2LLTA

Post-translational s-nitrosylation is an endogenous factor fine-tuning human s100a1 protein properties
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
93
structure length
92
Chain Sequence
b'GSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVANNFFWENS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-A1
publication title Post-translational S-Nitrosylation Is an Endogenous Factor Fine Tuning the Properties of Human S100A1 Protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 37
structure length 92
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2lltA00
3PSRA 3BUMB 3SIAA 1WY9A 1KCYA 3IQQA 4OVNF 1TNWA 1CMGA 2QPTA 2F3YA 3VRPA 4NDCA 1QVIY 1QATA 3A4UB 4CFQA 3SG2A 3KO0A 4D1EA 1K93D 1PRWA 1YX8A 1LKJA 3WHUB 3PATA 2OS8C 3PN7B 2KFGA 1F55A 2GGZA 3BUWB 2L98A 1DMOA 1KFXL 4YGBB 1RK9A 1V1GA 2MAZA 2JWWA 3VRRA 2A4JA 2ZFDA 4CLNA 1FI5A 1SCVA 1M45A 2KNEA 2L51A 1OOJA 1YVLA 3JTDB 1CDLA 2BE6A 1EJ3A 2I94A 1KQMB 1S1EA 2OPOA 1JWDA 1NPQA 1DJHA 1BU3A 3OX5A 1XA5A 5CSIA 1B47A 2KGRA 2QACA 2ZRTA 3KEVA 3TDIA 2NXQA 3I5FB 3CLNA 1Y1UA 5IBWA 2PALA 2P6BB 3C1VA 1TNXA 1TRFA 2MJWB 4GNKB 1YUSA 3D0YA 3SG4A 4BY4A 1NUBA 1DGUA 2KFFA 2LLUA 2WC8A 4GGNA 1SYMA 2WCFA 5HKWA 3RM1A 1OE9B 3D0YB 3BOWA 4MSPA 3NSIA 1QS7A 3TS5B 2VRGA 4MZJA 1MR8A 1MQ1A 2KAYA 1A2XA 3RLZA 4I5KA 2GGMA 4N5XA 4PCWA 5HLOA 1BMOA 1BLQA 1RECA 3CR4X 2DOQA 4M2OA 4M2PA 1NX3A 2BCXA 2CNPA 4A4CA 3I5GC 1JFJA 2M0RA 5ER5A 3TUYB 1IH0A 1SCMC 1KFUL 1YUUA 2F2OA 1RTP1 2K61A 1CFPA 1G33A 1EH2A 1TCFA 1M31A 1IKUA 1LA3A 1TIZA 2OTGB 3CGAA 1JFKA 2Y4QA 2KDHA 1BT6A 1F4OA 1PK0D 4BY5A 1CM1A 1UHIA 3LL8B 2JNFA 3EK7A 2WCEA 5AFPA 2R2IA 2ZKMX 2L50A 4PE4A 1L2OC 3CTNA 1ZMZA 4DRWA 4GAOA 1F54A 2KFHA 1OSAA 4U8DA 1SKTA 1E8AA 1B1GA 2Y1MA 3H4SE 3LK0A 2CTNA 3AKBA 1CKKA 2LMVA 4XJKB 5ER4X 1SMGA 1QX5B 1K2HA 2BBNA 1Y1AA 2Y1NA 1NX1A 3SG3A 2M9GA 1TNQA 1KQVA 3IF7A 4YGEB 2JRFA 2LNKA 4PALA 2LUCA 1K9KA 1F71A 1OMRA 2L5XB 2LE9B 3K21A 3PN7C 3SG7A 2JT8A 3GK2A 2H61C 2CT9A 3AAJA 1AHRA 1SL8A 2KHNA 1LINA 2MRDA 2COLB 1ODBA 2HF5A 4PE7A 1AK8A 1QTXA 4MLWA 1B4CA 1JBAA 1NIWA 2LVVA 3EKHA 4GUKA 5CSFA 4GGFC 4AQJA 1J7PA 1A4PA 4WQ3A 1K94A 1MXEA 1Q80A 5JJGA 1BODA 4C0LA 2LLSA 2KBMA 3BUNB 1TN4A 2O60A 3GK4X 4P5OE 3NSOA 4AQIA 1NCXA 2MA2A 4OCIA 1OMDA 2KI4B 4WRIA 1MUXA 2CBLA 1N0YA 2KBIA 4OR9B 4N1GA 1SR6B 4QJ5B 1ZUZA 3TDUA 4N1FA 2LHIA 1TTXA 4C0JA 2K7CA 2JU0A 1B7TZ 3GOFA 5HYDA 1QV0A 3VGOA 1SPYA 2HETA 4MEWA 3SIBA 3TS5C 1MF8B 2KSPA 1QXPA 4DS7A 5FYXA 2LVJA 5D7FA 2H61A 1CLBA 5I2OA 4TNCA 5D69A 4WQ2A 1GGWA 3LK1A 2NLNA 1BOCA 2L4IA 3VRQA 2CXJA 1B8LA 1TNPA 2PMYA 2LMUA 2SCPA 2K2FA 3TZ1A 4FQOA 3TUYC 4GGFA 1SBJA 2K7DA 4ZCUA 5I2LA 1LVCD 3D10A 1CDNA 2JC2A 4GPLB 1S36A 2KAXA 1CDMA 1XO5A 2OTGC 1C07A 1KWOC 3OB2B 1S6JA 2TN4A 1WRKA 1JSAA 4PHNA 4OV2A 4HRHA 4Q04A 1NP8A 1Y1XA 1YVHA 3EVVA 5TNCA 1J7OA 2V53A 3SG6A 3PM8A 2PRUA 2M29A 1ZOTB 1DJYA 5K89A 2FOTA 1XFZO 1NX2A 3HX4A 1XFXO 4MZKA 3I5IC 2KQYA 2B1UA 4R1EA 1IQ3A 1B7TY 5KSZA 3O2PA 4JQ0D 1UHHA 1YR5A 2RGIA 1SL7A 3I5HC 4MBEA 3QRXA 1J7QA 3MSEB 2LC5A 1XYDA 2EGDA 1D1OA 1OZOA 1J55A 1G8IA 1CTRA 2LANA 2M7LA 1XFYO 1CFCA 5CSNA 2ZN8A 3PFVA 4GFTA 1DT7B 3DF0B 3DD4A 1KSOA 2MHHA 3HCMA 1WLMA 1G4YR 1DJIA 2HQ8A 3KF9A 2JULA 2L2EA 3TDZA 1AJ5A 4QJ4B 1X02A 3DVKA 1RJVA 2MLEC 3CR5X 1XFVO 4PDZA 2FCEA 2IS9A 1JF0A 1FF1A 2K7OA 1CLMA 1KWOB 1AUIB 1HQVA 4YI9A 4JWQA 2NCOA 1UHJA 1U5IA 2GV5A 2ZN9A 2KQ6A 4GBAA 4ZCVA 1K90D 1N65A 4C0KA 4YGCB 5F6TA 1LA0A 2K8MB 3FS7A 4XJKA 2BKIB 4HSZA 1S26D 2KI4C 4I5JA 1U5IB 1CNPA 3I5IB 1SR6C 2LP2A 3BQ3A 3WXAA 2WOSA 2F2PA 2E30A 4HREE 1EG4A 3I5HB 3WHTB 1H8BA 1S5GZ 2AMIA 3WNXB 4YBHB 4MRXA 3OB1B 2JNXA 2JXLA 1A03A 2K0JA 2WNDA 1QX2A 3SJSA 2NCPA 4DCKA 4YRUA 1MWNA 1XK4C 2KOTA 1C7WA 3DVEA 4QJ3B 3BUXB 1IWQA 1PSBA 2KYCA 5DKRA 1AVSA 1DJWA 1YURA 2M1UA 2K7BA 2ZNDA 2F33A 5JOLA 3EK8A 2LP3A 3ICBA 1UHNA 1F8HA 2MLFC 2ZNEA 1N2DA 1M46A 2I2RE 2EC6C 4NDDA 1FPWA 3OP0A 1IQ5A 5AEQA 1QIVA 3A8RA 1L7ZA 4PE1A 1OMVA 1DVIA 1NWDA 2JXCA 5CPVA 2L4HA 1NSHA 1QJTA 4E68A 3FWBA 2F3ZA 1UHKA 5KTYA 1S5GY 1KK8B 3JVTB 4YGDB 3CS1A 1XK4A 1ZACA 3OX6A 2K2AA 2LUXA 3PALA 1GGZA 2KI6C 2JQ6A 5G08A 4MN0A 5BPJA 1M39A 3O78A 4XYNA 3VROA 1SK6D 1BR1B 2Q4UA 1A75A 1BF5A 3NXAA 4NQGA 1PVAA 1DTLA 2E6WA 5KU1A 2LV7A 1ALVA 1QLKA 1QV1A 1F70A 1NYAA 3FIAA 3LLEA 1YX7A 3EK4A 4IL1A 1MXLC 4ORBB 1K9PA 1A75B 1PVBA 2KAVA 1LXFC 1CDPA 1C7VA 4YGAA 1S6IA 1MHOA 2LLTA 2ZRSA 3NSKA 2M97A 2HPSA 2M49B 2M3WA 1DF0A 4L9MA 4JPZB 1S6CA 2M7NA 1DJGA 2Q91A 2EC6B 1PULA 1XVJA 1IRJA 1UUSA 1YRUB 1AJ4A 1SRAA 1QIWA 1B8CA 1UURA 3CWGA 4MVFA 1AP4A 1IG5A 1DF0B 1K96A 1KFXS 1WRLA 1SW8A 1RWYA 2I18A 2LM5A 1ALWA 5AERA 2FJUB 2LAPA 3SG5A 2I7AA 3DF0A 4CPVA 1J1EA 1V1FA 1KK7Z 2BBMA 3AKAA 2JTZA 1S3PA 2BKHB 3ZWHA 1JC2A 2M1KB 1K8UA 2BECA 1WLZA 1QX7A 4CIDA 3CR2A 1DJXA 1BG1A 4MZLA 3DVJA 4UPGA 3EVUA 3BXKA 2BE4A 2AUCA 2NZ0A 1Y6WA 1EXRA 1EL4A 1WRZA 1K95A 1R6PA 1TOPA 2LVIA 3ZNIA 4M2QA 1WDCC 3GK1A 1FI6A 1FW4A 1YRTB 2LCPA 2JT3A 2BL0C 1FBVA 1YUTA 4PHJA 1SNLA 2D8NA 2LVKA 2CCMA 2JT0A 1A29A 2AAOA 1M63B 1OQPA 1CM4A 4DIRA 5I8NA 1F4QA 3BYAA 1BR4B 3LCPC 1IJ6A 4OKHA 1JUOA 2Y5IA 4I5NB 1XFUO 1CFDA 1J1DA 1NCZA 2PVBA 2WCBA 5DKNA 4A4BA 1TCOB 4YI8A 2OS8B 1UWOA 3BOWB 3NSLA 1KSMA 1HT9A 2SASA 1W7JB 5HLVA 4HRGA 2KGBC 1KFUS 3F45A 1KK8C 3E3RA 3JVTC 4ETOA 1KK7Y 2PASA 2BCBA 4NDBA 1J7RA 2F8PA 2JTTA 1EG3A 3KHEA 1B9AA 2FCDA 5I2QA 4ICBA 3O4YA 1CMFA 5DKQA 3IQOA 3PLFB 1BJFA 4I5LB 5J3XA 4F0ZB 1R2UA 1PALA 1NX0A 5GQQC 2LMTA 1SL9A 1DJZA 4MRYA 4FTGA 3KPXA 5AANA 1DGVA 2HQWA 1IJ5A 1W7IB 4DUQA 1CB1A 3EVRA 2WORA 2KYFA 2PSRA 4PHMA 1WDCB 1H4BA 2G2BA 2BL0B 1IGVA 3M0WA 3AAKA 4AOMA 1NCYA 3BUOB 1RFJA 3CZTX 1K9UA 1UP5A 4ORAB 5B8IB 3O6BA 1QVIZ 2JZIA 1Y0VH 1JF2A 3DVMA 2L0PA 1RROA 1GJYA 3I5GB 3EKJA 1VRKA 1CFFA 1SCMB 5CSJA 1B8RA 2H2KA 3JTDC 4USLA 1KQMC 2M8UA 4CFRA 2JPTA 1SY9A 1YTZC 4ORCB 5HKYA 4PE0A 2G9BA 4PHKA 2O5GA 1OZSA 2BCAA 3I5FC 1QASA 5PALA 5AXIA 2EHBA 2LHLA 2KI6D 1L2OB 1XFWO 1CLLA 1GQMA 1PSRA 1QLSA 3FWCA 2MBXA 2JOJA 3OHMB 5HKZA 2ISDA 1ZFSA 3VRNA 4P2YB
chains in the Genus database with same CATH superfamily
2QEVA 3PSRA 2P70A 3BUMB 3FE9A 3SIAA 1WY9A 1KCYA 3IQQA 4OVNF 1TNWA 1CMGA 2QPTA 2F3YA 3VRPA 4NDCA 1QVIY 1QATA 3A4UB 3NGVA 4CFQA 3SG2A 3KO0A 4D1EA 1K93D 1PRWA 1YX8A 1LKJA 3WHUB 3PATA 2OS8C 3S0BA 3PN7B 2KFGA 1F55A 2GGZA 3BUWB 3S0AA 2L98A 1DMOA 1KFXL 4YGBB 3SS5A 1RK9A 1V1GA 2MAZA 2JWWA 3VRRA 2A4JA 2ZFDA 4CLNA 5HL1A 1FI5A 1SCVA 1M45A 2KNEA 2L51A 1OOJA 1YVLA 3JTDB 1CDLA 2BE6A 1EJ3A 2GTEA 2I94A 1KQMB 1S1EA 2OPOA 1JWDA 1NPQA 1DJHA 1BU3A 3OX5A 1XA5A 3DY9A 5CSIA 1B47A 2KGRA 2QACA 2ZRTA 3KEVA 3TDIA 2NXQA 3I5FB 3CLNA 1Y1UA 3UNWA 1TUJA 5IBWA 2PALA 2P6BB 3C1VA 1TNXA 1TRFA 2H8VA 2MJWB 1YUSA 3D0YA 4GNKB 3SG4A 4BY4A 1NUBA 3R1VA 1DGUA 4INXA 2KFFA 2LLUA 2WC8A 4GGNA 1SYMA 2WCFA 5HKWA 1OOHA 3RM1A 1OE9B 3QMEA 2L5YA 3D0YB 3BOWA 4MSPA 3NSIA 1QS7A 3TS5B 2VRGA 4MZJA 1MR8A 1MQ1A 2KAYA 1A2XA 2PYQA 1Z4HA 3RLZA 4I5KA 2GGMA 4N5XA 4PCWA 5HLOA 1BMOA 1BLQA 1SSEB 1RECA 3CR4X 2DOQA 4M2OA 4M2PA 1NX3A 2BCXA 2CNPA 3UO9A 3I5GC 4A4CA 1JFJA 2M0RA 5ER5A 3TUYB 1W9ZA 1IH0A 1SCMC 1KFUL 3CYZA 1YUUA 2F2OA 1RTP1 2K61A 1CFPA 1G33A 1EH2A 1TCFA 1M31A 1IKUA 1LA3A 1TIZA 2OTGB 3CGAA 1JFKA 2Y4QA 2KDHA 1BT6A 1F4OA 1PK0D 4BY5A 1CM1A 1UHIA 3LL8B 2JNFA 3EK7A 2WCEA 5AFPA 2R2IA 2ZKMX 2L50A 4PE4A 1L2OC 3CTNA 1ZMZA 4DRWA 2K60A 4GAOA 1F54A 2KFHA 1OSAA 4U8DA 1SKTA 1E8AA 4OZDA 1B1GA 3FE6A 2Y1MA 1OOFA 3H4SE 3LK0A 2CTNA 3AKBA 1CKKA 2LMVA 4XJKB 5ER4X 1SMGA 1QX5B 1K2HA 2BBNA 1Y1AA 2Y1NA 1NX1A 3SG3A 2M9GA 2PQLA 5FI2A 1TNQA 1KQVA 3FE8A 3IF7A 4YGEB 2JRFA 2LNKA 4PALA 2LUCA 1K9KA 1F71A 1OMRA 2L5XB 2LE9B 3K21A 3PN7C 3D78A 3SG7A 2JT8A 3GK2A 2L2CA 2H61C 2CT9A 3AAJA 3D74A 1AHRA 1SL8A 2KHNA 1LINA 2MRDA 2COLB 1ODBA 2HF5A 3DXLA 4PE7A 1AK8A 1QTXA 3OGNA 3D76A 4MLWA 1B4CA 1JBAA 1NIWA 2LVVA 3EKHA 3S0GA 4GUKA 5CSFA 4GGFC 4AQJA 1J7PA 1A4PA 4WQ3A 1K94A 1MXEA 1ORGA 1Q80A 5JJGA 1BODA 4C0LA 2LLSA 2KBMA 3BUNB 1TN4A 2O60A 3GK4X 4P5OE 3NSOA 4AQIA 1NCXA 2MA2A 4OCIA 1OMDA 2KI4B 4WRIA 1MUXA 1N0YA 2CBLA 2KBIA 4OR9B 4N1GA 1SR6B 4QJ5B 1ZUZA 3TDUA 4N1FA 1OOGA 1OW4A 1TTXA 2LHIA 2K7CA 2JU0A 2WC6A 1B7TZ 3VB1A 3GOFA 4C0JA 2JPOA 5HYDA 1QV0A 3VGOA 1SPYA 2HETA 4MEWA 3SIBA 3TS5C 1MF8B 2KSPA 1QXPA 4DS7A 5FYXA 2LVJA 3DZTA 5D7FA 2H61A 2WCKA 1CLBA 5I2OA 4TNCA 5D69A 4WQ2A 1GGWA 3LK1A 2NLNA 1BOCA 2L4IA 3DYEA 3VRQA 2CXJA 1B8LA 1TNPA 1T14A 2PMYA 3CDNA 3EG5B 2LMUA 2SCPA 2K2FA 3TZ1A 4FQOA 3TUYC 4GGFA 1SBJA 2K7DA 4ZCUA 5I2LA 1LVCD 3D10A 1CDNA 2JC2A 4GPLB 1S36A 3CZ2A 2KAXA 1CDMA 1XO5A 2OTGC 1C07A 1KWOC 3OB2B 1P28A 1S6JA 2TN4A 1WRKA 1JSAA 4PHNA 4OV2A 4HRHA 4Q04A 1NP8A 1Y1XA 1YVHA 3EVVA 5TNCA 1J7OA 2V53A 3SG6A 3PM8A 2PRUA 2M29A 1ZOTB 1DJYA 5K89A 2FOTA 1XFZO 1NX2A 3HX4A 1XFXO 4MZKA 5FI7A 3I5IC 2KQYA 2B1UA 4R1EA 1IQ3A 1B7TY 5KSZA 3O2PA 4JQ0D 1TUZA 1UHHA 1YR5A 2RGIA 1SL7A 3I5HC 4MBEA 3QRXA 1J7QA 3MSEB 2LC5A 1XYDA 2EGDA 2WCJA 1D1OA 1OZOA 3BFHA 1J55A 1C3YA 1G8IA 1CTRA 2LANA 2M7LA 1XFYO 1CFCA 5CSNA 2ZN8A 3PFVA 4GFTA 1DT7B 3DF0B 1LS8A 3DD4A 1KSOA 2MHHA 3HCMA 1GM0A 3CZ0A 1WLMA 3K1EA 3O4XA 1G4YR 1DJIA 2HQ8A 3KF9A 2QEBA 2JULA 2L2EA 3TDZA 1AJ5A 4QJ4B 1X02A 3DVKA 1RJVA 2MLEC 3CR5X 1XFVO 2QEOA 4PDZA 2FCEA 2IS9A 1Z2CB 3BFAA 1JF0A 1FF1A 2K7OA 1CLMA 1KWOB 3OBVA 1AUIB 3D77A 1HQVA 2BAPA 4JWQA 4YI9A 2NCOA 1UHJA 1U5IA 2GV5A 2ZN9A 2KQ6A 4GBAA 4ZCVA 2BNXA 2KPHA 2QDIA 1K90D 1N65A 4C0KA 4YGCB 5F6TA 1LA0A 2K8MB 3FS7A 3Q8IA 2YGUA 4XJKA 2BKIB 4HSZA 1S26D 3L47A 2KI4C 4I5JA 3B87A 1U5IB 1CNPA 3I5IB 1SR6C 2LP2A 2WCMA 3BQ3A 2WOSA 5D3OA 2F2PA 3WXAA 2E30A 4HREE 1EG4A 3I5HB 3WHTB 1H8BA 3D75A 1S5GZ 2AMIA 3WNXB 4YBHB 4MRXA 3OB1B 2JNXA 2JXLA 1A03A 2K0JA 2WNDA 1QX2A 3SJSA 2NCPA 4DCKA 4YRUA 1MWNA 1XK4C 2KOTA 1C7WA 3DVEA 4QJ3B 3BUXB 3BJHA 1IWQA 2WCHA 1PSBA 2KYCA 5DKRA 1AVSA 1DJWA 1YURA 4IJ7A 2M1UA 2K7BA 2ZNDA 2F33A 3R72A 5JOLA 3EK8A 2LP3A 3ICBA 1UHNA 1F8HA 2MLFC 2ZNEA 1N2DA 1M46A 2I2RE 2EC6C 4NDDA 1FPWA 3OP0A 1IQ5A 5AEQA 5DICA 1QIVA 3A8RA 4PT1A 1L7ZA 2WC5A 4PE1A 1OMVA 5EL2A 1DVIA 1NWDA 3PM2A 2JXCA 5CPVA 2L4HA 1NSHA 1QJTA 4F7FA 4E68A 3FWBA 2F3ZA 3NHTA 1UHKA 5KTYA 1S5GY 1KK8B 3JVTB 4YGDB 3CS1A 1XK4A 1ZACA 3OX6A 2K2AA 3PJIA 2LUXA 3PALA 1GGZA 2KI6C 2JQ6A 1XFRA 5G08A 4JD9A 2KLEA 1M39A 4MN0A 5BPJA 3O78A 4XYNA 3VROA 1SK6D 1BR1B 2Q4UA 1A75A 1BF5A 3NXAA 4NQGA 1PVAA 1DTLA 2E6WA 5KU1A 2LV7A 1ALVA 1QLKA 1QV1A 1F70A 1NYAA 3FIAA 3LLEA 3R1PA 1YX7A 3EK4A 4IL1A 1MXLC 4ORBB 1K9PA 1A75B 1PVBA 2KAVA 1LXFC 1CDPA 2P71A 1C7VA 4YGAA 1S6IA 1MHOA 2LLTA 3CABA 2ZRSA 3SS4A 3NSKA 3IVTA 2M97A 2HPSA 2M49B 5I94A 2M3WA 1DF0A 4L9MA 4JPZB 1S6CA 2M7NA 1DJGA 2Q91A 2EC6B 1PULA 1XVJA 1QWVA 1IRJA 3B86A 1UUSA 1YRUB 1AJ4A 1SRAA 1QIWA 1B8CA 1UURA 3CWGA 4MVFA 1AP4A 1IG5A 1DF0B 1K96A 3B7AA 1KFXS 1WRLA 1SW8A 1RWYA 2I18A 2LM5A 1ALWA 5AERA 2FJUB 2LAPA 3S0DA 3SG5A 2I7AA 3DF0A 4CPVA 1J1EA 1V1FA 1KK7Z 2BBMA 3AKAA 2JTZA 1S3PA 2BKHB 3ZWHA 1JC2A 2M1KB 1K8UA 2BECA 1WLZA 2FJYA 1QX7A 4CIDA 3CR2A 1DJXA 1BG1A 4MZLA 3DVJA 4UPGA 3EVUA 3BXKA 3N7HA 2BE4A 2AUCA 2NZ0A 1DEKA 1Y6WA 1EXRA 1EL4A 1WRZA 1TOPA 1K95A 1R6PA 2LVIA 3ZNIA 4M2QA 1WDCC 3GK1A 1FI6A 1FW4A 1YRTB 2LCPA 2JT3A 2BL0C 1IIOA 1FBVA 1YUTA 4PHJA 1SNLA 2D8NA 2LVKA 2CCMA 2JT0A 1A29A 2AAOA 3SS3A 1M63B 1OQPA 1CM4A 1DC1A 4DIRA 5I8NA 1F4QA 3BYAA 1BR4B 3LCPC 3R1OA 1IJ6A 4INWA 4OKHA 1JUOA 2Y5IA 4FQTA 4I5NB 1XFUO 1CFDA 1J1DA 1NCZA 2PVBA 2WCBA 5DKNA 4A4BA 1DELA 1C3ZA 1TCOB 4YI8A 2OS8B 1UWOA 3BOWB 3NSLA 1KSMA 1HT9A 2SASA 1W7JB 5HLVA 4HRGA 2KGBC 1KFUS 3BFBA 1KK8C 3CZ1A 3E3RA 3F45A 3JVTC 4ETOA 1KK7Y 2PASA 2BCBA 4NDBA 1J7RA 2F8PA 2JTTA 1EG3A 3KHEA 1B9AA 2FCDA 5I2QA 4ICBA 3O4YA 1CMFA 5DKQA 3B6XA 3IQOA 3PLFB 1BJFA 4I5LB 5J3XA 4F0ZB 1R2UA 1PALA 1NX0A 5GQQC 2LMTA 1SL9A 4KYNA 1DJZA 4MRYA 4FTGA 3KPXA 5AANA 1DGVA 2HQWA 1IJ5A 1W7IB 4DUQA 1CB1A 3EVRA 2WORA 2KYFA 2PSRA 4PHMA 1WDCB 1H4BA 2G2BA 1OOIX 2BL0B 3S0EA 4JKTA 1IGVA 3M0WA 3AAKA 4AOMA 1NCYA 3BUOB 3S0FA 2WCLA 1RFJA 3CZTX 3NHIA 1K9UA 1UP5A 2ERBA 4ORAB 5B8IB 3O6BA 1QVIZ 2JZIA 1Y0VH 2KLDA 3V2LA 1JF2A 3DVMA 2L0PA 1RROA 1GJYA 3I5GB 3EKJA 1VRKA 1CFFA 3D73A 1SCMB 5CSJA 3B88A 1B8RA 2H2KA 3JTDC 3L4AA 4USLA 5FI6A 1KQMC 2M8UA 4CFRA 2JPTA 3L4LA 1SY9A 1YTZC 4ORCB 1DQEA 5HKYA 4PE0A 2G9BA 4PHKA 2O5GA 1OZSA 2BCAA 3I5FC 1QASA 5PALA 5AXIA 2EHBA 2LHLA 2KI6D 1L2OB 2QEHA 1XFWO 1CLLA 1GQMA 1PSRA 1QLSA 1TWOA 3FWCA 2MBXA 3RZSA 2JOJA 3OHMB 5HKZA 2ISDA 1ZFSA 3VRNA 4P2YB
chains in the Genus database with same CATH topology
3PSRA 3BUMB 3SIAA 1WY9A 1KCYA 3IQQA 4OVNF 1TNWA 1CMGA 2QPTA 2F3YA 3VRPA 4NDCA 1QVIY 1QATA 3A4UB 4CFQA 3SG2A 3KO0A 4D1EA 1K93D 1PRWA 1YX8A 1LKJA 3WHUB 3PATA 2OS8C 3PN7B 2KFGA 1F55A 2GGZA 3BUWB 2L98A 1DMOA 1KFXL 4YGBB 1RK9A 1V1GA 2MAZA 2JWWA 3VRRA 2A4JA 2ZFDA 4CLNA 1FI5A 1SCVA 1M45A 2KNEA 2L51A 1OOJA 1YVLA 3JTDB 1CDLA 2BE6A 1EJ3A 2I94A 1KQMB 1S1EA 2OPOA 1JWDA 1NPQA 1DJHA 1BU3A 3OX5A 1XA5A 5CSIA 1B47A 2KGRA 2QACA 2ZRTA 3KEVA 3TDIA 2NXQA 3I5FB 3CLNA 1Y1UA 5IBWA 2PALA 2P6BB 3C1VA 1TNXA 1TRFA 2MJWB 4GNKB 1YUSA 3D0YA 3SG4A 4BY4A 1NUBA 1DGUA 2KFFA 2LLUA 2WC8A 4GGNA 1SYMA 2WCFA 5HKWA 3RM1A 1OE9B 3D0YB 3BOWA 4MSPA 3NSIA 1QS7A 3TS5B 2VRGA 4MZJA 1MR8A 1MQ1A 2KAYA 1A2XA 3RLZA 4I5KA 2GGMA 4N5XA 4PCWA 5HLOA 1BMOA 1BLQA 1RECA 3CR4X 2DOQA 4M2OA 4M2PA 1NX3A 2BCXA 2CNPA 4A4CA 3I5GC 1JFJA 2M0RA 5ER5A 3TUYB 1IH0A 1SCMC 1KFUL 1YUUA 2F2OA 1RTP1 2K61A 1CFPA 1G33A 1EH2A 1TCFA 1M31A 1IKUA 1LA3A 1TIZA 2OTGB 3CGAA 1JFKA 2Y4QA 2KDHA 1BT6A 1F4OA 1PK0D 4BY5A 1CM1A 1UHIA 3LL8B 2JNFA 3EK7A 2WCEA 5AFPA 2R2IA 2ZKMX 2L50A 4PE4A 1L2OC 3CTNA 1ZMZA 4DRWA 4GAOA 1F54A 2KFHA 1OSAA 4U8DA 1SKTA 1E8AA 1B1GA 2Y1MA 3H4SE 3LK0A 2CTNA 3AKBA 1CKKA 2LMVA 4XJKB 5ER4X 1SMGA 1QX5B 1K2HA 2BBNA 1Y1AA 2Y1NA 1NX1A 3SG3A 2M9GA 1TNQA 1KQVA 3IF7A 4YGEB 2JRFA 2LNKA 4PALA 2LUCA 1K9KA 1F71A 1OMRA 2L5XB 2LE9B 3K21A 3PN7C 3SG7A 2JT8A 3GK2A 2H61C 2CT9A 3AAJA 1AHRA 1SL8A 2KHNA 1LINA 2MRDA 2COLB 1ODBA 2HF5A 4PE7A 1AK8A 1QTXA 4MLWA 1B4CA 1JBAA 1NIWA 2LVVA 3EKHA 4GUKA 5CSFA 4GGFC 4AQJA 1J7PA 1A4PA 4WQ3A 1K94A 1MXEA 1Q80A 5JJGA 1BODA 4C0LA 2LLSA 2KBMA 3BUNB 1TN4A 2O60A 3GK4X 4P5OE 3NSOA 4AQIA 1NCXA 2MA2A 4OCIA 1OMDA 2KI4B 4WRIA 1MUXA 2CBLA 1N0YA 2KBIA 4OR9B 4N1GA 1SR6B 4QJ5B 1ZUZA 3TDUA 4N1FA 2LHIA 1TTXA 4C0JA 2K7CA 2JU0A 1B7TZ 3GOFA 5HYDA 1QV0A 3VGOA 1SPYA 2HETA 4MEWA 3SIBA 3TS5C 1MF8B 2KSPA 1QXPA 4DS7A 5FYXA 2LVJA 5D7FA 2H61A 1CLBA 5I2OA 4TNCA 5D69A 4WQ2A 1GGWA 3LK1A 2NLNA 1BOCA 2L4IA 3VRQA 2CXJA 1B8LA 1TNPA 2PMYA 2LMUA 2SCPA 2K2FA 3TZ1A 4FQOA 3TUYC 4GGFA 1SBJA 2K7DA 4ZCUA 5I2LA 1LVCD 3D10A 1CDNA 2JC2A 4GPLB 1S36A 2KAXA 1CDMA 1XO5A 2OTGC 1C07A 1KWOC 3OB2B 1S6JA 2TN4A 1WRKA 1JSAA 4PHNA 4OV2A 4HRHA 4Q04A 1NP8A 1Y1XA 1YVHA 3EVVA 5TNCA 1J7OA 2V53A 3SG6A 3PM8A 2PRUA 2M29A 1ZOTB 1DJYA 5K89A 2FOTA 1XFZO 1NX2A 3HX4A 1XFXO 4MZKA 3I5IC 2KQYA 2B1UA 4R1EA 1IQ3A 1B7TY 5KSZA 3O2PA 4JQ0D 1UHHA 1YR5A 2RGIA 1SL7A 3I5HC 4MBEA 3QRXA 1J7QA 3MSEB 2LC5A 1XYDA 2EGDA 1D1OA 1OZOA 1J55A 1G8IA 1CTRA 2LANA 2M7LA 1XFYO 1CFCA 5CSNA 2ZN8A 3PFVA 4GFTA 1DT7B 3DF0B 3DD4A 1KSOA 2MHHA 3HCMA 1WLMA 1G4YR 1DJIA 2HQ8A 3KF9A 2JULA 2L2EA 3TDZA 1AJ5A 4QJ4B 1X02A 3DVKA 1RJVA 2MLEC 3CR5X 1XFVO 4PDZA 2FCEA 2IS9A 1JF0A 1FF1A 2K7OA 1CLMA 1KWOB 1AUIB 1HQVA 4YI9A 4JWQA 2NCOA 1UHJA 1U5IA 2GV5A 2ZN9A 2KQ6A 4GBAA 4ZCVA 1K90D 1N65A 4C0KA 4YGCB 5F6TA 1LA0A 2K8MB 3FS7A 4XJKA 2BKIB 4HSZA 1S26D 2KI4C 4I5JA 1U5IB 1CNPA 3I5IB 1SR6C 2LP2A 3BQ3A 3WXAA 2WOSA 2F2PA 2E30A 4HREE 1EG4A 3I5HB 3WHTB 1H8BA 1S5GZ 2AMIA 3WNXB 4YBHB 4MRXA 3OB1B 2JNXA 2JXLA 1A03A 2K0JA 2WNDA 1QX2A 3SJSA 2NCPA 4DCKA 4YRUA 1MWNA 1XK4C 2KOTA 1C7WA 3DVEA 4QJ3B 3BUXB 1IWQA 1PSBA 2KYCA 5DKRA 1AVSA 1DJWA 1YURA 2M1UA 2K7BA 2ZNDA 2F33A 5JOLA 3EK8A 2LP3A 3ICBA 1UHNA 1F8HA 2MLFC 2ZNEA 1N2DA 1M46A 2I2RE 2EC6C 4NDDA 1FPWA 3OP0A 1IQ5A 5AEQA 1QIVA 3A8RA 1L7ZA 4PE1A 1OMVA 1DVIA 1NWDA 2JXCA 5CPVA 2L4HA 1NSHA 1QJTA 4E68A 3FWBA 2F3ZA 1UHKA 5KTYA 1S5GY 1KK8B 3JVTB 4YGDB 3CS1A 1XK4A 1ZACA 3OX6A 2K2AA 2LUXA 3PALA 1GGZA 2KI6C 2JQ6A 5G08A 4MN0A 5BPJA 1M39A 3O78A 4XYNA 3VROA 1SK6D 1BR1B 2Q4UA 1A75A 1BF5A 3NXAA 4NQGA 1PVAA 1DTLA 2E6WA 5KU1A 2LV7A 1ALVA 1QLKA 1QV1A 1F70A 1NYAA 3FIAA 3LLEA 1YX7A 3EK4A 4IL1A 1MXLC 4ORBB 1K9PA 1A75B 1PVBA 2KAVA 1LXFC 1CDPA 1C7VA 4YGAA 1S6IA 1MHOA 2LLTA 2ZRSA 3NSKA 2M97A 2HPSA 2M49B 2M3WA 1DF0A 4L9MA 4JPZB 1S6CA 2M7NA 1DJGA 2Q91A 2EC6B 1PULA 1XVJA 1IRJA 1UUSA 1YRUB 1AJ4A 1SRAA 1QIWA 1B8CA 1UURA 3CWGA 4MVFA 1AP4A 1IG5A 1DF0B 1K96A 1KFXS 1WRLA 1SW8A 1RWYA 2I18A 2LM5A 1ALWA 5AERA 2FJUB 2LAPA 3SG5A 2I7AA 3DF0A 4CPVA 1J1EA 1V1FA 1KK7Z 2BBMA 3AKAA 2JTZA 1S3PA 2BKHB 3ZWHA 1JC2A 2M1KB 1K8UA 2BECA 1WLZA 1QX7A 4CIDA 3CR2A 1DJXA 1BG1A 4MZLA 3DVJA 4UPGA 3EVUA 3BXKA 2BE4A 2AUCA 2NZ0A 1Y6WA 1EXRA 1EL4A 1WRZA 1K95A 1R6PA 1TOPA 2LVIA 3ZNIA 4M2QA 1WDCC 3GK1A 1FI6A 1FW4A 1YRTB 2LCPA 2JT3A 2BL0C 1FBVA 1YUTA 4PHJA 1SNLA 2D8NA 2LVKA 2CCMA 2JT0A 1A29A 2AAOA 1M63B 1OQPA 1CM4A 4DIRA 5I8NA 1F4QA 3BYAA 1BR4B 3LCPC 1IJ6A 4OKHA 1JUOA 2Y5IA 4I5NB 1XFUO 1CFDA 1J1DA 1NCZA 2PVBA 2WCBA 5DKNA 4A4BA 1TCOB 4YI8A 2OS8B 1UWOA 3BOWB 3NSLA 1KSMA 1HT9A 2SASA 1W7JB 5HLVA 4HRGA 2KGBC 1KFUS 3F45A 1KK8C 3E3RA 3JVTC 4ETOA 1KK7Y 2PASA 2BCBA 4NDBA 1J7RA 2F8PA 2JTTA 1EG3A 3KHEA 1B9AA 2FCDA 5I2QA 4ICBA 3O4YA 1CMFA 5DKQA 3IQOA 3PLFB 1BJFA 4I5LB 5J3XA 4F0ZB 1R2UA 1PALA 1NX0A 5GQQC 2LMTA 1SL9A 1DJZA 4MRYA 4FTGA 3KPXA 5AANA 1DGVA 2HQWA 1IJ5A 1W7IB 4DUQA 1CB1A 3EVRA 2WORA 2KYFA 2PSRA 4PHMA 1WDCB 1H4BA 2G2BA 2BL0B 1IGVA 3M0WA 3AAKA 4AOMA 1NCYA 3BUOB 1RFJA 3CZTX 1K9UA 1UP5A 4ORAB 5B8IB 3O6BA 1QVIZ 2JZIA 1Y0VH 1JF2A 3DVMA 2L0PA 1RROA 1GJYA 3I5GB 3EKJA 1VRKA 1CFFA 1SCMB 5CSJA 1B8RA 2H2KA 3JTDC 4USLA 1KQMC 2M8UA 4CFRA 2JPTA 1SY9A 1YTZC 4ORCB 5HKYA 4PE0A 2G9BA 4PHKA 2O5GA 1OZSA 2BCAA 3I5FC 1QASA 5PALA 5AXIA 2EHBA 2LHLA 2KI6D 1L2OB 1XFWO 1CLLA 1GQMA 1PSRA 1QLSA 3FWCA 2MBXA 2JOJA 3OHMB 5HKZA 2ISDA 1ZFSA 3VRNA 4P2YB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PSR A;  3BUM B;  3SIA A;  1WY9 A;  1KCY A;  3IQQ A;  4OVN F;  1TNW A;  1CMG A;  2QPT A;  2F3Y A;  3VRP A;  4NDC A;  1QVI Y;  1QAT A;  3A4U B;  4CFQ A;  3SG2 A;  3KO0 A;  4D1E A;  1K93 D;  1PRW A;  1YX8 A;  1LKJ A;  3WHU B;  3PAT A;  2OS8 C;  3PN7 B;  2KFG A;  1F55 A;  2GGZ A;  3BUW B;  2L98 A;  1DMO A;  1KFX L;  4YGB B;  1RK9 A;  1V1G A;  2MAZ A;  2JWW A;  3VRR A;  2A4J A;  2ZFD A;  4CLN A;  1FI5 A;  1SCV A;  1M45 A;  2KNE A;  2L51 A;  1OOJ A;  1YVL A;  3JTD B;  1CDL A;  2BE6 A;  1EJ3 A;  2I94 A;  1KQM B;  1S1E A;  2OPO A;  1JWD A;  1NPQ A;  1DJH A;  1BU3 A;  3OX5 A;  1XA5 A;  5CSI A;  1B47 A;  2KGR A;  2QAC A;  2ZRT A;  3KEV A;  3TDI A;  2NXQ A;  3I5F B;  3CLN A;  1Y1U A;  5IBW A;  2PAL A;  2P6B B;  3C1V A;  1TNX A;  1TRF A;  2MJW B;  4GNK B;  1YUS A;  3D0Y A;  3SG4 A;  4BY4 A;  1NUB A;  1DGU A;  2KFF A;  2LLU A;  2WC8 A;  4GGN A;  1SYM A;  2WCF A;  5HKW A;  3RM1 A;  1OE9 B;  3D0Y B;  3BOW A;  4MSP A;  3NSI A;  1QS7 A;  3TS5 B;  2VRG A;  4MZJ A;  1MR8 A;  1MQ1 A;  2KAY A;  1A2X A;  3RLZ A;  4I5K A;  2GGM A;  4N5X A;  4PCW A;  5HLO A;  1BMO A;  1BLQ A;  1REC A;  3CR4 X;  2DOQ A;  4M2O A;  4M2P A;  1NX3 A;  2BCX A;  2CNP A;  4A4C A;  3I5G C;  1JFJ A;  2M0R A;  5ER5 A;  3TUY B;  1IH0 A;  1SCM C;  1KFU L;  1YUU A;  2F2O A;  1RTP 1;  2K61 A;  1CFP A;  1G33 A;  1EH2 A;  1TCF A;  1M31 A;  1IKU A;  1LA3 A;  1TIZ A;  2OTG B;  3CGA A;  1JFK A;  2Y4Q A;  2KDH A;  1BT6 A;  1F4O A;  1PK0 D;  4BY5 A;  1CM1 A;  1UHI A;  3LL8 B;  2JNF A;  3EK7 A;  2WCE A;  5AFP A;  2R2I A;  2ZKM X;  2L50 A;  4PE4 A;  1L2O C;  3CTN A;  1ZMZ A;  4DRW A;  4GAO A;  1F54 A;  2KFH A;  1OSA A;  4U8D A;  1SKT A;  1E8A A;  1B1G A;  2Y1M A;  3H4S E;  3LK0 A;  2CTN A;  3AKB A;  1CKK A;  2LMV A;  4XJK B;  5ER4 X;  1SMG A;  1QX5 B;  1K2H A;  2BBN A;  1Y1A A;  2Y1N A;  1NX1 A;  3SG3 A;  2M9G A;  1TNQ A;  1KQV A;  3IF7 A;  4YGE B;  2JRF A;  2LNK A;  4PAL A;  2LUC A;  1K9K A;  1F71 A;  1OMR A;  2L5X B;  2LE9 B;  3K21 A;  3PN7 C;  3SG7 A;  2JT8 A;  3GK2 A;  2H61 C;  2CT9 A;  3AAJ A;  1AHR A;  1SL8 A;  2KHN A;  1LIN A;  2MRD A;  2COL B;  1ODB A;  2HF5 A;  4PE7 A;  1AK8 A;  1QTX A;  4MLW A;  1B4C A;  1JBA A;  1NIW A;  2LVV A;  3EKH A;  4GUK A;  5CSF A;  4GGF C;  4AQJ A;  1J7P A;  1A4P A;  4WQ3 A;  1K94 A;  1MXE A;  1Q80 A;  5JJG A;  1BOD A;  4C0L A;  2LLS A;  2KBM A;  3BUN B;  1TN4 A;  2O60 A;  3GK4 X;  4P5O E;  3NSO A;  4AQI A;  1NCX A;  2MA2 A;  4OCI A;  1OMD A;  2KI4 B;  4WRI A;  1MUX A;  2CBL A;  1N0Y A;  2KBI A;  4OR9 B;  4N1G A;  1SR6 B;  4QJ5 B;  1ZUZ A;  3TDU A;  4N1F A;  2LHI A;  1TTX A;  4C0J A;  2K7C A;  2JU0 A;  1B7T Z;  3GOF A;  5HYD A;  1QV0 A;  3VGO A;  1SPY A;  2HET A;  4MEW A;  3SIB A;  3TS5 C;  1MF8 B;  2KSP A;  1QXP A;  4DS7 A;  5FYX A;  2LVJ A;  5D7F A;  2H61 A;  1CLB A;  5I2O A;  4TNC A;  5D69 A;  4WQ2 A;  1GGW A;  3LK1 A;  2NLN A;  1BOC A;  2L4I A;  3VRQ A;  2CXJ A;  1B8L A;  1TNP A;  2PMY A;  2LMU A;  2SCP A;  2K2F A;  3TZ1 A;  4FQO A;  3TUY C;  4GGF A;  1SBJ A;  2K7D A;  4ZCU A;  5I2L A;  1LVC D;  3D10 A;  1CDN A;  2JC2 A;  4GPL B;  1S36 A;  2KAX A;  1CDM A;  1XO5 A;  2OTG C;  1C07 A;  1KWO C;  3OB2 B;  1S6J A;  2TN4 A;  1WRK A;  1JSA A;  4PHN A;  4OV2 A;  4HRH A;  4Q04 A;  1NP8 A;  1Y1X A;  1YVH A;  3EVV A;  5TNC A;  1J7O A;  2V53 A;  3SG6 A;  3PM8 A;  2PRU A;  2M29 A;  1ZOT B;  1DJY A;  5K89 A;  2FOT A;  1XFZ O;  1NX2 A;  3HX4 A;  1XFX O;  4MZK A;  3I5I C;  2KQY A;  2B1U A;  4R1E A;  1IQ3 A;  1B7T Y;  5KSZ A;  3O2P A;  4JQ0 D;  1UHH A;  1YR5 A;  2RGI A;  1SL7 A;  3I5H C;  4MBE A;  3QRX A;  1J7Q A;  3MSE B;  2LC5 A;  1XYD A;  2EGD A;  1D1O A;  1OZO A;  1J55 A;  1G8I A;  1CTR A;  2LAN A;  2M7L A;  1XFY O;  1CFC A;  5CSN A;  2ZN8 A;  3PFV A;  4GFT A;  1DT7 B;  3DF0 B;  3DD4 A;  1KSO A;  2MHH A;  3HCM A;  1WLM A;  1G4Y R;  1DJI A;  2HQ8 A;  3KF9 A;  2JUL A;  2L2E A;  3TDZ A;  1AJ5 A;  4QJ4 B;  1X02 A;  3DVK A;  1RJV A;  2MLE C;  3CR5 X;  1XFV O;  4PDZ A;  2FCE A;  2IS9 A;  1JF0 A;  1FF1 A;  2K7O A;  1CLM A;  1KWO B;  1AUI B;  1HQV A;  4YI9 A;  4JWQ A;  2NCO A;  1UHJ A;  1U5I A;  2GV5 A;  2ZN9 A;  2KQ6 A;  4GBA A;  4ZCV A;  1K90 D;  1N65 A;  4C0K A;  4YGC B;  5F6T A;  1LA0 A;  2K8M B;  3FS7 A;  4XJK A;  2BKI B;  4HSZ A;  1S26 D;  2KI4 C;  4I5J A;  1U5I B;  1CNP A;  3I5I B;  1SR6 C;  2LP2 A;  3BQ3 A;  3WXA A;  2WOS A;  2F2P A;  2E30 A;  4HRE E;  1EG4 A;  3I5H B;  3WHT B;  1H8B A;  1S5G Z;  2AMI A;  3WNX B;  4YBH B;  4MRX A;  3OB1 B;  2JNX A;  2JXL A;  1A03 A;  2K0J A;  2WND A;  1QX2 A;  3SJS A;  2NCP A;  4DCK A;  4YRU A;  1MWN A;  1XK4 C;  2KOT A;  1C7W A;  3DVE A;  4QJ3 B;  3BUX B;  1IWQ A;  1PSB A;  2KYC A;  5DKR A;  1AVS A;  1DJW A;  1YUR A;  2M1U A;  2K7B A;  2ZND A;  2F33 A;  5JOL A;  3EK8 A;  2LP3 A;  3ICB A;  1UHN A;  1F8H A;  2MLF C;  2ZNE A;  1N2D A;  1M46 A;  2I2R E;  2EC6 C;  4NDD A;  1FPW A;  3OP0 A;  1IQ5 A;  5AEQ A;  1QIV A;  3A8R A;  1L7Z A;  4PE1 A;  1OMV A;  1DVI A;  1NWD A;  2JXC A;  5CPV A;  2L4H A;  1NSH A;  1QJT A;  4E68 A;  3FWB A;  2F3Z A;  1UHK A;  5KTY A;  1S5G Y;  1KK8 B;  3JVT B;  4YGD B;  3CS1 A;  1XK4 A;  1ZAC A;  3OX6 A;  2K2A A;  2LUX A;  3PAL A;  1GGZ A;  2KI6 C;  2JQ6 A;  5G08 A;  4MN0 A;  5BPJ A;  1M39 A;  3O78 A;  4XYN A;  3VRO A;  1SK6 D;  1BR1 B;  2Q4U A;  1A75 A;  1BF5 A;  3NXA A;  4NQG A;  1PVA A;  1DTL A;  2E6W A;  5KU1 A;  2LV7 A;  1ALV A;  1QLK A;  1QV1 A;  1F70 A;  1NYA A;  3FIA A;  3LLE A;  1YX7 A;  3EK4 A;  4IL1 A;  1MXL C;  4ORB B;  1K9P A;  1A75 B;  1PVB A;  2KAV A;  1LXF C;  1CDP A;  1C7V A;  4YGA A;  1S6I A;  1MHO A;  2LLT A;  2ZRS A;  3NSK A;  2M97 A;  2HPS A;  2M49 B;  2M3W A;  1DF0 A;  4L9M A;  4JPZ B;  1S6C A;  2M7N A;  1DJG A;  2Q91 A;  2EC6 B;  1PUL A;  1XVJ A;  1IRJ A;  1UUS A;  1YRU B;  1AJ4 A;  1SRA A;  1QIW A;  1B8C A;  1UUR A;  3CWG A;  4MVF A;  1AP4 A;  1IG5 A;  1DF0 B;  1K96 A;  1KFX S;  1WRL A;  1SW8 A;  1RWY A;  2I18 A;  2LM5 A;  1ALW A;  5AER A;  2FJU B;  2LAP A;  3SG5 A;  2I7A A;  3DF0 A;  4CPV A;  1J1E A;  1V1F A;  1KK7 Z;  2BBM A;  3AKA A;  2JTZ A;  1S3P A;  2BKH B;  3ZWH A;  1JC2 A;  2M1K B;  1K8U A;  2BEC A;  1WLZ A;  1QX7 A;  4CID A;  3CR2 A;  1DJX A;  1BG1 A;  4MZL A;  3DVJ A;  4UPG A;  3EVU A;  3BXK A;  2BE4 A;  2AUC A;  2NZ0 A;  1Y6W A;  1EXR A;  1EL4 A;  1WRZ A;  1K95 A;  1R6P A;  1TOP A;  2LVI A;  3ZNI A;  4M2Q A;  1WDC C;  3GK1 A;  1FI6 A;  1FW4 A;  1YRT B;  2LCP A;  2JT3 A;  2BL0 C;  1FBV A;  1YUT A;  4PHJ A;  1SNL A;  2D8N A;  2LVK A;  2CCM A;  2JT0 A;  1A29 A;  2AAO A;  1M63 B;  1OQP A;  1CM4 A;  4DIR A;  5I8N A;  1F4Q A;  3BYA A;  1BR4 B;  3LCP C;  1IJ6 A;  4OKH A;  1JUO A;  2Y5I A;  4I5N B;  1XFU O;  1CFD A;  1J1D A;  1NCZ A;  2PVB A;  2WCB A;  5DKN A;  4A4B A;  1TCO B;  4YI8 A;  2OS8 B;  1UWO A;  3BOW B;  3NSL A;  1KSM A;  1HT9 A;  2SAS A;  1W7J B;  5HLV A;  4HRG A;  2KGB C;  1KFU S;  3F45 A;  1KK8 C;  3E3R A;  3JVT C;  4ETO A;  1KK7 Y;  2PAS A;  2BCB A;  4NDB A;  1J7R A;  2F8P A;  2JTT A;  1EG3 A;  3KHE A;  1B9A A;  2FCD A;  5I2Q A;  4ICB A;  3O4Y A;  1CMF A;  5DKQ A;  3IQO A;  3PLF B;  1BJF A;  4I5L B;  5J3X A;  4F0Z B;  1R2U A;  1PAL A;  1NX0 A;  5GQQ C;  2LMT A;  1SL9 A;  1DJZ A;  4MRY A;  4FTG A;  3KPX A;  5AAN A;  1DGV A;  2HQW A;  1IJ5 A;  1W7I B;  4DUQ A;  1CB1 A;  3EVR A;  2WOR A;  2KYF A;  2PSR A;  4PHM A;  1WDC B;  1H4B A;  2G2B A;  2BL0 B;  1IGV A;  3M0W A;  3AAK A;  4AOM A;  1NCY A;  3BUO B;  1RFJ A;  3CZT X;  1K9U A;  1UP5 A;  4ORA B;  5B8I B;  3O6B A;  1QVI Z;  2JZI A;  1Y0V H;  1JF2 A;  3DVM A;  2L0P A;  1RRO A;  1GJY A;  3I5G B;  3EKJ A;  1VRK A;  1CFF A;  1SCM B;  5CSJ A;  1B8R A;  2H2K A;  3JTD C;  4USL A;  1KQM C;  2M8U A;  4CFR A;  2JPT A;  1SY9 A;  1YTZ C;  4ORC B;  5HKY A;  4PE0 A;  2G9B A;  4PHK A;  2O5G A;  1OZS A;  2BCA A;  3I5F C;  1QAS A;  5PAL A;  5AXI A;  2EHB A;  2LHL A;  2KI6 D;  1L2O B;  1XFW O;  1CLL A;  1GQM A;  1PSR A;  1QLS A;  3FWC A;  2MBX A;  2JOJ A;  3OHM B;  5HKZ A;  2ISD A;  1ZFS A;  3VRN A;  4P2Y B; 
#chains in the Genus database with same CATH topology
 2QEV A;  3PSR A;  2P70 A;  3BUM B;  3FE9 A;  3SIA A;  1WY9 A;  1KCY A;  3IQQ A;  4OVN F;  1TNW A;  1CMG A;  2QPT A;  2F3Y A;  3VRP A;  4NDC A;  1QVI Y;  1QAT A;  3A4U B;  3NGV A;  4CFQ A;  3SG2 A;  3KO0 A;  4D1E A;  1K93 D;  1PRW A;  1YX8 A;  1LKJ A;  3WHU B;  3PAT A;  2OS8 C;  3S0B A;  3PN7 B;  2KFG A;  1F55 A;  2GGZ A;  3BUW B;  3S0A A;  2L98 A;  1DMO A;  1KFX L;  4YGB B;  3SS5 A;  1RK9 A;  1V1G A;  2MAZ A;  2JWW A;  3VRR A;  2A4J A;  2ZFD A;  4CLN A;  5HL1 A;  1FI5 A;  1SCV A;  1M45 A;  2KNE A;  2L51 A;  1OOJ A;  1YVL A;  3JTD B;  1CDL A;  2BE6 A;  1EJ3 A;  2GTE A;  2I94 A;  1KQM B;  1S1E A;  2OPO A;  1JWD A;  1NPQ A;  1DJH A;  1BU3 A;  3OX5 A;  1XA5 A;  3DY9 A;  5CSI A;  1B47 A;  2KGR A;  2QAC A;  2ZRT A;  3KEV A;  3TDI A;  2NXQ A;  3I5F B;  3CLN A;  1Y1U A;  3UNW A;  1TUJ A;  5IBW A;  2PAL A;  2P6B B;  3C1V A;  1TNX A;  1TRF A;  2H8V A;  2MJW B;  1YUS A;  3D0Y A;  4GNK B;  3SG4 A;  4BY4 A;  1NUB A;  3R1V A;  1DGU A;  4INX A;  2KFF A;  2LLU A;  2WC8 A;  4GGN A;  1SYM A;  2WCF A;  5HKW A;  1OOH A;  3RM1 A;  1OE9 B;  3QME A;  2L5Y A;  3D0Y B;  3BOW A;  4MSP A;  3NSI A;  1QS7 A;  3TS5 B;  2VRG A;  4MZJ A;  1MR8 A;  1MQ1 A;  2KAY A;  1A2X A;  2PYQ A;  1Z4H A;  3RLZ A;  4I5K A;  2GGM A;  4N5X A;  4PCW A;  5HLO A;  1BMO A;  1BLQ A;  1SSE B;  1REC A;  3CR4 X;  2DOQ A;  4M2O A;  4M2P A;  1NX3 A;  2BCX A;  2CNP A;  3UO9 A;  3I5G C;  4A4C A;  1JFJ A;  2M0R A;  5ER5 A;  3TUY B;  1W9Z A;  1IH0 A;  1SCM C;  1KFU L;  3CYZ A;  1YUU A;  2F2O A;  1RTP 1;  2K61 A;  1CFP A;  1G33 A;  1EH2 A;  1TCF A;  1M31 A;  1IKU A;  1LA3 A;  1TIZ A;  2OTG B;  3CGA A;  1JFK A;  2Y4Q A;  2KDH A;  1BT6 A;  1F4O A;  1PK0 D;  4BY5 A;  1CM1 A;  1UHI A;  3LL8 B;  2JNF A;  3EK7 A;  2WCE A;  5AFP A;  2R2I A;  2ZKM X;  2L50 A;  4PE4 A;  1L2O C;  3CTN A;  1ZMZ A;  4DRW A;  2K60 A;  4GAO A;  1F54 A;  2KFH A;  1OSA A;  4U8D A;  1SKT A;  1E8A A;  4OZD A;  1B1G A;  3FE6 A;  2Y1M A;  1OOF A;  3H4S E;  3LK0 A;  2CTN A;  3AKB A;  1CKK A;  2LMV A;  4XJK B;  5ER4 X;  1SMG A;  1QX5 B;  1K2H A;  2BBN A;  1Y1A A;  2Y1N A;  1NX1 A;  3SG3 A;  2M9G A;  2PQL A;  5FI2 A;  1TNQ A;  1KQV A;  3FE8 A;  3IF7 A;  4YGE B;  2JRF A;  2LNK A;  4PAL A;  2LUC A;  1K9K A;  1F71 A;  1OMR A;  2L5X B;  2LE9 B;  3K21 A;  3PN7 C;  3D78 A;  3SG7 A;  2JT8 A;  3GK2 A;  2L2C A;  2H61 C;  2CT9 A;  3AAJ A;  3D74 A;  1AHR A;  1SL8 A;  2KHN A;  1LIN A;  2MRD A;  2COL B;  1ODB A;  2HF5 A;  3DXL A;  4PE7 A;  1AK8 A;  1QTX A;  3OGN A;  3D76 A;  4MLW A;  1B4C A;  1JBA A;  1NIW A;  2LVV A;  3EKH A;  3S0G A;  4GUK A;  5CSF A;  4GGF C;  4AQJ A;  1J7P A;  1A4P A;  4WQ3 A;  1K94 A;  1MXE A;  1ORG A;  1Q80 A;  5JJG A;  1BOD A;  4C0L A;  2LLS A;  2KBM A;  3BUN B;  1TN4 A;  2O60 A;  3GK4 X;  4P5O E;  3NSO A;  4AQI A;  1NCX A;  2MA2 A;  4OCI A;  1OMD A;  2KI4 B;  4WRI A;  1MUX A;  1N0Y A;  2CBL A;  2KBI A;  4OR9 B;  4N1G A;  1SR6 B;  4QJ5 B;  1ZUZ A;  3TDU A;  4N1F A;  1OOG A;  1OW4 A;  1TTX A;  2LHI A;  2K7C A;  2JU0 A;  2WC6 A;  1B7T Z;  3VB1 A;  3GOF A;  4C0J A;  2JPO A;  5HYD A;  1QV0 A;  3VGO A;  1SPY A;  2HET A;  4MEW A;  3SIB A;  3TS5 C;  1MF8 B;  2KSP A;  1QXP A;  4DS7 A;  5FYX A;  2LVJ A;  3DZT A;  5D7F A;  2H61 A;  2WCK A;  1CLB A;  5I2O A;  4TNC A;  5D69 A;  4WQ2 A;  1GGW A;  3LK1 A;  2NLN A;  1BOC A;  2L4I A;  3DYE A;  3VRQ A;  2CXJ A;  1B8L A;  1TNP A;  1T14 A;  2PMY A;  3CDN A;  3EG5 B;  2LMU A;  2SCP A;  2K2F A;  3TZ1 A;  4FQO A;  3TUY C;  4GGF A;  1SBJ A;  2K7D A;  4ZCU A;  5I2L A;  1LVC D;  3D10 A;  1CDN A;  2JC2 A;  4GPL B;  1S36 A;  3CZ2 A;  2KAX A;  1CDM A;  1XO5 A;  2OTG C;  1C07 A;  1KWO C;  3OB2 B;  1P28 A;  1S6J A;  2TN4 A;  1WRK A;  1JSA A;  4PHN A;  4OV2 A;  4HRH A;  4Q04 A;  1NP8 A;  1Y1X A;  1YVH A;  3EVV A;  5TNC A;  1J7O A;  2V53 A;  3SG6 A;  3PM8 A;  2PRU A;  2M29 A;  1ZOT B;  1DJY A;  5K89 A;  2FOT A;  1XFZ O;  1NX2 A;  3HX4 A;  1XFX O;  4MZK A;  5FI7 A;  3I5I C;  2KQY A;  2B1U A;  4R1E A;  1IQ3 A;  1B7T Y;  5KSZ A;  3O2P A;  4JQ0 D;  1TUZ A;  1UHH A;  1YR5 A;  2RGI A;  1SL7 A;  3I5H C;  4MBE A;  3QRX A;  1J7Q A;  3MSE B;  2LC5 A;  1XYD A;  2EGD A;  2WCJ A;  1D1O A;  1OZO A;  3BFH A;  1J55 A;  1C3Y A;  1G8I A;  1CTR A;  2LAN A;  2M7L A;  1XFY O;  1CFC A;  5CSN A;  2ZN8 A;  3PFV A;  4GFT A;  1DT7 B;  3DF0 B;  1LS8 A;  3DD4 A;  1KSO A;  2MHH A;  3HCM A;  1GM0 A;  3CZ0 A;  1WLM A;  3K1E A;  3O4X A;  1G4Y R;  1DJI A;  2HQ8 A;  3KF9 A;  2QEB A;  2JUL A;  2L2E A;  3TDZ A;  1AJ5 A;  4QJ4 B;  1X02 A;  3DVK A;  1RJV A;  2MLE C;  3CR5 X;  1XFV O;  2QEO A;  4PDZ A;  2FCE A;  2IS9 A;  1Z2C B;  3BFA A;  1JF0 A;  1FF1 A;  2K7O A;  1CLM A;  1KWO B;  3OBV A;  1AUI B;  3D77 A;  1HQV A;  2BAP A;  4JWQ A;  4YI9 A;  2NCO A;  1UHJ A;  1U5I A;  2GV5 A;  2ZN9 A;  2KQ6 A;  4GBA A;  4ZCV A;  2BNX A;  2KPH A;  2QDI A;  1K90 D;  1N65 A;  4C0K A;  4YGC B;  5F6T A;  1LA0 A;  2K8M B;  3FS7 A;  3Q8I A;  2YGU A;  4XJK A;  2BKI B;  4HSZ A;  1S26 D;  3L47 A;  2KI4 C;  4I5J A;  3B87 A;  1U5I B;  1CNP A;  3I5I B;  1SR6 C;  2LP2 A;  2WCM A;  3BQ3 A;  2WOS A;  5D3O A;  2F2P A;  3WXA A;  2E30 A;  4HRE E;  1EG4 A;  3I5H B;  3WHT B;  1H8B A;  3D75 A;  1S5G Z;  2AMI A;  3WNX B;  4YBH B;  4MRX A;  3OB1 B;  2JNX A;  2JXL A;  1A03 A;  2K0J A;  2WND A;  1QX2 A;  3SJS A;  2NCP A;  4DCK A;  4YRU A;  1MWN A;  1XK4 C;  2KOT A;  1C7W A;  3DVE A;  4QJ3 B;  3BUX B;  3BJH A;  1IWQ A;  2WCH A;  1PSB A;  2KYC A;  5DKR A;  1AVS A;  1DJW A;  1YUR A;  4IJ7 A;  2M1U A;  2K7B A;  2ZND A;  2F33 A;  3R72 A;  5JOL A;  3EK8 A;  2LP3 A;  3ICB A;  1UHN A;  1F8H A;  2MLF C;  2ZNE A;  1N2D A;  1M46 A;  2I2R E;  2EC6 C;  4NDD A;  1FPW A;  3OP0 A;  1IQ5 A;  5AEQ A;  5DIC A;  1QIV A;  3A8R A;  4PT1 A;  1L7Z A;  2WC5 A;  4PE1 A;  1OMV A;  5EL2 A;  1DVI A;  1NWD A;  3PM2 A;  2JXC A;  5CPV A;  2L4H A;  1NSH A;  1QJT A;  4F7F A;  4E68 A;  3FWB A;  2F3Z A;  3NHT A;  1UHK A;  5KTY A;  1S5G Y;  1KK8 B;  3JVT B;  4YGD B;  3CS1 A;  1XK4 A;  1ZAC A;  3OX6 A;  2K2A A;  3PJI A;  2LUX A;  3PAL A;  1GGZ A;  2KI6 C;  2JQ6 A;  1XFR A;  5G08 A;  4JD9 A;  2KLE A;  1M39 A;  4MN0 A;  5BPJ A;  3O78 A;  4XYN A;  3VRO A;  1SK6 D;  1BR1 B;  2Q4U A;  1A75 A;  1BF5 A;  3NXA A;  4NQG A;  1PVA A;  1DTL A;  2E6W A;  5KU1 A;  2LV7 A;  1ALV A;  1QLK A;  1QV1 A;  1F70 A;  1NYA A;  3FIA A;  3LLE A;  3R1P A;  1YX7 A;  3EK4 A;  4IL1 A;  1MXL C;  4ORB B;  1K9P A;  1A75 B;  1PVB A;  2KAV A;  1LXF C;  1CDP A;  2P71 A;  1C7V A;  4YGA A;  1S6I A;  1MHO A;  2LLT A;  3CAB A;  2ZRS A;  3SS4 A;  3NSK A;  3IVT A;  2M97 A;  2HPS A;  2M49 B;  5I94 A;  2M3W A;  1DF0 A;  4L9M A;  4JPZ B;  1S6C A;  2M7N A;  1DJG A;  2Q91 A;  2EC6 B;  1PUL A;  1XVJ A;  1QWV A;  1IRJ A;  3B86 A;  1UUS A;  1YRU B;  1AJ4 A;  1SRA A;  1QIW A;  1B8C A;  1UUR A;  3CWG A;  4MVF A;  1AP4 A;  1IG5 A;  1DF0 B;  1K96 A;  3B7A A;  1KFX S;  1WRL A;  1SW8 A;  1RWY A;  2I18 A;  2LM5 A;  1ALW A;  5AER A;  2FJU B;  2LAP A;  3S0D A;  3SG5 A;  2I7A A;  3DF0 A;  4CPV A;  1J1E A;  1V1F A;  1KK7 Z;  2BBM A;  3AKA A;  2JTZ A;  1S3P A;  2BKH B;  3ZWH A;  1JC2 A;  2M1K B;  1K8U A;  2BEC A;  1WLZ A;  2FJY A;  1QX7 A;  4CID A;  3CR2 A;  1DJX A;  1BG1 A;  4MZL A;  3DVJ A;  4UPG A;  3EVU A;  3BXK A;  3N7H A;  2BE4 A;  2AUC A;  2NZ0 A;  1DEK A;  1Y6W A;  1EXR A;  1EL4 A;  1WRZ A;  1TOP A;  1K95 A;  1R6P A;  2LVI A;  3ZNI A;  4M2Q A;  1WDC C;  3GK1 A;  1FI6 A;  1FW4 A;  1YRT B;  2LCP A;  2JT3 A;  2BL0 C;  1IIO A;  1FBV A;  1YUT A;  4PHJ A;  1SNL A;  2D8N A;  2LVK A;  2CCM A;  2JT0 A;  1A29 A;  2AAO A;  3SS3 A;  1M63 B;  1OQP A;  1CM4 A;  1DC1 A;  4DIR A;  5I8N A;  1F4Q A;  3BYA A;  1BR4 B;  3LCP C;  3R1O A;  1IJ6 A;  4INW A;  4OKH A;  1JUO A;  2Y5I A;  4FQT A;  4I5N B;  1XFU O;  1CFD A;  1J1D A;  1NCZ A;  2PVB A;  2WCB A;  5DKN A;  4A4B A;  1DEL A;  1C3Z A;  1TCO B;  4YI8 A;  2OS8 B;  1UWO A;  3BOW B;  3NSL A;  1KSM A;  1HT9 A;  2SAS A;  1W7J B;  5HLV A;  4HRG A;  2KGB C;  1KFU S;  3BFB A;  1KK8 C;  3CZ1 A;  3E3R A;  3F45 A;  3JVT C;  4ETO A;  1KK7 Y;  2PAS A;  2BCB A;  4NDB A;  1J7R A;  2F8P A;  2JTT A;  1EG3 A;  3KHE A;  1B9A A;  2FCD A;  5I2Q A;  4ICB A;  3O4Y A;  1CMF A;  5DKQ A;  3B6X A;  3IQO A;  3PLF B;  1BJF A;  4I5L B;  5J3X A;  4F0Z B;  1R2U A;  1PAL A;  1NX0 A;  5GQQ C;  2LMT A;  1SL9 A;  4KYN A;  1DJZ A;  4MRY A;  4FTG A;  3KPX A;  5AAN A;  1DGV A;  2HQW A;  1IJ5 A;  1W7I B;  4DUQ A;  1CB1 A;  3EVR A;  2WOR A;  2KYF A;  2PSR A;  4PHM A;  1WDC B;  1H4B A;  2G2B A;  1OOI X;  2BL0 B;  3S0E A;  4JKT A;  1IGV A;  3M0W A;  3AAK A;  4AOM A;  1NCY A;  3BUO B;  3S0F A;  2WCL A;  1RFJ A;  3CZT X;  3NHI A;  1K9U A;  1UP5 A;  2ERB A;  4ORA B;  5B8I B;  3O6B A;  1QVI Z;  2JZI A;  1Y0V H;  2KLD A;  3V2L A;  1JF2 A;  3DVM A;  2L0P A;  1RRO A;  1GJY A;  3I5G B;  3EKJ A;  1VRK A;  1CFF A;  3D73 A;  1SCM B;  5CSJ A;  3B88 A;  1B8R A;  2H2K A;  3JTD C;  3L4A A;  4USL A;  5FI6 A;  1KQM C;  2M8U A;  4CFR A;  2JPT A;  3L4L A;  1SY9 A;  1YTZ C;  4ORC B;  1DQE A;  5HKY A;  4PE0 A;  2G9B A;  4PHK A;  2O5G A;  1OZS A;  2BCA A;  3I5F C;  1QAS A;  5PAL A;  5AXI A;  2EHB A;  2LHL A;  2KI6 D;  1L2O B;  2QEH A;  1XFW O;  1CLL A;  1GQM A;  1PSR A;  1QLS A;  1TWO A;  3FWC A;  2MBX A;  3RZS A;  2JOJ A;  3OHM B;  5HKZ A;  2ISD A;  1ZFS A;  3VRN A;  4P2Y B; 
#chains in the Genus database with same CATH homology
 3PSR A;  3BUM B;  3SIA A;  1WY9 A;  1KCY A;  3IQQ A;  4OVN F;  1TNW A;  1CMG A;  2QPT A;  2F3Y A;  3VRP A;  4NDC A;  1QVI Y;  1QAT A;  3A4U B;  4CFQ A;  3SG2 A;  3KO0 A;  4D1E A;  1K93 D;  1PRW A;  1YX8 A;  1LKJ A;  3WHU B;  3PAT A;  2OS8 C;  3PN7 B;  2KFG A;  1F55 A;  2GGZ A;  3BUW B;  2L98 A;  1DMO A;  1KFX L;  4YGB B;  1RK9 A;  1V1G A;  2MAZ A;  2JWW A;  3VRR A;  2A4J A;  2ZFD A;  4CLN A;  1FI5 A;  1SCV A;  1M45 A;  2KNE A;  2L51 A;  1OOJ A;  1YVL A;  3JTD B;  1CDL A;  2BE6 A;  1EJ3 A;  2I94 A;  1KQM B;  1S1E A;  2OPO A;  1JWD A;  1NPQ A;  1DJH A;  1BU3 A;  3OX5 A;  1XA5 A;  5CSI A;  1B47 A;  2KGR A;  2QAC A;  2ZRT A;  3KEV A;  3TDI A;  2NXQ A;  3I5F B;  3CLN A;  1Y1U A;  5IBW A;  2PAL A;  2P6B B;  3C1V A;  1TNX A;  1TRF A;  2MJW B;  4GNK B;  1YUS A;  3D0Y A;  3SG4 A;  4BY4 A;  1NUB A;  1DGU A;  2KFF A;  2LLU A;  2WC8 A;  4GGN A;  1SYM A;  2WCF A;  5HKW A;  3RM1 A;  1OE9 B;  3D0Y B;  3BOW A;  4MSP A;  3NSI A;  1QS7 A;  3TS5 B;  2VRG A;  4MZJ A;  1MR8 A;  1MQ1 A;  2KAY A;  1A2X A;  3RLZ A;  4I5K A;  2GGM A;  4N5X A;  4PCW A;  5HLO A;  1BMO A;  1BLQ A;  1REC A;  3CR4 X;  2DOQ A;  4M2O A;  4M2P A;  1NX3 A;  2BCX A;  2CNP A;  4A4C A;  3I5G C;  1JFJ A;  2M0R A;  5ER5 A;  3TUY B;  1IH0 A;  1SCM C;  1KFU L;  1YUU A;  2F2O A;  1RTP 1;  2K61 A;  1CFP A;  1G33 A;  1EH2 A;  1TCF A;  1M31 A;  1IKU A;  1LA3 A;  1TIZ A;  2OTG B;  3CGA A;  1JFK A;  2Y4Q A;  2KDH A;  1BT6 A;  1F4O A;  1PK0 D;  4BY5 A;  1CM1 A;  1UHI A;  3LL8 B;  2JNF A;  3EK7 A;  2WCE A;  5AFP A;  2R2I A;  2ZKM X;  2L50 A;  4PE4 A;  1L2O C;  3CTN A;  1ZMZ A;  4DRW A;  4GAO A;  1F54 A;  2KFH A;  1OSA A;  4U8D A;  1SKT A;  1E8A A;  1B1G A;  2Y1M A;  3H4S E;  3LK0 A;  2CTN A;  3AKB A;  1CKK A;  2LMV A;  4XJK B;  5ER4 X;  1SMG A;  1QX5 B;  1K2H A;  2BBN A;  1Y1A A;  2Y1N A;  1NX1 A;  3SG3 A;  2M9G A;  1TNQ A;  1KQV A;  3IF7 A;  4YGE B;  2JRF A;  2LNK A;  4PAL A;  2LUC A;  1K9K A;  1F71 A;  1OMR A;  2L5X B;  2LE9 B;  3K21 A;  3PN7 C;  3SG7 A;  2JT8 A;  3GK2 A;  2H61 C;  2CT9 A;  3AAJ A;  1AHR A;  1SL8 A;  2KHN A;  1LIN A;  2MRD A;  2COL B;  1ODB A;  2HF5 A;  4PE7 A;  1AK8 A;  1QTX A;  4MLW A;  1B4C A;  1JBA A;  1NIW A;  2LVV A;  3EKH A;  4GUK A;  5CSF A;  4GGF C;  4AQJ A;  1J7P A;  1A4P A;  4WQ3 A;  1K94 A;  1MXE A;  1Q80 A;  5JJG A;  1BOD A;  4C0L A;  2LLS A;  2KBM A;  3BUN B;  1TN4 A;  2O60 A;  3GK4 X;  4P5O E;  3NSO A;  4AQI A;  1NCX A;  2MA2 A;  4OCI A;  1OMD A;  2KI4 B;  4WRI A;  1MUX A;  2CBL A;  1N0Y A;  2KBI A;  4OR9 B;  4N1G A;  1SR6 B;  4QJ5 B;  1ZUZ A;  3TDU A;  4N1F A;  2LHI A;  1TTX A;  4C0J A;  2K7C A;  2JU0 A;  1B7T Z;  3GOF A;  5HYD A;  1QV0 A;  3VGO A;  1SPY A;  2HET A;  4MEW A;  3SIB A;  3TS5 C;  1MF8 B;  2KSP A;  1QXP A;  4DS7 A;  5FYX A;  2LVJ A;  5D7F A;  2H61 A;  1CLB A;  5I2O A;  4TNC A;  5D69 A;  4WQ2 A;  1GGW A;  3LK1 A;  2NLN A;  1BOC A;  2L4I A;  3VRQ A;  2CXJ A;  1B8L A;  1TNP A;  2PMY A;  2LMU A;  2SCP A;  2K2F A;  3TZ1 A;  4FQO A;  3TUY C;  4GGF A;  1SBJ A;  2K7D A;  4ZCU A;  5I2L A;  1LVC D;  3D10 A;  1CDN A;  2JC2 A;  4GPL B;  1S36 A;  2KAX A;  1CDM A;  1XO5 A;  2OTG C;  1C07 A;  1KWO C;  3OB2 B;  1S6J A;  2TN4 A;  1WRK A;  1JSA A;  4PHN A;  4OV2 A;  4HRH A;  4Q04 A;  1NP8 A;  1Y1X A;  1YVH A;  3EVV A;  5TNC A;  1J7O A;  2V53 A;  3SG6 A;  3PM8 A;  2PRU A;  2M29 A;  1ZOT B;  1DJY A;  5K89 A;  2FOT A;  1XFZ O;  1NX2 A;  3HX4 A;  1XFX O;  4MZK A;  3I5I C;  2KQY A;  2B1U A;  4R1E A;  1IQ3 A;  1B7T Y;  5KSZ A;  3O2P A;  4JQ0 D;  1UHH A;  1YR5 A;  2RGI A;  1SL7 A;  3I5H C;  4MBE A;  3QRX A;  1J7Q A;  3MSE B;  2LC5 A;  1XYD A;  2EGD A;  1D1O A;  1OZO A;  1J55 A;  1G8I A;  1CTR A;  2LAN A;  2M7L A;  1XFY O;  1CFC A;  5CSN A;  2ZN8 A;  3PFV A;  4GFT A;  1DT7 B;  3DF0 B;  3DD4 A;  1KSO A;  2MHH A;  3HCM A;  1WLM A;  1G4Y R;  1DJI A;  2HQ8 A;  3KF9 A;  2JUL A;  2L2E A;  3TDZ A;  1AJ5 A;  4QJ4 B;  1X02 A;  3DVK A;  1RJV A;  2MLE C;  3CR5 X;  1XFV O;  4PDZ A;  2FCE A;  2IS9 A;  1JF0 A;  1FF1 A;  2K7O A;  1CLM A;  1KWO B;  1AUI B;  1HQV A;  4YI9 A;  4JWQ A;  2NCO A;  1UHJ A;  1U5I A;  2GV5 A;  2ZN9 A;  2KQ6 A;  4GBA A;  4ZCV A;  1K90 D;  1N65 A;  4C0K A;  4YGC B;  5F6T A;  1LA0 A;  2K8M B;  3FS7 A;  4XJK A;  2BKI B;  4HSZ A;  1S26 D;  2KI4 C;  4I5J A;  1U5I B;  1CNP A;  3I5I B;  1SR6 C;  2LP2 A;  3BQ3 A;  3WXA A;  2WOS A;  2F2P A;  2E30 A;  4HRE E;  1EG4 A;  3I5H B;  3WHT B;  1H8B A;  1S5G Z;  2AMI A;  3WNX B;  4YBH B;  4MRX A;  3OB1 B;  2JNX A;  2JXL A;  1A03 A;  2K0J A;  2WND A;  1QX2 A;  3SJS A;  2NCP A;  4DCK A;  4YRU A;  1MWN A;  1XK4 C;  2KOT A;  1C7W A;  3DVE A;  4QJ3 B;  3BUX B;  1IWQ A;  1PSB A;  2KYC A;  5DKR A;  1AVS A;  1DJW A;  1YUR A;  2M1U A;  2K7B A;  2ZND A;  2F33 A;  5JOL A;  3EK8 A;  2LP3 A;  3ICB A;  1UHN A;  1F8H A;  2MLF C;  2ZNE A;  1N2D A;  1M46 A;  2I2R E;  2EC6 C;  4NDD A;  1FPW A;  3OP0 A;  1IQ5 A;  5AEQ A;  1QIV A;  3A8R A;  1L7Z A;  4PE1 A;  1OMV A;  1DVI A;  1NWD A;  2JXC A;  5CPV A;  2L4H A;  1NSH A;  1QJT A;  4E68 A;  3FWB A;  2F3Z A;  1UHK A;  5KTY A;  1S5G Y;  1KK8 B;  3JVT B;  4YGD B;  3CS1 A;  1XK4 A;  1ZAC A;  3OX6 A;  2K2A A;  2LUX A;  3PAL A;  1GGZ A;  2KI6 C;  2JQ6 A;  5G08 A;  4MN0 A;  5BPJ A;  1M39 A;  3O78 A;  4XYN A;  3VRO A;  1SK6 D;  1BR1 B;  2Q4U A;  1A75 A;  1BF5 A;  3NXA A;  4NQG A;  1PVA A;  1DTL A;  2E6W A;  5KU1 A;  2LV7 A;  1ALV A;  1QLK A;  1QV1 A;  1F70 A;  1NYA A;  3FIA A;  3LLE A;  1YX7 A;  3EK4 A;  4IL1 A;  1MXL C;  4ORB B;  1K9P A;  1A75 B;  1PVB A;  2KAV A;  1LXF C;  1CDP A;  1C7V A;  4YGA A;  1S6I A;  1MHO A;  2LLT A;  2ZRS A;  3NSK A;  2M97 A;  2HPS A;  2M49 B;  2M3W A;  1DF0 A;  4L9M A;  4JPZ B;  1S6C A;  2M7N A;  1DJG A;  2Q91 A;  2EC6 B;  1PUL A;  1XVJ A;  1IRJ A;  1UUS A;  1YRU B;  1AJ4 A;  1SRA A;  1QIW A;  1B8C A;  1UUR A;  3CWG A;  4MVF A;  1AP4 A;  1IG5 A;  1DF0 B;  1K96 A;  1KFX S;  1WRL A;  1SW8 A;  1RWY A;  2I18 A;  2LM5 A;  1ALW A;  5AER A;  2FJU B;  2LAP A;  3SG5 A;  2I7A A;  3DF0 A;  4CPV A;  1J1E A;  1V1F A;  1KK7 Z;  2BBM A;  3AKA A;  2JTZ A;  1S3P A;  2BKH B;  3ZWH A;  1JC2 A;  2M1K B;  1K8U A;  2BEC A;  1WLZ A;  1QX7 A;  4CID A;  3CR2 A;  1DJX A;  1BG1 A;  4MZL A;  3DVJ A;  4UPG A;  3EVU A;  3BXK A;  2BE4 A;  2AUC A;  2NZ0 A;  1Y6W A;  1EXR A;  1EL4 A;  1WRZ A;  1K95 A;  1R6P A;  1TOP A;  2LVI A;  3ZNI A;  4M2Q A;  1WDC C;  3GK1 A;  1FI6 A;  1FW4 A;  1YRT B;  2LCP A;  2JT3 A;  2BL0 C;  1FBV A;  1YUT A;  4PHJ A;  1SNL A;  2D8N A;  2LVK A;  2CCM A;  2JT0 A;  1A29 A;  2AAO A;  1M63 B;  1OQP A;  1CM4 A;  4DIR A;  5I8N A;  1F4Q A;  3BYA A;  1BR4 B;  3LCP C;  1IJ6 A;  4OKH A;  1JUO A;  2Y5I A;  4I5N B;  1XFU O;  1CFD A;  1J1D A;  1NCZ A;  2PVB A;  2WCB A;  5DKN A;  4A4B A;  1TCO B;  4YI8 A;  2OS8 B;  1UWO A;  3BOW B;  3NSL A;  1KSM A;  1HT9 A;  2SAS A;  1W7J B;  5HLV A;  4HRG A;  2KGB C;  1KFU S;  3F45 A;  1KK8 C;  3E3R A;  3JVT C;  4ETO A;  1KK7 Y;  2PAS A;  2BCB A;  4NDB A;  1J7R A;  2F8P A;  2JTT A;  1EG3 A;  3KHE A;  1B9A A;  2FCD A;  5I2Q A;  4ICB A;  3O4Y A;  1CMF A;  5DKQ A;  3IQO A;  3PLF B;  1BJF A;  4I5L B;  5J3X A;  4F0Z B;  1R2U A;  1PAL A;  1NX0 A;  5GQQ C;  2LMT A;  1SL9 A;  1DJZ A;  4MRY A;  4FTG A;  3KPX A;  5AAN A;  1DGV A;  2HQW A;  1IJ5 A;  1W7I B;  4DUQ A;  1CB1 A;  3EVR A;  2WOR A;  2KYF A;  2PSR A;  4PHM A;  1WDC B;  1H4B A;  2G2B A;  2BL0 B;  1IGV A;  3M0W A;  3AAK A;  4AOM A;  1NCY A;  3BUO B;  1RFJ A;  3CZT X;  1K9U A;  1UP5 A;  4ORA B;  5B8I B;  3O6B A;  1QVI Z;  2JZI A;  1Y0V H;  1JF2 A;  3DVM A;  2L0P A;  1RRO A;  1GJY A;  3I5G B;  3EKJ A;  1VRK A;  1CFF A;  1SCM B;  5CSJ A;  1B8R A;  2H2K A;  3JTD C;  4USL A;  1KQM C;  2M8U A;  4CFR A;  2JPT A;  1SY9 A;  1YTZ C;  4ORC B;  5HKY A;  4PE0 A;  2G9B A;  4PHK A;  2O5G A;  1OZS A;  2BCA A;  3I5F C;  1QAS A;  5PAL A;  5AXI A;  2EHB A;  2LHL A;  2KI6 D;  1L2O B;  1XFW O;  1CLL A;  1GQM A;  1PSR A;  1QLS A;  3FWC A;  2MBX A;  2JOJ A;  3OHM B;  5HKZ A;  2ISD A;  1ZFS A;  3VRN A;  4P2Y B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...