AFPA 1PALA 2CT9A 1FBVA 4I5NB 1YUUA 1XFUO 2AUCA 3OP0A 1W7IB 1J7QA 1ZFSA 1KFXS 2Y5IA 2LHIA 1CMGA 1KWOB 5G08A 3TDIA 1SL7A 2CCMA 1BJFA 2KFFA 1GQMA 2MBXA 1D1OA 5DKRA 3JVTC 4DCKA 1TCFA 4ETOA 1RJVA 1EJ3A 1SR6C 1UURA 2LP2A 3VRRA 1NYAA 1GGWA 1SBJA 2I7AA 3O4YA 1K96A 1CB1A 3PATA 2TN4A 1S6IA 3DD4A 5KTYA 3CR4X 1SCVA 3I5FC 2JT3A 2JWWA 1TCOB 1PVAA 2FJUB 2KBIA 1JC2A 1UWOA 3AAJA 3O78A 4DUQA 3SG5A 4E68A 1DGUA 1M63B 1KFXL 2OTGC 1QX5B 3EVRA 3FWBA 1EL4A 4M2OA 5D7FA 3VRQA 1B8CA 4NDBA 4QJ5B 4ICBA 3EK4A 2JOJA 1OQPA 1WLZA 1BOCA 3KF9A 3I5GB 1M45A 1C7VA 2A4JA 4QJ4B 2KQYA 3FS7A 2I2RE 3OB1B 1UHKA 3RM1A 2LLTA 3DF0A 1U5IB 1WRKA 1CM1A 1FF1A 1UHIA 1IJ6A 4DIRA 3ICBA 1CLBA 3BUXB 1JF0A 1WLMA 4GFTA 4ZCUA 3D0YB 1PK0D 5AEQA 5BPJA 2JC2A 4PE7A 1UUSA 2WCFA 2MAZA 4MVFA 4OVNF 2KI4C 1FI6A 3TS5C 1S5GY 1SCMB 1AK8A 4GPLB 4XJKA 5CPVA 1YR5A 2M3WA 2LUXA 4MLWA 4WQ3A 1KFUS 2K7BA 1K2HA 1KQVA 2BKHB 2GGMA 1NSHA 1TNWA 2BKIB 2RGIA 3VRNA 1PSBA 3ZNIA 1HQVA 3WNXB 2SCPA 3DVMA 1IRJA 2KI6D 1DMOA 2COLB 1QTXA 2K7CA 3BOWB 3PN7C 2CTNA 3A8RA 4C0LA 2ZRSA 1NIWA 3AAKA 2KAVA 1SNLA 2BCAA 1KQMC 2K7DA 3KO0A 1XO5A 1KK8C 3EKHA 1XFZO 2LVIA 4CLNA 1IQ3A 5HLOA 5HYDA 2AAOA 2EC6B 2KGRA 1QIVA 1Y1UA 4OV2A 1KK7Y 3JTDC 2PRUA 1QVIZ 1F4QA 1KFUL 4M2QA 2F2PA 2M0RA 4R1EA 3TDZA 1RROA 4N5XA 3VROA 1DF0B 1RWYA 1A75B 1OMVA 1YRTB 2O60A 5HLVA 1MWNA 1MXEA 1K8UA 3LLEA 5I2LA 2P6BB 3KHEA 5F6TA 2LVVA 2L51A 2LNKA 3CR5X 5DKQA 1UHJA 4MBEA 2B1UA 3PALA 2JXCA 1BF5A 4F0ZB 1ZMZA 1KSMA 3EVVA 5HKZA 4GGNA 1WY9A 1A29A 4IL1A 4MN0A 2LLSA 2KGBC 1B1GA 4PHMA 2HPSA 1NCYA 1WDCC 4BY4A 1QLKA 4CPVA 2K2AA 1XA5A 1FW4A 3EK7A 4HREE 5D69A 1CDLA 2LP3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OS8 C;  3TDU A;  1CFC A;  1CM4 A;  3DVK A;  1RK9 A;  1S36 A;  3LK0 A;  4P5O E;  1J7R A;  1DT7 B;  2JPT A;  1PUL A;  2KNE A;  2LMT A;  4GBA A;  4U8D A;  1C7W A;  2MJW B;  4OKH A;  1K93 D;  4TNC A;  1CDN A;  2WOR A;  1QV1 A;  4GUK A;  1QJT A;  1KCY A;  1RTP 1;  3NSK A;  4WRI A;  1XK4 C;  1NUB A;  2BL0 C;  3WHT B;  3I5G C;  2MRD A;  2BBN A;  1NPQ A;  1B7T Z;  2L5X B;  3DVJ A;  3PSR A;  1LIN A;  4DS7 A;  2K2F A;  3HX4 A;  4GGF A;  2KI6 C;  1J1D A;  3BYA A;  2LCP A;  4GNK B;  4DRW A;  2Y4Q A;  1NCZ A;  1ZUZ A;  1IJ5 A;  1N0Y A;  1CDP A;  3BXK A;  2GGZ A;  4UPG A;  1BR4 B;  1DJX A;  1LKJ A;  1FI5 A;  4NDC A;  3CZT X;  4C0K A;  3DF0 B;  4PE0 A;  3D10 A;  2M49 B;  4Q04 A;  3C1V A;  1CFD A;  1LA0 A;  5CSI A;  5K89 A;  1F8H A;  4I5K A;  2PSR A;  1VRK A;  4MSP A;  1IKU A;  3AKB A;  3K21 A;  3OHM B;  3SG7 A;  2MLE C;  4CFR A;  1IH0 A;  2BCX A;  2JRF A;  2KAX A;  4ORA B;  1JUO A;  1YX8 A;  4D1E A;  3I5I C;  1BG1 A;  1BMO A;  4HSZ A;  1S6J A;  1DVI A;  2PAS A;  3NXA A;  4MZJ A;  1EG4 A;  4YGA A;  1N2D A;  1QX2 A;  4HRH A;  4YI9 A;  4MRX A;  1MHO A;  4P2Y B;  4XJK B;  2KSP A;  1OMD A;  2ISD A;  2CBL A;  3VGO A;  1CDM A;  2NCP A;  2L50 A;  3QRX A;  5ER4 X;  2WND A;  1B8R A;  2F3Y A;  5CSJ A;  2DOQ A;  5IBW A;  1JWD A;  3GOF A;  2F8P A;  4FTG A;  3HCM A;  2JTT A;  2EC6 C;  1M46 A;  2WOS A;  1XVJ A;  1F4O A;  5B8I B;  5JJG A;  5I8N A;  3JVT B;  1CTR A;  4AOM A;  1GGZ A;  3SG2 A;  1CNP A;  3CGA A;  4M2P A;  1NCX A;  2M7L A;  1GJY A;  1SR6 B;  2KQ6 A;  2FCE A;  1FPW A;  1TN4 A;  2JQ6 A;  3PLF B;  1J7O A;  4A4B A;  3CS1 A;  4XYN A;  5FYX A;  4PDZ A;  1G4Y R;  2NCO A;  1Y1A A;  1KSO A;  2F3Z A;  1QV0 A;  4PHN A;  1OZS A;  2JZI A;  3O6B A;  1XK4 A;  2G2B A;  2KYF A;  1PVB A;  2FCD A;  2OTG B;  4MZK A;  1B8L A;  2MLF C;  1M31 A;  1TIZ A;  2PMY A;  1YRU B;  3PM8 A;  2M9G A;  1SYM A;  1LVC D;  3SIB A;  1SK6 D;  3OX6 A;  4QJ3 B;  1G33 A;  1AHR A;  4PHJ A;  1IG5 A;  1E8A A;  2PAL A;  2ZKM X;  2JU0 A;  4OCI A;  2ZN8 A;  3RLZ A;  1CLM A;  1J7P A;  2M97 A;  5TNC A;  1TTX A;  4I5L B;  2K7O A;  2KDH A;  3NSI A;  1PRW A;  4YRU A;  3EKJ A;  1KWO C;  3NSL A;  3BQ3 A;  1XFW O;  1OOJ A;  2JT0 A;  3TUY B;  2I94 A;  1SY9 A;  1BOD A;  1B47 A;  1DJW A;  2LE9 B;  2LLU A;  3I5H B;  4PCW A;  5CSN A;  4C0J A;  5AER A;  2WCB A;  2KI4 B;  1BLQ A;  4JWQ A;  3TS5 B;  1EH2 A;  1L2O B;  2KFH A;  4N1G A;  2ZFD A;  1AJ4 A;  2LHL A;  3AKA A;  4MZL A;  1XFY O;  1K94 A;  1V1F A;  2JNF A;  1XYD A;  2OPO A;  1LXF C;  4USL A;  1EG3 A;  4JPZ B;  1M39 A;  1QVI Y;  1JBA A;  1K9U A;  1H8B A;  2M1K B;  2H2K A;  2O5G A;  1CFF A;  1OSA A;  1AP4 A;  2HET A;  1SPY A;  4PHK A;  3FWC A;  2BE6 A;  2H61 C;  2CXJ A;  1F55 A;  1K90 D;  3SJS A;  1KQM B;  2LAN A;  4JQ0 D;  2HF5 A;  3EK8 A;  1J1E A;  3NSO A;  2L0P A;  1BR1 B;  1L7Z A;  1PSR A;  5DKN A;  1F71 A;  3TZ1 A;  1A03 A;  2E30 A;  4OR9 B;  5J3X A;  1IWQ A;  1LA3 A;  4YGC B;  3KPX A;  3VRP A;  1N65 A;  2JTZ A;  1SW8 A;  1DJG A;  1WRL A;  4NDD A;  1UP5 A;  1DGV A;  3GK1 A;  2SAS A;  1WRZ A;  2BCB A;  2ZND A;  1TNP A;  4N1F A;  2HQW A;  1HT9 A;  1XFV O;  2EGD A;  1YX7 A;  2LVJ A;  1ZOT B;  3KEV A;  1R2U A;  2FOT A;  1AJ5 A;  2F33 A;  1SCM C;  5PAL A;  2E6W A;  5I2Q A;  3H4S E;  3SIA A;  3MSE B;  1JFK A;  4HRG A;  3SG4 A;  2Q4U A;  3BUO B;  5HKY A;  3IQQ A;  2LMU A;  1TRF A;  1K9P A;  1TOP A;  1WDC B;  1NP8 A;  1YUS A;  3DVE A;  2I18 A;  5I2O A;  1B7T Y;  2LVK A;  1S6C A;  2VRG A;  4WQ2 A;  2QAC A;  3LCP C;  2R2I A;  3M0W A;  1IGV A;  2MHH A;  2OS8 B;  3O2P A;  4ORC B;  5AXI A;  2ZRT A;  1A2X A;  2BEC A;  2JUL A;  4PAL A;  3CTN A;  1JSA A;  1UHN A;  1CFP A;  1B9A A;  2KAY A;  1S5G Z;  4BY5 A;  4YI8 A;  1UHH A;  1YTZ C;  1YUR A;  4YGB B;  1NX3 A;  4I5J A;  3CLN A;  4ORB B;  2BE4 A;  2D8N A;  1CMF A;  3GK2 A;  2BL0 B;  1EXR A;  4PE1 A;  4PE4 A;  1ODB A;  2KBM A;  1Y1X A;  1MF8 B;  1IQ5 A;  2JNX A;  2LUC A;  2IS9 A;  2L98 A;  3I5F B;  4YBH B;  2H61 A;  3LK1 A;  1CKK A;  2M29 A;  1A4P A;  4AQI A;  1ALW A;  1QIW A;  3TUY C;  3IF7 A;  3OX5 A;  1NX1 A;  3WHU B;  1ZAC A;  4AQJ A;  2KOT A;  2F2O A;  3I5H C;  3LL8 B;  2NLN A;  1KK7 Z;  1MR8 A;  2ZN9 A;  1QS7 A;  2L2E A;  3FIA A;  4FQO A;  2QPT A;  2K61 A;  1YVL A;  3GK4 X;  1ALV A;  1U5I A;  1L2O C;  1QAT A;  5GQQ C;  4CID A;  1MQ1 A;  3ZWH A;  1CLL A;  2Y1N A;  4GAO A;  2EHB A;  2Y1M A;  3I5I B;  4CFQ A;  1S3P A;  3D0Y A;  4GGF C;  4L9M A;  2HQ8 A;  1DJY A;  2CNP A;  4MEW A;  4MRY A;  5ER5 A;  2M8U A;  1BT6 A;  2PVB A;  1YUT A;  3CR2 A;  1BU3 A;  3F45 A;  2NZ0 A;  1AUI B;  1MXL C;  1DJH A;  3BUN B;  1C07 A;  3BUW B;  1F70 A;  1SL8 A;  3BUM B;  1OZO A;  2LAP A;  1SL9 A;  2JXL A;  5JOL A;  1TNQ A;  2LC5 A;  1G8I A;  1QX7 A;  1OE9 B;  2V53 A;  3SG6 A;  2K8M B;  1DJI A;  2M7N A;  2NXQ A;  2KYC A;  1DJZ A;  3A4U B;  4A4C A;  2LV7 A;  1TNX A;  1X02 A;  1Y0V H;  2KFG A;  2Q91 A;  3BOW A;  1JFJ A;  1QLS A;  1JF2 A;  1SMG A;  5KSZ A;  2AMI A;  1NWD A;  4ZCV A;  1XFX O;  1K95 A;  3WXA A;  2K0J A;  1QXP A;  2KHN A;  1S1E A;  2BBM A;  1J55 A;  4NQG A;  1B4C A;  5CSF A;  1NX2 A;  2LM5 A;  1S26 D;  3EVU A;  2JT8 A;  3PN7 B;  2G9B A;  1RFJ A;  4YGE B;  1REC A;  1W7J B;  2L4I A;  1V1G A;  5KU1 A;  2WC8 A;  5AAN A;  3SG3 A;  2LMV A;  1DF0 A;  1KK8 B;  1A75 A;  2WCE A;  2GV5 A;  1YVH A;  1Q80 A;  1SRA A;  1F54 A;  2M1U A;  1QAS A;  1K9K A;  4YGD B;  3E3R A;  1H4B A;  3JTD B;  1DTL A;  1Y6W A;  3OB2 B;  1R6P A;  2ZNE A;  1OMR A;  3CWG A;  1NX0 A;  1MUX A;  2MA2 A;  1SKT A;  2L4H A;  3IQO A;  1AVS A;  3PFV A;  5HKW A;  5AFP A;  1PAL A;  2CT9 A;  1FBV A;  4I5N B;  1YUU A;  1XFU O;  2AUC A;  3OP0 A;  1W7I B;  1J7Q A;  1ZFS A;  1KFX S;  2Y5I A;  2LHI A;  1CMG A;  1KWO B;  5G08 A;  3TDI A;  1SL7 A;  2CCM A;  1BJF A;  2KFF A;  1GQM A;  2MBX A;  1D1O A;  5DKR A;  3JVT C;  4DCK A;  1TCF A;  4ETO A;  1RJV A;  1EJ3 A;  1SR6 C;  1UUR A;  2LP2 A;  3VRR A;  1NYA A;  1GGW A;  1SBJ A;  2I7A A;  3O4Y A;  1K96 A;  1CB1 A;  3PAT A;  2TN4 A;  1S6I A;  3DD4 A;  5KTY A;  3CR4 X;  1SCV A;  3I5F C;  2JT3 A;  2JWW A;  1TCO B;  1PVA A;  2FJU B;  2KBI A;  1JC2 A;  1UWO A;  3AAJ A;  3O78 A;  4DUQ A;  3SG5 A;  4E68 A;  1DGU A;  1M63 B;  1KFX L;  2OTG C;  1QX5 B;  3EVR A;  3FWB A;  1EL4 A;  4M2O A;  5D7F A;  3VRQ A;  1B8C A;  4NDB A;  4QJ5 B;  4ICB A;  3EK4 A;  2JOJ A;  1OQP A;  1WLZ A;  1BOC A;  3KF9 A;  3I5G B;  1M45 A;  1C7V A;  2A4J A;  4QJ4 B;  2KQY A;  3FS7 A;  2I2R E;  3OB1 B;  1UHK A;  3RM1 A;  2LLT A;  3DF0 A;  1U5I B;  1WRK A;  1CM1 A;  1FF1 A;  1UHI A;  1IJ6 A;  4DIR A;  3ICB A;  1CLB A;  3BUX B;  1JF0 A;  1WLM A;  4GFT A;  4ZCU A;  3D0Y B;  1PK0 D;  5AEQ A;  5BPJ A;  2JC2 A;  4PE7 A;  1UUS A;  2WCF A;  2MAZ A;  4MVF A;  4OVN F;  2KI4 C;  1FI6 A;  3TS5 C;  1S5G Y;  1SCM B;  1AK8 A;  4GPL B;  4XJK A;  5CPV A;  1YR5 A;  2M3W A;  2LUX A;  4MLW A;  4WQ3 A;  1KFU S;  2K7B A;  1K2H A;  1KQV A;  2BKH B;  2GGM A;  1NSH A;  1TNW A;  2BKI B;  2RGI A;  3VRN A;  1PSB A;  3ZNI A;  1HQV A;  3WNX B;  2SCP A;  3DVM A;  1IRJ A;  2KI6 D;  1DMO A;  2COL B;  1QTX A;  2K7C A;  3BOW B;  3PN7 C;  2CTN A;  3A8R A;  4C0L A;  2ZRS A;  1NIW A;  3AAK A;  2KAV A;  1SNL A;  2BCA A;  1KQM C;  2K7D A;  3KO0 A;  1XO5 A;  1KK8 C;  3EKH A;  1XFZ O;  2LVI A;  4CLN A;  1IQ3 A;  5HLO A;  5HYD A;  2AAO A;  2EC6 B;  2KGR A;  1QIV A;  1Y1U A;  4OV2 A;  1KK7 Y;  3JTD C;  2PRU A;  1QVI Z;  1F4Q A;  1KFU L;  4M2Q A;  2F2P A;  2M0R A;  4R1E A;  3TDZ A;  1RRO A;  4N5X A;  3VRO A;  1DF0 B;  1RWY A;  1A75 B;  1OMV A;  1YRT B;  2O60 A;  5HLV A;  1MWN A;  1MXE A;  1K8U A;  3LLE A;  5I2L A;  2P6B B;  3KHE A;  5F6T A;  2LVV A;  2L51 A;  2LNK A;  3CR5 X;  5DKQ A;  1UHJ A;  4MBE A;  2B1U A;  3PAL A;  2JXC A;  1BF5 A;  4F0Z B;  1ZMZ A;  1KSM A;  3EVV A;  5HKZ A;  4GGN A;  1WY9 A;  1A29 A;  4IL1 A;  4MN0 A;  2LLS A;  2KGB C;  1B1G A;  4PHM A;  2HPS A;  1NCY A;  1WDC C;  4BY4 A;  1QLK A;  4CPV A;  2K2A A;  1XA5 A;  1FW4 A;  3EK7 A;  4HRE E;  5D69 A;  1CDL A;  2LP3 A; 
#chains in the Genus database with same CATH topology
 2OS8 C;  3TDU A;  1CFC A;  1CM4 A;  3DVK A;  4OZD A;  1RK9 A;  3L47 A;  1S36 A;  2P70 A;  3LK0 A;  4P5O E;  1J7R A;  1DT7 B;  2JPT A;  1PUL A;  2KNE A;  2LMT A;  2WCL A;  4GBA A;  4U8D A;  1C7W A;  2MJW B;  4OKH A;  1K93 D;  4TNC A;  1CDN A;  2WOR A;  1QV1 A;  4GUK A;  1QJT A;  5FI7 A;  1KCY A;  1RTP 1;  3NSK A;  2KPH A;  4WRI A;  1XK4 C;  1NUB A;  2BL0 C;  3WHT B;  3I5G C;  2MRD A;  3R1P A;  2BBN A;  1NPQ A;  1GGW A;  1B7T Z;  2L5X B;  3DVJ A;  3PSR A;  1LIN A;  4DS7 A;  2K2F A;  3HX4 A;  4GGF A;  2KI6 C;  1J1D A;  3BYA A;  2LCP A;  4GNK B;  4DRW A;  2BAP A;  2Y4Q A;  1NCZ A;  1ZUZ A;  1IJ5 A;  1N0Y A;  1CDP A;  3FE9 A;  3BXK A;  2GGZ A;  5FI6 A;  4UPG A;  1BR4 B;  1DJX A;  1LKJ A;  1FI5 A;  4NDC A;  3CZT X;  4C0K A;  3DF0 B;  4PE0 A;  3D10 A;  2M49 B;  3B88 A;  4Q04 A;  1Z2C B;  3UO9 A;  3C1V A;  1CFD A;  1LA0 A;  5CSI A;  5K89 A;  1F8H A;  4I5K A;  5I94 A;  2PSR A;  1VRK A;  2WC6 A;  4MSP A;  1IKU A;  3AKB A;  3K21 A;  3OHM B;  3SG7 A;  2MLE C;  3BFH A;  2FJY A;  4CFR A;  1IH0 A;  2BCX A;  2JRF A;  2KAX A;  4ORA B;  1JUO A;  1YX8 A;  4D1E A;  3I5I C;  1BG1 A;  1BMO A;  4HSZ A;  1S6J A;  1DVI A;  2PAS A;  3NXA A;  4MZJ A;  1EG4 A;  4YGA A;  1N2D A;  1OOF A;  1QX2 A;  4HRH A;  4YI9 A;  4MRX A;  1MHO A;  4P2Y B;  4XJK B;  2KSP A;  3PM2 A;  1OMD A;  2ISD A;  2CBL A;  3VGO A;  1CDM A;  2NCP A;  2YGU A;  2L50 A;  2QEO A;  3QRX A;  5ER4 X;  2WND A;  1B8R A;  2F3Y A;  5CSJ A;  2DOQ A;  5IBW A;  1JWD A;  3GOF A;  2F8P A;  4FTG A;  3HCM A;  2JTT A;  2EC6 C;  1M46 A;  2WOS A;  1XVJ A;  1F4O A;  5B8I B;  5JJG A;  5I8N A;  3JVT B;  1CTR A;  4AOM A;  1GGZ A;  2WCJ A;  3SG2 A;  1CNP A;  3CGA A;  4M2P A;  1NCX A;  2M7L A;  1GJY A;  3SS3 A;  1SR6 B;  2KQ6 A;  2FCE A;  1FPW A;  1TN4 A;  2JQ6 A;  3PLF B;  1J7O A;  4A4B A;  3CS1 A;  4XYN A;  5FYX A;  4PDZ A;  1G4Y R;  2NCO A;  1Y1A A;  1KSO A;  2F3Z A;  1QV0 A;  4PHN A;  3CDN A;  1GM0 A;  1OZS A;  2JZI A;  3O6B A;  1XK4 A;  2G2B A;  2KYF A;  1PVB A;  2FCD A;  2OTG B;  4MZK A;  5FI2 A;  1B8L A;  3RZS A;  3D78 A;  2MLF C;  1M31 A;  1TIZ A;  2PMY A;  1YRU B;  3PM8 A;  2M9G A;  1SYM A;  1LVC D;  3SIB A;  1SK6 D;  3OX6 A;  3CZ1 A;  4QJ3 B;  1G33 A;  1AHR A;  4PHJ A;  1IG5 A;  1E8A A;  2P71 A;  2PAL A;  2ZKM X;  2JU0 A;  4OCI A;  2ZN8 A;  3L4L A;  1CLM A;  3RLZ A;  1TUZ A;  2M97 A;  5TNC A;  1J7P A;  1TTX A;  2WCH A;  2K7O A;  2KDH A;  4I5L B;  3NSI A;  1PRW A;  4YRU A;  1ORG A;  3EKJ A;  1KWO C;  3NSL A;  1TWO A;  3BQ3 A;  1XFW O;  1OOJ A;  2JT0 A;  1DEK A;  3TUY B;  2I94 A;  1SY9 A;  1BOD A;  1B47 A;  3SS5 A;  1DJW A;  2LE9 B;  2LLU A;  2QEV A;  3I5H B;  4PCW A;  5CSN A;  4C0J A;  5AER A;  2WCB A;  2KI4 B;  3V2L A;  1BLQ A;  4JWQ A;  3TS5 B;  1EH2 A;  4JKT A;  1C3Y A;  1L2O B;  2KFH A;  4N1G A;  2ZFD A;  1AJ4 A;  2LHL A;  3AKA A;  4MZL A;  1XFY O;  1K94 A;  1V1F A;  2JNF A;  1XYD A;  2OPO A;  3BFB A;  1LXF C;  4USL A;  1EG3 A;  4JPZ B;  1M39 A;  1QVI Y;  1QWV A;  1JBA A;  1K9U A;  1OOG A;  1H8B A;  2M1K B;  1TUJ A;  2H2K A;  2O5G A;  1OSA A;  1CFF A;  1AP4 A;  2HET A;  1SPY A;  4PHK A;  3FWC A;  2BE6 A;  2H61 C;  2CXJ A;  1F55 A;  1K90 D;  3SJS A;  1KQM B;  2LAN A;  5EL2 A;  4JQ0 D;  2HF5 A;  3EK8 A;  1J1E A;  3K1E A;  2L0P A;  1BR1 B;  1L7Z A;  1PSR A;  3NSO A;  5DKN A;  1F71 A;  3TZ1 A;  1A03 A;  2E30 A;  4OR9 B;  5J3X A;  1IWQ A;  1LA3 A;  4YGC B;  3KPX A;  3VRP A;  2JPO A;  1N65 A;  2JTZ A;  1SW8 A;  1DJG A;  1WRL A;  4NDD A;  3R1V A;  1UP5 A;  1DGV A;  3GK1 A;  2SAS A;  1WRZ A;  1OOH A;  2BCB A;  2ZND A;  1TNP A;  4N1F A;  2HQW A;  3NHI A;  1HT9 A;  1XFV O;  2EGD A;  1YX7 A;  4IJ7 A;  2LVJ A;  1ZOT B;  3KEV A;  1R2U A;  2FOT A;  1AJ5 A;  5ER5 A;  3FE6 A;  2F33 A;  1SCM C;  5PAL A;  2E6W A;  5I2Q A;  3H4S E;  3SIA A;  3Q8I A;  3MSE B;  1JFK A;  4HRG A;  4JD9 A;  2Q4U A;  3BUO B;  3SG4 A;  5HKY A;  3IQQ A;  2LMU A;  1P28 A;  1TRF A;  2PQL A;  1K9P A;  1TOP A;  1WDC B;  1NP8 A;  1YUS A;  2ERB A;  3DVE A;  2I18 A;  3B87 A;  5I2O A;  1B7T Y;  2LVK A;  1S6C A;  2VRG A;  4WQ2 A;  2QAC A;  3LCP C;  2QDI A;  2R2I A;  3M0W A;  1IGV A;  2L2C A;  2MHH A;  2OS8 B;  3O2P A;  4ORC B;  5AXI A;  2ZRT A;  1A2X A;  2BEC A;  2JUL A;  4PAL A;  3NGV A;  3CTN A;  1JSA A;  1UHN A;  1DEL A;  1CFP A;  1B9A A;  2KAY A;  1S5G Z;  4BY5 A;  4YI8 A;  1UHH A;  1YTZ C;  3D76 A;  1YUR A;  4YGB B;  1NX3 A;  4I5J A;  3CLN A;  4ORB B;  2BE4 A;  2D8N A;  1CMF A;  3GK2 A;  2BL0 B;  1EXR A;  4PE1 A;  4PE4 A;  1DC1 A;  1ODB A;  5D3O A;  2KBM A;  1Y1X A;  2WC5 A;  1MF8 B;  1IQ5 A;  3CAB A;  2JNX A;  2LUC A;  2IS9 A;  2L98 A;  3I5F B;  4YBH B;  2H61 A;  3LK1 A;  2PYQ A;  1CKK A;  2M29 A;  1A4P A;  4AQI A;  1ALW A;  1QIW A;  3TUY C;  3IF7 A;  3OX5 A;  1NX1 A;  3WHU B;  1ZAC A;  4AQJ A;  2KOT A;  2F2O A;  3DZT A;  3I5H C;  3LL8 B;  2NLN A;  1KK7 Z;  1MR8 A;  2ZN9 A;  1QS7 A;  2L2E A;  3FIA A;  4FQO A;  2QPT A;  2K61 A;  1YVL A;  3GK4 X;  1ALV A;  1U5I A;  1L2O C;  1QAT A;  5GQQ C;  4CID A;  1MQ1 A;  3ZWH A;  1CLL A;  2Y1N A;  3SS4 A;  4GAO A;  2EHB A;  2Y1M A;  3I5I B;  4CFQ A;  1S3P A;  3D0Y A;  4GGF C;  4L9M A;  2HQ8 A;  1DJY A;  2CNP A;  2QEH A;  4MEW A;  4MRY A;  2M8U A;  1BT6 A;  2PVB A;  1YUT A;  3CR2 A;  1BU3 A;  3F45 A;  2NZ0 A;  3R1O A;  1AUI B;  1MXL C;  1DJH A;  3BUN B;  3BJH A;  1C07 A;  3BUW B;  3B7A A;  1F70 A;  1SL8 A;  3BUM B;  1OZO A;  2LAP A;  1SL9 A;  2JXL A;  5JOL A;  1TNQ A;  2LC5 A;  1G8I A;  1QX7 A;  1OE9 B;  2V53 A;  3SG6 A;  2K8M B;  1DJI A;  2M7N A;  2NXQ A;  2KYC A;  3EG5 B;  1DJZ A;  3A4U B;  4A4C A;  2LV7 A;  1TNX A;  1X02 A;  1Y0V H;  2KFG A;  2Q91 A;  3BOW A;  3D77 A;  1JFJ A;  1QLS A;  1JF2 A;  1SMG A;  3B86 A;  3UNW A;  3VB1 A;  5KSZ A;  2AMI A;  1NWD A;  4ZCV A;  1XFX O;  1K95 A;  3WXA A;  2K0J A;  1QXP A;  2KHN A;  1S1E A;  2BBM A;  1J55 A;  4NQG A;  3CZ2 A;  1B4C A;  5CSF A;  1NX2 A;  2LM5 A;  1S26 D;  3EVU A;  2JT8 A;  3PN7 B;  2G9B A;  1RFJ A;  4YGE B;  1REC A;  1W7J B;  2L4I A;  1V1G A;  5KU1 A;  2WC8 A;  5AAN A;  3SG3 A;  2LMV A;  1DF0 A;  3OBV A;  1KK8 B;  1A75 A;  2WCE A;  2GV5 A;  1YVH A;  1Q80 A;  1SRA A;  1F54 A;  2M1U A;  1QAS A;  1K9K A;  4YGD B;  3E3R A;  1H4B A;  3JTD B;  1DTL A;  1Y6W A;  3OB2 B;  1R6P A;  2ZNE A;  1OMR A;  3CWG A;  5DIC A;  2KLE A;  1NX0 A;  1MUX A;  2MA2 A;  1SKT A;  2L4H A;  3IQO A;  1AVS A;  3PFV A;  5HKW A;  5AFP A;  1PAL A;  2CT9 A;  3DYE A;  1FBV A;  2GTE A;  4I5N B;  1YUU A;  1XFU O;  2AUC A;  2L5Y A;  3OP0 A;  1W7I B;  1J7Q A;  1ZFS A;  1KFX S;  2Y5I A;  2LHI A;  1CMG A;  1KWO B;  3DXL A;  5G08 A;  3TDI A;  1SL7 A;  2CCM A;  1BJF A;  1DQE A;  1GQM A;  2KFF A;  2MBX A;  5DKR A;  1D1O A;  3JVT C;  4FQT A;  4KYN A;  4DCK A;  1TCF A;  3NHT A;  4ETO A;  1RJV A;  1EJ3 A;  1SR6 C;  1UUR A;  2LP2 A;  3VRR A;  3D74 A;  1NYA A;  3S0B A;  1SBJ A;  2I7A A;  3D73 A;  1K96 A;  3N7H A;  3O4Y A;  3PAT A;  1CB1 A;  1W9Z A;  1S6I A;  1T14 A;  2TN4 A;  3DD4 A;  3PJI A;  5KTY A;  3CR4 X;  1SCV A;  3I5F C;  2JT3 A;  2QEB A;  2WCK A;  2JWW A;  1TCO B;  1PVA A;  2FJU B;  2KBI A;  1JC2 A;  2K60 A;  1UWO A;  3AAJ A;  3O78 A;  3DY9 A;  4DUQ A;  4PT1 A;  3SG5 A;  4E68 A;  1XFR A;  1DGU A;  1M63 B;  1KFX L;  2OTG C;  1QX5 B;  3EVR A;  3FWB A;  1EL4 A;  4M2O A;  5D7F A;  3VRQ A;  1B8C A;  4NDB A;  3CZ0 A;  4QJ5 B;  4ICB A;  3O4X A;  1OW4 A;  3EK4 A;  2JOJ A;  1OQP A;  1WLZ A;  1BOC A;  1OOI X;  3KF9 A;  1IIO A;  3I5G B;  1M45 A;  1C7V A;  2A4J A;  4QJ4 B;  2KQY A;  3FS7 A;  2I2R E;  3OB1 B;  1UHK A;  3RM1 A;  2LLT A;  3DF0 A;  1U5I B;  1WRK A;  1CM1 A;  3D75 A;  1FF1 A;  1UHI A;  1IJ6 A;  4DIR A;  3ICB A;  1CLB A;  3BUX B;  1JF0 A;  1WLM A;  4GFT A;  4ZCU A;  2BNX A;  3D0Y B;  3IVT A;  1PK0 D;  5AEQ A;  5BPJ A;  2JC2 A;  4PE7 A;  3R72 A;  1UUS A;  2WCF A;  2MAZ A;  4MVF A;  3CYZ A;  4OVN F;  2KI4 C;  4INX A;  1FI6 A;  3TS5 C;  1S5G Y;  1SCM B;  1AK8 A;  4GPL B;  4INW A;  4XJK A;  5CPV A;  1YR5 A;  3OGN A;  2M3W A;  2LUX A;  4MLW A;  4WQ3 A;  1KFU S;  2K7B A;  1K2H A;  3FE8 A;  1KQV A;  2BKH B;  2GGM A;  1NSH A;  1TNW A;  2BKI B;  2RGI A;  3VRN A;  1PSB A;  3ZNI A;  1HQV A;  1SSE B;  3WNX B;  2SCP A;  3DVM A;  1IRJ A;  3S0F A;  2KI6 D;  1DMO A;  3S0A A;  2COL B;  1QTX A;  2K7C A;  3BOW B;  3PN7 C;  2CTN A;  3A8R A;  4C0L A;  3S0E A;  1C3Z A;  2KLD A;  2ZRS A;  1NIW A;  3L4A A;  3AAK A;  2KAV A;  1SNL A;  2BCA A;  1KQM C;  2K7D A;  3KO0 A;  1XO5 A;  1KK8 C;  3EKH A;  1XFZ O;  2LVI A;  4CLN A;  1IQ3 A;  5HLO A;  5HYD A;  2AAO A;  2EC6 B;  2KGR A;  1QIV A;  1Y1U A;  4OV2 A;  1KK7 Y;  3JTD C;  2PRU A;  1Z4H A;  1QVI Z;  1F4Q A;  1KFU L;  4M2Q A;  2F2P A;  2M0R A;  4R1E A;  3TDZ A;  1RRO A;  4N5X A;  1LS8 A;  2H8V A;  1DF0 B;  3VRO A;  1RWY A;  1A75 B;  1OMV A;  1YRT B;  2O60 A;  5HLV A;  2WCM A;  3QME A;  1MWN A;  1MXE A;  1K8U A;  3LLE A;  5I2L A;  2P6B B;  3KHE A;  5F6T A;  2LVV A;  2L51 A;  2LNK A;  3CR5 X;  5DKQ A;  1UHJ A;  4MBE A;  2B1U A;  3PAL A;  2JXC A;  1BF5 A;  3S0G A;  4F0Z B;  1ZMZ A;  1KSM A;  3EVV A;  5HKZ A;  4GGN A;  1WY9 A;  1A29 A;  4IL1 A;  4MN0 A;  2LLS A;  2KGB C;  1B1G A;  4PHM A;  2HPS A;  3B6X A;  3S0D A;  1NCY A;  5HL1 A;  3BFA A;  1WDC C;  4BY4 A;  1QLK A;  4CPV A;  2K2A A;  1XA5 A;  1FW4 A;  3EK7 A;  4HRE E;  5D69 A;  1CDL A;  4F7F A;  2LP3 A; 
#chains in the Genus database with same CATH homology
 2OS8 C;  3TDU A;  1CFC A;  1CM4 A;  3DVK A;  1RK9 A;  1S36 A;  3LK0 A;  4P5O E;  1J7R A;  1DT7 B;  2JPT A;  1PUL A;  2KNE A;  2LMT A;  4GBA A;  4U8D A;  1C7W A;  2MJW B;  4OKH A;  1K93 D;  4TNC A;  1CDN A;  2WOR A;  1QV1 A;  4GUK A;  1QJT A;  1KCY A;  1RTP 1;  3NSK A;  4WRI A;  1XK4 C;  1NUB A;  2BL0 C;  3WHT B;  3I5G C;  2MRD A;  2BBN A;  1NPQ A;  1B7T Z;  2L5X B;  3DVJ A;  3PSR A;  1LIN A;  4DS7 A;  2K2F A;  3HX4 A;  4GGF A;  2KI6 C;  1J1D A;  3BYA A;  2LCP A;  4GNK B;  4DRW A;  2Y4Q A;  1NCZ A;  1ZUZ A;  1IJ5 A;  1N0Y A;  1CDP A;  3BXK A;  2GGZ A;  4UPG A;  1BR4 B;  1DJX A;  1LKJ A;  1FI5 A;  4NDC A;  3CZT X;  4C0K A;  3DF0 B;  4PE0 A;  3D10 A;  2M49 B;  4Q04 A;  3C1V A;  1CFD A;  1LA0 A;  5CSI A;  5K89 A;  1F8H A;  4I5K A;  2PSR A;  1VRK A;  4MSP A;  1IKU A;  3AKB A;  3K21 A;  3OHM B;  3SG7 A;  2MLE C;  4CFR A;  1IH0 A;  2BCX A;  2JRF A;  2KAX A;  4ORA B;  1JUO A;  1YX8 A;  4D1E A;  3I5I C;  1BG1 A;  1BMO A;  4HSZ A;  1S6J A;  1DVI A;  2PAS A;  3NXA A;  4MZJ A;  1EG4 A;  4YGA A;  1N2D A;  1QX2 A;  4HRH A;  4YI9 A;  4MRX A;  1MHO A;  4P2Y B;  4XJK B;  2KSP A;  1OMD A;  2ISD A;  2CBL A;  3VGO A;  1CDM A;  2NCP A;  2L50 A;  3QRX A;  5ER4 X;  2WND A;  1B8R A;  2F3Y A;  5CSJ A;  2DOQ A;  5IBW A;  1JWD A;  3GOF A;  2F8P A;  4FTG A;  3HCM A;  2JTT A;  2EC6 C;  1M46 A;  2WOS A;  1XVJ A;  1F4O A;  5B8I B;  5JJG A;  5I8N A;  3JVT B;  1CTR A;  4AOM A;  1GGZ A;  3SG2 A;  1CNP A;  3CGA A;  4M2P A;  1NCX A;  2M7L A;  1GJY A;  1SR6 B;  2KQ6 A;  2FCE A;  1FPW A;  1TN4 A;  2JQ6 A;  3PLF B;  1J7O A;  4A4B A;  3CS1 A;  4XYN A;  5FYX A;  4PDZ A;  1G4Y R;  2NCO A;  1Y1A A;  1KSO A;  2F3Z A;  1QV0 A;  4PHN A;  1OZS A;  2JZI A;  3O6B A;  1XK4 A;  2G2B A;  2KYF A;  1PVB A;  2FCD A;  2OTG B;  4MZK A;  1B8L A;  2MLF C;  1M31 A;  1TIZ A;  2PMY A;  1YRU B;  3PM8 A;  2M9G A;  1SYM A;  1LVC D;  3SIB A;  1SK6 D;  3OX6 A;  4QJ3 B;  1G33 A;  1AHR A;  4PHJ A;  1IG5 A;  1E8A A;  2PAL A;  2ZKM X;  2JU0 A;  4OCI A;  2ZN8 A;  3RLZ A;  1CLM A;  1J7P A;  2M97 A;  5TNC A;  1TTX A;  4I5L B;  2K7O A;  2KDH A;  3NSI A;  1PRW A;  4YRU A;  3EKJ A;  1KWO C;  3NSL A;  3BQ3 A;  1XFW O;  1OOJ A;  2JT0 A;  3TUY B;  2I94 A;  1SY9 A;  1BOD A;  1B47 A;  1DJW A;  2LE9 B;  2LLU A;  3I5H B;  4PCW A;  5CSN A;  4C0J A;  5AER A;  2WCB A;  2KI4 B;  1BLQ A;  4JWQ A;  3TS5 B;  1EH2 A;  1L2O B;  2KFH A;  4N1G A;  2ZFD A;  1AJ4 A;  2LHL A;  3AKA A;  4MZL A;  1XFY O;  1K94 A;  1V1F A;  2JNF A;  1XYD A;  2OPO A;  1LXF C;  4USL A;  1EG3 A;  4JPZ B;  1M39 A;  1QVI Y;  1JBA A;  1K9U A;  1H8B A;  2M1K B;  2H2K A;  2O5G A;  1CFF A;  1OSA A;  1AP4 A;  2HET A;  1SPY A;  4PHK A;  3FWC A;  2BE6 A;  2H61 C;  2CXJ A;  1F55 A;  1K90 D;  3SJS A;  1KQM B;  2LAN A;  4JQ0 D;  2HF5 A;  3EK8 A;  1J1E A;  3NSO A;  2L0P A;  1BR1 B;  1L7Z A;  1PSR A;  5DKN A;  1F71 A;  3TZ1 A;  1A03 A;  2E30 A;  4OR9 B;  5J3X A;  1IWQ A;  1LA3 A;  4YGC B;  3KPX A;  3VRP A;  1N65 A;  2JTZ A;  1SW8 A;  1DJG A;  1WRL A;  4NDD A;  1UP5 A;  1DGV A;  3GK1 A;  2SAS A;  1WRZ A;  2BCB A;  2ZND A;  1TNP A;  4N1F A;  2HQW A;  1HT9 A;  1XFV O;  2EGD A;  1YX7 A;  2LVJ A;  1ZOT B;  3KEV A;  1R2U A;  2FOT A;  1AJ5 A;  2F33 A;  1SCM C;  5PAL A;  2E6W A;  5I2Q A;  3H4S E;  3SIA A;  3MSE B;  1JFK A;  4HRG A;  3SG4 A;  2Q4U A;  3BUO B;  5HKY A;  3IQQ A;  2LMU A;  1TRF A;  1K9P A;  1TOP A;  1WDC B;  1NP8 A;  1YUS A;  3DVE A;  2I18 A;  5I2O A;  1B7T Y;  2LVK A;  1S6C A;  2VRG A;  4WQ2 A;  2QAC A;  3LCP C;  2R2I A;  3M0W A;  1IGV A;  2MHH A;  2OS8 B;  3O2P A;  4ORC B;  5AXI A;  2ZRT A;  1A2X A;  2BEC A;  2JUL A;  4PAL A;  3CTN A;  1JSA A;  1UHN A;  1CFP A;  1B9A A;  2KAY A;  1S5G Z;  4BY5 A;  4YI8 A;  1UHH A;  1YTZ C;  1YUR A;  4YGB B;  1NX3 A;  4I5J A;  3CLN A;  4ORB B;  2BE4 A;  2D8N A;  1CMF A;  3GK2 A;  2BL0 B;  1EXR A;  4PE1 A;  4PE4 A;  1ODB A;  2KBM A;  1Y1X A;  1MF8 B;  1IQ5 A;  2JNX A;  2LUC A;  2IS9 A;  2L98 A;  3I5F B;  4YBH B;  2H61 A;  3LK1 A;  1CKK A;  2M29 A;  1A4P A;  4AQI A;  1ALW A;  1QIW A;  3TUY C;  3IF7 A;  3OX5 A;  1NX1 A;  3WHU B;  1ZAC A;  4AQJ A;  2KOT A;  2F2O A;  3I5H C;  3LL8 B;  2NLN A;  1KK7 Z;  1MR8 A;  2ZN9 A;  1QS7 A;  2L2E A;  3FIA A;  4FQO A;  2QPT A;  2K61 A;  1YVL A;  3GK4 X;  1ALV A;  1U5I A;  1L2O C;  1QAT A;  5GQQ C;  4CID A;  1MQ1 A;  3ZWH A;  1CLL A;  2Y1N A;  4GAO A;  2EHB A;  2Y1M A;  3I5I B;  4CFQ A;  1S3P A;  3D0Y A;  4GGF C;  4L9M A;  2HQ8 A;  1DJY A;  2CNP A;  4MEW A;  4MRY A;  5ER5 A;  2M8U A;  1BT6 A;  2PVB A;  1YUT A;  3CR2 A;  1BU3 A;  3F45 A;  2NZ0 A;  1AUI B;  1MXL C;  1DJH A;  3BUN B;  1C07 A;  3BUW B;  1F70 A;  1SL8 A;  3BUM B;  1OZO A;  2LAP A;  1SL9 A;  2JXL A;  5JOL A;  1TNQ A;  2LC5 A;  1G8I A;  1QX7 A;  1OE9 B;  2V53 A;  3SG6 A;  2K8M B;  1DJI A;  2M7N A;  2NXQ A;  2KYC A;  1DJZ A;  3A4U B;  4A4C A;  2LV7 A;  1TNX A;  1X02 A;  1Y0V H;  2KFG A;  2Q91 A;  3BOW A;  1JFJ A;  1QLS A;  1JF2 A;  1SMG A;  5KSZ A;  2AMI A;  1NWD A;  4ZCV A;  1XFX O;  1K95 A;  3WXA A;  2K0J A;  1QXP A;  2KHN A;  1S1E A;  2BBM A;  1J55 A;  4NQG A;  1B4C A;  5CSF A;  1NX2 A;  2LM5 A;  1S26 D;  3EVU A;  2JT8 A;  3PN7 B;  2G9B A;  1RFJ A;  4YGE B;  1REC A;  1W7J B;  2L4I A;  1V1G A;  5KU1 A;  2WC8 A;  5AAN A;  3SG3 A;  2LMV A;  1DF0 A;  1KK8 B;  1A75 A;  2WCE A;  2GV5 A;  1YVH A;  1Q80 A;  1SRA A;  1F54 A;  2M1U A;  1QAS A;  1K9K A;  4YGD B;  3E3R A;  1H4B A;  3JTD B;  1DTL A;  1Y6W A;  3OB2 B;  1R6P A;  2ZNE A;  1OMR A;  3CWG A;  1NX0 A;  1MUX A;  2MA2 A;  1SKT A;  2L4H A;  3IQO A;  1AVS A;  3PFV A;  5HKW A;  5AFP A;  1PAL A;  2CT9 A;  1FBV A;  4I5N B;  1YUU A;  1XFU O;  2AUC A;  3OP0 A;  1W7I B;  1J7Q A;  1ZFS A;  1KFX S;  2Y5I A;  2LHI A;  1CMG A;  1KWO B;  5G08 A;  3TDI A;  1SL7 A;  2CCM A;  1BJF A;  2KFF A;  1GQM A;  2MBX A;  1D1O A;  5DKR A;  3JVT C;  4DCK A;  1TCF A;  4ETO A;  1RJV A;  1EJ3 A;  1SR6 C;  1UUR A;  2LP2 A;  3VRR A;  1NYA A;  1GGW A;  1SBJ A;  2I7A A;  3O4Y A;  1K96 A;  1CB1 A;  3PAT A;  2TN4 A;  1S6I A;  3DD4 A;  5KTY A;  3CR4 X;  1SCV A;  3I5F C;  2JT3 A;  2JWW A;  1TCO B;  1PVA A;  2FJU B;  2KBI A;  1JC2 A;  1UWO A;  3AAJ A;  3O78 A;  4DUQ A;  3SG5 A;  4E68 A;  1DGU A;  1M63 B;  1KFX L;  2OTG C;  1QX5 B;  3EVR A;  3FWB A;  1EL4 A;  4M2O A;  5D7F A;  3VRQ A;  1B8C A;  4NDB A;  4QJ5 B;  4ICB A;  3EK4 A;  2JOJ A;  1OQP A;  1WLZ A;  1BOC A;  3KF9 A;  3I5G B;  1M45 A;  1C7V A;  2A4J A;  4QJ4 B;  2KQY A;  3FS7 A;  2I2R E;  3OB1 B;  1UHK A;  3RM1 A;  2LLT A;  3DF0 A;  1U5I B;  1WRK A;  1CM1 A;  1FF1 A;  1UHI A;  1IJ6 A;  4DIR A;  3ICB A;  1CLB A;  3BUX B;  1JF0 A;  1WLM A;  4GFT A;  4ZCU A;  3D0Y B;  1PK0 D;  5AEQ A;  5BPJ A;  2JC2 A;  4PE7 A;  1UUS A;  2WCF A;  2MAZ A;  4MVF A;  4OVN F;  2KI4 C;  1FI6 A;  3TS5 C;  1S5G Y;  1SCM B;  1AK8 A;  4GPL B;  4XJK A;  5CPV A;  1YR5 A;  2M3W A;  2LUX A;  4MLW A;  4WQ3 A;  1KFU S;  2K7B A;  1K2H A;  1KQV A;  2BKH B;  2GGM A;  1NSH A;  1TNW A;  2BKI B;  2RGI A;  3VRN A;  1PSB A;  3ZNI A;  1HQV A;  3WNX B;  2SCP A;  3DVM A;  1IRJ A;  2KI6 D;  1DMO A;  2COL B;  1QTX A;  2K7C A;  3BOW B;  3PN7 C;  2CTN A;  3A8R A;  4C0L A;  2ZRS A;  1NIW A;  3AAK A;  2KAV A;  1SNL A;  2BCA A;  1KQM C;  2K7D A;  3KO0 A;  1XO5 A;  1KK8 C;  3EKH A;  1XFZ O;  2LVI A;  4CLN A;  1IQ3 A;  5HLO A;  5HYD A;  2AAO A;  2EC6 B;  2KGR A;  1QIV A;  1Y1U A;  4OV2 A;  1KK7 Y;  3JTD C;  2PRU A;  1QVI Z;  1F4Q A;  1KFU L;  4M2Q A;  2F2P A;  2M0R A;  4R1E A;  3TDZ A;  1RRO A;  4N5X A;  3VRO A;  1DF0 B;  1RWY A;  1A75 B;  1OMV A;  1YRT B;  2O60 A;  5HLV A;  1MWN A;  1MXE A;  1K8U A;  3LLE A;  5I2L A;  2P6B B;  3KHE A;  5F6T A;  2LVV A;  2L51 A;  2LNK A;  3CR5 X;  5DKQ A;  1UHJ A;  4MBE A;  2B1U A;  3PAL A;  2JXC A;  1BF5 A;  4F0Z B;  1ZMZ A;  1KSM A;  3EVV A;  5HKZ A;  4GGN A;  1WY9 A;  1A29 A;  4IL1 A;  4MN0 A;  2LLS A;  2KGB C;  1B1G A;  4PHM A;  2HPS A;  1NCY A;  1WDC C;  4BY4 A;  1QLK A;  4CPV A;  2K2A A;  1XA5 A;  1FW4 A;  3EK7 A;  4HRE E;  5D69 A;  1CDL A;  2LP3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...