3A8RA

The structure of the n-terminal regulatory domain of a plant nadph oxidase
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
166
structure length
166
Chain Sequence
TKSSAAVALKGLQFVTAKVGNDGWAAVEKRFNQLQVDGVLLRSRFGKCIGMDGSDEFAVQMFDSLARKRGIVKQVLTKDELKDFYEQLTDQGFDNRLRTFFDMVDKNADGRLTAEEVKEIIALSASANKLSKIKERADEYTALIMEELDPTNLGYIEMEDLEALLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Calcium binding protein
molecule keywords Putative uncharacterized protein
publication title The structure of the N-terminal regulatory domain of a plant NADPH oxidase and its functional implications
pubmed doi rcsb
source organism Oryza sativa japonica group
total genus 61
structure length 166
sequence length 166
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3a8rA01
1TCOB 1NX0A 2L4HA 4YGCB 1F8HA 1S6CA 1N0YA 1F4OA 3EK4A 2Q91A 1K8UA 2V53A 3F45A 4YGEB 2KBIA 1OMDA 4N5XA 1UHJA 2E30A 2EHBA 2GGZA 1OE9B 1BR4B 3RM1A 1RJVA 2K2AA 2LLTA 4GFTA 4L9MA 1TNXA 3BUOB 5KSZA 1S5GY 3SG2A 3HCMA 4XYNA 3PSRA 3D0YA 4GUKA 1YX8A 2BCXA 3OX6A 1R6PA 4ICBA 4MZLA 5ER4X 3I5IC 3I5FB 1XK4C 4UPGA 5JJGA 1S6JA 1SNLA 1YUTA 3HX4A 2NCPA 2KAVA 2F3YA 2KHNA 2K7BA 3JVTB 4U8DA 4GPLB 2HF5A 4HRHA 1NWDA 1NX2A 1B8CA 1YURA 2H61C 2CNPA 1JF0A 1J55A 2L98A 2Q4UA 3ZWHA 3LL8B 1UHIA 3IF7A 1A03A 1QX7A 1E8AA 1UWOA 3CGAA 1BMOA 3EK8A 2HQ8A 3PLFB 1XA5A 1MWNA 1Y1AA 1SY9A 1DF0A 2CCMA 1S36A 3IQQA 5TNCA 4OR9B 1QV1A 3O2PA 1KSMA 4GGNA 1NCYA 4ZCUA 2L50A 3I5FC 1JC2A 1C7VA 1NYAA 1AVSA 1YVHA 3AKBA 2WOSA 3D10A 1XFZO 2QACA 1JSAA 2CTNA 2K7CA 2OS8B 5HKWA 1G4YR 4BY4A 1QVIY 2QPTA 1NX1A 4PE0A 2P6BB 3JVTC 3PATA 4OKHA 5CSJA 2M1UA 1BU3A 5B8IB 1SL7A 1DJZA 1C07A 4USLA 1L7ZA 3SG3A 1FI6A 5CSNA 3CR4X 3DVMA 4HREE 2ZNEA 4A4BA 3FWCA 1JBAA 1ALVA 4MLWA 1JWDA 2M0RA 1M46A 5DKNA 1OMVA 3DF0A 5ER5A 3BUMB 3GOFA 2TN4A 1D1OA 1KK7Y 1NUBA 1XK4A 2M29A 3CZTX 1K2HA 5JOLA 4PDZA 1AK8A 1GJYA 2KYCA 5D7FA 2L5XB 1F54A 3LLEA 2KDHA 2OS8C 2WCFA 4M2OA 1SW8A 1CLMA 3EVRA 1A29A 1TNQA 4YGAA 3EVVA 4JQ0D 2LV7A 2IS9A 1OMRA 1TCFA 1WY9A 2EGDA 2JOJA 1MF8B 2LHLA 4IL1A 1ZMZA 3AKAA 2CT9A 5KTYA 1UHKA 1GGWA 3GK4X 3CR5X 3K21A 2LLUA 4P5OE 1MXEA 1M39A 3SG7A 4DRWA 5HKZA 2G9BA 2DOQA 2ZN9A 1EL4A 2BBMA 2LVIA 2F2OA 1CNPA 1JUOA 1QLKA 2BECA 2ZN8A 1A2XA 2L2EA 1LINA 1M31A 2JTTA 2KNEA 1NPQA 2HPSA 1JF2A 2JT3A 1N65A 3SIBA 1FPWA 2H2KA 4I5KA 5PALA 4JWQA 3KHEA 2JNXA 4C0KA 4ORCB 1XVJA 2FJUB 2NXQA 1YVLA 3O78A 1HT9A 3TDIA 2M7LA 4CIDA 3BYAA 1M63B 4OVNF 2LUCA 1PRWA 2MJWB 3I5HB 3ZNIA 2OTGC 4XJKA 1X02A 1CM1A 1YX7A 1H8BA 1CFFA 2EC6B 3O4YA 1F71A 1YUSA 5I2LA 2ZFDA 5D69A 3PN7B 5AEQA 3AAJA 2BL0B 2RGIA 4N1FA 1RFJA 1K96A 1AJ5A 2KFGA 3SG5A 3TZ1A 2LVJA 2JXLA 4MRYA 4TNCA 1V1FA 1Y6WA 4NDDA 3BXKA 1B8LA 4PALA 1F70A 4N1GA 4CPVA 2LNKA 1J7QA 2M49B 1FI5A 1VRKA 1QV0A 2GGMA 3GK2A 1U5IA 4D1EA 3I5HC 4PE4A 1GGZA 2K2FA 3EKJA 4MZKA 4I5LB 4C0JA 4DCKA 2I94A 4NDCA 4CLNA 1CDNA 3A4UB 1OSAA 1RTP1 1EJ3A 2EC6C 2I18A 1IRJA 4ETOA 1KK8B 3PN7C 3SG6A 1DJGA 2BL0C 2FCDA 1AUIB 1UUSA 3WXAA 1TIZA 2I2RE 3CWGA 2MHHA 4PE1A 1QJTA 1K9PA 2KGBC 1K94A 2LMUA 2M9GA 1MHOA 1AJ4A 3SIAA 1K93D 3ICBA 3WNXB 1PALA 1YRUB 4YI9A 5G08A 2MBXA 5I2OA 1S1EA 4GGFC 3TDUA 2F8PA 5F6TA 5AFPA 1EG4A 3SJSA 1EG3A 1IJ5A 2K61A 1JFJA 2NLNA 1H4BA 1OZOA 1DJHA 2F33A 3E3RA 2BE4A 2VRGA 2SCPA 2AAOA 4F0ZB 1DJXA 1S5GZ 2MLFC 2BCAA 2LCPA 2Y1NA 1KK8C 2KI6D 3EK7A 3QRXA 2KOTA 2KAYA 1IKUA 3OP0A 4M2PA 1TN4A 3OX5A 1WDCB 1ZACA 3O6BA 3TDZA 1MXLC 2KGRA 3NSIA 1J7PA 1L2OB 1V1GA 2BBNA 1N2DA 1PVAA 4M2QA 3DVJA 2MA2A 1AP4A 1LA0A 1J7OA 1Y1UA 1WLZA 2BKIB 3VRNA 3TUYB 2JTZA 5HYDA 4FQOA 4MBEA 1SRAA 4I5NB 2KFHA 3C1VA 5IBWA 5HLOA 3CTNA 1MQ1A 5BPJA 4E68A 2ISDA 1F55A 2JRFA 3FIAA 5AERA 2LVVA 1CLLA 3M0WA 2H61A 3BOWB 4DIRA 1FF1A 2AMIA 2AUCA 2M8UA 2MLEC 2A4JA 4QJ5B 1IG5A 1KFUL 1XFUO 3CLNA 1BR1B 1K90D 3EKHA 4WQ2A 1B8RA 2KQYA 1B7TY 2BCBA 1WDCC 2K7DA 1DGUA 2B1UA 4ORAB 1CDPA 1SPYA 4PE7A 1L2OC 3NSLA 1PVBA 3VGOA 4CFQA 1A4PA 3LCPC 1YRTB 2PSRA 1OZSA 4WQ3A 4MRXA 1CB1A 1BODA 1DJIA 1QVIZ 1SKTA 1NCZA 3RLZA 2K0JA 1KFUS 3TUYC 4GGFA 5DKQA 1IGVA 2LE9B 1BT6A 2JT8A 1DTLA 1J7RA 2Y5IA 1RWYA 1WRLA 2JNFA 3LK1A 1DF0B 1ZFSA 1C7WA 1TTXA 2WC8A 3VROA 1F4QA 2JU0A 2LANA 2Y1MA 4ZCVA 4DS7A 1KK7Z 1Y1XA 2KSPA 3MSEB 2LP3A 2NCOA 4YI8A 3PFVA 3NSKA 2WNDA 3FWBA 1YR5A 1CKKA 1KCYA 2KI4B 5HKYA 1G8IA 2PALA 4ORBB 1M45A 2O5GA 2KYFA 1S3PA 4P2YB 1EXRA 1XFVO 5AANA 4MN0A 5AXIA 2CXJA 1NP8A 4C0LA 2PASA 2PRUA 2LLSA 1J1EA 2COLB 2LVKA 3KPXA 3AAKA 1YTZC 1DJYA 1CTRA 1XFWO 1ALWA 1IJ6A 1CLBA 1B47A 1DGVA 3OB2B 1ZUZA 2KI6C 1A75B 1OQPA 3FS7A 1SCVA 2Y4QA 4CFRA 2L51A 4NQGA 5FYXA 3KO0A 2R2IA 5GQQC 2CBLA 3DF0B 1KQVA 1CMFA 1CMGA 1TNWA 2JC2A 4PCWA 1LVCD 2JZIA 2ZRSA 2WORA 4I5JA 2KI4C 1TRFA 5CPVA 3SG4A 1B1GA 4YRUA 1SMGA 1QX2A 5K89A 2O60A 2K7OA 4PHMA 1DVIA 3IQOA 1NIWA 3DVKA 3A8RA 1SL9A 3PM8A 2M7NA 1BOCA 2M1KB 5HLVA 2FOTA 4Q04A 4OCIA 1B9AA 3BOWA 1DT7B 1CDMA 2E6WA 1MR8A 4MVFA 2WCEA 3CS1A 1FBVA 1KWOB 1NSHA 3NXAA 1XO5A 1QASA 2JWWA 4R1EA 1XYDA 2PMYA 4YBHB 1DJWA 1ZOTB 2M3WA 2M97A 4HRGA 4AQIA 1SK6D 1AHRA 2F3ZA 1Y0VH 1CFDA 2WCBA 4GNKB 3VRPA 5CSIA 1QXPA 1QLSA 2ZNDA 3JTDB 2ZKMX 1BG1A 1IQ3A 1SL8A 3KEVA 2L0PA 1XFYO 2MRDA 2LC5A 2LMTA 1JFKA 3BUXB 4MSPA 5I8NA 4YGBB 1R2UA 3I5GB 5DKRA 1SCMB 1PULA 2BE6A 1NCXA 4XJKB 2LHIA 2D8NA 1HQVA 1LA3A 2NZ0A 3PALA 5J3XA 1Q80A 1BJFA 1KWOC 1KFXL 1DMOA 1TNPA 2KQ6A 1UHNA 2LAPA 1SR6B 2L4IA 4QJ3B 1WRKA 1BLQA 1KQMB 3BQ3A 3VRRA 1BF5A 4WRIA 2LM5A 1YUUA 1MUXA 3JTDC 1W7IB 1CFPA 2SASA 2HETA 2MAZA 1KFXS 4JPZB 2LUXA 3D0YB 1K9UA 1RROA 2KAXA 1A75A 1CDLA 3I5GC 1SBJA 3WHTB 1U5IB 4BY5A 1PSRA 1RECA 1SCMC 4PHJA 4A4CA 3H4SE 4HSZA 2JQ6A 1WRZA 2JT0A 5I2QA 1S26D 1WLMA 3CR2A 2G2BA 1FW4A 2I7AA 2KBMA 1QTXA 1K9KA 1SR6C 4QJ4B 1OOJA 2F2PA 2JPTA 4NDBA 1KQMC 1J1DA 3OB1B 4PHKA 1RK9A 1CFCA 3BUNB 3NSOA 4OV2A 3OHMB 2PVBA 3VRQA 4GBAA 1B4CA 4AOMA 1ODBA 3GK1A 4PHNA 1G33A 1QIVA 4YGDB 1K95A 3TS5B 2OTGB 1QIWA 2GV5A 5KU1A 2LMVA 3KF9A 4AQJA 1UURA 1UP5A 4GAOA 5CSFA 3LK0A 1LKJA 3DVEA 2K8MB 1TOPA 1IQ5A 1QS7A 3EVUA 1SYMA 2HQWA 4MEWA 1CM4A 2ZRTA 3DD4A 1B7TZ 1PSBA 1S6IA 1XFXO 1QATA 2BKHB 1EH2A 2JULA 2KFFA 1KSOA 2JXCA 4FTGA 1IWQA 2LP2A 2OPOA 3I5IB 4MZJA 1W7JB 3WHUB 1PK0D 4DUQA 1IH0A 3BUWB 1GQMA 1LXFC 1NX3A 2FCEA 1UHHA 1QX5B 3TS5C
chains in the Genus database with same CATH superfamily
1TCOB 1NX0A 2L4HA 4YGCB 1F8HA 1S6CA 1N0YA 1F4OA 1OW4A 3EK4A 2Q91A 1K8UA 2V53A 3F45A 4YGEB 2WCLA 2KBIA 3CYZA 1OMDA 4N5XA 1UHJA 2E30A 2EHBA 2GGZA 2PYQA 1TUJA 1C3ZA 1OE9B 1BR4B 3RM1A 1RJVA 2K2AA 2LLTA 4GFTA 4L9MA 1TNXA 3BUOB 5KSZA 1S5GY 1DC1A 3SG2A 3HCMA 4XYNA 3PSRA 3D0YA 4GUKA 1YX8A 2BCXA 3CZ2A 1R6PA 3OX6A 4ICBA 4MZLA 5ER4X 3I5IC 3I5FB 1XK4C 4UPGA 5JJGA 3SS4A 1S6JA 3DXLA 1TUZA 3VB1A 3B6XA 1SNLA 1YUTA 3HX4A 2NCPA 2KAVA 2F3YA 2KHNA 2K7BA 3JVTB 4U8DA 4GPLB 2HF5A 4HRHA 1NWDA 1NX2A 1B8CA 1YURA 2H61C 2CNPA 4JKTA 1JF0A 1J55A 2L98A 2Q4UA 2KLEA 3LL8B 1UHIA 3IF7A 3ZWHA 1A03A 1QX7A 1E8AA 1UWOA 3CGAA 1BMOA 3EK8A 2HQ8A 3B86A 3PLFB 1XA5A 1MWNA 1Y1AA 1SY9A 1DF0A 2CCMA 1S36A 3IQQA 5TNCA 4OR9B 1OOGA 1QV1A 4OZDA 3O2PA 1KSMA 1IIOA 4GGNA 1NCYA 4ZCUA 2L50A 3I5FC 1JC2A 1C7VA 1NYAA 1AVSA 1YVHA 3AKBA 2WOSA 3D10A 1XFZO 2QACA 1JSAA 2CTNA 2K7CA 2OS8B 5HKWA 1G4YR 4BY4A 1QVIY 2QPTA 1NX1A 4PE0A 2P6BB 3JVTC 3PATA 4OKHA 5CSJA 2M1UA 1BU3A 5B8IB 1SL7A 1DJZA 1C07A 3DZTA 1L7ZA 4USLA 3SG3A 5CSNA 1TWOA 1FI6A 3CR4X 2WC5A 3DVMA 4HREE 2ZNEA 5FI2A 3FWCA 4A4BA 1JBAA 1ALVA 4MLWA 1JWDA 3SS3A 2M0RA 1M46A 3DYEA 3Q8IA 5DKNA 1OMVA 3DF0A 5ER5A 3BUMB 3GOFA 2TN4A 1D1OA 1KK7Y 1NUBA 1XK4A 2M29A 3CZTX 3R72A 1K2HA 5JOLA 1DELA 4PDZA 2GTEA 1T14A 2QDIA 1AK8A 1GJYA 2KYCA 5D7FA 2L5XB 1F54A 3LLEA 2KDHA 2OS8C 2WCFA 4M2OA 1SW8A 1CLMA 3CDNA 4FQTA 3EVRA 1A29A 1TNQA 4YGAA 5DICA 3EVVA 4F7FA 3UNWA 4JQ0D 2LV7A 2IS9A 1OMRA 1TCFA 1WY9A 2EGDA 2JOJA 1MF8B 2LHLA 4IL1A 1ZMZA 3AKAA 2CT9A 3R1PA 5KTYA 1UHKA 1GGWA 3GK4X 3CR5X 3K21A 2LLUA 1ORGA 1MXEA 1M39A 4P5OE 3SG7A 5HKZA 2G9BA 2DOQA 2ZN9A 1EL4A 2BBMA 2LVIA 2F2OA 1CNPA 1JUOA 1QLKA 2BECA 2ZN8A 1C3YA 1A2XA 2L2EA 1LINA 1M31A 2JTTA 2KNEA 1NPQA 2HPSA 3DY9A 1JF2A 2JT3A 3S0DA 1N65A 3L47A 3SIBA 1FPWA 2H2KA 4I5KA 5PALA 4JWQA 3KHEA 2JNXA 4C0KA 4ORCB 1XVJA 2FJUB 2NXQA 1YVLA 3O78A 1HT9A 3NHIA 3TDIA 2M7LA 4CIDA 3BYAA 1M63B 4OVNF 2QEVA 2LUCA 1PRWA 2KLDA 2MJWB 3I5HB 3ZNIA 1SSEB 2OTGC 4XJKA 1X02A 1CM1A 1YX7A 1H8BA 1CFFA 2EC6B 3O4YA 1F71A 1YUSA 5I2LA 2ZFDA 5D69A 3PN7B 5AEQA 3AAJA 2BL0B 2RGIA 4N1FA 1RFJA 1K96A 1AJ5A 2KFGA 3SG5A 3TZ1A 2LVJA 2L2CA 2JXLA 4MRYA 2WCKA 4TNCA 3BJHA 1V1FA 1Y6WA 4NDDA 3BXKA 1B8LA 4PALA 1F70A 4N1GA 4CPVA 2LNKA 3BFHA 2M49B 3EG5B 1J7QA 1FI5A 1VRKA 1QV0A 2GGMA 3GK2A 1U5IA 4D1EA 3V2LA 3I5HC 4PE4A 1GGZA 2K2FA 3EKJA 4MZKA 4I5LB 4C0JA 4DCKA 2I94A 4NDCA 4CLNA 1CDNA 3A4UB 3D75A 1OSAA 1RTP1 1EJ3A 2EC6C 2I18A 1IRJA 4ETOA 1KK8B 3PN7C 3SG6A 1DJGA 2BL0C 2FCDA 1AUIB 1UUSA 3WXAA 1TIZA 2I2RE 3CWGA 2MHHA 3FE6A 4PE1A 1QJTA 1K9PA 2KGBC 1K94A 2LMUA 2M9GA 1MHOA 1AJ4A 1OOIX 2K60A 3SIAA 1K93D 3NHTA 3S0GA 3ICBA 3FE8A 3PM2A 3WNXB 1PALA 1YRUB 4YI9A 2WC6A 5G08A 2MBXA 1S1EA 5I2OA 5FI6A 4GGFC 3TDUA 2F8PA 5F6TA 5AFPA 1EG4A 3SJSA 1EG3A 1IJ5A 2K61A 1JFJA 2NLNA 1H4BA 1OZOA 1DJHA 2F33A 3E3RA 2BE4A 2VRGA 2SCPA 2AAOA 4F0ZB 1DJXA 1S5GZ 2MLFC 2BCAA 2LCPA 2Y1NA 1KK8C 2KI6D 3EK7A 3QRXA 2KOTA 2KAYA 1IKUA 3OP0A 4M2PA 1TN4A 3OX5A 1WDCB 1ZACA 3O6BA 3TDZA 1MXLC 2KGRA 3NSIA 1J7PA 1L2OB 1V1GA 2BBNA 1N2DA 1PVAA 4M2QA 3DVJA 2MA2A 1AP4A 1LA0A 1J7OA 1Y1UA 1WLZA 2BKIB 3L4LA 3VRNA 3TUYB 3S0AA 2JTZA 5EL2A 5HYDA 4FQOA 4MBEA 1SRAA 4I5NB 2KFHA 3C1VA 2WCJA 5IBWA 5HLOA 1LS8A 1MQ1A 3CTNA 1Z2CB 2ISDA 5BPJA 4E68A 2JRFA 3D73A 3FIAA 5AERA 3B7AA 2LVVA 1CLLA 3M0WA 2H61A 3BOWB 4DIRA 1FF1A 2AMIA 2AUCA 2M8UA 2MLEC 2A4JA 4QJ5B 1IG5A 1KFUL 1XFUO 3CLNA 1BR1B 1K90D 3EKHA 4WQ2A 1B8RA 2KQYA 1B7TY 2BCBA 1WDCC 2K7DA 1DGUA 2B1UA 4ORAB 1CDPA 1SPYA 3S0EA 4PE7A 1L2OC 3NSLA 1PVBA 3VGOA 4CFQA 1A4PA 3LCPC 1YRTB 2PSRA 1OZSA 4WQ3A 4MRXA 1CB1A 1BODA 1DJIA 1QVIZ 1SKTA 1NCZA 3CZ0A 3RLZA 2K0JA 1KFUS 3TUYC 4GGFA 5DKQA 1IGVA 3D77A 2LE9B 1BT6A 2JPOA 2JT8A 1DTLA 3CABA 1J7RA 2Y5IA 1RWYA 1WRLA 2JNFA 3LK1A 1DEKA 1DF0B 1ZFSA 1C7WA 1TTXA 2WC8A 3D76A 1F4QA 2FJYA 3VROA 2JU0A 2LANA 2Y1MA 4ZCVA 4DS7A 1KK7Z 1Y1XA 2KSPA 3MSEB 2LP3A 2NCOA 2WCHA 3PFVA 2BNXA 1W9ZA 2WNDA 3NSKA 3FWBA 1YR5A 3O4XA 4YI8A 1CKKA 2KI4B 5HKYA 1KCYA 1G8IA 2PALA 4ORBB 1M45A 2O5GA 2KYFA 1S3PA 4P2YB 1EXRA 1XFVO 5AANA 4MN0A 5AXIA 2CXJA 1NP8A 4C0LA 2PASA 2PRUA 2LLSA 1J1EA 2COLB 1OOHA 2LVKA 3D74A 3FE9A 3AAKA 1YTZC 3KPXA 1DJYA 2BAPA 1CTRA 1XFWO 1ALWA 1IJ6A 1CLBA 1B47A 1DGVA 3OB2B 1ZUZA 2KI6C 2P71A 1A75B 1OQPA 3FS7A 1SCVA 2Y4QA 2P70A 2L51A 4CFRA 4NQGA 5FYXA 3KO0A 2R2IA 5GQQC 2CBLA 3DF0B 1KQVA 1CMFA 1CMGA 1TNWA 2JC2A 3BFAA 4PCWA 5HL1A 1LVCD 2JZIA 3OBVA 2ZRSA 2WORA 4I5JA 2KI4C 1TRFA 5CPVA 3SG4A 1B1GA 2L5YA 4YRUA 1SMGA 1QX2A 5K89A 2O60A 2K7OA 4KYNA 4PHMA 1DVIA 4PT1A 3IQOA 1NIWA 1P28A 3DVKA 3A8RA 1SL9A 3PM8A 2M7NA 1BOCA 2M1KB 5HLVA 2FOTA 4Q04A 4OCIA 1B9AA 3NGVA 3BOWA 1DT7B 1CDMA 2E6WA 1MR8A 4MVFA 2WCEA 1XFRA 2QEHA 3CS1A 1FBVA 3R1OA 1KWOB 1NSHA 3NXAA 1XO5A 3B88A 1QASA 2JWWA 3D78A 1XYDA 2PMYA 3QMEA 3R1VA 4R1EA 4YBHB 1DJWA 1ZOTB 1GM0A 2M3WA 2M97A 4HRGA 4AQIA 1SK6D 1AHRA 2F3ZA 3L4AA 1Y0VH 1CFDA 2WCBA 4GNKB 3VRPA 5CSIA 1QXPA 1QLSA 2KPHA 2ZNDA 2ZKMX 3JTDB 1BG1A 1IQ3A 1SL8A 3BFBA 3KEVA 3SS5A 2L0PA 1XFYO 2MRDA 2LC5A 2LMTA 1JFKA 3BUXB 4MSPA 5I8NA 4YGBB 1R2UA 3I5GB 5DKRA 1SCMB 1PULA 2BE6A 1NCXA 4XJKB 2LHIA 2D8NA 2PQLA 4DRWA 1HQVA 1LA3A 2NZ0A 3PALA 5D3OA 1Q80A 1BJFA 5FI7A 3IVTA 5J3XA 3PJIA 1KWOC 1KFXL 1DMOA 1TNPA 2KQ6A 1UHNA 2LAPA 1SR6B 2L4IA 4QJ3B 1WRKA 1BLQA 4INXA 1KQMB 3BQ3A 3VRRA 1BF5A 4WRIA 2LM5A 3K1EA 1YUUA 1MUXA 3JTDC 1W7IB 3OGNA 1CFPA 3S0BA 2SASA 2HETA 2MAZA 1KFXS 4JPZB 2LUXA 3D0YB 1K9UA 1RROA 2KAXA 1A75A 1CDLA 2H8VA 3I5GC 1SBJA 3WHTB 1U5IB 4BY5A 1PSRA 1RECA 1SCMC 3S0FA 4PHJA 4A4CA 3H4SE 2ERBA 4HSZA 2JQ6A 1WRZA 2QEOA 2JT0A 1OOFA 5I2QA 1S26D 1WLMA 3CR2A 2G2BA 1DQEA 1FW4A 2I7AA 2KBMA 1QTXA 1K9KA 5I94A 1SR6C 3CZ1A 2QEBA 4QJ4B 1OOJA 1Z4HA 2F2PA 2JPTA 4NDBA 1KQMC 1J1DA 3OB1B 4PHKA 1RK9A 1CFCA 3BUNB 3NSOA 4OV2A 3OHMB 1QWVA 2PVBA 3VRQA 4GBAA 3RZSA 3B87A 1ODBA 4AOMA 1B4CA 3GK1A 4PHNA 1G33A 1QIVA 4YGDB 1K95A 3TS5B 2OTGB 3UO9A 3N7HA 1QIWA 2GV5A 5KU1A 2LMVA 3KF9A 4AQJA 1UURA 1UP5A 4GAOA 5CSFA 3LK0A 1LKJA 3DVEA 2K8MB 1TOPA 1IQ5A 1QS7A 3EVUA 4INWA 1SYMA 2HQWA 2YGUA 4MEWA 1CM4A 2ZRTA 3DD4A 1B7TZ 4JD9A 1PSBA 1S6IA 1XFXO 1QATA 2BKHB 4IJ7A 1EH2A 2JULA 2KFFA 1KSOA 2JXCA 4FTGA 1IWQA 1F55A 2LP2A 2OPOA 3I5IB 4MZJA 1W7JB 3WHUB 1PK0D 4DUQA 1IH0A 3BUWB 1GQMA 1LXFC 1NX3A 2FCEA 1UHHA 1QX5B 2WCMA 3TS5C
chains in the Genus database with same CATH topology
1TCOB 1NX0A 2L4HA 4YGCB 1F8HA 1S6CA 1N0YA 1F4OA 3EK4A 2Q91A 1K8UA 2V53A 3F45A 4YGEB 2KBIA 1OMDA 4N5XA 1UHJA 2E30A 2EHBA 2GGZA 1OE9B 1BR4B 3RM1A 1RJVA 2K2AA 2LLTA 4GFTA 4L9MA 1TNXA 3BUOB 5KSZA 1S5GY 3SG2A 3HCMA 4XYNA 3PSRA 3D0YA 4GUKA 1YX8A 2BCXA 3OX6A 1R6PA 4ICBA 4MZLA 5ER4X 3I5IC 3I5FB 1XK4C 4UPGA 5JJGA 1S6JA 1SNLA 1YUTA 3HX4A 2NCPA 2KAVA 2F3YA 2KHNA 2K7BA 3JVTB 4U8DA 4GPLB 2HF5A 4HRHA 1NWDA 1NX2A 1B8CA 1YURA 2H61C 2CNPA 1JF0A 1J55A 2L98A 2Q4UA 3ZWHA 3LL8B 1UHIA 3IF7A 1A03A 1QX7A 1E8AA 1UWOA 3CGAA 1BMOA 3EK8A 2HQ8A 3PLFB 1XA5A 1MWNA 1Y1AA 1SY9A 1DF0A 2CCMA 1S36A 3IQQA 5TNCA 4OR9B 1QV1A 3O2PA 1KSMA 4GGNA 1NCYA 4ZCUA 2L50A 3I5FC 1JC2A 1C7VA 1NYAA 1AVSA 1YVHA 3AKBA 2WOSA 3D10A 1XFZO 2QACA 1JSAA 2CTNA 2K7CA 2OS8B 5HKWA 1G4YR 4BY4A 1QVIY 2QPTA 1NX1A 4PE0A 2P6BB 3JVTC 3PATA 4OKHA 5CSJA 2M1UA 1BU3A 5B8IB 1SL7A 1DJZA 1C07A 4USLA 1L7ZA 3SG3A 1FI6A 5CSNA 3CR4X 3DVMA 4HREE 2ZNEA 4A4BA 3FWCA 1JBAA 1ALVA 4MLWA 1JWDA 2M0RA 1M46A 5DKNA 1OMVA 3DF0A 5ER5A 3BUMB 3GOFA 2TN4A 1D1OA 1KK7Y 1NUBA 1XK4A 2M29A 3CZTX 1K2HA 5JOLA 4PDZA 1AK8A 1GJYA 2KYCA 5D7FA 2L5XB 1F54A 3LLEA 2KDHA 2OS8C 2WCFA 4M2OA 1SW8A 1CLMA 3EVRA 1A29A 1TNQA 4YGAA 3EVVA 4JQ0D 2LV7A 2IS9A 1OMRA 1TCFA 1WY9A 2EGDA 2JOJA 1MF8B 2LHLA 4IL1A 1ZMZA 3AKAA 2CT9A 5KTYA 1UHKA 1GGWA 3GK4X 3CR5X 3K21A 2LLUA 4P5OE 1MXEA 1M39A 3SG7A 4DRWA 5HKZA 2G9BA 2DOQA 2ZN9A 1EL4A 2BBMA 2LVIA 2F2OA 1CNPA 1JUOA 1QLKA 2BECA 2ZN8A 1A2XA 2L2EA 1LINA 1M31A 2JTTA 2KNEA 1NPQA 2HPSA 1JF2A 2JT3A 1N65A 3SIBA 1FPWA 2H2KA 4I5KA 5PALA 4JWQA 3KHEA 2JNXA 4C0KA 4ORCB 1XVJA 2FJUB 2NXQA 1YVLA 3O78A 1HT9A 3TDIA 2M7LA 4CIDA 3BYAA 1M63B 4OVNF 2LUCA 1PRWA 2MJWB 3I5HB 3ZNIA 2OTGC 4XJKA 1X02A 1CM1A 1YX7A 1H8BA 1CFFA 2EC6B 3O4YA 1F71A 1YUSA 5I2LA 2ZFDA 5D69A 3PN7B 5AEQA 3AAJA 2BL0B 2RGIA 4N1FA 1RFJA 1K96A 1AJ5A 2KFGA 3SG5A 3TZ1A 2LVJA 2JXLA 4MRYA 4TNCA 1V1FA 1Y6WA 4NDDA 3BXKA 1B8LA 4PALA 1F70A 4N1GA 4CPVA 2LNKA 1J7QA 2M49B 1FI5A 1VRKA 1QV0A 2GGMA 3GK2A 1U5IA 4D1EA 3I5HC 4PE4A 1GGZA 2K2FA 3EKJA 4MZKA 4I5LB 4C0JA 4DCKA 2I94A 4NDCA 4CLNA 1CDNA 3A4UB 1OSAA 1RTP1 1EJ3A 2EC6C 2I18A 1IRJA 4ETOA 1KK8B 3PN7C 3SG6A 1DJGA 2BL0C 2FCDA 1AUIB 1UUSA 3WXAA 1TIZA 2I2RE 3CWGA 2MHHA 4PE1A 1QJTA 1K9PA 2KGBC 1K94A 2LMUA 2M9GA 1MHOA 1AJ4A 3SIAA 1K93D 3ICBA 3WNXB 1PALA 1YRUB 4YI9A 5G08A 2MBXA 5I2OA 1S1EA 4GGFC 3TDUA 2F8PA 5F6TA 5AFPA 1EG4A 3SJSA 1EG3A 1IJ5A 2K61A 1JFJA 2NLNA 1H4BA 1OZOA 1DJHA 2F33A 3E3RA 2BE4A 2VRGA 2SCPA 2AAOA 4F0ZB 1DJXA 1S5GZ 2MLFC 2BCAA 2LCPA 2Y1NA 1KK8C 2KI6D 3EK7A 3QRXA 2KOTA 2KAYA 1IKUA 3OP0A 4M2PA 1TN4A 3OX5A 1WDCB 1ZACA 3O6BA 3TDZA 1MXLC 2KGRA 3NSIA 1J7PA 1L2OB 1V1GA 2BBNA 1N2DA 1PVAA 4M2QA 3DVJA 2MA2A 1AP4A 1LA0A 1J7OA 1Y1UA 1WLZA 2BKIB 3VRNA 3TUYB 2JTZA 5HYDA 4FQOA 4MBEA 1SRAA 4I5NB 2KFHA 3C1VA 5IBWA 5HLOA 3CTNA 1MQ1A 5BPJA 4E68A 2ISDA 1F55A 2JRFA 3FIAA 5AERA 2LVVA 1CLLA 3M0WA 2H61A 3BOWB 4DIRA 1FF1A 2AMIA 2AUCA 2M8UA 2MLEC 2A4JA 4QJ5B 1IG5A 1KFUL 1XFUO 3CLNA 1BR1B 1K90D 3EKHA 4WQ2A 1B8RA 2KQYA 1B7TY 2BCBA 1WDCC 2K7DA 1DGUA 2B1UA 4ORAB 1CDPA 1SPYA 4PE7A 1L2OC 3NSLA 1PVBA 3VGOA 4CFQA 1A4PA 3LCPC 1YRTB 2PSRA 1OZSA 4WQ3A 4MRXA 1CB1A 1BODA 1DJIA 1QVIZ 1SKTA 1NCZA 3RLZA 2K0JA 1KFUS 3TUYC 4GGFA 5DKQA 1IGVA 2LE9B 1BT6A 2JT8A 1DTLA 1J7RA 2Y5IA 1RWYA 1WRLA 2JNFA 3LK1A 1DF0B 1ZFSA 1C7WA 1TTXA 2WC8A 3VROA 1F4QA 2JU0A 2LANA 2Y1MA 4ZCVA 4DS7A 1KK7Z 1Y1XA 2KSPA 3MSEB 2LP3A 2NCOA 4YI8A 3PFVA 3NSKA 2WNDA 3FWBA 1YR5A 1CKKA 1KCYA 2KI4B 5HKYA 1G8IA 2PALA 4ORBB 1M45A 2O5GA 2KYFA 1S3PA 4P2YB 1EXRA 1XFVO 5AANA 4MN0A 5AXIA 2CXJA 1NP8A 4C0LA 2PASA 2PRUA 2LLSA 1J1EA 2COLB 2LVKA 3KPXA 3AAKA 1YTZC 1DJYA 1CTRA 1XFWO 1ALWA 1IJ6A 1CLBA 1B47A 1DGVA 3OB2B 1ZUZA 2KI6C 1A75B 1OQPA 3FS7A 1SCVA 2Y4QA 4CFRA 2L51A 4NQGA 5FYXA 3KO0A 2R2IA 5GQQC 2CBLA 3DF0B 1KQVA 1CMFA 1CMGA 1TNWA 2JC2A 4PCWA 1LVCD 2JZIA 2ZRSA 2WORA 4I5JA 2KI4C 1TRFA 5CPVA 3SG4A 1B1GA 4YRUA 1SMGA 1QX2A 5K89A 2O60A 2K7OA 4PHMA 1DVIA 3IQOA 1NIWA 3DVKA 3A8RA 1SL9A 3PM8A 2M7NA 1BOCA 2M1KB 5HLVA 2FOTA 4Q04A 4OCIA 1B9AA 3BOWA 1DT7B 1CDMA 2E6WA 1MR8A 4MVFA 2WCEA 3CS1A 1FBVA 1KWOB 1NSHA 3NXAA 1XO5A 1QASA 2JWWA 4R1EA 1XYDA 2PMYA 4YBHB 1DJWA 1ZOTB 2M3WA 2M97A 4HRGA 4AQIA 1SK6D 1AHRA 2F3ZA 1Y0VH 1CFDA 2WCBA 4GNKB 3VRPA 5CSIA 1QXPA 1QLSA 2ZNDA 3JTDB 2ZKMX 1BG1A 1IQ3A 1SL8A 3KEVA 2L0PA 1XFYO 2MRDA 2LC5A 2LMTA 1JFKA 3BUXB 4MSPA 5I8NA 4YGBB 1R2UA 3I5GB 5DKRA 1SCMB 1PULA 2BE6A 1NCXA 4XJKB 2LHIA 2D8NA 1HQVA 1LA3A 2NZ0A 3PALA 5J3XA 1Q80A 1BJFA 1KWOC 1KFXL 1DMOA 1TNPA 2KQ6A 1UHNA 2LAPA 1SR6B 2L4IA 4QJ3B 1WRKA 1BLQA 1KQMB 3BQ3A 3VRRA 1BF5A 4WRIA 2LM5A 1YUUA 1MUXA 3JTDC 1W7IB 1CFPA 2SASA 2HETA 2MAZA 1KFXS 4JPZB 2LUXA 3D0YB 1K9UA 1RROA 2KAXA 1A75A 1CDLA 3I5GC 1SBJA 3WHTB 1U5IB 4BY5A 1PSRA 1RECA 1SCMC 4PHJA 4A4CA 3H4SE 4HSZA 2JQ6A 1WRZA 2JT0A 5I2QA 1S26D 1WLMA 3CR2A 2G2BA 1FW4A 2I7AA 2KBMA 1QTXA 1K9KA 1SR6C 4QJ4B 1OOJA 2F2PA 2JPTA 4NDBA 1KQMC 1J1DA 3OB1B 4PHKA 1RK9A 1CFCA 3BUNB 3NSOA 4OV2A 3OHMB 2PVBA 3VRQA 4GBAA 1B4CA 4AOMA 1ODBA 3GK1A 4PHNA 1G33A 1QIVA 4YGDB 1K95A 3TS5B 2OTGB 1QIWA 2GV5A 5KU1A 2LMVA 3KF9A 4AQJA 1UURA 1UP5A 4GAOA 5CSFA 3LK0A 1LKJA 3DVEA 2K8MB 1TOPA 1IQ5A 1QS7A 3EVUA 1SYMA 2HQWA 4MEWA 1CM4A 2ZRTA 3DD4A 1B7TZ 1PSBA 1S6IA 1XFXO 1QATA 2BKHB 1EH2A 2JULA 2KFFA 1KSOA 2JXCA 4FTGA 1IWQA 2LP2A 2OPOA 3I5IB 4MZJA 1W7JB 3WHUB 1PK0D 4DUQA 1IH0A 3BUWB 1GQMA 1LXFC 1NX3A 2FCEA 1UHHA 1QX5B 3TS5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TCO B;  1NX0 A;  2L4H A;  4YGC B;  1F8H A;  1S6C A;  1N0Y A;  1F4O A;  3EK4 A;  2Q91 A;  1K8U A;  2V53 A;  3F45 A;  4YGE B;  2KBI A;  1OMD A;  4N5X A;  1UHJ A;  2E30 A;  2EHB A;  2GGZ A;  1OE9 B;  1BR4 B;  3RM1 A;  1RJV A;  2K2A A;  2LLT A;  4GFT A;  4L9M A;  1TNX A;  3BUO B;  5KSZ A;  1S5G Y;  3SG2 A;  3HCM A;  4XYN A;  3PSR A;  3D0Y A;  4GUK A;  1YX8 A;  2BCX A;  3OX6 A;  1R6P A;  4ICB A;  4MZL A;  5ER4 X;  3I5I C;  3I5F B;  1XK4 C;  4UPG A;  5JJG A;  1S6J A;  1SNL A;  1YUT A;  3HX4 A;  2NCP A;  2KAV A;  2F3Y A;  2KHN A;  2K7B A;  3JVT B;  4U8D A;  4GPL B;  2HF5 A;  4HRH A;  1NWD A;  1NX2 A;  1B8C A;  1YUR A;  2H61 C;  2CNP A;  1JF0 A;  1J55 A;  2L98 A;  2Q4U A;  3ZWH A;  3LL8 B;  1UHI A;  3IF7 A;  1A03 A;  1QX7 A;  1E8A A;  1UWO A;  3CGA A;  1BMO A;  3EK8 A;  2HQ8 A;  3PLF B;  1XA5 A;  1MWN A;  1Y1A A;  1SY9 A;  1DF0 A;  2CCM A;  1S36 A;  3IQQ A;  5TNC A;  4OR9 B;  1QV1 A;  3O2P A;  1KSM A;  4GGN A;  1NCY A;  4ZCU A;  2L50 A;  3I5F C;  1JC2 A;  1C7V A;  1NYA A;  1AVS A;  1YVH A;  3AKB A;  2WOS A;  3D10 A;  1XFZ O;  2QAC A;  1JSA A;  2CTN A;  2K7C A;  2OS8 B;  5HKW A;  1G4Y R;  4BY4 A;  1QVI Y;  2QPT A;  1NX1 A;  4PE0 A;  2P6B B;  3JVT C;  3PAT A;  4OKH A;  5CSJ A;  2M1U A;  1BU3 A;  5B8I B;  1SL7 A;  1DJZ A;  1C07 A;  4USL A;  1L7Z A;  3SG3 A;  1FI6 A;  5CSN A;  3CR4 X;  3DVM A;  4HRE E;  2ZNE A;  4A4B A;  3FWC A;  1JBA A;  1ALV A;  4MLW A;  1JWD A;  2M0R A;  1M46 A;  5DKN A;  1OMV A;  3DF0 A;  5ER5 A;  3BUM B;  3GOF A;  2TN4 A;  1D1O A;  1KK7 Y;  1NUB A;  1XK4 A;  2M29 A;  3CZT X;  1K2H A;  5JOL A;  4PDZ A;  1AK8 A;  1GJY A;  2KYC A;  5D7F A;  2L5X B;  1F54 A;  3LLE A;  2KDH A;  2OS8 C;  2WCF A;  4M2O A;  1SW8 A;  1CLM A;  3EVR A;  1A29 A;  1TNQ A;  4YGA A;  3EVV A;  4JQ0 D;  2LV7 A;  2IS9 A;  1OMR A;  1TCF A;  1WY9 A;  2EGD A;  2JOJ A;  1MF8 B;  2LHL A;  4IL1 A;  1ZMZ A;  3AKA A;  2CT9 A;  5KTY A;  1UHK A;  1GGW A;  3GK4 X;  3CR5 X;  3K21 A;  2LLU A;  4P5O E;  1MXE A;  1M39 A;  3SG7 A;  4DRW A;  5HKZ A;  2G9B A;  2DOQ A;  2ZN9 A;  1EL4 A;  2BBM A;  2LVI A;  2F2O A;  1CNP A;  1JUO A;  1QLK A;  2BEC A;  2ZN8 A;  1A2X A;  2L2E A;  1LIN A;  1M31 A;  2JTT A;  2KNE A;  1NPQ A;  2HPS A;  1JF2 A;  2JT3 A;  1N65 A;  3SIB A;  1FPW A;  2H2K A;  4I5K A;  5PAL A;  4JWQ A;  3KHE A;  2JNX A;  4C0K A;  4ORC B;  1XVJ A;  2FJU B;  2NXQ A;  1YVL A;  3O78 A;  1HT9 A;  3TDI A;  2M7L A;  4CID A;  3BYA A;  1M63 B;  4OVN F;  2LUC A;  1PRW A;  2MJW B;  3I5H B;  3ZNI A;  2OTG C;  4XJK A;  1X02 A;  1CM1 A;  1YX7 A;  1H8B A;  1CFF A;  2EC6 B;  3O4Y A;  1F71 A;  1YUS A;  5I2L A;  2ZFD A;  5D69 A;  3PN7 B;  5AEQ A;  3AAJ A;  2BL0 B;  2RGI A;  4N1F A;  1RFJ A;  1K96 A;  1AJ5 A;  2KFG A;  3SG5 A;  3TZ1 A;  2LVJ A;  2JXL A;  4MRY A;  4TNC A;  1V1F A;  1Y6W A;  4NDD A;  3BXK A;  1B8L A;  4PAL A;  1F70 A;  4N1G A;  4CPV A;  2LNK A;  1J7Q A;  2M49 B;  1FI5 A;  1VRK A;  1QV0 A;  2GGM A;  3GK2 A;  1U5I A;  4D1E A;  3I5H C;  4PE4 A;  1GGZ A;  2K2F A;  3EKJ A;  4MZK A;  4I5L B;  4C0J A;  4DCK A;  2I94 A;  4NDC A;  4CLN A;  1CDN A;  3A4U B;  1OSA A;  1RTP 1;  1EJ3 A;  2EC6 C;  2I18 A;  1IRJ A;  4ETO A;  1KK8 B;  3PN7 C;  3SG6 A;  1DJG A;  2BL0 C;  2FCD A;  1AUI B;  1UUS A;  3WXA A;  1TIZ A;  2I2R E;  3CWG A;  2MHH A;  4PE1 A;  1QJT A;  1K9P A;  2KGB C;  1K94 A;  2LMU A;  2M9G A;  1MHO A;  1AJ4 A;  3SIA A;  1K93 D;  3ICB A;  3WNX B;  1PAL A;  1YRU B;  4YI9 A;  5G08 A;  2MBX A;  5I2O A;  1S1E A;  4GGF C;  3TDU A;  2F8P A;  5F6T A;  5AFP A;  1EG4 A;  3SJS A;  1EG3 A;  1IJ5 A;  2K61 A;  1JFJ A;  2NLN A;  1H4B A;  1OZO A;  1DJH A;  2F33 A;  3E3R A;  2BE4 A;  2VRG A;  2SCP A;  2AAO A;  4F0Z B;  1DJX A;  1S5G Z;  2MLF C;  2BCA A;  2LCP A;  2Y1N A;  1KK8 C;  2KI6 D;  3EK7 A;  3QRX A;  2KOT A;  2KAY A;  1IKU A;  3OP0 A;  4M2P A;  1TN4 A;  3OX5 A;  1WDC B;  1ZAC A;  3O6B A;  3TDZ A;  1MXL C;  2KGR A;  3NSI A;  1J7P A;  1L2O B;  1V1G A;  2BBN A;  1N2D A;  1PVA A;  4M2Q A;  3DVJ A;  2MA2 A;  1AP4 A;  1LA0 A;  1J7O A;  1Y1U A;  1WLZ A;  2BKI B;  3VRN A;  3TUY B;  2JTZ A;  5HYD A;  4FQO A;  4MBE A;  1SRA A;  4I5N B;  2KFH A;  3C1V A;  5IBW A;  5HLO A;  3CTN A;  1MQ1 A;  5BPJ A;  4E68 A;  2ISD A;  1F55 A;  2JRF A;  3FIA A;  5AER A;  2LVV A;  1CLL A;  3M0W A;  2H61 A;  3BOW B;  4DIR A;  1FF1 A;  2AMI A;  2AUC A;  2M8U A;  2MLE C;  2A4J A;  4QJ5 B;  1IG5 A;  1KFU L;  1XFU O;  3CLN A;  1BR1 B;  1K90 D;  3EKH A;  4WQ2 A;  1B8R A;  2KQY A;  1B7T Y;  2BCB A;  1WDC C;  2K7D A;  1DGU A;  2B1U A;  4ORA B;  1CDP A;  1SPY A;  4PE7 A;  1L2O C;  3NSL A;  1PVB A;  3VGO A;  4CFQ A;  1A4P A;  3LCP C;  1YRT B;  2PSR A;  1OZS A;  4WQ3 A;  4MRX A;  1CB1 A;  1BOD A;  1DJI A;  1QVI Z;  1SKT A;  1NCZ A;  3RLZ A;  2K0J A;  1KFU S;  3TUY C;  4GGF A;  5DKQ A;  1IGV A;  2LE9 B;  1BT6 A;  2JT8 A;  1DTL A;  1J7R A;  2Y5I A;  1RWY A;  1WRL A;  2JNF A;  3LK1 A;  1DF0 B;  1ZFS A;  1C7W A;  1TTX A;  2WC8 A;  3VRO A;  1F4Q A;  2JU0 A;  2LAN A;  2Y1M A;  4ZCV A;  4DS7 A;  1KK7 Z;  1Y1X A;  2KSP A;  3MSE B;  2LP3 A;  2NCO A;  4YI8 A;  3PFV A;  3NSK A;  2WND A;  3FWB A;  1YR5 A;  1CKK A;  1KCY A;  2KI4 B;  5HKY A;  1G8I A;  2PAL A;  4ORB B;  1M45 A;  2O5G A;  2KYF A;  1S3P A;  4P2Y B;  1EXR A;  1XFV O;  5AAN A;  4MN0 A;  5AXI A;  2CXJ A;  1NP8 A;  4C0L A;  2PAS A;  2PRU A;  2LLS A;  1J1E A;  2COL B;  2LVK A;  3KPX A;  3AAK A;  1YTZ C;  1DJY A;  1CTR A;  1XFW O;  1ALW A;  1IJ6 A;  1CLB A;  1B47 A;  1DGV A;  3OB2 B;  1ZUZ A;  2KI6 C;  1A75 B;  1OQP A;  3FS7 A;  1SCV A;  2Y4Q A;  4CFR A;  2L51 A;  4NQG A;  5FYX A;  3KO0 A;  2R2I A;  5GQQ C;  2CBL A;  3DF0 B;  1KQV A;  1CMF A;  1CMG A;  1TNW A;  2JC2 A;  4PCW A;  1LVC D;  2JZI A;  2ZRS A;  2WOR A;  4I5J A;  2KI4 C;  1TRF A;  5CPV A;  3SG4 A;  1B1G A;  4YRU A;  1SMG A;  1QX2 A;  5K89 A;  2O60 A;  2K7O A;  4PHM A;  1DVI A;  3IQO A;  1NIW A;  3DVK A;  3A8R A;  1SL9 A;  3PM8 A;  2M7N A;  1BOC A;  2M1K B;  5HLV A;  2FOT A;  4Q04 A;  4OCI A;  1B9A A;  3BOW A;  1DT7 B;  1CDM A;  2E6W A;  1MR8 A;  4MVF A;  2WCE A;  3CS1 A;  1FBV A;  1KWO B;  1NSH A;  3NXA A;  1XO5 A;  1QAS A;  2JWW A;  4R1E A;  1XYD A;  2PMY A;  4YBH B;  1DJW A;  1ZOT B;  2M3W A;  2M97 A;  4HRG A;  4AQI A;  1SK6 D;  1AHR A;  2F3Z A;  1Y0V H;  1CFD A;  2WCB A;  4GNK B;  3VRP A;  5CSI A;  1QXP A;  1QLS A;  2ZND A;  3JTD B;  2ZKM X;  1BG1 A;  1IQ3 A;  1SL8 A;  3KEV A;  2L0P A;  1XFY O;  2MRD A;  2LC5 A;  2LMT A;  1JFK A;  3BUX B;  4MSP A;  5I8N A;  4YGB B;  1R2U A;  3I5G B;  5DKR A;  1SCM B;  1PUL A;  2BE6 A;  1NCX A;  4XJK B;  2LHI A;  2D8N A;  1HQV A;  1LA3 A;  2NZ0 A;  3PAL A;  5J3X A;  1Q80 A;  1BJF A;  1KWO C;  1KFX L;  1DMO A;  1TNP A;  2KQ6 A;  1UHN A;  2LAP A;  1SR6 B;  2L4I A;  4QJ3 B;  1WRK A;  1BLQ A;  1KQM B;  3BQ3 A;  3VRR A;  1BF5 A;  4WRI A;  2LM5 A;  1YUU A;  1MUX A;  3JTD C;  1W7I B;  1CFP A;  2SAS A;  2HET A;  2MAZ A;  1KFX S;  4JPZ B;  2LUX A;  3D0Y B;  1K9U A;  1RRO A;  2KAX A;  1A75 A;  1CDL A;  3I5G C;  1SBJ A;  3WHT B;  1U5I B;  4BY5 A;  1PSR A;  1REC A;  1SCM C;  4PHJ A;  4A4C A;  3H4S E;  4HSZ A;  2JQ6 A;  1WRZ A;  2JT0 A;  5I2Q A;  1S26 D;  1WLM A;  3CR2 A;  2G2B A;  1FW4 A;  2I7A A;  2KBM A;  1QTX A;  1K9K A;  1SR6 C;  4QJ4 B;  1OOJ A;  2F2P A;  2JPT A;  4NDB A;  1KQM C;  1J1D A;  3OB1 B;  4PHK A;  1RK9 A;  1CFC A;  3BUN B;  3NSO A;  4OV2 A;  3OHM B;  2PVB A;  3VRQ A;  4GBA A;  1B4C A;  4AOM A;  1ODB A;  3GK1 A;  4PHN A;  1G33 A;  1QIV A;  4YGD B;  1K95 A;  3TS5 B;  2OTG B;  1QIW A;  2GV5 A;  5KU1 A;  2LMV A;  3KF9 A;  4AQJ A;  1UUR A;  1UP5 A;  4GAO A;  5CSF A;  3LK0 A;  1LKJ A;  3DVE A;  2K8M B;  1TOP A;  1IQ5 A;  1QS7 A;  3EVU A;  1SYM A;  2HQW A;  4MEW A;  1CM4 A;  2ZRT A;  3DD4 A;  1B7T Z;  1PSB A;  1S6I A;  1XFX O;  1QAT A;  2BKH B;  1EH2 A;  2JUL A;  2KFF A;  1KSO A;  2JXC A;  4FTG A;  1IWQ A;  2LP2 A;  2OPO A;  3I5I B;  4MZJ A;  1W7J B;  3WHU B;  1PK0 D;  4DUQ A;  1IH0 A;  3BUW B;  1GQM A;  1LXF C;  1NX3 A;  2FCE A;  1UHH A;  1QX5 B;  3TS5 C; 
#chains in the Genus database with same CATH topology
 1TCO B;  1NX0 A;  2L4H A;  4YGC B;  1F8H A;  1S6C A;  1N0Y A;  1F4O A;  1OW4 A;  3EK4 A;  2Q91 A;  1K8U A;  2V53 A;  3F45 A;  4YGE B;  2WCL A;  2KBI A;  3CYZ A;  1OMD A;  4N5X A;  1UHJ A;  2E30 A;  2EHB A;  2GGZ A;  2PYQ A;  1TUJ A;  1C3Z A;  1OE9 B;  1BR4 B;  3RM1 A;  1RJV A;  2K2A A;  2LLT A;  4GFT A;  4L9M A;  1TNX A;  3BUO B;  5KSZ A;  1S5G Y;  1DC1 A;  3SG2 A;  3HCM A;  4XYN A;  3PSR A;  3D0Y A;  4GUK A;  1YX8 A;  2BCX A;  3CZ2 A;  1R6P A;  3OX6 A;  4ICB A;  4MZL A;  5ER4 X;  3I5I C;  3I5F B;  1XK4 C;  4UPG A;  5JJG A;  3SS4 A;  1S6J A;  3DXL A;  1TUZ A;  3VB1 A;  3B6X A;  1SNL A;  1YUT A;  3HX4 A;  2NCP A;  2KAV A;  2F3Y A;  2KHN A;  2K7B A;  3JVT B;  4U8D A;  4GPL B;  2HF5 A;  4HRH A;  1NWD A;  1NX2 A;  1B8C A;  1YUR A;  2H61 C;  2CNP A;  4JKT A;  1JF0 A;  1J55 A;  2L98 A;  2Q4U A;  2KLE A;  3LL8 B;  1UHI A;  3IF7 A;  3ZWH A;  1A03 A;  1QX7 A;  1E8A A;  1UWO A;  3CGA A;  1BMO A;  3EK8 A;  2HQ8 A;  3B86 A;  3PLF B;  1XA5 A;  1MWN A;  1Y1A A;  1SY9 A;  1DF0 A;  2CCM A;  1S36 A;  3IQQ A;  5TNC A;  4OR9 B;  1OOG A;  1QV1 A;  4OZD A;  3O2P A;  1KSM A;  1IIO A;  4GGN A;  1NCY A;  4ZCU A;  2L50 A;  3I5F C;  1JC2 A;  1C7V A;  1NYA A;  1AVS A;  1YVH A;  3AKB A;  2WOS A;  3D10 A;  1XFZ O;  2QAC A;  1JSA A;  2CTN A;  2K7C A;  2OS8 B;  5HKW A;  1G4Y R;  4BY4 A;  1QVI Y;  2QPT A;  1NX1 A;  4PE0 A;  2P6B B;  3JVT C;  3PAT A;  4OKH A;  5CSJ A;  2M1U A;  1BU3 A;  5B8I B;  1SL7 A;  1DJZ A;  1C07 A;  3DZT A;  1L7Z A;  4USL A;  3SG3 A;  5CSN A;  1TWO A;  1FI6 A;  3CR4 X;  2WC5 A;  3DVM A;  4HRE E;  2ZNE A;  5FI2 A;  3FWC A;  4A4B A;  1JBA A;  1ALV A;  4MLW A;  1JWD A;  3SS3 A;  2M0R A;  1M46 A;  3DYE A;  3Q8I A;  5DKN A;  1OMV A;  3DF0 A;  5ER5 A;  3BUM B;  3GOF A;  2TN4 A;  1D1O A;  1KK7 Y;  1NUB A;  1XK4 A;  2M29 A;  3CZT X;  3R72 A;  1K2H A;  5JOL A;  1DEL A;  4PDZ A;  2GTE A;  1T14 A;  2QDI A;  1AK8 A;  1GJY A;  2KYC A;  5D7F A;  2L5X B;  1F54 A;  3LLE A;  2KDH A;  2OS8 C;  2WCF A;  4M2O A;  1SW8 A;  1CLM A;  3CDN A;  4FQT A;  3EVR A;  1A29 A;  1TNQ A;  4YGA A;  5DIC A;  3EVV A;  4F7F A;  3UNW A;  4JQ0 D;  2LV7 A;  2IS9 A;  1OMR A;  1TCF A;  1WY9 A;  2EGD A;  2JOJ A;  1MF8 B;  2LHL A;  4IL1 A;  1ZMZ A;  3AKA A;  2CT9 A;  3R1P A;  5KTY A;  1UHK A;  1GGW A;  3GK4 X;  3CR5 X;  3K21 A;  2LLU A;  1ORG A;  1MXE A;  1M39 A;  4P5O E;  3SG7 A;  5HKZ A;  2G9B A;  2DOQ A;  2ZN9 A;  1EL4 A;  2BBM A;  2LVI A;  2F2O A;  1CNP A;  1JUO A;  1QLK A;  2BEC A;  2ZN8 A;  1C3Y A;  1A2X A;  2L2E A;  1LIN A;  1M31 A;  2JTT A;  2KNE A;  1NPQ A;  2HPS A;  3DY9 A;  1JF2 A;  2JT3 A;  3S0D A;  1N65 A;  3L47 A;  3SIB A;  1FPW A;  2H2K A;  4I5K A;  5PAL A;  4JWQ A;  3KHE A;  2JNX A;  4C0K A;  4ORC B;  1XVJ A;  2FJU B;  2NXQ A;  1YVL A;  3O78 A;  1HT9 A;  3NHI A;  3TDI A;  2M7L A;  4CID A;  3BYA A;  1M63 B;  4OVN F;  2QEV A;  2LUC A;  1PRW A;  2KLD A;  2MJW B;  3I5H B;  3ZNI A;  1SSE B;  2OTG C;  4XJK A;  1X02 A;  1CM1 A;  1YX7 A;  1H8B A;  1CFF A;  2EC6 B;  3O4Y A;  1F71 A;  1YUS A;  5I2L A;  2ZFD A;  5D69 A;  3PN7 B;  5AEQ A;  3AAJ A;  2BL0 B;  2RGI A;  4N1F A;  1RFJ A;  1K96 A;  1AJ5 A;  2KFG A;  3SG5 A;  3TZ1 A;  2LVJ A;  2L2C A;  2JXL A;  4MRY A;  2WCK A;  4TNC A;  3BJH A;  1V1F A;  1Y6W A;  4NDD A;  3BXK A;  1B8L A;  4PAL A;  1F70 A;  4N1G A;  4CPV A;  2LNK A;  3BFH A;  2M49 B;  3EG5 B;  1J7Q A;  1FI5 A;  1VRK A;  1QV0 A;  2GGM A;  3GK2 A;  1U5I A;  4D1E A;  3V2L A;  3I5H C;  4PE4 A;  1GGZ A;  2K2F A;  3EKJ A;  4MZK A;  4I5L B;  4C0J A;  4DCK A;  2I94 A;  4NDC A;  4CLN A;  1CDN A;  3A4U B;  3D75 A;  1OSA A;  1RTP 1;  1EJ3 A;  2EC6 C;  2I18 A;  1IRJ A;  4ETO A;  1KK8 B;  3PN7 C;  3SG6 A;  1DJG A;  2BL0 C;  2FCD A;  1AUI B;  1UUS A;  3WXA A;  1TIZ A;  2I2R E;  3CWG A;  2MHH A;  3FE6 A;  4PE1 A;  1QJT A;  1K9P A;  2KGB C;  1K94 A;  2LMU A;  2M9G A;  1MHO A;  1AJ4 A;  1OOI X;  2K60 A;  3SIA A;  1K93 D;  3NHT A;  3S0G A;  3ICB A;  3FE8 A;  3PM2 A;  3WNX B;  1PAL A;  1YRU B;  4YI9 A;  2WC6 A;  5G08 A;  2MBX A;  1S1E A;  5I2O A;  5FI6 A;  4GGF C;  3TDU A;  2F8P A;  5F6T A;  5AFP A;  1EG4 A;  3SJS A;  1EG3 A;  1IJ5 A;  2K61 A;  1JFJ A;  2NLN A;  1H4B A;  1OZO A;  1DJH A;  2F33 A;  3E3R A;  2BE4 A;  2VRG A;  2SCP A;  2AAO A;  4F0Z B;  1DJX A;  1S5G Z;  2MLF C;  2BCA A;  2LCP A;  2Y1N A;  1KK8 C;  2KI6 D;  3EK7 A;  3QRX A;  2KOT A;  2KAY A;  1IKU A;  3OP0 A;  4M2P A;  1TN4 A;  3OX5 A;  1WDC B;  1ZAC A;  3O6B A;  3TDZ A;  1MXL C;  2KGR A;  3NSI A;  1J7P A;  1L2O B;  1V1G A;  2BBN A;  1N2D A;  1PVA A;  4M2Q A;  3DVJ A;  2MA2 A;  1AP4 A;  1LA0 A;  1J7O A;  1Y1U A;  1WLZ A;  2BKI B;  3L4L A;  3VRN A;  3TUY B;  3S0A A;  2JTZ A;  5EL2 A;  5HYD A;  4FQO A;  4MBE A;  1SRA A;  4I5N B;  2KFH A;  3C1V A;  2WCJ A;  5IBW A;  5HLO A;  1LS8 A;  1MQ1 A;  3CTN A;  1Z2C B;  2ISD A;  5BPJ A;  4E68 A;  2JRF A;  3D73 A;  3FIA A;  5AER A;  3B7A A;  2LVV A;  1CLL A;  3M0W A;  2H61 A;  3BOW B;  4DIR A;  1FF1 A;  2AMI A;  2AUC A;  2M8U A;  2MLE C;  2A4J A;  4QJ5 B;  1IG5 A;  1KFU L;  1XFU O;  3CLN A;  1BR1 B;  1K90 D;  3EKH A;  4WQ2 A;  1B8R A;  2KQY A;  1B7T Y;  2BCB A;  1WDC C;  2K7D A;  1DGU A;  2B1U A;  4ORA B;  1CDP A;  1SPY A;  3S0E A;  4PE7 A;  1L2O C;  3NSL A;  1PVB A;  3VGO A;  4CFQ A;  1A4P A;  3LCP C;  1YRT B;  2PSR A;  1OZS A;  4WQ3 A;  4MRX A;  1CB1 A;  1BOD A;  1DJI A;  1QVI Z;  1SKT A;  1NCZ A;  3CZ0 A;  3RLZ A;  2K0J A;  1KFU S;  3TUY C;  4GGF A;  5DKQ A;  1IGV A;  3D77 A;  2LE9 B;  1BT6 A;  2JPO A;  2JT8 A;  1DTL A;  3CAB A;  1J7R A;  2Y5I A;  1RWY A;  1WRL A;  2JNF A;  3LK1 A;  1DEK A;  1DF0 B;  1ZFS A;  1C7W A;  1TTX A;  2WC8 A;  3D76 A;  1F4Q A;  2FJY A;  3VRO A;  2JU0 A;  2LAN A;  2Y1M A;  4ZCV A;  4DS7 A;  1KK7 Z;  1Y1X A;  2KSP A;  3MSE B;  2LP3 A;  2NCO A;  2WCH A;  3PFV A;  2BNX A;  1W9Z A;  2WND A;  3NSK A;  3FWB A;  1YR5 A;  3O4X A;  4YI8 A;  1CKK A;  2KI4 B;  5HKY A;  1KCY A;  1G8I A;  2PAL A;  4ORB B;  1M45 A;  2O5G A;  2KYF A;  1S3P A;  4P2Y B;  1EXR A;  1XFV O;  5AAN A;  4MN0 A;  5AXI A;  2CXJ A;  1NP8 A;  4C0L A;  2PAS A;  2PRU A;  2LLS A;  1J1E A;  2COL B;  1OOH A;  2LVK A;  3D74 A;  3FE9 A;  3AAK A;  1YTZ C;  3KPX A;  1DJY A;  2BAP A;  1CTR A;  1XFW O;  1ALW A;  1IJ6 A;  1CLB A;  1B47 A;  1DGV A;  3OB2 B;  1ZUZ A;  2KI6 C;  2P71 A;  1A75 B;  1OQP A;  3FS7 A;  1SCV A;  2Y4Q A;  2P70 A;  2L51 A;  4CFR A;  4NQG A;  5FYX A;  3KO0 A;  2R2I A;  5GQQ C;  2CBL A;  3DF0 B;  1KQV A;  1CMF A;  1CMG A;  1TNW A;  2JC2 A;  3BFA A;  4PCW A;  5HL1 A;  1LVC D;  2JZI A;  3OBV A;  2ZRS A;  2WOR A;  4I5J A;  2KI4 C;  1TRF A;  5CPV A;  3SG4 A;  1B1G A;  2L5Y A;  4YRU A;  1SMG A;  1QX2 A;  5K89 A;  2O60 A;  2K7O A;  4KYN A;  4PHM A;  1DVI A;  4PT1 A;  3IQO A;  1NIW A;  1P28 A;  3DVK A;  3A8R A;  1SL9 A;  3PM8 A;  2M7N A;  1BOC A;  2M1K B;  5HLV A;  2FOT A;  4Q04 A;  4OCI A;  1B9A A;  3NGV A;  3BOW A;  1DT7 B;  1CDM A;  2E6W A;  1MR8 A;  4MVF A;  2WCE A;  1XFR A;  2QEH A;  3CS1 A;  1FBV A;  3R1O A;  1KWO B;  1NSH A;  3NXA A;  1XO5 A;  3B88 A;  1QAS A;  2JWW A;  3D78 A;  1XYD A;  2PMY A;  3QME A;  3R1V A;  4R1E A;  4YBH B;  1DJW A;  1ZOT B;  1GM0 A;  2M3W A;  2M97 A;  4HRG A;  4AQI A;  1SK6 D;  1AHR A;  2F3Z A;  3L4A A;  1Y0V H;  1CFD A;  2WCB A;  4GNK B;  3VRP A;  5CSI A;  1QXP A;  1QLS A;  2KPH A;  2ZND A;  2ZKM X;  3JTD B;  1BG1 A;  1IQ3 A;  1SL8 A;  3BFB A;  3KEV A;  3SS5 A;  2L0P A;  1XFY O;  2MRD A;  2LC5 A;  2LMT A;  1JFK A;  3BUX B;  4MSP A;  5I8N A;  4YGB B;  1R2U A;  3I5G B;  5DKR A;  1SCM B;  1PUL A;  2BE6 A;  1NCX A;  4XJK B;  2LHI A;  2D8N A;  2PQL A;  4DRW A;  1HQV A;  1LA3 A;  2NZ0 A;  3PAL A;  5D3O A;  1Q80 A;  1BJF A;  5FI7 A;  3IVT A;  5J3X A;  3PJI A;  1KWO C;  1KFX L;  1DMO A;  1TNP A;  2KQ6 A;  1UHN A;  2LAP A;  1SR6 B;  2L4I A;  4QJ3 B;  1WRK A;  1BLQ A;  4INX A;  1KQM B;  3BQ3 A;  3VRR A;  1BF5 A;  4WRI A;  2LM5 A;  3K1E A;  1YUU A;  1MUX A;  3JTD C;  1W7I B;  3OGN A;  1CFP A;  3S0B A;  2SAS A;  2HET A;  2MAZ A;  1KFX S;  4JPZ B;  2LUX A;  3D0Y B;  1K9U A;  1RRO A;  2KAX A;  1A75 A;  1CDL A;  2H8V A;  3I5G C;  1SBJ A;  3WHT B;  1U5I B;  4BY5 A;  1PSR A;  1REC A;  1SCM C;  3S0F A;  4PHJ A;  4A4C A;  3H4S E;  2ERB A;  4HSZ A;  2JQ6 A;  1WRZ A;  2QEO A;  2JT0 A;  1OOF A;  5I2Q A;  1S26 D;  1WLM A;  3CR2 A;  2G2B A;  1DQE A;  1FW4 A;  2I7A A;  2KBM A;  1QTX A;  1K9K A;  5I94 A;  1SR6 C;  3CZ1 A;  2QEB A;  4QJ4 B;  1OOJ A;  1Z4H A;  2F2P A;  2JPT A;  4NDB A;  1KQM C;  1J1D A;  3OB1 B;  4PHK A;  1RK9 A;  1CFC A;  3BUN B;  3NSO A;  4OV2 A;  3OHM B;  1QWV A;  2PVB A;  3VRQ A;  4GBA A;  3RZS A;  3B87 A;  1ODB A;  4AOM A;  1B4C A;  3GK1 A;  4PHN A;  1G33 A;  1QIV A;  4YGD B;  1K95 A;  3TS5 B;  2OTG B;  3UO9 A;  3N7H A;  1QIW A;  2GV5 A;  5KU1 A;  2LMV A;  3KF9 A;  4AQJ A;  1UUR A;  1UP5 A;  4GAO A;  5CSF A;  3LK0 A;  1LKJ A;  3DVE A;  2K8M B;  1TOP A;  1IQ5 A;  1QS7 A;  3EVU A;  4INW A;  1SYM A;  2HQW A;  2YGU A;  4MEW A;  1CM4 A;  2ZRT A;  3DD4 A;  1B7T Z;  4JD9 A;  1PSB A;  1S6I A;  1XFX O;  1QAT A;  2BKH B;  4IJ7 A;  1EH2 A;  2JUL A;  2KFF A;  1KSO A;  2JXC A;  4FTG A;  1IWQ A;  1F55 A;  2LP2 A;  2OPO A;  3I5I B;  4MZJ A;  1W7J B;  3WHU B;  1PK0 D;  4DUQ A;  1IH0 A;  3BUW B;  1GQM A;  1LXF C;  1NX3 A;  2FCE A;  1UHH A;  1QX5 B;  2WCM A;  3TS5 C; 
#chains in the Genus database with same CATH homology
 1TCO B;  1NX0 A;  2L4H A;  4YGC B;  1F8H A;  1S6C A;  1N0Y A;  1F4O A;  3EK4 A;  2Q91 A;  1K8U A;  2V53 A;  3F45 A;  4YGE B;  2KBI A;  1OMD A;  4N5X A;  1UHJ A;  2E30 A;  2EHB A;  2GGZ A;  1OE9 B;  1BR4 B;  3RM1 A;  1RJV A;  2K2A A;  2LLT A;  4GFT A;  4L9M A;  1TNX A;  3BUO B;  5KSZ A;  1S5G Y;  3SG2 A;  3HCM A;  4XYN A;  3PSR A;  3D0Y A;  4GUK A;  1YX8 A;  2BCX A;  3OX6 A;  1R6P A;  4ICB A;  4MZL A;  5ER4 X;  3I5I C;  3I5F B;  1XK4 C;  4UPG A;  5JJG A;  1S6J A;  1SNL A;  1YUT A;  3HX4 A;  2NCP A;  2KAV A;  2F3Y A;  2KHN A;  2K7B A;  3JVT B;  4U8D A;  4GPL B;  2HF5 A;  4HRH A;  1NWD A;  1NX2 A;  1B8C A;  1YUR A;  2H61 C;  2CNP A;  1JF0 A;  1J55 A;  2L98 A;  2Q4U A;  3ZWH A;  3LL8 B;  1UHI A;  3IF7 A;  1A03 A;  1QX7 A;  1E8A A;  1UWO A;  3CGA A;  1BMO A;  3EK8 A;  2HQ8 A;  3PLF B;  1XA5 A;  1MWN A;  1Y1A A;  1SY9 A;  1DF0 A;  2CCM A;  1S36 A;  3IQQ A;  5TNC A;  4OR9 B;  1QV1 A;  3O2P A;  1KSM A;  4GGN A;  1NCY A;  4ZCU A;  2L50 A;  3I5F C;  1JC2 A;  1C7V A;  1NYA A;  1AVS A;  1YVH A;  3AKB A;  2WOS A;  3D10 A;  1XFZ O;  2QAC A;  1JSA A;  2CTN A;  2K7C A;  2OS8 B;  5HKW A;  1G4Y R;  4BY4 A;  1QVI Y;  2QPT A;  1NX1 A;  4PE0 A;  2P6B B;  3JVT C;  3PAT A;  4OKH A;  5CSJ A;  2M1U A;  1BU3 A;  5B8I B;  1SL7 A;  1DJZ A;  1C07 A;  4USL A;  1L7Z A;  3SG3 A;  1FI6 A;  5CSN A;  3CR4 X;  3DVM A;  4HRE E;  2ZNE A;  4A4B A;  3FWC A;  1JBA A;  1ALV A;  4MLW A;  1JWD A;  2M0R A;  1M46 A;  5DKN A;  1OMV A;  3DF0 A;  5ER5 A;  3BUM B;  3GOF A;  2TN4 A;  1D1O A;  1KK7 Y;  1NUB A;  1XK4 A;  2M29 A;  3CZT X;  1K2H A;  5JOL A;  4PDZ A;  1AK8 A;  1GJY A;  2KYC A;  5D7F A;  2L5X B;  1F54 A;  3LLE A;  2KDH A;  2OS8 C;  2WCF A;  4M2O A;  1SW8 A;  1CLM A;  3EVR A;  1A29 A;  1TNQ A;  4YGA A;  3EVV A;  4JQ0 D;  2LV7 A;  2IS9 A;  1OMR A;  1TCF A;  1WY9 A;  2EGD A;  2JOJ A;  1MF8 B;  2LHL A;  4IL1 A;  1ZMZ A;  3AKA A;  2CT9 A;  5KTY A;  1UHK A;  1GGW A;  3GK4 X;  3CR5 X;  3K21 A;  2LLU A;  4P5O E;  1MXE A;  1M39 A;  3SG7 A;  4DRW A;  5HKZ A;  2G9B A;  2DOQ A;  2ZN9 A;  1EL4 A;  2BBM A;  2LVI A;  2F2O A;  1CNP A;  1JUO A;  1QLK A;  2BEC A;  2ZN8 A;  1A2X A;  2L2E A;  1LIN A;  1M31 A;  2JTT A;  2KNE A;  1NPQ A;  2HPS A;  1JF2 A;  2JT3 A;  1N65 A;  3SIB A;  1FPW A;  2H2K A;  4I5K A;  5PAL A;  4JWQ A;  3KHE A;  2JNX A;  4C0K A;  4ORC B;  1XVJ A;  2FJU B;  2NXQ A;  1YVL A;  3O78 A;  1HT9 A;  3TDI A;  2M7L A;  4CID A;  3BYA A;  1M63 B;  4OVN F;  2LUC A;  1PRW A;  2MJW B;  3I5H B;  3ZNI A;  2OTG C;  4XJK A;  1X02 A;  1CM1 A;  1YX7 A;  1H8B A;  1CFF A;  2EC6 B;  3O4Y A;  1F71 A;  1YUS A;  5I2L A;  2ZFD A;  5D69 A;  3PN7 B;  5AEQ A;  3AAJ A;  2BL0 B;  2RGI A;  4N1F A;  1RFJ A;  1K96 A;  1AJ5 A;  2KFG A;  3SG5 A;  3TZ1 A;  2LVJ A;  2JXL A;  4MRY A;  4TNC A;  1V1F A;  1Y6W A;  4NDD A;  3BXK A;  1B8L A;  4PAL A;  1F70 A;  4N1G A;  4CPV A;  2LNK A;  1J7Q A;  2M49 B;  1FI5 A;  1VRK A;  1QV0 A;  2GGM A;  3GK2 A;  1U5I A;  4D1E A;  3I5H C;  4PE4 A;  1GGZ A;  2K2F A;  3EKJ A;  4MZK A;  4I5L B;  4C0J A;  4DCK A;  2I94 A;  4NDC A;  4CLN A;  1CDN A;  3A4U B;  1OSA A;  1RTP 1;  1EJ3 A;  2EC6 C;  2I18 A;  1IRJ A;  4ETO A;  1KK8 B;  3PN7 C;  3SG6 A;  1DJG A;  2BL0 C;  2FCD A;  1AUI B;  1UUS A;  3WXA A;  1TIZ A;  2I2R E;  3CWG A;  2MHH A;  4PE1 A;  1QJT A;  1K9P A;  2KGB C;  1K94 A;  2LMU A;  2M9G A;  1MHO A;  1AJ4 A;  3SIA A;  1K93 D;  3ICB A;  3WNX B;  1PAL A;  1YRU B;  4YI9 A;  5G08 A;  2MBX A;  5I2O A;  1S1E A;  4GGF C;  3TDU A;  2F8P A;  5F6T A;  5AFP A;  1EG4 A;  3SJS A;  1EG3 A;  1IJ5 A;  2K61 A;  1JFJ A;  2NLN A;  1H4B A;  1OZO A;  1DJH A;  2F33 A;  3E3R A;  2BE4 A;  2VRG A;  2SCP A;  2AAO A;  4F0Z B;  1DJX A;  1S5G Z;  2MLF C;  2BCA A;  2LCP A;  2Y1N A;  1KK8 C;  2KI6 D;  3EK7 A;  3QRX A;  2KOT A;  2KAY A;  1IKU A;  3OP0 A;  4M2P A;  1TN4 A;  3OX5 A;  1WDC B;  1ZAC A;  3O6B A;  3TDZ A;  1MXL C;  2KGR A;  3NSI A;  1J7P A;  1L2O B;  1V1G A;  2BBN A;  1N2D A;  1PVA A;  4M2Q A;  3DVJ A;  2MA2 A;  1AP4 A;  1LA0 A;  1J7O A;  1Y1U A;  1WLZ A;  2BKI B;  3VRN A;  3TUY B;  2JTZ A;  5HYD A;  4FQO A;  4MBE A;  1SRA A;  4I5N B;  2KFH A;  3C1V A;  5IBW A;  5HLO A;  3CTN A;  1MQ1 A;  5BPJ A;  4E68 A;  2ISD A;  1F55 A;  2JRF A;  3FIA A;  5AER A;  2LVV A;  1CLL A;  3M0W A;  2H61 A;  3BOW B;  4DIR A;  1FF1 A;  2AMI A;  2AUC A;  2M8U A;  2MLE C;  2A4J A;  4QJ5 B;  1IG5 A;  1KFU L;  1XFU O;  3CLN A;  1BR1 B;  1K90 D;  3EKH A;  4WQ2 A;  1B8R A;  2KQY A;  1B7T Y;  2BCB A;  1WDC C;  2K7D A;  1DGU A;  2B1U A;  4ORA B;  1CDP A;  1SPY A;  4PE7 A;  1L2O C;  3NSL A;  1PVB A;  3VGO A;  4CFQ A;  1A4P A;  3LCP C;  1YRT B;  2PSR A;  1OZS A;  4WQ3 A;  4MRX A;  1CB1 A;  1BOD A;  1DJI A;  1QVI Z;  1SKT A;  1NCZ A;  3RLZ A;  2K0J A;  1KFU S;  3TUY C;  4GGF A;  5DKQ A;  1IGV A;  2LE9 B;  1BT6 A;  2JT8 A;  1DTL A;  1J7R A;  2Y5I A;  1RWY A;  1WRL A;  2JNF A;  3LK1 A;  1DF0 B;  1ZFS A;  1C7W A;  1TTX A;  2WC8 A;  3VRO A;  1F4Q A;  2JU0 A;  2LAN A;  2Y1M A;  4ZCV A;  4DS7 A;  1KK7 Z;  1Y1X A;  2KSP A;  3MSE B;  2LP3 A;  2NCO A;  4YI8 A;  3PFV A;  3NSK A;  2WND A;  3FWB A;  1YR5 A;  1CKK A;  1KCY A;  2KI4 B;  5HKY A;  1G8I A;  2PAL A;  4ORB B;  1M45 A;  2O5G A;  2KYF A;  1S3P A;  4P2Y B;  1EXR A;  1XFV O;  5AAN A;  4MN0 A;  5AXI A;  2CXJ A;  1NP8 A;  4C0L A;  2PAS A;  2PRU A;  2LLS A;  1J1E A;  2COL B;  2LVK A;  3KPX A;  3AAK A;  1YTZ C;  1DJY A;  1CTR A;  1XFW O;  1ALW A;  1IJ6 A;  1CLB A;  1B47 A;  1DGV A;  3OB2 B;  1ZUZ A;  2KI6 C;  1A75 B;  1OQP A;  3FS7 A;  1SCV A;  2Y4Q A;  4CFR A;  2L51 A;  4NQG A;  5FYX A;  3KO0 A;  2R2I A;  5GQQ C;  2CBL A;  3DF0 B;  1KQV A;  1CMF A;  1CMG A;  1TNW A;  2JC2 A;  4PCW A;  1LVC D;  2JZI A;  2ZRS A;  2WOR A;  4I5J A;  2KI4 C;  1TRF A;  5CPV A;  3SG4 A;  1B1G A;  4YRU A;  1SMG A;  1QX2 A;  5K89 A;  2O60 A;  2K7O A;  4PHM A;  1DVI A;  3IQO A;  1NIW A;  3DVK A;  3A8R A;  1SL9 A;  3PM8 A;  2M7N A;  1BOC A;  2M1K B;  5HLV A;  2FOT A;  4Q04 A;  4OCI A;  1B9A A;  3BOW A;  1DT7 B;  1CDM A;  2E6W A;  1MR8 A;  4MVF A;  2WCE A;  3CS1 A;  1FBV A;  1KWO B;  1NSH A;  3NXA A;  1XO5 A;  1QAS A;  2JWW A;  4R1E A;  1XYD A;  2PMY A;  4YBH B;  1DJW A;  1ZOT B;  2M3W A;  2M97 A;  4HRG A;  4AQI A;  1SK6 D;  1AHR A;  2F3Z A;  1Y0V H;  1CFD A;  2WCB A;  4GNK B;  3VRP A;  5CSI A;  1QXP A;  1QLS A;  2ZND A;  3JTD B;  2ZKM X;  1BG1 A;  1IQ3 A;  1SL8 A;  3KEV A;  2L0P A;  1XFY O;  2MRD A;  2LC5 A;  2LMT A;  1JFK A;  3BUX B;  4MSP A;  5I8N A;  4YGB B;  1R2U A;  3I5G B;  5DKR A;  1SCM B;  1PUL A;  2BE6 A;  1NCX A;  4XJK B;  2LHI A;  2D8N A;  1HQV A;  1LA3 A;  2NZ0 A;  3PAL A;  5J3X A;  1Q80 A;  1BJF A;  1KWO C;  1KFX L;  1DMO A;  1TNP A;  2KQ6 A;  1UHN A;  2LAP A;  1SR6 B;  2L4I A;  4QJ3 B;  1WRK A;  1BLQ A;  1KQM B;  3BQ3 A;  3VRR A;  1BF5 A;  4WRI A;  2LM5 A;  1YUU A;  1MUX A;  3JTD C;  1W7I B;  1CFP A;  2SAS A;  2HET A;  2MAZ A;  1KFX S;  4JPZ B;  2LUX A;  3D0Y B;  1K9U A;  1RRO A;  2KAX A;  1A75 A;  1CDL A;  3I5G C;  1SBJ A;  3WHT B;  1U5I B;  4BY5 A;  1PSR A;  1REC A;  1SCM C;  4PHJ A;  4A4C A;  3H4S E;  4HSZ A;  2JQ6 A;  1WRZ A;  2JT0 A;  5I2Q A;  1S26 D;  1WLM A;  3CR2 A;  2G2B A;  1FW4 A;  2I7A A;  2KBM A;  1QTX A;  1K9K A;  1SR6 C;  4QJ4 B;  1OOJ A;  2F2P A;  2JPT A;  4NDB A;  1KQM C;  1J1D A;  3OB1 B;  4PHK A;  1RK9 A;  1CFC A;  3BUN B;  3NSO A;  4OV2 A;  3OHM B;  2PVB A;  3VRQ A;  4GBA A;  1B4C A;  4AOM A;  1ODB A;  3GK1 A;  4PHN A;  1G33 A;  1QIV A;  4YGD B;  1K95 A;  3TS5 B;  2OTG B;  1QIW A;  2GV5 A;  5KU1 A;  2LMV A;  3KF9 A;  4AQJ A;  1UUR A;  1UP5 A;  4GAO A;  5CSF A;  3LK0 A;  1LKJ A;  3DVE A;  2K8M B;  1TOP A;  1IQ5 A;  1QS7 A;  3EVU A;  1SYM A;  2HQW A;  4MEW A;  1CM4 A;  2ZRT A;  3DD4 A;  1B7T Z;  1PSB A;  1S6I A;  1XFX O;  1QAT A;  2BKH B;  1EH2 A;  2JUL A;  2KFF A;  1KSO A;  2JXC A;  4FTG A;  1IWQ A;  2LP2 A;  2OPO A;  3I5I B;  4MZJ A;  1W7J B;  3WHU B;  1PK0 D;  4DUQ A;  1IH0 A;  3BUW B;  1GQM A;  1LXF C;  1NX3 A;  2FCE A;  1UHH A;  1QX5 B;  3TS5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...