2LLTA

Post-translational s-nitrosylation is an endogenous factor fine-tuning human s100a1 protein properties
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
93
structure length
92
Chain Sequence
GSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVANNFFWENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Protein S100-A1
publication title Post-translational S-Nitrosylation Is an Endogenous Factor Fine Tuning the Properties of Human S100A1 Protein.
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 92
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2lltA00
4MEWA 3EK8A 4GFTA 4L9MA 3TDZA 2EC6B 1CMFA 4GGNA 1SYMA 1XO5A 1DJGA 1NPQA 4GNKB 1AP4A 4Q04A 3E3RA 1DGUA 1FF1A 1OMDA 2NXQA 1SRAA 3O78A 5HLVA 1Y1XA 3K21A 2CXJA 2K0JA 2JU0A 2MRDA 1WY9A 3SG3A 2ZN8A 2FCDA 1TNWA 2G2BA 4PE7A 2SCPA 1EL4A 1AK8A 5I8NA 3WNXB 1MF8B 3SG7A 1JUOA 2LM5A 2LLUA 4M2PA 1FI6A 1KQMB 1CLMA 1UHKA 1JC2A 1TNPA 3TUYB 1JF2A 1KFUL 1B9AA 2WCEA 3OX6A 4GGFA 1NCXA 1Y0VH 1VRKA 1D1OA 1KFXL 1J7PA 2LLTA 3LCPC 2L4HA 2M3WA 2BCXA 3C1VA 3CR4X 4PALA 4OKHA 1B8LA 1RK9A 2L4IA 3AKAA 5I2OA 1XFUO 1SBJA 2JULA 1B7TY 1L2OB 2JT8A 3CLNA 4YI9A 4MRXA 1F70A 2KI6C 1CDMA 2FCEA 1F4QA 2KNEA 1UHIA 1XYDA 2NLNA 4OR9B 1F71A 1TNXA 3PN7B 1UP5A 4OVNF 3JVTB 1WLZA 2WC8A 2NCPA 1A75A 2PRUA 3D10A 4PDZA 1Y1UA 1L2OC 4CIDA 3MSEB 1JWDA 2PSRA 2JXCA 1L7ZA 1ZUZA 4PE1A 2ISDA 2L0PA 2CCMA 4YBHB 3CZTX 2QACA 3GOFA 3SIAA 1XFZO 2JC2A 2WORA 3LK1A 2MAZA 1GQMA 1SMGA 1Y1AA 3KF9A 3OB2B 2KBIA 1RECA 2JXLA 1LKJA 4E68A 1A75B 2BCAA 4I5LB 1AHRA 2ZRSA 1SL9A 4I5NB 1PRWA 3JTDB 2LVIA 2M7NA 2F33A 2ZNEA 5BPJA 1NX0A 2KSPA 1J55A 2COLB 4PE4A 1SPYA 2JT3A 3FIAA 1OMVA 5HYDA 1F8HA 1RROA 3NSKA 2BKHB 2PALA 3FS7A 2CT9A 2KI4C 2L50A 5I2QA 2BE4A 1EG3A 2F3YA 2KBMA 2PMYA 1OZOA 4C0LA 3BUXB 3BOWA 3LLEA 1K9PA 3VRRA 1NUBA 1N2DA 1B8CA 2Y5IA 1HQVA 2OPOA 3TDIA 1BT6A 2M1UA 1AUIB 1KSOA 2M8UA 1N65A 5AXIA 2LHLA 1UHJA 4WQ2A 1B1GA 1OSAA 1S5GY 2LANA 5J3XA 1QV1A 4NDDA 2MA2A 3WHUB 2JQ6A 1SCVA 1KCYA 1QXPA 1KK7Y 1WDCB 1QVIY 2AMIA 4PHKA 4YGEB 3RM1A 1K9KA 1JSAA 2P6BB 2R2IA 5I2LA 3BUOB 2VRGA 2JWWA 1J7RA 1WDCC 3ZNIA 1KK8B 5CSJA 1YVLA 2LP2A 4GAOA 2BE6A 4ORCB 5AANA 1X02A 4HREE 1DMOA 4F0ZB 2KYFA 4YGDB 4QJ5B 2EHBA 4JPZB 2GGZA 1DT7B 1DJYA 2WOSA 2LMVA 2ZRTA 1IKUA 2Y1NA 4CLNA 1GGZA 2CBLA 1UHNA 1DF0B 2ZN9A 2I18A 2LLSA 2EC6C 1DTLA 1CFDA 2JTTA 2LMUA 1MHOA 2KAYA 5DKNA 1WLMA 3AKBA 3OB1B 1QJTA 1NX1A 1DGVA 5JJGA 4UPGA 1ZOTB 4HRHA 2LC5A 4MLWA 1IG5A 2H61C 4MZLA 3PSRA 3AAJA 3BYAA 1NSHA 4GPLB 1ALVA 1S5GZ 2M1KB 3PALA 2KHNA 1SL8A 2OTGB 4M2OA 4PCWA 2O5GA 1RTP1 2HF5A 4ICBA 2K7CA 3BUNB 1B47A 3SJSA 2OS8B 1AVSA 1KK7Z 5FYXA 1M63B 4MVFA 5ER4X 1QVIZ 1R6PA 3BUWB 2K7DA 1AJ5A 3TZ1A 4CFRA 4OV2A 2L5XB 1KQMC 2M0RA 1IQ3A 1IJ6A 4GUKA 3TUYC 4BY4A 1A29A 2HQ8A 2OS8C 1A2XA 2Q4UA 2I94A 1K94A 1XFVO 4QJ4B 1TNQA 1FW4A 2K7OA 3I5FB 5IBWA 2KFHA 1EG4A 3DF0B 1GGWA 5TNCA 1MR8A 1WRLA 3AAKA 1CKKA 1A03A 1XFXO 2JNFA 1NX2A 3FWBA 1MXEA 1RFJA 2JOJA 1XFWO 1E8AA 1DJXA 1SNLA 1BOCA 2SASA 4MRYA 1CFCA 1TTXA 3D0YB 3EK7A 2JZIA 4XJKB 4YGAA 1GJYA 2KYCA 3VROA 3QRXA 2D8NA 1BF5A 3HCMA 1M39A 2IS9A 2DOQA 1ZMZA 3PN7C 2G9BA 3JVTC 3EVRA 1G4YR 1SK6D 3CWGA 4C0JA 1TCFA 1PVBA 2L2EA 4DIRA 1OOJA 4C0KA 1K2HA 1YX7A 1YURA 2MLFC 3KEVA 1S36A 2LUCA 1QV0A 1ZACA 1TN4A 2BECA 3M0WA 4ORBB 4WQ3A 2HETA 2LHIA 3OP0A 2BCBA 3VRQA 2QPTA 3NXAA 1S6CA 1B8RA 1LA0A 2KAXA 2KOTA 3DVJA 4JQ0D 5CSNA 5HLOA 2F3ZA 2RGIA 2KI6D 5PALA 1KQVA 1W7IB 5HKZA 3JTDC 1LINA 3OX5A 4MZKA 1SL7A 1F55A 3NSIA 3KPXA 4QJ3B 4PHMA 2KFGA 3A8RA 3I5HB 1CMGA 1BMOA 1SCMB 3BUMB 1BG1A 1B4CA 1FI5A 2BKIB 1JF0A 1CLBA 1H8BA 1F4OA 1XK4C 3TS5B 4AQJA 2HPSA 2TN4A 5DKQA 1MXLC 3CGAA 1QIWA 3I5HC 2WCFA 4M2QA 4N5XA 4U8DA 2KGRA 2E6WA 5ER5A 3ICBA 1YRTB 5D69A 2LAPA 2LVKA 1DJIA 1K90D 4ZCVA 5D7FA 1YUTA 1RWYA 1QIVA 3RLZA 1H4BA 2LV7A 3CS1A 1QASA 1KSMA 1C7WA 2M7LA 1MWNA 2MBXA 1Y6WA 1J7QA 2B1UA 1DF0A 5HKYA 2JNXA 3ZWHA 1LVCD 2H61A 1YVHA 3DVKA 1FBVA 3VRNA 3I5GB 5K89A 2MJWB 2BBNA 1SW8A 3NSOA 4PE0A 4WRIA 1YUSA 1PULA 1C7VA 1QLKA 1QX7A 1NWDA 1IJ5A 3DVMA 5HKWA 4YGCB 5F6TA 3GK4X 1J7OA 4CPVA 1XFYO 1CM4A 1KK8C 2K2FA 2KAVA 1CDPA 3WHTB 1SKTA 2CTNA 2L98A 4JWQA 5AERA 1PSRA 1HT9A 2K61A 1NCYA 3EVUA 1OE9B 2LMTA 2KQYA 4IL1A 4D1EA 3F45A 2BBMA 1QATA 3O4YA 1BLQA 4OCIA 1PK0D 1U5IB 2V53A 3H4SE 3SG2A 4I5JA 1BJFA 1IQ5A 2KGBC 1QX5B 3TDUA 4I5KA 4FTGA 3BXKA 1OQPA 1BR1B 1S6IA 1ODBA 2H2KA 2LUXA 3DF0A 2AUCA 2LP3A 2KFFA 1Q80A 3EK4A 1FPWA 1WRZA 3DD4A 4ETOA 2Y1MA 1CM1A 1TRFA 2MLEC 2I7AA 3SIBA 2JPTA 1IWQA 2JTZA 2OTGC 3D0YA 4XJKA 3EKJA 1A4PA 5CPVA 1CLLA 4DUQA 1YUUA 4YRUA 4DCKA 1R2UA 4A4BA 1PSBA 2M29A 1OZSA 1XVJA 1S26D 3O2PA 1CFFA 2GV5A 4YI8A 5DKRA 1UWOA 2WCBA 1QX2A 2FOTA 3KO0A 2LNKA 2HQWA 3IF7A 1M45A 4ORAB 1K95A 1CDNA 4PHJA 2BL0B 3I5FC 1M46A 1EH2A 3IQOA 2MHHA 2F2OA 1TIZA 2AAOA 4CFQA 1K96A 3IQQA 5KU1A 1G8IA 1S3PA 1DJHA 4A4CA 1TCOB 2BL0C 1KFUS 3SG4A 2LE9B 3BQ3A 4P5OE 1CB1A 4R1EA 5B8IB 1KFXS 2M49B 1IH0A 1XK4A 1J1DA 1SR6B 1S1EA 2Y4QA 4AOMA 1K9UA 3PM8A 1QLSA 1V1GA 2O60A 2ZKMX 1S6JA 1BR4B 3PLFB 2K8MB 3SG6A 1W7JB 1AJ4A 1YTZC 3O6BA 1UURA 1IRJA 3EVVA 3PFVA 1RJVA 3GK1A 4GGFC 1SR6C 3OHMB 1UUSA 1CNPA 1LXFC 1V1FA 4AQIA 3CR2A 4GBAA 5CSIA 3LL8B 1J1EA 1C07A 3CTNA 3NSLA 2LVJA 4ZCUA 4NQGA 5AEQA 1ALWA 4DRWA 2ZNDA 1UHHA 2F2PA 1TOPA 2NCOA 1IGVA 3WXAA 3VGOA 1NIWA 2LVVA 3PATA 5JOLA 1K8UA 3LK0A 2M97A 4MZJA 1CTRA 1OMRA 2KI4B 3DVEA 4P2YB 1SY9A 1KWOB 1DJWA 1NP8A 2A4JA 1MUXA 1QS7A 2F8PA 4XYNA 1SCMC 2GGMA 2LCPA 2CNPA 4N1FA 1K93D 4NDBA 2ZFDA 1LA3A 3TS5C 2FJUB 1M31A 1QTXA 4MN0A 1YRUB 1JFJA 1DJZA 1KWOC 3SG5A 1N0YA 4N1GA 1CDLA 5G08A 1B7TZ 1PVAA 2Q91A 4TNCA 1MQ1A 1DVIA 4HRGA 2I2RE 1NCZA 1NYAA 2K2AA 4HSZA 4PHNA 1YR5A 2NZ0A 2E30A 4BY5A 2JRFA 1XA5A 3GK2A 2PVBA 2WNDA 4USLA 3EKHA 1G33A 1F54A 1CFPA 2L51A 1JFKA 1PALA 1U5IA 1ZFSA 2PASA 3A4UB 3BOWB 1NX3A 3I5GC 4NDCA 4FQOA 2EGDA 5KSZA 4MBEA 4MSPA 2KQ6A 3I5IB 1BODA 1BU3A 2JT0A 3VRPA 1WRKA 3KHEA 4YGBB 5KTYA 1YX8A 3FWCA 2KDHA 5CSFA 5AFPA 3CR5X 5GQQC 2K7BA 2M9GA 4DS7A 1EXRA 1EJ3A 3HX4A 1JBAA 3I5IC
chains in the Genus database with same CATH superfamily
3UNWA 4MEWA 3EK8A 4GFTA 4L9MA 3TDZA 2EC6B 1CMFA 1OOIX 4GGNA 1SYMA 1XO5A 1DJGA 1NPQA 4GNKB 1AP4A 4Q04A 3D73A 3E3RA 1DGUA 1FF1A 1OMDA 2NXQA 1SRAA 2BNXA 3O78A 5HLVA 1Y1XA 2WCJA 3K21A 2CXJA 2K0JA 2JU0A 2MRDA 1WY9A 3SG3A 2ZN8A 2FCDA 1TNWA 2G2BA 5EL2A 4PE7A 2SCPA 1EL4A 1AK8A 5I8NA 3WNXB 1MF8B 3VB1A 3SG7A 1JUOA 2LM5A 2LLUA 4M2PA 1FI6A 1KQMB 1CLMA 1UHKA 1JC2A 1TNPA 3N7HA 3TUYB 1JF2A 1KFUL 1B9AA 1DELA 2WCEA 3OX6A 4GGFA 1Y0VH 1NCXA 1VRKA 1D1OA 1KFXL 1J7PA 2LLTA 3LCPC 1IIOA 2L4HA 2M3WA 2BCXA 3C1VA 3CR4X 5FI2A 1ORGA 2WCMA 4OKHA 4PALA 1B8LA 1RK9A 2L4IA 3AKAA 5I2OA 1XFUO 1SBJA 3D76A 4JKTA 3B6XA 2JULA 1B7TY 1L2OB 2JT8A 3CLNA 4IJ7A 4YI9A 4MRXA 1F70A 2KI6C 1CDMA 2FCEA 1F4QA 3S0FA 2KNEA 5CSNA 1UHIA 1XYDA 2NLNA 4OR9B 1F71A 1TNXA 3PN7B 1UP5A 2GTEA 2P70A 1WLZA 2WC8A 2PQLA 3JVTB 2NCPA 1A75A 2PRUA 3D10A 4PDZA 1Y1UA 1L2OC 3L4LA 4CIDA 3MSEB 1JWDA 2PSRA 3D77A 2JXCA 1L7ZA 1ZUZA 4PE1A 2ISDA 2L0PA 2CCMA 3SS5A 4YBHB 3CZTX 2QACA 3GOFA 3SIAA 1XFZO 2JC2A 2WORA 3LK1A 2MAZA 3NGVA 1GQMA 3O4XA 1SMGA 1Y1AA 3KF9A 3OB2B 2KBIA 1RECA 2QEBA 2JXLA 1LKJA 2WC6A 4E68A 1A75B 2BCAA 4I5LB 1AHRA 2ZRSA 3PM2A 1SL9A 4I5NB 1PRWA 3JTDB 2LVIA 2M7NA 3RZSA 2F33A 3BFHA 2ZNEA 2WC5A 5BPJA 1NX0A 2KSPA 1J55A 2COLB 4PE4A 1SPYA 2JT3A 3FIAA 1OMVA 5HYDA 1F8HA 1RROA 3NSKA 2BKHB 4OVNF 2PALA 1DEKA 3FS7A 2CT9A 2KLDA 2PYQA 2KI4C 1LS8A 3CABA 2L50A 5I2QA 3BFAA 2BE4A 1EG3A 2F3YA 2KBMA 2PMYA 1OZOA 4C0LA 3BUXB 3NHIA 3BOWA 3LLEA 1K9PA 3VRRA 3OBVA 2WCLA 1NUBA 5I94A 1N2DA 1B8CA 2Y5IA 1HQVA 2OPOA 3TDIA 1BT6A 2M1UA 1AUIB 1KSOA 2M8UA 1N65A 5AXIA 2LHLA 1UHJA 4WQ2A 1B1GA 1OSAA 1S5GY 4KYNA 2LANA 5J3XA 1QV1A 3B86A 3L4AA 4NDDA 2MA2A 3WHUB 2JQ6A 1SCVA 1KCYA 1QXPA 1KK7Y 1TUZA 1WDCB 3S0EA 1QVIY 2AMIA 4PHKA 4YGEB 3RM1A 1K9KA 1JSAA 2P6BB 2R2IA 5I2LA 3BUOB 2VRGA 2JWWA 1J7RA 3QMEA 1WDCC 1P28A 3ZNIA 1KK8B 5CSJA 1YVLA 2LP2A 4GAOA 2BE6A 4ORCB 5AANA 1X02A 2ERBA 4HREE 1DMOA 3CDNA 4F0ZB 2KYFA 4YGDB 4QJ5B 2EHBA 2K60A 4JPZB 2GGZA 1DT7B 1DJYA 3NHTA 2WOSA 2LMVA 2ZRTA 3R1VA 1IKUA 2Y1NA 4CLNA 1GGZA 2CBLA 1UHNA 1OOGA 1DF0B 2ZN9A 2I18A 1DC1A 2LLSA 2EC6C 1DTLA 1CFDA 2JTTA 2LMUA 1MHOA 2KAYA 5DKNA 1WLMA 3AKBA 3OB1B 1QJTA 1NX1A 1DGVA 5JJGA 4UPGA 1ZOTB 1C3YA 4HRHA 2LC5A 4MLWA 1IG5A 2H61C 4MZLA 5DICA 3BJHA 3PSRA 3AAJA 3BYAA 1NSHA 4GPLB 1ALVA 1S5GZ 2M1KB 3PALA 2KHNA 1SL8A 2OTGB 4M2OA 4PCWA 2O5GA 1RTP1 2HF5A 2BAPA 4ICBA 2K7CA 3SS3A 3BUNB 1B47A 3SJSA 2OS8B 1AVSA 1KK7Z 5FYXA 1M63B 3R1OA 4MVFA 5ER4X 1QVIZ 1R6PA 1SSEB 3BUWB 2K7DA 1AJ5A 3TZ1A 4CFRA 4OV2A 2L5XB 1KQMC 2M0RA 1IQ3A 1IJ6A 4GUKA 3TUYC 2QEVA 4BY4A 1A29A 2HQ8A 2OS8C 1A2XA 2Q4UA 2I94A 1K94A 1XFVO 5FI7A 4QJ4B 1TNQA 1FW4A 2K7OA 3I5FB 5IBWA 2KFHA 1EG4A 3DF0B 1GGWA 5TNCA 1MR8A 1WRLA 3AAKA 1CKKA 5FI6A 1A03A 1XFXO 2JNFA 1NX2A 3FWBA 1MXEA 1RFJA 2JOJA 3R72A 1XFWO 1E8AA 1DJXA 1SNLA 1BOCA 2SASA 4MRYA 1CFCA 1TTXA 3D0YB 3EK7A 2JZIA 4XJKB 4YGAA 1GJYA 2KYCA 2QDIA 3QRXA 2D8NA 3VROA 1BF5A 3HCMA 1M39A 2IS9A 2DOQA 1ZMZA 3PN7C 2G9BA 3JVTC 3EVRA 1G4YR 1SK6D 3CWGA 4C0JA 1TCFA 1GM0A 1PVBA 2L2EA 3CZ1A 4DIRA 1OOJA 2QEOA 4C0KA 1OW4A 1K2HA 1YX7A 1YURA 2MLFC 3KEVA 1S36A 2LUCA 1QV0A 1ZACA 1TN4A 2BECA 3M0WA 4ORBB 4WQ3A 2HETA 2LHIA 3OP0A 2BCBA 3VRQA 2QPTA 3NXAA 1S6CA 1B8RA 1LA0A 2KAXA 2KOTA 2QEHA 3CZ2A 3DVJA 4JQ0D 2F3ZA 2RGIA 2KI6D 5HLOA 5PALA 1KQVA 1W7IB 5HKZA 3JTDC 1LINA 3OX5A 4MZKA 1SL7A 1F55A 3NSIA 3KPXA 4QJ3B 4PHMA 2KFGA 3CYZA 3A8RA 3I5HB 1CMGA 1BMOA 1SCMB 3BUMB 1BG1A 1B4CA 1FI5A 2BKIB 3B87A 1JF0A 1CLBA 1H8BA 1F4OA 1XK4C 3TS5B 4AQJA 2HPSA 2TN4A 5DKQA 3S0AA 1MXLC 3CGAA 1QIWA 3I5HC 2WCFA 3D75A 4M2QA 4N5XA 4U8DA 2KGRA 2E6WA 3S0GA 5ER5A 3ICBA 1YRTB 5D69A 2FJYA 2LAPA 2LVKA 3DYEA 1DJIA 1K90D 4ZCVA 3DZTA 2JPOA 5D7FA 3V2LA 1YUTA 3B88A 3L47A 1RWYA 1QIVA 3RLZA 1H4BA 2LV7A 3CS1A 1QASA 1KSMA 1C7WA 2M7LA 1MWNA 2MBXA 2L2CA 1Y6WA 1J7QA 2B1UA 1DF0A 5HKYA 2JNXA 3ZWHA 1LVCD 2H61A 1YVHA 3DVKA 1FBVA 3VRNA 3I5GB 3B7AA 5K89A 2MJWB 2BBNA 1SW8A 3NSOA 4PE0A 4WRIA 4PT1A 2L5YA 1YUSA 2WCHA 1PULA 1C7VA 1QLKA 1QX7A 3EG5B 1NWDA 1IJ5A 3DVMA 5HKWA 4YGCB 5F6TA 3GK4X 1J7OA 4CPVA 1XFYO 1CM4A 1KK8C 2K2FA 2KAVA 1CDPA 3WHTB 1SKTA 2CTNA 2L98A 4JWQA 5AERA 1PSRA 1HT9A 2K61A 1NCYA 3EVUA 1OE9B 2LMTA 2KQYA 4IL1A 4D1EA 3F45A 2BBMA 1QATA 3O4YA 1BLQA 4OCIA 1PK0D 1U5IB 2V53A 3H4SE 3SG2A 4I5JA 1BJFA 1IQ5A 2KGBC 1QX5B 3TDUA 4I5KA 4FTGA 3BXKA 1OQPA 1BR1B 1S6IA 1ODBA 2H2KA 1TUJA 2LUXA 3DF0A 3UO9A 2AUCA 2LP3A 2KFFA 1Q80A 3EK4A 3FE8A 1FPWA 4INXA 1WRZA 3DD4A 4ETOA 2Y1MA 1CM1A 2WCKA 1TRFA 2MLEC 2I7AA 3SIBA 2JPTA 1IWQA 2JTZA 2OTGC 3D0YA 1DQEA 4XJKA 3EKJA 1T14A 1A4PA 5CPVA 1CLLA 4DUQA 1YUUA 4YRUA 4DCKA 1R2UA 4A4BA 1PSBA 2M29A 1OZSA 1XVJA 1S26D 3O2PA 1CFFA 2GV5A 4YI8A 5DKRA 1UWOA 2WCBA 1QX2A 2FOTA 3KO0A 2LNKA 2HQWA 2KPHA 1TWOA 3IF7A 1M45A 4ORAB 1K95A 1CDNA 4PHJA 2BL0B 3I5FC 1M46A 1EH2A 3IQOA 2MHHA 2F2OA 1TIZA 2AAOA 4CFQA 1K96A 3IQQA 5KU1A 1G8IA 1S3PA 1QWVA 1DJHA 4A4CA 1TCOB 3R1PA 2BL0C 1KFUS 3SG4A 2LE9B 3BQ3A 4P5OE 1CB1A 4R1EA 5B8IB 1KFXS 2M49B 1IH0A 1XK4A 1J1DA 1SR6B 5HL1A 1S1EA 2Y4QA 4AOMA 1K9UA 3PM8A 1QLSA 1V1GA 2O60A 2ZKMX 1S6JA 3DXLA 1BR4B 3PLFB 2K8MB 3SG6A 1W7JB 1AJ4A 1YTZC 3O6BA 5D3OA 1UURA 1IRJA 2P71A 3EVVA 2KLEA 1RJVA 3GK1A 3PFVA 4GGFC 1SR6C 4INWA 3OHMB 1UUSA 1CNPA 1LXFC 1V1FA 4AQIA 3CR2A 4GBAA 5CSIA 3LL8B 1J1EA 3FE9A 1C07A 3CTNA 3NSLA 4OZDA 2LVJA 4ZCUA 4NQGA 5AEQA 1ALWA 4DRWA 2ZNDA 1OOHA 1UHHA 2F2PA 1TOPA 2NCOA 1IGVA 3WXAA 3VGOA 1NIWA 2LVVA 3PATA 5JOLA 1K8UA 3PJIA 3OGNA 3LK0A 1Z2CB 2M97A 4MZJA 1CTRA 1OMRA 2H8VA 2KI4B 3DVEA 4P2YB 3SS4A 1SY9A 1KWOB 1DJWA 1NP8A 2A4JA 1MUXA 1QS7A 2F8PA 4XYNA 1SCMC 2GGMA 2LCPA 3FE6A 2CNPA 2YGUA 4N1FA 4FQTA 3BFBA 1K93D 4NDBA 2ZFDA 1LA3A 3TS5C 2FJUB 1M31A 1QTXA 4MN0A 1YRUB 1JFJA 1DJZA 1KWOC 3SG5A 1N0YA 1W9ZA 4N1GA 1CDLA 5G08A 3IVTA 1B7TZ 1PVAA 2Q91A 4TNCA 1MQ1A 1DVIA 3D78A 4HRGA 2I2RE 1OOFA 1NCZA 1NYAA 2K2AA 4HSZA 4PHNA 1YR5A 2NZ0A 2E30A 3DY9A 2JRFA 4BY5A 1XA5A 3GK2A 2PVBA 4F7FA 2WNDA 1Z4HA 3EKHA 4USLA 3K1EA 1G33A 1F54A 1XFRA 1CFPA 2L51A 1JFKA 1PALA 1U5IA 1ZFSA 2PASA 3A4UB 3BOWB 1NX3A 3I5GC 3Q8IA 4NDCA 4FQOA 2EGDA 3S0DA 5KSZA 4MBEA 4JD9A 4MSPA 2KQ6A 3I5IB 1BODA 1BU3A 2JT0A 3VRPA 1WRKA 3KHEA 4YGBB 3CZ0A 5KTYA 1YX8A 3FWCA 2KDHA 5CSFA 3S0BA 5AFPA 3CR5X 5GQQC 1C3ZA 2K7BA 2M9GA 3D74A 4DS7A 1EXRA 1EJ3A 3HX4A 1JBAA 3I5IC
chains in the Genus database with same CATH topology
4MEWA 3EK8A 4GFTA 4L9MA 3TDZA 2EC6B 1CMFA 4GGNA 1SYMA 1XO5A 1DJGA 1NPQA 4GNKB 1AP4A 4Q04A 3E3RA 1DGUA 1FF1A 1OMDA 2NXQA 1SRAA 3O78A 5HLVA 1Y1XA 3K21A 2CXJA 2K0JA 2JU0A 2MRDA 1WY9A 3SG3A 2ZN8A 2FCDA 1TNWA 2G2BA 4PE7A 2SCPA 1EL4A 1AK8A 5I8NA 3WNXB 1MF8B 3SG7A 1JUOA 2LM5A 2LLUA 4M2PA 1FI6A 1KQMB 1CLMA 1UHKA 1JC2A 1TNPA 3TUYB 1JF2A 1KFUL 1B9AA 2WCEA 3OX6A 4GGFA 1NCXA 1Y0VH 1VRKA 1D1OA 1KFXL 1J7PA 2LLTA 3LCPC 2L4HA 2M3WA 2BCXA 3C1VA 3CR4X 4PALA 4OKHA 1B8LA 1RK9A 2L4IA 3AKAA 5I2OA 1XFUO 1SBJA 2JULA 1B7TY 1L2OB 2JT8A 3CLNA 4YI9A 4MRXA 1F70A 2KI6C 1CDMA 2FCEA 1F4QA 2KNEA 1UHIA 1XYDA 2NLNA 4OR9B 1F71A 1TNXA 3PN7B 1UP5A 4OVNF 3JVTB 1WLZA 2WC8A 2NCPA 1A75A 2PRUA 3D10A 4PDZA 1Y1UA 1L2OC 4CIDA 3MSEB 1JWDA 2PSRA 2JXCA 1L7ZA 1ZUZA 4PE1A 2ISDA 2L0PA 2CCMA 4YBHB 3CZTX 2QACA 3GOFA 3SIAA 1XFZO 2JC2A 2WORA 3LK1A 2MAZA 1GQMA 1SMGA 1Y1AA 3KF9A 3OB2B 2KBIA 1RECA 2JXLA 1LKJA 4E68A 1A75B 2BCAA 4I5LB 1AHRA 2ZRSA 1SL9A 4I5NB 1PRWA 3JTDB 2LVIA 2M7NA 2F33A 2ZNEA 5BPJA 1NX0A 2KSPA 1J55A 2COLB 4PE4A 1SPYA 2JT3A 3FIAA 1OMVA 5HYDA 1F8HA 1RROA 3NSKA 2BKHB 2PALA 3FS7A 2CT9A 2KI4C 2L50A 5I2QA 2BE4A 1EG3A 2F3YA 2KBMA 2PMYA 1OZOA 4C0LA 3BUXB 3BOWA 3LLEA 1K9PA 3VRRA 1NUBA 1N2DA 1B8CA 2Y5IA 1HQVA 2OPOA 3TDIA 1BT6A 2M1UA 1AUIB 1KSOA 2M8UA 1N65A 5AXIA 2LHLA 1UHJA 4WQ2A 1B1GA 1OSAA 1S5GY 2LANA 5J3XA 1QV1A 4NDDA 2MA2A 3WHUB 2JQ6A 1SCVA 1KCYA 1QXPA 1KK7Y 1WDCB 1QVIY 2AMIA 4PHKA 4YGEB 3RM1A 1K9KA 1JSAA 2P6BB 2R2IA 5I2LA 3BUOB 2VRGA 2JWWA 1J7RA 1WDCC 3ZNIA 1KK8B 5CSJA 1YVLA 2LP2A 4GAOA 2BE6A 4ORCB 5AANA 1X02A 4HREE 1DMOA 4F0ZB 2KYFA 4YGDB 4QJ5B 2EHBA 4JPZB 2GGZA 1DT7B 1DJYA 2WOSA 2LMVA 2ZRTA 1IKUA 2Y1NA 4CLNA 1GGZA 2CBLA 1UHNA 1DF0B 2ZN9A 2I18A 2LLSA 2EC6C 1DTLA 1CFDA 2JTTA 2LMUA 1MHOA 2KAYA 5DKNA 1WLMA 3AKBA 3OB1B 1QJTA 1NX1A 1DGVA 5JJGA 4UPGA 1ZOTB 4HRHA 2LC5A 4MLWA 1IG5A 2H61C 4MZLA 3PSRA 3AAJA 3BYAA 1NSHA 4GPLB 1ALVA 1S5GZ 2M1KB 3PALA 2KHNA 1SL8A 2OTGB 4M2OA 4PCWA 2O5GA 1RTP1 2HF5A 4ICBA 2K7CA 3BUNB 1B47A 3SJSA 2OS8B 1AVSA 1KK7Z 5FYXA 1M63B 4MVFA 5ER4X 1QVIZ 1R6PA 3BUWB 2K7DA 1AJ5A 3TZ1A 4CFRA 4OV2A 2L5XB 1KQMC 2M0RA 1IQ3A 1IJ6A 4GUKA 3TUYC 4BY4A 1A29A 2HQ8A 2OS8C 1A2XA 2Q4UA 2I94A 1K94A 1XFVO 4QJ4B 1TNQA 1FW4A 2K7OA 3I5FB 5IBWA 2KFHA 1EG4A 3DF0B 1GGWA 5TNCA 1MR8A 1WRLA 3AAKA 1CKKA 1A03A 1XFXO 2JNFA 1NX2A 3FWBA 1MXEA 1RFJA 2JOJA 1XFWO 1E8AA 1DJXA 1SNLA 1BOCA 2SASA 4MRYA 1CFCA 1TTXA 3D0YB 3EK7A 2JZIA 4XJKB 4YGAA 1GJYA 2KYCA 3VROA 3QRXA 2D8NA 1BF5A 3HCMA 1M39A 2IS9A 2DOQA 1ZMZA 3PN7C 2G9BA 3JVTC 3EVRA 1G4YR 1SK6D 3CWGA 4C0JA 1TCFA 1PVBA 2L2EA 4DIRA 1OOJA 4C0KA 1K2HA 1YX7A 1YURA 2MLFC 3KEVA 1S36A 2LUCA 1QV0A 1ZACA 1TN4A 2BECA 3M0WA 4ORBB 4WQ3A 2HETA 2LHIA 3OP0A 2BCBA 3VRQA 2QPTA 3NXAA 1S6CA 1B8RA 1LA0A 2KAXA 2KOTA 3DVJA 4JQ0D 5CSNA 5HLOA 2F3ZA 2RGIA 2KI6D 5PALA 1KQVA 1W7IB 5HKZA 3JTDC 1LINA 3OX5A 4MZKA 1SL7A 1F55A 3NSIA 3KPXA 4QJ3B 4PHMA 2KFGA 3A8RA 3I5HB 1CMGA 1BMOA 1SCMB 3BUMB 1BG1A 1B4CA 1FI5A 2BKIB 1JF0A 1CLBA 1H8BA 1F4OA 1XK4C 3TS5B 4AQJA 2HPSA 2TN4A 5DKQA 1MXLC 3CGAA 1QIWA 3I5HC 2WCFA 4M2QA 4N5XA 4U8DA 2KGRA 2E6WA 5ER5A 3ICBA 1YRTB 5D69A 2LAPA 2LVKA 1DJIA 1K90D 4ZCVA 5D7FA 1YUTA 1RWYA 1QIVA 3RLZA 1H4BA 2LV7A 3CS1A 1QASA 1KSMA 1C7WA 2M7LA 1MWNA 2MBXA 1Y6WA 1J7QA 2B1UA 1DF0A 5HKYA 2JNXA 3ZWHA 1LVCD 2H61A 1YVHA 3DVKA 1FBVA 3VRNA 3I5GB 5K89A 2MJWB 2BBNA 1SW8A 3NSOA 4PE0A 4WRIA 1YUSA 1PULA 1C7VA 1QLKA 1QX7A 1NWDA 1IJ5A 3DVMA 5HKWA 4YGCB 5F6TA 3GK4X 1J7OA 4CPVA 1XFYO 1CM4A 1KK8C 2K2FA 2KAVA 1CDPA 3WHTB 1SKTA 2CTNA 2L98A 4JWQA 5AERA 1PSRA 1HT9A 2K61A 1NCYA 3EVUA 1OE9B 2LMTA 2KQYA 4IL1A 4D1EA 3F45A 2BBMA 1QATA 3O4YA 1BLQA 4OCIA 1PK0D 1U5IB 2V53A 3H4SE 3SG2A 4I5JA 1BJFA 1IQ5A 2KGBC 1QX5B 3TDUA 4I5KA 4FTGA 3BXKA 1OQPA 1BR1B 1S6IA 1ODBA 2H2KA 2LUXA 3DF0A 2AUCA 2LP3A 2KFFA 1Q80A 3EK4A 1FPWA 1WRZA 3DD4A 4ETOA 2Y1MA 1CM1A 1TRFA 2MLEC 2I7AA 3SIBA 2JPTA 1IWQA 2JTZA 2OTGC 3D0YA 4XJKA 3EKJA 1A4PA 5CPVA 1CLLA 4DUQA 1YUUA 4YRUA 4DCKA 1R2UA 4A4BA 1PSBA 2M29A 1OZSA 1XVJA 1S26D 3O2PA 1CFFA 2GV5A 4YI8A 5DKRA 1UWOA 2WCBA 1QX2A 2FOTA 3KO0A 2LNKA 2HQWA 3IF7A 1M45A 4ORAB 1K95A 1CDNA 4PHJA 2BL0B 3I5FC 1M46A 1EH2A 3IQOA 2MHHA 2F2OA 1TIZA 2AAOA 4CFQA 1K96A 3IQQA 5KU1A 1G8IA 1S3PA 1DJHA 4A4CA 1TCOB 2BL0C 1KFUS 3SG4A 2LE9B 3BQ3A 4P5OE 1CB1A 4R1EA 5B8IB 1KFXS 2M49B 1IH0A 1XK4A 1J1DA 1SR6B 1S1EA 2Y4QA 4AOMA 1K9UA 3PM8A 1QLSA 1V1GA 2O60A 2ZKMX 1S6JA 1BR4B 3PLFB 2K8MB 3SG6A 1W7JB 1AJ4A 1YTZC 3O6BA 1UURA 1IRJA 3EVVA 3PFVA 1RJVA 3GK1A 4GGFC 1SR6C 3OHMB 1UUSA 1CNPA 1LXFC 1V1FA 4AQIA 3CR2A 4GBAA 5CSIA 3LL8B 1J1EA 1C07A 3CTNA 3NSLA 2LVJA 4ZCUA 4NQGA 5AEQA 1ALWA 4DRWA 2ZNDA 1UHHA 2F2PA 1TOPA 2NCOA 1IGVA 3WXAA 3VGOA 1NIWA 2LVVA 3PATA 5JOLA 1K8UA 3LK0A 2M97A 4MZJA 1CTRA 1OMRA 2KI4B 3DVEA 4P2YB 1SY9A 1KWOB 1DJWA 1NP8A 2A4JA 1MUXA 1QS7A 2F8PA 4XYNA 1SCMC 2GGMA 2LCPA 2CNPA 4N1FA 1K93D 4NDBA 2ZFDA 1LA3A 3TS5C 2FJUB 1M31A 1QTXA 4MN0A 1YRUB 1JFJA 1DJZA 1KWOC 3SG5A 1N0YA 4N1GA 1CDLA 5G08A 1B7TZ 1PVAA 2Q91A 4TNCA 1MQ1A 1DVIA 4HRGA 2I2RE 1NCZA 1NYAA 2K2AA 4HSZA 4PHNA 1YR5A 2NZ0A 2E30A 4BY5A 2JRFA 1XA5A 3GK2A 2PVBA 2WNDA 4USLA 3EKHA 1G33A 1F54A 1CFPA 2L51A 1JFKA 1PALA 1U5IA 1ZFSA 2PASA 3A4UB 3BOWB 1NX3A 3I5GC 4NDCA 4FQOA 2EGDA 5KSZA 4MBEA 4MSPA 2KQ6A 3I5IB 1BODA 1BU3A 2JT0A 3VRPA 1WRKA 3KHEA 4YGBB 5KTYA 1YX8A 3FWCA 2KDHA 5CSFA 5AFPA 3CR5X 5GQQC 2K7BA 2M9GA 4DS7A 1EXRA 1EJ3A 3HX4A 1JBAA 3I5IC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MEW A;  3EK8 A;  4GFT A;  4L9M A;  3TDZ A;  2EC6 B;  1CMF A;  4GGN A;  1SYM A;  1XO5 A;  1DJG A;  1NPQ A;  4GNK B;  1AP4 A;  4Q04 A;  3E3R A;  1DGU A;  1FF1 A;  1OMD A;  2NXQ A;  1SRA A;  3O78 A;  5HLV A;  1Y1X A;  3K21 A;  2CXJ A;  2K0J A;  2JU0 A;  2MRD A;  1WY9 A;  3SG3 A;  2ZN8 A;  2FCD A;  1TNW A;  2G2B A;  4PE7 A;  2SCP A;  1EL4 A;  1AK8 A;  5I8N A;  3WNX B;  1MF8 B;  3SG7 A;  1JUO A;  2LM5 A;  2LLU A;  4M2P A;  1FI6 A;  1KQM B;  1CLM A;  1UHK A;  1JC2 A;  1TNP A;  3TUY B;  1JF2 A;  1KFU L;  1B9A A;  2WCE A;  3OX6 A;  4GGF A;  1NCX A;  1Y0V H;  1VRK A;  1D1O A;  1KFX L;  1J7P A;  2LLT A;  3LCP C;  2L4H A;  2M3W A;  2BCX A;  3C1V A;  3CR4 X;  4PAL A;  4OKH A;  1B8L A;  1RK9 A;  2L4I A;  3AKA A;  5I2O A;  1XFU O;  1SBJ A;  2JUL A;  1B7T Y;  1L2O B;  2JT8 A;  3CLN A;  4YI9 A;  4MRX A;  1F70 A;  2KI6 C;  1CDM A;  2FCE A;  1F4Q A;  2KNE A;  1UHI A;  1XYD A;  2NLN A;  4OR9 B;  1F71 A;  1TNX A;  3PN7 B;  1UP5 A;  4OVN F;  3JVT B;  1WLZ A;  2WC8 A;  2NCP A;  1A75 A;  2PRU A;  3D10 A;  4PDZ A;  1Y1U A;  1L2O C;  4CID A;  3MSE B;  1JWD A;  2PSR A;  2JXC A;  1L7Z A;  1ZUZ A;  4PE1 A;  2ISD A;  2L0P A;  2CCM A;  4YBH B;  3CZT X;  2QAC A;  3GOF A;  3SIA A;  1XFZ O;  2JC2 A;  2WOR A;  3LK1 A;  2MAZ A;  1GQM A;  1SMG A;  1Y1A A;  3KF9 A;  3OB2 B;  2KBI A;  1REC A;  2JXL A;  1LKJ A;  4E68 A;  1A75 B;  2BCA A;  4I5L B;  1AHR A;  2ZRS A;  1SL9 A;  4I5N B;  1PRW A;  3JTD B;  2LVI A;  2M7N A;  2F33 A;  2ZNE A;  5BPJ A;  1NX0 A;  2KSP A;  1J55 A;  2COL B;  4PE4 A;  1SPY A;  2JT3 A;  3FIA A;  1OMV A;  5HYD A;  1F8H A;  1RRO A;  3NSK A;  2BKH B;  2PAL A;  3FS7 A;  2CT9 A;  2KI4 C;  2L50 A;  5I2Q A;  2BE4 A;  1EG3 A;  2F3Y A;  2KBM A;  2PMY A;  1OZO A;  4C0L A;  3BUX B;  3BOW A;  3LLE A;  1K9P A;  3VRR A;  1NUB A;  1N2D A;  1B8C A;  2Y5I A;  1HQV A;  2OPO A;  3TDI A;  1BT6 A;  2M1U A;  1AUI B;  1KSO A;  2M8U A;  1N65 A;  5AXI A;  2LHL A;  1UHJ A;  4WQ2 A;  1B1G A;  1OSA A;  1S5G Y;  2LAN A;  5J3X A;  1QV1 A;  4NDD A;  2MA2 A;  3WHU B;  2JQ6 A;  1SCV A;  1KCY A;  1QXP A;  1KK7 Y;  1WDC B;  1QVI Y;  2AMI A;  4PHK A;  4YGE B;  3RM1 A;  1K9K A;  1JSA A;  2P6B B;  2R2I A;  5I2L A;  3BUO B;  2VRG A;  2JWW A;  1J7R A;  1WDC C;  3ZNI A;  1KK8 B;  5CSJ A;  1YVL A;  2LP2 A;  4GAO A;  2BE6 A;  4ORC B;  5AAN A;  1X02 A;  4HRE E;  1DMO A;  4F0Z B;  2KYF A;  4YGD B;  4QJ5 B;  2EHB A;  4JPZ B;  2GGZ A;  1DT7 B;  1DJY A;  2WOS A;  2LMV A;  2ZRT A;  1IKU A;  2Y1N A;  4CLN A;  1GGZ A;  2CBL A;  1UHN A;  1DF0 B;  2ZN9 A;  2I18 A;  2LLS A;  2EC6 C;  1DTL A;  1CFD A;  2JTT A;  2LMU A;  1MHO A;  2KAY A;  5DKN A;  1WLM A;  3AKB A;  3OB1 B;  1QJT A;  1NX1 A;  1DGV A;  5JJG A;  4UPG A;  1ZOT B;  4HRH A;  2LC5 A;  4MLW A;  1IG5 A;  2H61 C;  4MZL A;  3PSR A;  3AAJ A;  3BYA A;  1NSH A;  4GPL B;  1ALV A;  1S5G Z;  2M1K B;  3PAL A;  2KHN A;  1SL8 A;  2OTG B;  4M2O A;  4PCW A;  2O5G A;  1RTP 1;  2HF5 A;  4ICB A;  2K7C A;  3BUN B;  1B47 A;  3SJS A;  2OS8 B;  1AVS A;  1KK7 Z;  5FYX A;  1M63 B;  4MVF A;  5ER4 X;  1QVI Z;  1R6P A;  3BUW B;  2K7D A;  1AJ5 A;  3TZ1 A;  4CFR A;  4OV2 A;  2L5X B;  1KQM C;  2M0R A;  1IQ3 A;  1IJ6 A;  4GUK A;  3TUY C;  4BY4 A;  1A29 A;  2HQ8 A;  2OS8 C;  1A2X A;  2Q4U A;  2I94 A;  1K94 A;  1XFV O;  4QJ4 B;  1TNQ A;  1FW4 A;  2K7O A;  3I5F B;  5IBW A;  2KFH A;  1EG4 A;  3DF0 B;  1GGW A;  5TNC A;  1MR8 A;  1WRL A;  3AAK A;  1CKK A;  1A03 A;  1XFX O;  2JNF A;  1NX2 A;  3FWB A;  1MXE A;  1RFJ A;  2JOJ A;  1XFW O;  1E8A A;  1DJX A;  1SNL A;  1BOC A;  2SAS A;  4MRY A;  1CFC A;  1TTX A;  3D0Y B;  3EK7 A;  2JZI A;  4XJK B;  4YGA A;  1GJY A;  2KYC A;  3VRO A;  3QRX A;  2D8N A;  1BF5 A;  3HCM A;  1M39 A;  2IS9 A;  2DOQ A;  1ZMZ A;  3PN7 C;  2G9B A;  3JVT C;  3EVR A;  1G4Y R;  1SK6 D;  3CWG A;  4C0J A;  1TCF A;  1PVB A;  2L2E A;  4DIR A;  1OOJ A;  4C0K A;  1K2H A;  1YX7 A;  1YUR A;  2MLF C;  3KEV A;  1S36 A;  2LUC A;  1QV0 A;  1ZAC A;  1TN4 A;  2BEC A;  3M0W A;  4ORB B;  4WQ3 A;  2HET A;  2LHI A;  3OP0 A;  2BCB A;  3VRQ A;  2QPT A;  3NXA A;  1S6C A;  1B8R A;  1LA0 A;  2KAX A;  2KOT A;  3DVJ A;  4JQ0 D;  5CSN A;  5HLO A;  2F3Z A;  2RGI A;  2KI6 D;  5PAL A;  1KQV A;  1W7I B;  5HKZ A;  3JTD C;  1LIN A;  3OX5 A;  4MZK A;  1SL7 A;  1F55 A;  3NSI A;  3KPX A;  4QJ3 B;  4PHM A;  2KFG A;  3A8R A;  3I5H B;  1CMG A;  1BMO A;  1SCM B;  3BUM B;  1BG1 A;  1B4C A;  1FI5 A;  2BKI B;  1JF0 A;  1CLB A;  1H8B A;  1F4O A;  1XK4 C;  3TS5 B;  4AQJ A;  2HPS A;  2TN4 A;  5DKQ A;  1MXL C;  3CGA A;  1QIW A;  3I5H C;  2WCF A;  4M2Q A;  4N5X A;  4U8D A;  2KGR A;  2E6W A;  5ER5 A;  3ICB A;  1YRT B;  5D69 A;  2LAP A;  2LVK A;  1DJI A;  1K90 D;  4ZCV A;  5D7F A;  1YUT A;  1RWY A;  1QIV A;  3RLZ A;  1H4B A;  2LV7 A;  3CS1 A;  1QAS A;  1KSM A;  1C7W A;  2M7L A;  1MWN A;  2MBX A;  1Y6W A;  1J7Q A;  2B1U A;  1DF0 A;  5HKY A;  2JNX A;  3ZWH A;  1LVC D;  2H61 A;  1YVH A;  3DVK A;  1FBV A;  3VRN A;  3I5G B;  5K89 A;  2MJW B;  2BBN A;  1SW8 A;  3NSO A;  4PE0 A;  4WRI A;  1YUS A;  1PUL A;  1C7V A;  1QLK A;  1QX7 A;  1NWD A;  1IJ5 A;  3DVM A;  5HKW A;  4YGC B;  5F6T A;  3GK4 X;  1J7O A;  4CPV A;  1XFY O;  1CM4 A;  1KK8 C;  2K2F A;  2KAV A;  1CDP A;  3WHT B;  1SKT A;  2CTN A;  2L98 A;  4JWQ A;  5AER A;  1PSR A;  1HT9 A;  2K61 A;  1NCY A;  3EVU A;  1OE9 B;  2LMT A;  2KQY A;  4IL1 A;  4D1E A;  3F45 A;  2BBM A;  1QAT A;  3O4Y A;  1BLQ A;  4OCI A;  1PK0 D;  1U5I B;  2V53 A;  3H4S E;  3SG2 A;  4I5J A;  1BJF A;  1IQ5 A;  2KGB C;  1QX5 B;  3TDU A;  4I5K A;  4FTG A;  3BXK A;  1OQP A;  1BR1 B;  1S6I A;  1ODB A;  2H2K A;  2LUX A;  3DF0 A;  2AUC A;  2LP3 A;  2KFF A;  1Q80 A;  3EK4 A;  1FPW A;  1WRZ A;  3DD4 A;  4ETO A;  2Y1M A;  1CM1 A;  1TRF A;  2MLE C;  2I7A A;  3SIB A;  2JPT A;  1IWQ A;  2JTZ A;  2OTG C;  3D0Y A;  4XJK A;  3EKJ A;  1A4P A;  5CPV A;  1CLL A;  4DUQ A;  1YUU A;  4YRU A;  4DCK A;  1R2U A;  4A4B A;  1PSB A;  2M29 A;  1OZS A;  1XVJ A;  1S26 D;  3O2P A;  1CFF A;  2GV5 A;  4YI8 A;  5DKR A;  1UWO A;  2WCB A;  1QX2 A;  2FOT A;  3KO0 A;  2LNK A;  2HQW A;  3IF7 A;  1M45 A;  4ORA B;  1K95 A;  1CDN A;  4PHJ A;  2BL0 B;  3I5F C;  1M46 A;  1EH2 A;  3IQO A;  2MHH A;  2F2O A;  1TIZ A;  2AAO A;  4CFQ A;  1K96 A;  3IQQ A;  5KU1 A;  1G8I A;  1S3P A;  1DJH A;  4A4C A;  1TCO B;  2BL0 C;  1KFU S;  3SG4 A;  2LE9 B;  3BQ3 A;  4P5O E;  1CB1 A;  4R1E A;  5B8I B;  1KFX S;  2M49 B;  1IH0 A;  1XK4 A;  1J1D A;  1SR6 B;  1S1E A;  2Y4Q A;  4AOM A;  1K9U A;  3PM8 A;  1QLS A;  1V1G A;  2O60 A;  2ZKM X;  1S6J A;  1BR4 B;  3PLF B;  2K8M B;  3SG6 A;  1W7J B;  1AJ4 A;  1YTZ C;  3O6B A;  1UUR A;  1IRJ A;  3EVV A;  3PFV A;  1RJV A;  3GK1 A;  4GGF C;  1SR6 C;  3OHM B;  1UUS A;  1CNP A;  1LXF C;  1V1F A;  4AQI A;  3CR2 A;  4GBA A;  5CSI A;  3LL8 B;  1J1E A;  1C07 A;  3CTN A;  3NSL A;  2LVJ A;  4ZCU A;  4NQG A;  5AEQ A;  1ALW A;  4DRW A;  2ZND A;  1UHH A;  2F2P A;  1TOP A;  2NCO A;  1IGV A;  3WXA A;  3VGO A;  1NIW A;  2LVV A;  3PAT A;  5JOL A;  1K8U A;  3LK0 A;  2M97 A;  4MZJ A;  1CTR A;  1OMR A;  2KI4 B;  3DVE A;  4P2Y B;  1SY9 A;  1KWO B;  1DJW A;  1NP8 A;  2A4J A;  1MUX A;  1QS7 A;  2F8P A;  4XYN A;  1SCM C;  2GGM A;  2LCP A;  2CNP A;  4N1F A;  1K93 D;  4NDB A;  2ZFD A;  1LA3 A;  3TS5 C;  2FJU B;  1M31 A;  1QTX A;  4MN0 A;  1YRU B;  1JFJ A;  1DJZ A;  1KWO C;  3SG5 A;  1N0Y A;  4N1G A;  1CDL A;  5G08 A;  1B7T Z;  1PVA A;  2Q91 A;  4TNC A;  1MQ1 A;  1DVI A;  4HRG A;  2I2R E;  1NCZ A;  1NYA A;  2K2A A;  4HSZ A;  4PHN A;  1YR5 A;  2NZ0 A;  2E30 A;  4BY5 A;  2JRF A;  1XA5 A;  3GK2 A;  2PVB A;  2WND A;  4USL A;  3EKH A;  1G33 A;  1F54 A;  1CFP A;  2L51 A;  1JFK A;  1PAL A;  1U5I A;  1ZFS A;  2PAS A;  3A4U B;  3BOW B;  1NX3 A;  3I5G C;  4NDC A;  4FQO A;  2EGD A;  5KSZ A;  4MBE A;  4MSP A;  2KQ6 A;  3I5I B;  1BOD A;  1BU3 A;  2JT0 A;  3VRP A;  1WRK A;  3KHE A;  4YGB B;  5KTY A;  1YX8 A;  3FWC A;  2KDH A;  5CSF A;  5AFP A;  3CR5 X;  5GQQ C;  2K7B A;  2M9G A;  4DS7 A;  1EXR A;  1EJ3 A;  3HX4 A;  1JBA A;  3I5I C; 
#chains in the Genus database with same CATH topology
 3UNW A;  4MEW A;  3EK8 A;  4GFT A;  4L9M A;  3TDZ A;  2EC6 B;  1CMF A;  1OOI X;  4GGN A;  1SYM A;  1XO5 A;  1DJG A;  1NPQ A;  4GNK B;  1AP4 A;  4Q04 A;  3D73 A;  3E3R A;  1DGU A;  1FF1 A;  1OMD A;  2NXQ A;  1SRA A;  2BNX A;  3O78 A;  5HLV A;  1Y1X A;  2WCJ A;  3K21 A;  2CXJ A;  2K0J A;  2JU0 A;  2MRD A;  1WY9 A;  3SG3 A;  2ZN8 A;  2FCD A;  1TNW A;  2G2B A;  5EL2 A;  4PE7 A;  2SCP A;  1EL4 A;  1AK8 A;  5I8N A;  3WNX B;  1MF8 B;  3VB1 A;  3SG7 A;  1JUO A;  2LM5 A;  2LLU A;  4M2P A;  1FI6 A;  1KQM B;  1CLM A;  1UHK A;  1JC2 A;  1TNP A;  3N7H A;  3TUY B;  1JF2 A;  1KFU L;  1B9A A;  1DEL A;  2WCE A;  3OX6 A;  4GGF A;  1Y0V H;  1NCX A;  1VRK A;  1D1O A;  1KFX L;  1J7P A;  2LLT A;  3LCP C;  1IIO A;  2L4H A;  2M3W A;  2BCX A;  3C1V A;  3CR4 X;  5FI2 A;  1ORG A;  2WCM A;  4OKH A;  4PAL A;  1B8L A;  1RK9 A;  2L4I A;  3AKA A;  5I2O A;  1XFU O;  1SBJ A;  3D76 A;  4JKT A;  3B6X A;  2JUL A;  1B7T Y;  1L2O B;  2JT8 A;  3CLN A;  4IJ7 A;  4YI9 A;  4MRX A;  1F70 A;  2KI6 C;  1CDM A;  2FCE A;  1F4Q A;  3S0F A;  2KNE A;  5CSN A;  1UHI A;  1XYD A;  2NLN A;  4OR9 B;  1F71 A;  1TNX A;  3PN7 B;  1UP5 A;  2GTE A;  2P70 A;  1WLZ A;  2WC8 A;  2PQL A;  3JVT B;  2NCP A;  1A75 A;  2PRU A;  3D10 A;  4PDZ A;  1Y1U A;  1L2O C;  3L4L A;  4CID A;  3MSE B;  1JWD A;  2PSR A;  3D77 A;  2JXC A;  1L7Z A;  1ZUZ A;  4PE1 A;  2ISD A;  2L0P A;  2CCM A;  3SS5 A;  4YBH B;  3CZT X;  2QAC A;  3GOF A;  3SIA A;  1XFZ O;  2JC2 A;  2WOR A;  3LK1 A;  2MAZ A;  3NGV A;  1GQM A;  3O4X A;  1SMG A;  1Y1A A;  3KF9 A;  3OB2 B;  2KBI A;  1REC A;  2QEB A;  2JXL A;  1LKJ A;  2WC6 A;  4E68 A;  1A75 B;  2BCA A;  4I5L B;  1AHR A;  2ZRS A;  3PM2 A;  1SL9 A;  4I5N B;  1PRW A;  3JTD B;  2LVI A;  2M7N A;  3RZS A;  2F33 A;  3BFH A;  2ZNE A;  2WC5 A;  5BPJ A;  1NX0 A;  2KSP A;  1J55 A;  2COL B;  4PE4 A;  1SPY A;  2JT3 A;  3FIA A;  1OMV A;  5HYD A;  1F8H A;  1RRO A;  3NSK A;  2BKH B;  4OVN F;  2PAL A;  1DEK A;  3FS7 A;  2CT9 A;  2KLD A;  2PYQ A;  2KI4 C;  1LS8 A;  3CAB A;  2L50 A;  5I2Q A;  3BFA A;  2BE4 A;  1EG3 A;  2F3Y A;  2KBM A;  2PMY A;  1OZO A;  4C0L A;  3BUX B;  3NHI A;  3BOW A;  3LLE A;  1K9P A;  3VRR A;  3OBV A;  2WCL A;  1NUB A;  5I94 A;  1N2D A;  1B8C A;  2Y5I A;  1HQV A;  2OPO A;  3TDI A;  1BT6 A;  2M1U A;  1AUI B;  1KSO A;  2M8U A;  1N65 A;  5AXI A;  2LHL A;  1UHJ A;  4WQ2 A;  1B1G A;  1OSA A;  1S5G Y;  4KYN A;  2LAN A;  5J3X A;  1QV1 A;  3B86 A;  3L4A A;  4NDD A;  2MA2 A;  3WHU B;  2JQ6 A;  1SCV A;  1KCY A;  1QXP A;  1KK7 Y;  1TUZ A;  1WDC B;  3S0E A;  1QVI Y;  2AMI A;  4PHK A;  4YGE B;  3RM1 A;  1K9K A;  1JSA A;  2P6B B;  2R2I A;  5I2L A;  3BUO B;  2VRG A;  2JWW A;  1J7R A;  3QME A;  1WDC C;  1P28 A;  3ZNI A;  1KK8 B;  5CSJ A;  1YVL A;  2LP2 A;  4GAO A;  2BE6 A;  4ORC B;  5AAN A;  1X02 A;  2ERB A;  4HRE E;  1DMO A;  3CDN A;  4F0Z B;  2KYF A;  4YGD B;  4QJ5 B;  2EHB A;  2K60 A;  4JPZ B;  2GGZ A;  1DT7 B;  1DJY A;  3NHT A;  2WOS A;  2LMV A;  2ZRT A;  3R1V A;  1IKU A;  2Y1N A;  4CLN A;  1GGZ A;  2CBL A;  1UHN A;  1OOG A;  1DF0 B;  2ZN9 A;  2I18 A;  1DC1 A;  2LLS A;  2EC6 C;  1DTL A;  1CFD A;  2JTT A;  2LMU A;  1MHO A;  2KAY A;  5DKN A;  1WLM A;  3AKB A;  3OB1 B;  1QJT A;  1NX1 A;  1DGV A;  5JJG A;  4UPG A;  1ZOT B;  1C3Y A;  4HRH A;  2LC5 A;  4MLW A;  1IG5 A;  2H61 C;  4MZL A;  5DIC A;  3BJH A;  3PSR A;  3AAJ A;  3BYA A;  1NSH A;  4GPL B;  1ALV A;  1S5G Z;  2M1K B;  3PAL A;  2KHN A;  1SL8 A;  2OTG B;  4M2O A;  4PCW A;  2O5G A;  1RTP 1;  2HF5 A;  2BAP A;  4ICB A;  2K7C A;  3SS3 A;  3BUN B;  1B47 A;  3SJS A;  2OS8 B;  1AVS A;  1KK7 Z;  5FYX A;  1M63 B;  3R1O A;  4MVF A;  5ER4 X;  1QVI Z;  1R6P A;  1SSE B;  3BUW B;  2K7D A;  1AJ5 A;  3TZ1 A;  4CFR A;  4OV2 A;  2L5X B;  1KQM C;  2M0R A;  1IQ3 A;  1IJ6 A;  4GUK A;  3TUY C;  2QEV A;  4BY4 A;  1A29 A;  2HQ8 A;  2OS8 C;  1A2X A;  2Q4U A;  2I94 A;  1K94 A;  1XFV O;  5FI7 A;  4QJ4 B;  1TNQ A;  1FW4 A;  2K7O A;  3I5F B;  5IBW A;  2KFH A;  1EG4 A;  3DF0 B;  1GGW A;  5TNC A;  1MR8 A;  1WRL A;  3AAK A;  1CKK A;  5FI6 A;  1A03 A;  1XFX O;  2JNF A;  1NX2 A;  3FWB A;  1MXE A;  1RFJ A;  2JOJ A;  3R72 A;  1XFW O;  1E8A A;  1DJX A;  1SNL A;  1BOC A;  2SAS A;  4MRY A;  1CFC A;  1TTX A;  3D0Y B;  3EK7 A;  2JZI A;  4XJK B;  4YGA A;  1GJY A;  2KYC A;  2QDI A;  3QRX A;  2D8N A;  3VRO A;  1BF5 A;  3HCM A;  1M39 A;  2IS9 A;  2DOQ A;  1ZMZ A;  3PN7 C;  2G9B A;  3JVT C;  3EVR A;  1G4Y R;  1SK6 D;  3CWG A;  4C0J A;  1TCF A;  1GM0 A;  1PVB A;  2L2E A;  3CZ1 A;  4DIR A;  1OOJ A;  2QEO A;  4C0K A;  1OW4 A;  1K2H A;  1YX7 A;  1YUR A;  2MLF C;  3KEV A;  1S36 A;  2LUC A;  1QV0 A;  1ZAC A;  1TN4 A;  2BEC A;  3M0W A;  4ORB B;  4WQ3 A;  2HET A;  2LHI A;  3OP0 A;  2BCB A;  3VRQ A;  2QPT A;  3NXA A;  1S6C A;  1B8R A;  1LA0 A;  2KAX A;  2KOT A;  2QEH A;  3CZ2 A;  3DVJ A;  4JQ0 D;  2F3Z A;  2RGI A;  2KI6 D;  5HLO A;  5PAL A;  1KQV A;  1W7I B;  5HKZ A;  3JTD C;  1LIN A;  3OX5 A;  4MZK A;  1SL7 A;  1F55 A;  3NSI A;  3KPX A;  4QJ3 B;  4PHM A;  2KFG A;  3CYZ A;  3A8R A;  3I5H B;  1CMG A;  1BMO A;  1SCM B;  3BUM B;  1BG1 A;  1B4C A;  1FI5 A;  2BKI B;  3B87 A;  1JF0 A;  1CLB A;  1H8B A;  1F4O A;  1XK4 C;  3TS5 B;  4AQJ A;  2HPS A;  2TN4 A;  5DKQ A;  3S0A A;  1MXL C;  3CGA A;  1QIW A;  3I5H C;  2WCF A;  3D75 A;  4M2Q A;  4N5X A;  4U8D A;  2KGR A;  2E6W A;  3S0G A;  5ER5 A;  3ICB A;  1YRT B;  5D69 A;  2FJY A;  2LAP A;  2LVK A;  3DYE A;  1DJI A;  1K90 D;  4ZCV A;  3DZT A;  2JPO A;  5D7F A;  3V2L A;  1YUT A;  3B88 A;  3L47 A;  1RWY A;  1QIV A;  3RLZ A;  1H4B A;  2LV7 A;  3CS1 A;  1QAS A;  1KSM A;  1C7W A;  2M7L A;  1MWN A;  2MBX A;  2L2C A;  1Y6W A;  1J7Q A;  2B1U A;  1DF0 A;  5HKY A;  2JNX A;  3ZWH A;  1LVC D;  2H61 A;  1YVH A;  3DVK A;  1FBV A;  3VRN A;  3I5G B;  3B7A A;  5K89 A;  2MJW B;  2BBN A;  1SW8 A;  3NSO A;  4PE0 A;  4WRI A;  4PT1 A;  2L5Y A;  1YUS A;  2WCH A;  1PUL A;  1C7V A;  1QLK A;  1QX7 A;  3EG5 B;  1NWD A;  1IJ5 A;  3DVM A;  5HKW A;  4YGC B;  5F6T A;  3GK4 X;  1J7O A;  4CPV A;  1XFY O;  1CM4 A;  1KK8 C;  2K2F A;  2KAV A;  1CDP A;  3WHT B;  1SKT A;  2CTN A;  2L98 A;  4JWQ A;  5AER A;  1PSR A;  1HT9 A;  2K61 A;  1NCY A;  3EVU A;  1OE9 B;  2LMT A;  2KQY A;  4IL1 A;  4D1E A;  3F45 A;  2BBM A;  1QAT A;  3O4Y A;  1BLQ A;  4OCI A;  1PK0 D;  1U5I B;  2V53 A;  3H4S E;  3SG2 A;  4I5J A;  1BJF A;  1IQ5 A;  2KGB C;  1QX5 B;  3TDU A;  4I5K A;  4FTG A;  3BXK A;  1OQP A;  1BR1 B;  1S6I A;  1ODB A;  2H2K A;  1TUJ A;  2LUX A;  3DF0 A;  3UO9 A;  2AUC A;  2LP3 A;  2KFF A;  1Q80 A;  3EK4 A;  3FE8 A;  1FPW A;  4INX A;  1WRZ A;  3DD4 A;  4ETO A;  2Y1M A;  1CM1 A;  2WCK A;  1TRF A;  2MLE C;  2I7A A;  3SIB A;  2JPT A;  1IWQ A;  2JTZ A;  2OTG C;  3D0Y A;  1DQE A;  4XJK A;  3EKJ A;  1T14 A;  1A4P A;  5CPV A;  1CLL A;  4DUQ A;  1YUU A;  4YRU A;  4DCK A;  1R2U A;  4A4B A;  1PSB A;  2M29 A;  1OZS A;  1XVJ A;  1S26 D;  3O2P A;  1CFF A;  2GV5 A;  4YI8 A;  5DKR A;  1UWO A;  2WCB A;  1QX2 A;  2FOT A;  3KO0 A;  2LNK A;  2HQW A;  2KPH A;  1TWO A;  3IF7 A;  1M45 A;  4ORA B;  1K95 A;  1CDN A;  4PHJ A;  2BL0 B;  3I5F C;  1M46 A;  1EH2 A;  3IQO A;  2MHH A;  2F2O A;  1TIZ A;  2AAO A;  4CFQ A;  1K96 A;  3IQQ A;  5KU1 A;  1G8I A;  1S3P A;  1QWV A;  1DJH A;  4A4C A;  1TCO B;  3R1P A;  2BL0 C;  1KFU S;  3SG4 A;  2LE9 B;  3BQ3 A;  4P5O E;  1CB1 A;  4R1E A;  5B8I B;  1KFX S;  2M49 B;  1IH0 A;  1XK4 A;  1J1D A;  1SR6 B;  5HL1 A;  1S1E A;  2Y4Q A;  4AOM A;  1K9U A;  3PM8 A;  1QLS A;  1V1G A;  2O60 A;  2ZKM X;  1S6J A;  3DXL A;  1BR4 B;  3PLF B;  2K8M B;  3SG6 A;  1W7J B;  1AJ4 A;  1YTZ C;  3O6B A;  5D3O A;  1UUR A;  1IRJ A;  2P71 A;  3EVV A;  2KLE A;  1RJV A;  3GK1 A;  3PFV A;  4GGF C;  1SR6 C;  4INW A;  3OHM B;  1UUS A;  1CNP A;  1LXF C;  1V1F A;  4AQI A;  3CR2 A;  4GBA A;  5CSI A;  3LL8 B;  1J1E A;  3FE9 A;  1C07 A;  3CTN A;  3NSL A;  4OZD A;  2LVJ A;  4ZCU A;  4NQG A;  5AEQ A;  1ALW A;  4DRW A;  2ZND A;  1OOH A;  1UHH A;  2F2P A;  1TOP A;  2NCO A;  1IGV A;  3WXA A;  3VGO A;  1NIW A;  2LVV A;  3PAT A;  5JOL A;  1K8U A;  3PJI A;  3OGN A;  3LK0 A;  1Z2C B;  2M97 A;  4MZJ A;  1CTR A;  1OMR A;  2H8V A;  2KI4 B;  3DVE A;  4P2Y B;  3SS4 A;  1SY9 A;  1KWO B;  1DJW A;  1NP8 A;  2A4J A;  1MUX A;  1QS7 A;  2F8P A;  4XYN A;  1SCM C;  2GGM A;  2LCP A;  3FE6 A;  2CNP A;  2YGU A;  4N1F A;  4FQT A;  3BFB A;  1K93 D;  4NDB A;  2ZFD A;  1LA3 A;  3TS5 C;  2FJU B;  1M31 A;  1QTX A;  4MN0 A;  1YRU B;  1JFJ A;  1DJZ A;  1KWO C;  3SG5 A;  1N0Y A;  1W9Z A;  4N1G A;  1CDL A;  5G08 A;  3IVT A;  1B7T Z;  1PVA A;  2Q91 A;  4TNC A;  1MQ1 A;  1DVI A;  3D78 A;  4HRG A;  2I2R E;  1OOF A;  1NCZ A;  1NYA A;  2K2A A;  4HSZ A;  4PHN A;  1YR5 A;  2NZ0 A;  2E30 A;  3DY9 A;  2JRF A;  4BY5 A;  1XA5 A;  3GK2 A;  2PVB A;  4F7F A;  2WND A;  1Z4H A;  3EKH A;  4USL A;  3K1E A;  1G33 A;  1F54 A;  1XFR A;  1CFP A;  2L51 A;  1JFK A;  1PAL A;  1U5I A;  1ZFS A;  2PAS A;  3A4U B;  3BOW B;  1NX3 A;  3I5G C;  3Q8I A;  4NDC A;  4FQO A;  2EGD A;  3S0D A;  5KSZ A;  4MBE A;  4JD9 A;  4MSP A;  2KQ6 A;  3I5I B;  1BOD A;  1BU3 A;  2JT0 A;  3VRP A;  1WRK A;  3KHE A;  4YGB B;  3CZ0 A;  5KTY A;  1YX8 A;  3FWC A;  2KDH A;  5CSF A;  3S0B A;  5AFP A;  3CR5 X;  5GQQ C;  1C3Z A;  2K7B A;  2M9G A;  3D74 A;  4DS7 A;  1EXR A;  1EJ3 A;  3HX4 A;  1JBA A;  3I5I C; 
#chains in the Genus database with same CATH homology
 4MEW A;  3EK8 A;  4GFT A;  4L9M A;  3TDZ A;  2EC6 B;  1CMF A;  4GGN A;  1SYM A;  1XO5 A;  1DJG A;  1NPQ A;  4GNK B;  1AP4 A;  4Q04 A;  3E3R A;  1DGU A;  1FF1 A;  1OMD A;  2NXQ A;  1SRA A;  3O78 A;  5HLV A;  1Y1X A;  3K21 A;  2CXJ A;  2K0J A;  2JU0 A;  2MRD A;  1WY9 A;  3SG3 A;  2ZN8 A;  2FCD A;  1TNW A;  2G2B A;  4PE7 A;  2SCP A;  1EL4 A;  1AK8 A;  5I8N A;  3WNX B;  1MF8 B;  3SG7 A;  1JUO A;  2LM5 A;  2LLU A;  4M2P A;  1FI6 A;  1KQM B;  1CLM A;  1UHK A;  1JC2 A;  1TNP A;  3TUY B;  1JF2 A;  1KFU L;  1B9A A;  2WCE A;  3OX6 A;  4GGF A;  1NCX A;  1Y0V H;  1VRK A;  1D1O A;  1KFX L;  1J7P A;  2LLT A;  3LCP C;  2L4H A;  2M3W A;  2BCX A;  3C1V A;  3CR4 X;  4PAL A;  4OKH A;  1B8L A;  1RK9 A;  2L4I A;  3AKA A;  5I2O A;  1XFU O;  1SBJ A;  2JUL A;  1B7T Y;  1L2O B;  2JT8 A;  3CLN A;  4YI9 A;  4MRX A;  1F70 A;  2KI6 C;  1CDM A;  2FCE A;  1F4Q A;  2KNE A;  1UHI A;  1XYD A;  2NLN A;  4OR9 B;  1F71 A;  1TNX A;  3PN7 B;  1UP5 A;  4OVN F;  3JVT B;  1WLZ A;  2WC8 A;  2NCP A;  1A75 A;  2PRU A;  3D10 A;  4PDZ A;  1Y1U A;  1L2O C;  4CID A;  3MSE B;  1JWD A;  2PSR A;  2JXC A;  1L7Z A;  1ZUZ A;  4PE1 A;  2ISD A;  2L0P A;  2CCM A;  4YBH B;  3CZT X;  2QAC A;  3GOF A;  3SIA A;  1XFZ O;  2JC2 A;  2WOR A;  3LK1 A;  2MAZ A;  1GQM A;  1SMG A;  1Y1A A;  3KF9 A;  3OB2 B;  2KBI A;  1REC A;  2JXL A;  1LKJ A;  4E68 A;  1A75 B;  2BCA A;  4I5L B;  1AHR A;  2ZRS A;  1SL9 A;  4I5N B;  1PRW A;  3JTD B;  2LVI A;  2M7N A;  2F33 A;  2ZNE A;  5BPJ A;  1NX0 A;  2KSP A;  1J55 A;  2COL B;  4PE4 A;  1SPY A;  2JT3 A;  3FIA A;  1OMV A;  5HYD A;  1F8H A;  1RRO A;  3NSK A;  2BKH B;  2PAL A;  3FS7 A;  2CT9 A;  2KI4 C;  2L50 A;  5I2Q A;  2BE4 A;  1EG3 A;  2F3Y A;  2KBM A;  2PMY A;  1OZO A;  4C0L A;  3BUX B;  3BOW A;  3LLE A;  1K9P A;  3VRR A;  1NUB A;  1N2D A;  1B8C A;  2Y5I A;  1HQV A;  2OPO A;  3TDI A;  1BT6 A;  2M1U A;  1AUI B;  1KSO A;  2M8U A;  1N65 A;  5AXI A;  2LHL A;  1UHJ A;  4WQ2 A;  1B1G A;  1OSA A;  1S5G Y;  2LAN A;  5J3X A;  1QV1 A;  4NDD A;  2MA2 A;  3WHU B;  2JQ6 A;  1SCV A;  1KCY A;  1QXP A;  1KK7 Y;  1WDC B;  1QVI Y;  2AMI A;  4PHK A;  4YGE B;  3RM1 A;  1K9K A;  1JSA A;  2P6B B;  2R2I A;  5I2L A;  3BUO B;  2VRG A;  2JWW A;  1J7R A;  1WDC C;  3ZNI A;  1KK8 B;  5CSJ A;  1YVL A;  2LP2 A;  4GAO A;  2BE6 A;  4ORC B;  5AAN A;  1X02 A;  4HRE E;  1DMO A;  4F0Z B;  2KYF A;  4YGD B;  4QJ5 B;  2EHB A;  4JPZ B;  2GGZ A;  1DT7 B;  1DJY A;  2WOS A;  2LMV A;  2ZRT A;  1IKU A;  2Y1N A;  4CLN A;  1GGZ A;  2CBL A;  1UHN A;  1DF0 B;  2ZN9 A;  2I18 A;  2LLS A;  2EC6 C;  1DTL A;  1CFD A;  2JTT A;  2LMU A;  1MHO A;  2KAY A;  5DKN A;  1WLM A;  3AKB A;  3OB1 B;  1QJT A;  1NX1 A;  1DGV A;  5JJG A;  4UPG A;  1ZOT B;  4HRH A;  2LC5 A;  4MLW A;  1IG5 A;  2H61 C;  4MZL A;  3PSR A;  3AAJ A;  3BYA A;  1NSH A;  4GPL B;  1ALV A;  1S5G Z;  2M1K B;  3PAL A;  2KHN A;  1SL8 A;  2OTG B;  4M2O A;  4PCW A;  2O5G A;  1RTP 1;  2HF5 A;  4ICB A;  2K7C A;  3BUN B;  1B47 A;  3SJS A;  2OS8 B;  1AVS A;  1KK7 Z;  5FYX A;  1M63 B;  4MVF A;  5ER4 X;  1QVI Z;  1R6P A;  3BUW B;  2K7D A;  1AJ5 A;  3TZ1 A;  4CFR A;  4OV2 A;  2L5X B;  1KQM C;  2M0R A;  1IQ3 A;  1IJ6 A;  4GUK A;  3TUY C;  4BY4 A;  1A29 A;  2HQ8 A;  2OS8 C;  1A2X A;  2Q4U A;  2I94 A;  1K94 A;  1XFV O;  4QJ4 B;  1TNQ A;  1FW4 A;  2K7O A;  3I5F B;  5IBW A;  2KFH A;  1EG4 A;  3DF0 B;  1GGW A;  5TNC A;  1MR8 A;  1WRL A;  3AAK A;  1CKK A;  1A03 A;  1XFX O;  2JNF A;  1NX2 A;  3FWB A;  1MXE A;  1RFJ A;  2JOJ A;  1XFW O;  1E8A A;  1DJX A;  1SNL A;  1BOC A;  2SAS A;  4MRY A;  1CFC A;  1TTX A;  3D0Y B;  3EK7 A;  2JZI A;  4XJK B;  4YGA A;  1GJY A;  2KYC A;  3VRO A;  3QRX A;  2D8N A;  1BF5 A;  3HCM A;  1M39 A;  2IS9 A;  2DOQ A;  1ZMZ A;  3PN7 C;  2G9B A;  3JVT C;  3EVR A;  1G4Y R;  1SK6 D;  3CWG A;  4C0J A;  1TCF A;  1PVB A;  2L2E A;  4DIR A;  1OOJ A;  4C0K A;  1K2H A;  1YX7 A;  1YUR A;  2MLF C;  3KEV A;  1S36 A;  2LUC A;  1QV0 A;  1ZAC A;  1TN4 A;  2BEC A;  3M0W A;  4ORB B;  4WQ3 A;  2HET A;  2LHI A;  3OP0 A;  2BCB A;  3VRQ A;  2QPT A;  3NXA A;  1S6C A;  1B8R A;  1LA0 A;  2KAX A;  2KOT A;  3DVJ A;  4JQ0 D;  5CSN A;  5HLO A;  2F3Z A;  2RGI A;  2KI6 D;  5PAL A;  1KQV A;  1W7I B;  5HKZ A;  3JTD C;  1LIN A;  3OX5 A;  4MZK A;  1SL7 A;  1F55 A;  3NSI A;  3KPX A;  4QJ3 B;  4PHM A;  2KFG A;  3A8R A;  3I5H B;  1CMG A;  1BMO A;  1SCM B;  3BUM B;  1BG1 A;  1B4C A;  1FI5 A;  2BKI B;  1JF0 A;  1CLB A;  1H8B A;  1F4O A;  1XK4 C;  3TS5 B;  4AQJ A;  2HPS A;  2TN4 A;  5DKQ A;  1MXL C;  3CGA A;  1QIW A;  3I5H C;  2WCF A;  4M2Q A;  4N5X A;  4U8D A;  2KGR A;  2E6W A;  5ER5 A;  3ICB A;  1YRT B;  5D69 A;  2LAP A;  2LVK A;  1DJI A;  1K90 D;  4ZCV A;  5D7F A;  1YUT A;  1RWY A;  1QIV A;  3RLZ A;  1H4B A;  2LV7 A;  3CS1 A;  1QAS A;  1KSM A;  1C7W A;  2M7L A;  1MWN A;  2MBX A;  1Y6W A;  1J7Q A;  2B1U A;  1DF0 A;  5HKY A;  2JNX A;  3ZWH A;  1LVC D;  2H61 A;  1YVH A;  3DVK A;  1FBV A;  3VRN A;  3I5G B;  5K89 A;  2MJW B;  2BBN A;  1SW8 A;  3NSO A;  4PE0 A;  4WRI A;  1YUS A;  1PUL A;  1C7V A;  1QLK A;  1QX7 A;  1NWD A;  1IJ5 A;  3DVM A;  5HKW A;  4YGC B;  5F6T A;  3GK4 X;  1J7O A;  4CPV A;  1XFY O;  1CM4 A;  1KK8 C;  2K2F A;  2KAV A;  1CDP A;  3WHT B;  1SKT A;  2CTN A;  2L98 A;  4JWQ A;  5AER A;  1PSR A;  1HT9 A;  2K61 A;  1NCY A;  3EVU A;  1OE9 B;  2LMT A;  2KQY A;  4IL1 A;  4D1E A;  3F45 A;  2BBM A;  1QAT A;  3O4Y A;  1BLQ A;  4OCI A;  1PK0 D;  1U5I B;  2V53 A;  3H4S E;  3SG2 A;  4I5J A;  1BJF A;  1IQ5 A;  2KGB C;  1QX5 B;  3TDU A;  4I5K A;  4FTG A;  3BXK A;  1OQP A;  1BR1 B;  1S6I A;  1ODB A;  2H2K A;  2LUX A;  3DF0 A;  2AUC A;  2LP3 A;  2KFF A;  1Q80 A;  3EK4 A;  1FPW A;  1WRZ A;  3DD4 A;  4ETO A;  2Y1M A;  1CM1 A;  1TRF A;  2MLE C;  2I7A A;  3SIB A;  2JPT A;  1IWQ A;  2JTZ A;  2OTG C;  3D0Y A;  4XJK A;  3EKJ A;  1A4P A;  5CPV A;  1CLL A;  4DUQ A;  1YUU A;  4YRU A;  4DCK A;  1R2U A;  4A4B A;  1PSB A;  2M29 A;  1OZS A;  1XVJ A;  1S26 D;  3O2P A;  1CFF A;  2GV5 A;  4YI8 A;  5DKR A;  1UWO A;  2WCB A;  1QX2 A;  2FOT A;  3KO0 A;  2LNK A;  2HQW A;  3IF7 A;  1M45 A;  4ORA B;  1K95 A;  1CDN A;  4PHJ A;  2BL0 B;  3I5F C;  1M46 A;  1EH2 A;  3IQO A;  2MHH A;  2F2O A;  1TIZ A;  2AAO A;  4CFQ A;  1K96 A;  3IQQ A;  5KU1 A;  1G8I A;  1S3P A;  1DJH A;  4A4C A;  1TCO B;  2BL0 C;  1KFU S;  3SG4 A;  2LE9 B;  3BQ3 A;  4P5O E;  1CB1 A;  4R1E A;  5B8I B;  1KFX S;  2M49 B;  1IH0 A;  1XK4 A;  1J1D A;  1SR6 B;  1S1E A;  2Y4Q A;  4AOM A;  1K9U A;  3PM8 A;  1QLS A;  1V1G A;  2O60 A;  2ZKM X;  1S6J A;  1BR4 B;  3PLF B;  2K8M B;  3SG6 A;  1W7J B;  1AJ4 A;  1YTZ C;  3O6B A;  1UUR A;  1IRJ A;  3EVV A;  3PFV A;  1RJV A;  3GK1 A;  4GGF C;  1SR6 C;  3OHM B;  1UUS A;  1CNP A;  1LXF C;  1V1F A;  4AQI A;  3CR2 A;  4GBA A;  5CSI A;  3LL8 B;  1J1E A;  1C07 A;  3CTN A;  3NSL A;  2LVJ A;  4ZCU A;  4NQG A;  5AEQ A;  1ALW A;  4DRW A;  2ZND A;  1UHH A;  2F2P A;  1TOP A;  2NCO A;  1IGV A;  3WXA A;  3VGO A;  1NIW A;  2LVV A;  3PAT A;  5JOL A;  1K8U A;  3LK0 A;  2M97 A;  4MZJ A;  1CTR A;  1OMR A;  2KI4 B;  3DVE A;  4P2Y B;  1SY9 A;  1KWO B;  1DJW A;  1NP8 A;  2A4J A;  1MUX A;  1QS7 A;  2F8P A;  4XYN A;  1SCM C;  2GGM A;  2LCP A;  2CNP A;  4N1F A;  1K93 D;  4NDB A;  2ZFD A;  1LA3 A;  3TS5 C;  2FJU B;  1M31 A;  1QTX A;  4MN0 A;  1YRU B;  1JFJ A;  1DJZ A;  1KWO C;  3SG5 A;  1N0Y A;  4N1G A;  1CDL A;  5G08 A;  1B7T Z;  1PVA A;  2Q91 A;  4TNC A;  1MQ1 A;  1DVI A;  4HRG A;  2I2R E;  1NCZ A;  1NYA A;  2K2A A;  4HSZ A;  4PHN A;  1YR5 A;  2NZ0 A;  2E30 A;  4BY5 A;  2JRF A;  1XA5 A;  3GK2 A;  2PVB A;  2WND A;  4USL A;  3EKH A;  1G33 A;  1F54 A;  1CFP A;  2L51 A;  1JFK A;  1PAL A;  1U5I A;  1ZFS A;  2PAS A;  3A4U B;  3BOW B;  1NX3 A;  3I5G C;  4NDC A;  4FQO A;  2EGD A;  5KSZ A;  4MBE A;  4MSP A;  2KQ6 A;  3I5I B;  1BOD A;  1BU3 A;  2JT0 A;  3VRP A;  1WRK A;  3KHE A;  4YGB B;  5KTY A;  1YX8 A;  3FWC A;  2KDH A;  5CSF A;  5AFP A;  3CR5 X;  5GQQ C;  2K7B A;  2M9G A;  4DS7 A;  1EXR A;  1EJ3 A;  3HX4 A;  1JBA A;  3I5I C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...