2K8MB

S100a13-c2a binary complex structure
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
98
structure length
98
Chain Sequence
MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Putative uncharacterized protein
publication title S100A13-C2A binary complex structure-a key component in the acidic fibroblast growth factor for the non-classical pathway.
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 98
sequence length 98
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2k8mB00
1ALVA 1EG3A 1M31A 2H2KA 4XYNA 3LLEA 1SYMA 2KFGA 1BOCA 4XJKB 2F3YA 2KHNA 2KGBC 2L4HA 4ORBB 1QS7A 1CMFA 1CDNA 2KGRA 2KNEA 2P6BB 4NDBA 2RGIA 3EVUA 1CM1A 1XFYO 3KEVA 2M3WA 1NX3A 2PALA 3D10A 1A75A 1XFUO 1NX0A 1YUSA 1DT7B 1F4OA 1K95A 1UURA 4JWQA 2JZIA 3ZNIA 1B8LA 1NX2A 3DVEA 3IQOA 2KI6D 3VGOA 1GGZA 1EH2A 1XFZO 3A4UB 3I5IB 3SG4A 2KYFA 1F55A 2CT9A 2Y5IA 5CSJA 4CPVA 1FW4A 2K8MB 1SCMC 3FWBA 1QVIZ 1QJTA 1K8UA 1HQVA 4M2QA 1TNQA 2MLEC 3PN7B 2Q91A 4MZKA 1KWOB 1B9AA 1ZFSA 1CFDA 1BU3A 3FWCA 3CGAA 2JNXA 1M45A 2JTZA 4GBAA 1LINA 1OOJA 2JNFA 2O5GA 1G8IA 2JT8A 3DVKA 2R2IA 2KI4B 3QRXA 3JVTB 5BPJA 3OHMB 2KQYA 1S6IA 2B1UA 4YGAA 4N1GA 2LE9B 4PE7A 4DCKA 3BUOB 1MR8A 1U5IB 3D0YB 4I5KA 1TNWA 1SBJA 1UHKA 3OB2B 3VRNA 3KO0A 1FI5A 1IQ5A 3IF7A 1KFXS 1W7JB 2Y1MA 1NX1A 3NSKA 1XK4A 1EG4A 3SIAA 3BUXB 2ISDA 5FYXA 1KSOA 1XFWO 1AJ4A 2LNKA 4YRUA 1F71A 3DF0A 1YX7A 2JULA 3EK4A 2BKIB 1A75B 2FCDA 1OMVA 2OTGB 1J1DA 4YI8A 2L50A 2Y4QA 1SL8A 1H8BA 2TN4A 1IJ6A 4CIDA 1PULA 5D7FA 1IRJA 2NCOA 2KBIA 4OV2A 1CFPA 2Y1NA 4C0JA 3OP0A 1C7VA 1RWYA 1WLMA 3FS7A 2K2FA 2MLFC 3DVMA 2M1KB 4MRXA 2NCPA 3HCMA 4AQJA 1WDCC 1B47A 2KAVA 1OSAA 1Q80A 2LANA 2WC8A 3LK1A 4ZCVA 1V1GA 1KCYA 1N2DA 1AVSA 4DRWA 3E3RA 1S26D 1J1EA 1QATA 4ORCB 1M46A 2LP2A 5AERA 1NUBA 1C07A 1FBVA 1CLBA 2WCBA 2KQ6A 1K9KA 1K90D 4YGEB 1FI6A 1MXEA 4P5OE 4ICBA 2MJWB 2O60A 3O4YA 4I5JA 2KFFA 4YGDB 1IKUA 3H4SE 1NPQA 2JRFA 4C0LA 5HYDA 3TS5C 1VRKA 5AFPA 3O2PA 2I7AA 2BBNA 1SRAA 1TOPA 2ZRTA 2JT0A 3EK7A 1S5GZ 1JFKA 2BECA 4CLNA 2LMTA 5IBWA 1QIVA 5KU1A 2MBXA 1JC2A 1JUOA 1KQMB 2L98A 2LP3A 1DJYA 2LVJA 4FQOA 1JF0A 3VRRA 1UHIA 3CR5X 1XK4C 1XVJA 3NSLA 4N1FA 2KSPA 1ALWA 1KK7Z 2EHBA 1QASA 2LMUA 3FIAA 5F6TA 3SG7A 1YR5A 3ZWHA 3VROA 3BYAA 1C7WA 4I5NB 2PVBA 2LAPA 3DF0B 2PASA 1B4CA 1GGWA 1R6PA 3CTNA 2PSRA 1PSBA 2JPTA 3WHUB 4CFRA 3MSEB 3PFVA 4M2PA 2SCPA 3SG2A 1M39A 4GAOA 2JTTA 2K7DA 5KSZA 1J55A 1S3PA 2M1UA 1SNLA 1TRFA 4AOMA 1IH0A 1DJWA 2LC5A 1S6JA 1V1FA 2KOTA 2VRGA 2BE4A 2KBMA 2KI6C 2L51A 3DD4A 4QJ4B 1KFUS 3EKJA 1SCMB 3M0WA 1ZACA 2JQ6A 1SK6D 2HPSA 2BE6A 4PE4A 2AUCA 3BUMB 1F70A 1E8AA 1XFXO 1TNPA 3TDIA 5AXIA 2M0RA 4PCWA 1KK8C 2AMIA 1J7OA 1MQ1A 3VRQA 5I8NA 2BCBA 2FOTA 1AUIB 4WQ2A 1XYDA 5ER4X 5HKYA 1SW8A 1WY9A 2LUCA 1WRLA 3LCPC 2M7LA 3PM8A 1BG1A 4D1EA 2GGMA 1AP4A 1Y6WA 3BUWB 4U8DA 1F8HA 1TNXA 1SR6C 4PHNA 1SR6B 1UWOA 2JC2A 3CLNA 3K21A 1BMOA 4UPGA 1L2OC 2COLB 1L2OB 2LUXA 1B8RA 2SASA 5PALA 1PSRA 3I5HC 3WXAA 1K96A 1NCXA 4MSPA 5JOLA 5AANA 1YUUA 2H61A 2E30A 2KYCA 1NSHA 1A29A 1S5GY 5AEQA 1DMOA 1S36A 4MVFA 5I2QA 1NWDA 1F54A 3O6BA 3I5GC 3I5GB 2HETA 3LK0A 5GQQC 2F2PA 1DJGA 1CB1A 1OMRA 2CBLA 1Y0VH 5DKRA 1B7TY 3PATA 5KTYA 2BKHB 4PHJA 4PHKA 2LVIA 1D1OA 1BODA 1FPWA 1BR1B 4YBHB 1WDCB 1DJZA 1AJ5A 1TN4A 1SMGA 4CFQA 3O78A 4R1EA 1RTP1 3ICBA 5HLVA 1EJ3A 3WHTB 3LL8B 1LA0A 3VRPA 2WCEA 1HT9A 4TNCA 3RLZA 1J7RA 5ER5A 1QXPA 2LMVA 1SPYA 3IQQA 4GPLB 1SL9A 2MAZA 1OE9B 1JBAA 1UHNA 1OZSA 4OCIA 4A4BA 2Q4UA 3TS5B 4PE1A 1A4PA 1DGVA 2JXLA 2M29A 2JWWA 2JOJA 3HX4A 1KFXL 4MZLA 5I2OA 3NSOA 2V53A 1QVIY 2LHIA 1IWQA 2BL0C 1YTZC 1X02A 3SJSA 4HRHA 1GQMA 2OS8C 1YRUB 4USLA 4BY5A 4YGBB 1QX7A 1JF2A 4PHMA 2CXJA 2JT3A 1W7IB 1OMDA 2KFHA 4PDZA 1QX2A 2I18A 1OQPA 3GK1A 2H61C 3OX5A 1PALA 2K0JA 1CLLA 1MUXA 4GNKB 3NSIA 1DJHA 2LLTA 1RJVA 3AKBA 3TUYB 3TUYC 3TZ1A 1CDLA 1BLQA 4NQGA 1AK8A 1K2HA 4DIRA 4NDCA 1PRWA 1MWNA 2G2BA 3I5FC 3AAKA 3I5FB 1B1GA 2M8UA 1SKTA 1F4QA 4PE0A 4WQ3A 4HREE 2A4JA 2WORA 2ZNEA 1IG5A 3OX6A 4YGCB 1CDPA 2F8PA 1SL7A 1Y1XA 2CTNA 1AHRA 1NCZA 1S6CA 1UHHA 2F2OA 2GGZA 5CSNA 4ETOA 1RECA 1ZMZA 5I2LA 5JJGA 1OZOA 1GJYA 1B8CA 1LKJA 3EVVA 1CNPA 1TTXA 3DVJA 4A4CA 4DS7A 1LVCD 4MLWA 1JSAA 1JWDA 2LHLA 2PMYA 4ZCUA 1CFCA 1IQ3A 1LA3A 2GV5A 5K89A 2KAXA 1KQVA 2K2AA 1YURA 1N0YA 2ZN9A 4MEWA 1DF0A 1K9UA 1N65A 1QLKA 1NYAA 4GUKA 1KK8B 3CR4X 2K7BA 2ZKMX 3I5IC 4HSZA 4OVNF 2E6WA 3KHEA 2M97A 1YX8A 4QJ5B 3KPXA 2WOSA 3SG6A 1UP5A 1QV1A 3BUNB 4GGFC 4L9MA 3CR2A 1DVIA 2BCAA 1IGVA 2DOQA 3A8RA 2I2RE 2LV7A 4N5XA 1MXLC 1WRZA 1BT6A 1ZUZA 1PK0D 3RM1A 1NIWA 3PN7C 5HLOA 2EC6C 1KWOC 2EC6B 2LVVA 4MN0A 4JQ0D 4C0KA 4P2YB 1SY9A 3F45A 2K7OA 4GFTA 3PLFB 3TDZA 2WCFA 2FCEA 3GK4X 3GOFA 4GGNA 1SCVA 2BCXA 2LVKA 2ZFDA 3TDUA 3OB1B 2KI4C 3I5HB 4NDDA 3JVTC 1DJIA 1M63B 2LLUA 1XA5A 2ZRSA 1YVHA 4IL1A 3AKAA 1TCFA 1R2UA 2MRDA 1CMGA 2LM5A 4QJ3B 1G4YR 2F33A 1A2XA 1NCYA 3EVRA 3BOWA 3NXAA 2NLNA 4DUQA 1UHJA 1JFJA 2JXCA 1ODBA 2PRUA 1WRKA 1MHOA 1CM4A 1QTXA 1CDMA 4HRGA 5HKWA 2OPOA 5TNCA 1XO5A 2EGDA 3SG5A 1QV0A 3GK2A 1KFUL 1L7ZA 1NP8A 4I5LB 2ZNDA 3SG3A 4AQIA 1Y1AA 4MRYA 3SIBA 3CS1A 4XJKA 4YI9A 5HKZA 3KF9A 1PVBA 4MBEA 1J7PA 1ZOTB 1KK7Y 1RFJA 2WNDA 5CPVA 1DGUA 3EKHA 1DTLA 2FJUB 2I94A 2IS9A 2MHHA 5D69A 5DKQA 1EXRA 1YUTA 1PVAA 3PSRA 4Q04A 2CNPA 4ORAB 2JU0A 5G08A 2OTGC 3BXKA 1H4BA 2HQ8A 2HQWA 4E68A 1A03A 2M7NA 2M49B 5CSIA 5CSFA 5J3XA 5B8IB 2NZ0A 2LLSA 3AAJA 1DF0B 3EK8A 1K94A 1BR4B 1J7QA 4F0ZB 2BBMA 2HF5A 2D8NA 1Y1UA 1TCOB 4MZJA 1FF1A 1CTRA 2K7CA 3CZTX 3BQ3A 1YRTB 1MF8B 4GGFA 1K93D 2KAYA 1CKKA 2NXQA 1RROA 1QX5B 2LCPA 2CCMA 2BL0B 1EL4A 2L5XB 4OKHA 3CWGA 4WRIA 2M9GA 1QIWA 2OS8B 1KSMA 2F3ZA 1CFFA 3JTDC 2L0PA 3JTDB 4M2OA 1WLZA 2G9BA 1BJFA 2KDHA 1YVLA 3PALA 1XFVO 1K9PA 2AAOA 4OR9B 4BY4A 1G33A 1TIZA 1BF5A 3C1VA 1DJXA 3BOWB 3WNXB 2L2EA 2ZN8A 4FTGA 1LXFC 1KQMC 1U5IA 2K61A 2L4IA 1QLSA 3D0YA 4JPZB 1CLMA 1RK9A 4PALA 5DKNA 1UUSA 1S1EA 1IJ5A 2MA2A 1B7TZ 2QPTA 2QACA
chains in the Genus database with same CATH superfamily
1ALVA 1EG3A 1M31A 2H2KA 4XYNA 3LLEA 1SYMA 2KFGA 1BOCA 3D78A 2F3YA 2KHNA 4XJKB 2KGBC 2L4HA 4ORBB 1C3ZA 1QS7A 1CMFA 1CDNA 2KGRA 2KNEA 2P6BB 4NDBA 2RGIA 3EVUA 1CM1A 1XFYO 3KEVA 2M3WA 1NX3A 2PALA 2BNXA 3D10A 1A75A 4INWA 1XFUO 1NX0A 1YUSA 1DT7B 1F4OA 2K60A 4F7FA 1K95A 1UURA 4JWQA 2JZIA 3ZNIA 1B8LA 1NX2A 3DVEA 3IQOA 2KI6D 3NGVA 3VGOA 3PJIA 1GGZA 1EH2A 1XFZO 3A4UB 3CZ2A 3I5IB 3SG4A 4IJ7A 2KYFA 1F55A 2CT9A 2Y5IA 3B88A 5CSJA 1FW4A 2K8MB 5DKNA 1SCMC 3FWBA 1QVIZ 1QJTA 4CPVA 2KLEA 1K8UA 1HQVA 4M2QA 1TNQA 2MLEC 3PN7B 2Q91A 4MZKA 1KWOB 1B9AA 1ZFSA 1CFDA 3B87A 1BU3A 3FWCA 3CGAA 2JNXA 1M45A 2JTZA 4GBAA 2QEVA 1LINA 1OOJA 3D77A 2JNFA 2O5GA 1G8IA 3D74A 2JT8A 3DVKA 2R2IA 2KI4B 3QRXA 3JVTB 5BPJA 3OHMB 2KQYA 1S6IA 2B1UA 1OOIX 4YGAA 4N1GA 2LE9B 4PE7A 1C3YA 4DCKA 3BUOB 1MR8A 1U5IB 3D0YB 4I5KA 1TNWA 1DQEA 1SBJA 1UHKA 1TWOA 3OB2B 3VRNA 3KO0A 1FI5A 1IQ5A 3IF7A 1KFXS 1W7JB 2Y1MA 1NX1A 3DZTA 3NSKA 1XK4A 1EG4A 3SIAA 3FE6A 2PYQA 3BUXB 2ISDA 5FYXA 1KSOA 1XFWO 1AJ4A 2LNKA 4YRUA 1F71A 2KLDA 3DF0A 1OOHA 1YX7A 2JULA 3EK4A 1A75B 2BKIB 2FCDA 1OMVA 2OTGB 1J1DA 3EG5B 4YI8A 2L50A 2Y4QA 1SL8A 1H8BA 2TN4A 1IJ6A 4CIDA 1PULA 5D7FA 1IRJA 2NCOA 2KBIA 4OV2A 1CFPA 2Y1NA 2FJYA 4C0JA 3OP0A 1C7VA 1RWYA 1WLMA 3FS7A 2K2FA 2MLFC 2WCKA 2WC6A 3DVMA 2M1KB 4JKTA 4MRXA 3BFBA 2NCPA 3HCMA 3BJHA 4AQJA 1WDCC 1B47A 2KAVA 1OSAA 1Q80A 2LANA 2WC8A 3LK1A 4ZCVA 2WCMA 1V1GA 3UO9A 1KCYA 1N2DA 1AVSA 4DRWA 3RZSA 3E3RA 1S26D 1J1EA 1QATA 4ORCB 1M46A 2LP2A 5AERA 1NUBA 1C07A 1FBVA 1CLBA 2WCBA 2KQ6A 1K9KA 1K90D 4YGEB 1FI6A 1MXEA 4P5OE 4ICBA 2MJWB 2O60A 3O4YA 4I5JA 2KFFA 4YGDB 1IKUA 5EL2A 3H4SE 3R72A 3L4LA 1NPQA 2JRFA 4C0LA 5HYDA 3TS5C 1VRKA 3NHIA 3O2PA 2I7AA 5AFPA 2BBNA 1SRAA 2ERBA 3DXLA 1TOPA 2ZRTA 3L47A 3V2LA 1DEKA 2JT0A 1S5GZ 3EK7A 1JFKA 2GTEA 2BECA 3PM2A 4CLNA 2LMTA 5IBWA 1QIVA 3OGNA 1ORGA 3R1VA 5KU1A 2MBXA 1JC2A 1JUOA 1KQMB 2L98A 2LP3A 1DJYA 2LVJA 4FQOA 1JF0A 1OOFA 3VRRA 1UHIA 3CR5X 1XK4C 1XVJA 3NSLA 4N1FA 2KSPA 1ALWA 1KK7Z 2EHBA 1QASA 2LMUA 3FIAA 5F6TA 3SG7A 1YR5A 3ZWHA 3VROA 3S0FA 3BYAA 1C7WA 4I5NB 2PVBA 2LAPA 3DF0B 2PASA 3DY9A 3K1EA 5D3OA 1B4CA 3Q8IA 1R6PA 1GGWA 3CTNA 2PSRA 2QEBA 1PSBA 2JPTA 3CYZA 3WHUB 4CFRA 2P71A 3MSEB 3PFVA 4M2PA 4PT1A 2SCPA 3SG2A 1M39A 4GAOA 2JTTA 2K7DA 5KSZA 4INXA 1J55A 1S3PA 2M1UA 1SNLA 1TRFA 4AOMA 1IH0A 3QMEA 1DJWA 3SS5A 2LC5A 1S6JA 1V1FA 2KOTA 2VRGA 2BE4A 2KBMA 2KI6C 2L51A 3DD4A 1IIOA 4QJ4B 1KFUS 3EKJA 1SCMB 3M0WA 1ZACA 2JQ6A 1SK6D 4OZDA 2HPSA 2BE6A 4PE4A 2AUCA 3S0EA 3BUMB 1F70A 1E8AA 1OOGA 1XFXO 1TNPA 2P70A 5AXIA 3TDIA 2M0RA 1SSEB 4PCWA 1KK8C 2AMIA 1J7OA 1MQ1A 3VRQA 5I8NA 2BCBA 2FOTA 1AUIB 3BFHA 4WQ2A 1XYDA 2JPOA 5ER4X 5HKYA 1SW8A 1WY9A 2LUCA 1WRLA 2H8VA 1OW4A 3D75A 3LCPC 2M7LA 3PM8A 1BG1A 2QEOA 4D1EA 2GGMA 1AP4A 1Y6WA 3BUWB 4U8DA 1F8HA 1TNXA 1SR6C 4PHNA 1SR6B 1UWOA 2JC2A 3CLNA 3K21A 1BMOA 3NHTA 4UPGA 1L2OC 2COLB 1L2OB 2LUXA 1B8RA 2SASA 5PALA 1PSRA 3I5HC 3WXAA 1K96A 1NCXA 4MSPA 5JOLA 5AANA 1QWVA 1YUUA 2H61A 2E30A 2KYCA 3S0AA 1NSHA 1A29A 1S5GY 5AEQA 3D76A 1DMOA 1S36A 4MVFA 2WCJA 5I2QA 1NWDA 1F54A 3O6BA 3I5GC 3I5GB 2HETA 3LK0A 5GQQC 2F2PA 1DJGA 1CB1A 1OMRA 2CBLA 1Y0VH 1Z2CB 2L5YA 1B7TY 5DKRA 3PATA 5KTYA 2BKHB 4PHJA 4PHKA 2LVIA 1D1OA 1BODA 1FPWA 1BR1B 4YBHB 1WDCB 1DJZA 1AJ5A 1TN4A 1SMGA 2WC5A 4CFQA 3O78A 4R1EA 1RTP1 3ICBA 5HLVA 2QDIA 1EJ3A 3WHTB 3LL8B 1LA0A 3VRPA 2WCEA 1HT9A 4TNCA 3RLZA 1J7RA 5ER5A 3R1OA 3CZ1A 1QXPA 5DICA 2LMVA 1SPYA 2YGUA 3IQQA 4GPLB 1SL9A 2MAZA 1OE9B 2PQLA 1JBAA 1UHNA 1OZSA 4OCIA 4FQTA 4A4BA 2Q4UA 3TS5B 4PE1A 1A4PA 1DGVA 1TUJA 2WCHA 2JXLA 2M29A 2JWWA 1XFRA 2JOJA 3HX4A 1KFXL 4MZLA 5I2OA 3NSOA 2V53A 1QVIY 2LHIA 1IWQA 2BL0C 1YTZC 1X02A 3SJSA 4HRHA 1GQMA 2OS8C 1YRUB 4USLA 4BY5A 3S0BA 4YGBB 1QX7A 2L2CA 1JF2A 4PHMA 2CXJA 2JT3A 1W7IB 1OMDA 2KFHA 4PDZA 1QX2A 2I18A 1OQPA 1GM0A 3GK1A 2H61C 3OX5A 1PALA 2K0JA 1CLLA 3FE9A 1MUXA 4GNKB 3NSIA 1DJHA 2LLTA 1RJVA 3AKBA 3TUYB 3TUYC 3N7HA 3TZ1A 1CDLA 1BLQA 1P28A 4NQGA 1AK8A 1K2HA 4DIRA 4NDCA 1PRWA 2QEHA 1MWNA 2G2BA 3I5FC 3AAKA 3I5FB 1B1GA 1LS8A 2M8UA 1SKTA 1Z4HA 1F4QA 3B7AA 4PE0A 4WQ3A 4HREE 3IVTA 2A4JA 2WORA 2ZNEA 1IG5A 3OX6A 4YGCB 1CDPA 2F8PA 1SL7A 1Y1XA 2CTNA 1AHRA 1NCZA 1S6CA 1UHHA 2F2OA 2GGZA 3FE8A 5CSNA 1RECA 3S0DA 1ZMZA 4ETOA 5I2LA 5JJGA 1OZOA 1GJYA 1B8CA 1LKJA 3EVVA 1CNPA 1TTXA 3DVJA 4A4CA 4DS7A 5FI2A 1TUZA 1LVCD 4MLWA 4JD9A 1JSAA 1JWDA 2LHLA 2PMYA 4ZCUA 1CFCA 1IQ3A 1LA3A 2GV5A 5K89A 1DELA 2KAXA 3SS4A 1KQVA 2K2AA 1YURA 1N0YA 3UNWA 2ZN9A 4MEWA 1DF0A 1K9UA 1N65A 1QLKA 1NYAA 4GUKA 1KK8B 3CR4X 2K7BA 2ZKMX 3I5IC 4HSZA 4OVNF 2E6WA 3KHEA 2M97A 1YX8A 4QJ5B 3B6XA 3KPXA 2WOSA 3SG6A 1UP5A 1QV1A 3BUNB 4GGFC 4L9MA 3CR2A 1DVIA 2BCAA 3B86A 1IGVA 5I94A 2DOQA 3A8RA 2I2RE 2LV7A 4N5XA 1MXLC 3BFAA 1WRZA 1BT6A 1ZUZA 1PK0D 3RM1A 1NIWA 3PN7C 5HLOA 2EC6C 1KWOC 2EC6B 2LVVA 4MN0A 3L4AA 4JQ0D 4C0KA 4P2YB 1SY9A 3F45A 2K7OA 4GFTA 3PLFB 3D73A 3TDZA 2WCFA 2FCEA 3GK4X 3GOFA 4GGNA 1SCVA 2BCXA 2LVKA 2ZFDA 3CABA 3OB1B 1T14A 3TDUA 2KI4C 3I5HB 4NDDA 3JVTC 1DJIA 1M63B 2LLUA 1XA5A 2ZRSA 1YVHA 4IL1A 3AKAA 1TCFA 1R2UA 2MRDA 1CMGA 2LM5A 4QJ3B 1G4YR 2F33A 1A2XA 1NCYA 3EVRA 3BOWA 3NXAA 2NLNA 4DUQA 1UHJA 1JFJA 2JXCA 1ODBA 2PRUA 5FI7A 1WRKA 1MHOA 2BAPA 1CM4A 1QTXA 1CDMA 4HRGA 5HKWA 2OPOA 5TNCA 1XO5A 2EGDA 3SG5A 1QV0A 3GK2A 1KFUL 1L7ZA 1NP8A 4I5LB 2ZNDA 3SG3A 4AQIA 1Y1AA 4MRYA 3SIBA 3CS1A 4XJKA 4YI9A 5HKZA 3KF9A 1PVBA 3OBVA 4MBEA 5HL1A 1ZOTB 1J7PA 1KK7Y 1RFJA 2WNDA 5CPVA 1DGUA 3EKHA 1DTLA 2FJUB 2I94A 2IS9A 2MHHA 5D69A 5DKQA 1EXRA 1YUTA 1PVAA 3PSRA 4Q04A 2CNPA 4ORAB 2JU0A 5G08A 2OTGC 3BXKA 1H4BA 2HQ8A 2HQWA 3CZ0A 4E68A 2M7NA 2M49B 5CSIA 5CSFA 5J3XA 5B8IB 1A03A 2NZ0A 2LLSA 3AAJA 1DF0B 3EK8A 1K94A 3VB1A 1BR4B 1J7QA 4F0ZB 2BBMA 2HF5A 2D8NA 3S0GA 5FI6A 1Y1UA 3DYEA 1TCOB 4MZJA 1FF1A 1CTRA 2K7CA 3CZTX 3BQ3A 1YRTB 3SS3A 1MF8B 4GGFA 1K93D 2KAYA 1CKKA 2NXQA 1RROA 1QX5B 2LCPA 2CCMA 2BL0B 1EL4A 2L5XB 4OKHA 3CWGA 4WRIA 2M9GA 1QIWA 2OS8B 1KSMA 2F3ZA 1CFFA 1W9ZA 3JTDC 2L0PA 3JTDB 3R1PA 4M2OA 1WLZA 2G9BA 1DC1A 1BJFA 2KDHA 1YVLA 3PALA 1XFVO 1K9PA 2AAOA 4OR9B 4BY4A 2KPHA 1G33A 1TIZA 1BF5A 3C1VA 1DJXA 3BOWB 3WNXB 2L2EA 3CDNA 2ZN8A 4FTGA 4KYNA 1LXFC 1KQMC 1U5IA 2K61A 2L4IA 1QLSA 3D0YA 3O4XA 1CLMA 1RK9A 4JPZB 4PALA 1UUSA 2WCLA 1S1EA 1IJ5A 2MA2A 1B7TZ 2QPTA 2QACA
chains in the Genus database with same CATH topology
1ALVA 1EG3A 1M31A 2H2KA 4XYNA 3LLEA 1SYMA 2KFGA 1BOCA 4XJKB 2F3YA 2KHNA 2KGBC 2L4HA 4ORBB 1QS7A 1CMFA 1CDNA 2KGRA 2KNEA 2P6BB 4NDBA 2RGIA 3EVUA 1CM1A 1XFYO 3KEVA 2M3WA 1NX3A 2PALA 3D10A 1A75A 1XFUO 1NX0A 1YUSA 1DT7B 1F4OA 1K95A 1UURA 4JWQA 2JZIA 3ZNIA 1B8LA 1NX2A 3DVEA 3IQOA 2KI6D 3VGOA 1GGZA 1EH2A 1XFZO 3A4UB 3I5IB 3SG4A 2KYFA 1F55A 2CT9A 2Y5IA 5CSJA 4CPVA 1FW4A 2K8MB 1SCMC 3FWBA 1QVIZ 1QJTA 1K8UA 1HQVA 4M2QA 1TNQA 2MLEC 3PN7B 2Q91A 4MZKA 1KWOB 1B9AA 1ZFSA 1CFDA 1BU3A 3FWCA 3CGAA 2JNXA 1M45A 2JTZA 4GBAA 1LINA 1OOJA 2JNFA 2O5GA 1G8IA 2JT8A 3DVKA 2R2IA 2KI4B 3QRXA 3JVTB 5BPJA 3OHMB 2KQYA 1S6IA 2B1UA 4YGAA 4N1GA 2LE9B 4PE7A 4DCKA 3BUOB 1MR8A 1U5IB 3D0YB 4I5KA 1TNWA 1SBJA 1UHKA 3OB2B 3VRNA 3KO0A 1FI5A 1IQ5A 3IF7A 1KFXS 1W7JB 2Y1MA 1NX1A 3NSKA 1XK4A 1EG4A 3SIAA 3BUXB 2ISDA 5FYXA 1KSOA 1XFWO 1AJ4A 2LNKA 4YRUA 1F71A 3DF0A 1YX7A 2JULA 3EK4A 2BKIB 1A75B 2FCDA 1OMVA 2OTGB 1J1DA 4YI8A 2L50A 2Y4QA 1SL8A 1H8BA 2TN4A 1IJ6A 4CIDA 1PULA 5D7FA 1IRJA 2NCOA 2KBIA 4OV2A 1CFPA 2Y1NA 4C0JA 3OP0A 1C7VA 1RWYA 1WLMA 3FS7A 2K2FA 2MLFC 3DVMA 2M1KB 4MRXA 2NCPA 3HCMA 4AQJA 1WDCC 1B47A 2KAVA 1OSAA 1Q80A 2LANA 2WC8A 3LK1A 4ZCVA 1V1GA 1KCYA 1N2DA 1AVSA 4DRWA 3E3RA 1S26D 1J1EA 1QATA 4ORCB 1M46A 2LP2A 5AERA 1NUBA 1C07A 1FBVA 1CLBA 2WCBA 2KQ6A 1K9KA 1K90D 4YGEB 1FI6A 1MXEA 4P5OE 4ICBA 2MJWB 2O60A 3O4YA 4I5JA 2KFFA 4YGDB 1IKUA 3H4SE 1NPQA 2JRFA 4C0LA 5HYDA 3TS5C 1VRKA 5AFPA 3O2PA 2I7AA 2BBNA 1SRAA 1TOPA 2ZRTA 2JT0A 3EK7A 1S5GZ 1JFKA 2BECA 4CLNA 2LMTA 5IBWA 1QIVA 5KU1A 2MBXA 1JC2A 1JUOA 1KQMB 2L98A 2LP3A 1DJYA 2LVJA 4FQOA 1JF0A 3VRRA 1UHIA 3CR5X 1XK4C 1XVJA 3NSLA 4N1FA 2KSPA 1ALWA 1KK7Z 2EHBA 1QASA 2LMUA 3FIAA 5F6TA 3SG7A 1YR5A 3ZWHA 3VROA 3BYAA 1C7WA 4I5NB 2PVBA 2LAPA 3DF0B 2PASA 1B4CA 1GGWA 1R6PA 3CTNA 2PSRA 1PSBA 2JPTA 3WHUB 4CFRA 3MSEB 3PFVA 4M2PA 2SCPA 3SG2A 1M39A 4GAOA 2JTTA 2K7DA 5KSZA 1J55A 1S3PA 2M1UA 1SNLA 1TRFA 4AOMA 1IH0A 1DJWA 2LC5A 1S6JA 1V1FA 2KOTA 2VRGA 2BE4A 2KBMA 2KI6C 2L51A 3DD4A 4QJ4B 1KFUS 3EKJA 1SCMB 3M0WA 1ZACA 2JQ6A 1SK6D 2HPSA 2BE6A 4PE4A 2AUCA 3BUMB 1F70A 1E8AA 1XFXO 1TNPA 3TDIA 5AXIA 2M0RA 4PCWA 1KK8C 2AMIA 1J7OA 1MQ1A 3VRQA 5I8NA 2BCBA 2FOTA 1AUIB 4WQ2A 1XYDA 5ER4X 5HKYA 1SW8A 1WY9A 2LUCA 1WRLA 3LCPC 2M7LA 3PM8A 1BG1A 4D1EA 2GGMA 1AP4A 1Y6WA 3BUWB 4U8DA 1F8HA 1TNXA 1SR6C 4PHNA 1SR6B 1UWOA 2JC2A 3CLNA 3K21A 1BMOA 4UPGA 1L2OC 2COLB 1L2OB 2LUXA 1B8RA 2SASA 5PALA 1PSRA 3I5HC 3WXAA 1K96A 1NCXA 4MSPA 5JOLA 5AANA 1YUUA 2H61A 2E30A 2KYCA 1NSHA 1A29A 1S5GY 5AEQA 1DMOA 1S36A 4MVFA 5I2QA 1NWDA 1F54A 3O6BA 3I5GC 3I5GB 2HETA 3LK0A 5GQQC 2F2PA 1DJGA 1CB1A 1OMRA 2CBLA 1Y0VH 5DKRA 1B7TY 3PATA 5KTYA 2BKHB 4PHJA 4PHKA 2LVIA 1D1OA 1BODA 1FPWA 1BR1B 4YBHB 1WDCB 1DJZA 1AJ5A 1TN4A 1SMGA 4CFQA 3O78A 4R1EA 1RTP1 3ICBA 5HLVA 1EJ3A 3WHTB 3LL8B 1LA0A 3VRPA 2WCEA 1HT9A 4TNCA 3RLZA 1J7RA 5ER5A 1QXPA 2LMVA 1SPYA 3IQQA 4GPLB 1SL9A 2MAZA 1OE9B 1JBAA 1UHNA 1OZSA 4OCIA 4A4BA 2Q4UA 3TS5B 4PE1A 1A4PA 1DGVA 2JXLA 2M29A 2JWWA 2JOJA 3HX4A 1KFXL 4MZLA 5I2OA 3NSOA 2V53A 1QVIY 2LHIA 1IWQA 2BL0C 1YTZC 1X02A 3SJSA 4HRHA 1GQMA 2OS8C 1YRUB 4USLA 4BY5A 4YGBB 1QX7A 1JF2A 4PHMA 2CXJA 2JT3A 1W7IB 1OMDA 2KFHA 4PDZA 1QX2A 2I18A 1OQPA 3GK1A 2H61C 3OX5A 1PALA 2K0JA 1CLLA 1MUXA 4GNKB 3NSIA 1DJHA 2LLTA 1RJVA 3AKBA 3TUYB 3TUYC 3TZ1A 1CDLA 1BLQA 4NQGA 1AK8A 1K2HA 4DIRA 4NDCA 1PRWA 1MWNA 2G2BA 3I5FC 3AAKA 3I5FB 1B1GA 2M8UA 1SKTA 1F4QA 4PE0A 4WQ3A 4HREE 2A4JA 2WORA 2ZNEA 1IG5A 3OX6A 4YGCB 1CDPA 2F8PA 1SL7A 1Y1XA 2CTNA 1AHRA 1NCZA 1S6CA 1UHHA 2F2OA 2GGZA 5CSNA 4ETOA 1RECA 1ZMZA 5I2LA 5JJGA 1OZOA 1GJYA 1B8CA 1LKJA 3EVVA 1CNPA 1TTXA 3DVJA 4A4CA 4DS7A 1LVCD 4MLWA 1JSAA 1JWDA 2LHLA 2PMYA 4ZCUA 1CFCA 1IQ3A 1LA3A 2GV5A 5K89A 2KAXA 1KQVA 2K2AA 1YURA 1N0YA 2ZN9A 4MEWA 1DF0A 1K9UA 1N65A 1QLKA 1NYAA 4GUKA 1KK8B 3CR4X 2K7BA 2ZKMX 3I5IC 4HSZA 4OVNF 2E6WA 3KHEA 2M97A 1YX8A 4QJ5B 3KPXA 2WOSA 3SG6A 1UP5A 1QV1A 3BUNB 4GGFC 4L9MA 3CR2A 1DVIA 2BCAA 1IGVA 2DOQA 3A8RA 2I2RE 2LV7A 4N5XA 1MXLC 1WRZA 1BT6A 1ZUZA 1PK0D 3RM1A 1NIWA 3PN7C 5HLOA 2EC6C 1KWOC 2EC6B 2LVVA 4MN0A 4JQ0D 4C0KA 4P2YB 1SY9A 3F45A 2K7OA 4GFTA 3PLFB 3TDZA 2WCFA 2FCEA 3GK4X 3GOFA 4GGNA 1SCVA 2BCXA 2LVKA 2ZFDA 3TDUA 3OB1B 2KI4C 3I5HB 4NDDA 3JVTC 1DJIA 1M63B 2LLUA 1XA5A 2ZRSA 1YVHA 4IL1A 3AKAA 1TCFA 1R2UA 2MRDA 1CMGA 2LM5A 4QJ3B 1G4YR 2F33A 1A2XA 1NCYA 3EVRA 3BOWA 3NXAA 2NLNA 4DUQA 1UHJA 1JFJA 2JXCA 1ODBA 2PRUA 1WRKA 1MHOA 1CM4A 1QTXA 1CDMA 4HRGA 5HKWA 2OPOA 5TNCA 1XO5A 2EGDA 3SG5A 1QV0A 3GK2A 1KFUL 1L7ZA 1NP8A 4I5LB 2ZNDA 3SG3A 4AQIA 1Y1AA 4MRYA 3SIBA 3CS1A 4XJKA 4YI9A 5HKZA 3KF9A 1PVBA 4MBEA 1J7PA 1ZOTB 1KK7Y 1RFJA 2WNDA 5CPVA 1DGUA 3EKHA 1DTLA 2FJUB 2I94A 2IS9A 2MHHA 5D69A 5DKQA 1EXRA 1YUTA 1PVAA 3PSRA 4Q04A 2CNPA 4ORAB 2JU0A 5G08A 2OTGC 3BXKA 1H4BA 2HQ8A 2HQWA 4E68A 1A03A 2M7NA 2M49B 5CSIA 5CSFA 5J3XA 5B8IB 2NZ0A 2LLSA 3AAJA 1DF0B 3EK8A 1K94A 1BR4B 1J7QA 4F0ZB 2BBMA 2HF5A 2D8NA 1Y1UA 1TCOB 4MZJA 1FF1A 1CTRA 2K7CA 3CZTX 3BQ3A 1YRTB 1MF8B 4GGFA 1K93D 2KAYA 1CKKA 2NXQA 1RROA 1QX5B 2LCPA 2CCMA 2BL0B 1EL4A 2L5XB 4OKHA 3CWGA 4WRIA 2M9GA 1QIWA 2OS8B 1KSMA 2F3ZA 1CFFA 3JTDC 2L0PA 3JTDB 4M2OA 1WLZA 2G9BA 1BJFA 2KDHA 1YVLA 3PALA 1XFVO 1K9PA 2AAOA 4OR9B 4BY4A 1G33A 1TIZA 1BF5A 3C1VA 1DJXA 3BOWB 3WNXB 2L2EA 2ZN8A 4FTGA 1LXFC 1KQMC 1U5IA 2K61A 2L4IA 1QLSA 3D0YA 4JPZB 1CLMA 1RK9A 4PALA 5DKNA 1UUSA 1S1EA 1IJ5A 2MA2A 1B7TZ 2QPTA 2QACA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ALV A;  1EG3 A;  1M31 A;  2H2K A;  4XYN A;  3LLE A;  1SYM A;  2KFG A;  1BOC A;  4XJK B;  2F3Y A;  2KHN A;  2KGB C;  2L4H A;  4ORB B;  1QS7 A;  1CMF A;  1CDN A;  2KGR A;  2KNE A;  2P6B B;  4NDB A;  2RGI A;  3EVU A;  1CM1 A;  1XFY O;  3KEV A;  2M3W A;  1NX3 A;  2PAL A;  3D10 A;  1A75 A;  1XFU O;  1NX0 A;  1YUS A;  1DT7 B;  1F4O A;  1K95 A;  1UUR A;  4JWQ A;  2JZI A;  3ZNI A;  1B8L A;  1NX2 A;  3DVE A;  3IQO A;  2KI6 D;  3VGO A;  1GGZ A;  1EH2 A;  1XFZ O;  3A4U B;  3I5I B;  3SG4 A;  2KYF A;  1F55 A;  2CT9 A;  2Y5I A;  5CSJ A;  4CPV A;  1FW4 A;  2K8M B;  1SCM C;  3FWB A;  1QVI Z;  1QJT A;  1K8U A;  1HQV A;  4M2Q A;  1TNQ A;  2MLE C;  3PN7 B;  2Q91 A;  4MZK A;  1KWO B;  1B9A A;  1ZFS A;  1CFD A;  1BU3 A;  3FWC A;  3CGA A;  2JNX A;  1M45 A;  2JTZ A;  4GBA A;  1LIN A;  1OOJ A;  2JNF A;  2O5G A;  1G8I A;  2JT8 A;  3DVK A;  2R2I A;  2KI4 B;  3QRX A;  3JVT B;  5BPJ A;  3OHM B;  2KQY A;  1S6I A;  2B1U A;  4YGA A;  4N1G A;  2LE9 B;  4PE7 A;  4DCK A;  3BUO B;  1MR8 A;  1U5I B;  3D0Y B;  4I5K A;  1TNW A;  1SBJ A;  1UHK A;  3OB2 B;  3VRN A;  3KO0 A;  1FI5 A;  1IQ5 A;  3IF7 A;  1KFX S;  1W7J B;  2Y1M A;  1NX1 A;  3NSK A;  1XK4 A;  1EG4 A;  3SIA A;  3BUX B;  2ISD A;  5FYX A;  1KSO A;  1XFW O;  1AJ4 A;  2LNK A;  4YRU A;  1F71 A;  3DF0 A;  1YX7 A;  2JUL A;  3EK4 A;  2BKI B;  1A75 B;  2FCD A;  1OMV A;  2OTG B;  1J1D A;  4YI8 A;  2L50 A;  2Y4Q A;  1SL8 A;  1H8B A;  2TN4 A;  1IJ6 A;  4CID A;  1PUL A;  5D7F A;  1IRJ A;  2NCO A;  2KBI A;  4OV2 A;  1CFP A;  2Y1N A;  4C0J A;  3OP0 A;  1C7V A;  1RWY A;  1WLM A;  3FS7 A;  2K2F A;  2MLF C;  3DVM A;  2M1K B;  4MRX A;  2NCP A;  3HCM A;  4AQJ A;  1WDC C;  1B47 A;  2KAV A;  1OSA A;  1Q80 A;  2LAN A;  2WC8 A;  3LK1 A;  4ZCV A;  1V1G A;  1KCY A;  1N2D A;  1AVS A;  4DRW A;  3E3R A;  1S26 D;  1J1E A;  1QAT A;  4ORC B;  1M46 A;  2LP2 A;  5AER A;  1NUB A;  1C07 A;  1FBV A;  1CLB A;  2WCB A;  2KQ6 A;  1K9K A;  1K90 D;  4YGE B;  1FI6 A;  1MXE A;  4P5O E;  4ICB A;  2MJW B;  2O60 A;  3O4Y A;  4I5J A;  2KFF A;  4YGD B;  1IKU A;  3H4S E;  1NPQ A;  2JRF A;  4C0L A;  5HYD A;  3TS5 C;  1VRK A;  5AFP A;  3O2P A;  2I7A A;  2BBN A;  1SRA A;  1TOP A;  2ZRT A;  2JT0 A;  3EK7 A;  1S5G Z;  1JFK A;  2BEC A;  4CLN A;  2LMT A;  5IBW A;  1QIV A;  5KU1 A;  2MBX A;  1JC2 A;  1JUO A;  1KQM B;  2L98 A;  2LP3 A;  1DJY A;  2LVJ A;  4FQO A;  1JF0 A;  3VRR A;  1UHI A;  3CR5 X;  1XK4 C;  1XVJ A;  3NSL A;  4N1F A;  2KSP A;  1ALW A;  1KK7 Z;  2EHB A;  1QAS A;  2LMU A;  3FIA A;  5F6T A;  3SG7 A;  1YR5 A;  3ZWH A;  3VRO A;  3BYA A;  1C7W A;  4I5N B;  2PVB A;  2LAP A;  3DF0 B;  2PAS A;  1B4C A;  1GGW A;  1R6P A;  3CTN A;  2PSR A;  1PSB A;  2JPT A;  3WHU B;  4CFR A;  3MSE B;  3PFV A;  4M2P A;  2SCP A;  3SG2 A;  1M39 A;  4GAO A;  2JTT A;  2K7D A;  5KSZ A;  1J55 A;  1S3P A;  2M1U A;  1SNL A;  1TRF A;  4AOM A;  1IH0 A;  1DJW A;  2LC5 A;  1S6J A;  1V1F A;  2KOT A;  2VRG A;  2BE4 A;  2KBM A;  2KI6 C;  2L51 A;  3DD4 A;  4QJ4 B;  1KFU S;  3EKJ A;  1SCM B;  3M0W A;  1ZAC A;  2JQ6 A;  1SK6 D;  2HPS A;  2BE6 A;  4PE4 A;  2AUC A;  3BUM B;  1F70 A;  1E8A A;  1XFX O;  1TNP A;  3TDI A;  5AXI A;  2M0R A;  4PCW A;  1KK8 C;  2AMI A;  1J7O A;  1MQ1 A;  3VRQ A;  5I8N A;  2BCB A;  2FOT A;  1AUI B;  4WQ2 A;  1XYD A;  5ER4 X;  5HKY A;  1SW8 A;  1WY9 A;  2LUC A;  1WRL A;  3LCP C;  2M7L A;  3PM8 A;  1BG1 A;  4D1E A;  2GGM A;  1AP4 A;  1Y6W A;  3BUW B;  4U8D A;  1F8H A;  1TNX A;  1SR6 C;  4PHN A;  1SR6 B;  1UWO A;  2JC2 A;  3CLN A;  3K21 A;  1BMO A;  4UPG A;  1L2O C;  2COL B;  1L2O B;  2LUX A;  1B8R A;  2SAS A;  5PAL A;  1PSR A;  3I5H C;  3WXA A;  1K96 A;  1NCX A;  4MSP A;  5JOL A;  5AAN A;  1YUU A;  2H61 A;  2E30 A;  2KYC A;  1NSH A;  1A29 A;  1S5G Y;  5AEQ A;  1DMO A;  1S36 A;  4MVF A;  5I2Q A;  1NWD A;  1F54 A;  3O6B A;  3I5G C;  3I5G B;  2HET A;  3LK0 A;  5GQQ C;  2F2P A;  1DJG A;  1CB1 A;  1OMR A;  2CBL A;  1Y0V H;  5DKR A;  1B7T Y;  3PAT A;  5KTY A;  2BKH B;  4PHJ A;  4PHK A;  2LVI A;  1D1O A;  1BOD A;  1FPW A;  1BR1 B;  4YBH B;  1WDC B;  1DJZ A;  1AJ5 A;  1TN4 A;  1SMG A;  4CFQ A;  3O78 A;  4R1E A;  1RTP 1;  3ICB A;  5HLV A;  1EJ3 A;  3WHT B;  3LL8 B;  1LA0 A;  3VRP A;  2WCE A;  1HT9 A;  4TNC A;  3RLZ A;  1J7R A;  5ER5 A;  1QXP A;  2LMV A;  1SPY A;  3IQQ A;  4GPL B;  1SL9 A;  2MAZ A;  1OE9 B;  1JBA A;  1UHN A;  1OZS A;  4OCI A;  4A4B A;  2Q4U A;  3TS5 B;  4PE1 A;  1A4P A;  1DGV A;  2JXL A;  2M29 A;  2JWW A;  2JOJ A;  3HX4 A;  1KFX L;  4MZL A;  5I2O A;  3NSO A;  2V53 A;  1QVI Y;  2LHI A;  1IWQ A;  2BL0 C;  1YTZ C;  1X02 A;  3SJS A;  4HRH A;  1GQM A;  2OS8 C;  1YRU B;  4USL A;  4BY5 A;  4YGB B;  1QX7 A;  1JF2 A;  4PHM A;  2CXJ A;  2JT3 A;  1W7I B;  1OMD A;  2KFH A;  4PDZ A;  1QX2 A;  2I18 A;  1OQP A;  3GK1 A;  2H61 C;  3OX5 A;  1PAL A;  2K0J A;  1CLL A;  1MUX A;  4GNK B;  3NSI A;  1DJH A;  2LLT A;  1RJV A;  3AKB A;  3TUY B;  3TUY C;  3TZ1 A;  1CDL A;  1BLQ A;  4NQG A;  1AK8 A;  1K2H A;  4DIR A;  4NDC A;  1PRW A;  1MWN A;  2G2B A;  3I5F C;  3AAK A;  3I5F B;  1B1G A;  2M8U A;  1SKT A;  1F4Q A;  4PE0 A;  4WQ3 A;  4HRE E;  2A4J A;  2WOR A;  2ZNE A;  1IG5 A;  3OX6 A;  4YGC B;  1CDP A;  2F8P A;  1SL7 A;  1Y1X A;  2CTN A;  1AHR A;  1NCZ A;  1S6C A;  1UHH A;  2F2O A;  2GGZ A;  5CSN A;  4ETO A;  1REC A;  1ZMZ A;  5I2L A;  5JJG A;  1OZO A;  1GJY A;  1B8C A;  1LKJ A;  3EVV A;  1CNP A;  1TTX A;  3DVJ A;  4A4C A;  4DS7 A;  1LVC D;  4MLW A;  1JSA A;  1JWD A;  2LHL A;  2PMY A;  4ZCU A;  1CFC A;  1IQ3 A;  1LA3 A;  2GV5 A;  5K89 A;  2KAX A;  1KQV A;  2K2A A;  1YUR A;  1N0Y A;  2ZN9 A;  4MEW A;  1DF0 A;  1K9U A;  1N65 A;  1QLK A;  1NYA A;  4GUK A;  1KK8 B;  3CR4 X;  2K7B A;  2ZKM X;  3I5I C;  4HSZ A;  4OVN F;  2E6W A;  3KHE A;  2M97 A;  1YX8 A;  4QJ5 B;  3KPX A;  2WOS A;  3SG6 A;  1UP5 A;  1QV1 A;  3BUN B;  4GGF C;  4L9M A;  3CR2 A;  1DVI A;  2BCA A;  1IGV A;  2DOQ A;  3A8R A;  2I2R E;  2LV7 A;  4N5X A;  1MXL C;  1WRZ A;  1BT6 A;  1ZUZ A;  1PK0 D;  3RM1 A;  1NIW A;  3PN7 C;  5HLO A;  2EC6 C;  1KWO C;  2EC6 B;  2LVV A;  4MN0 A;  4JQ0 D;  4C0K A;  4P2Y B;  1SY9 A;  3F45 A;  2K7O A;  4GFT A;  3PLF B;  3TDZ A;  2WCF A;  2FCE A;  3GK4 X;  3GOF A;  4GGN A;  1SCV A;  2BCX A;  2LVK A;  2ZFD A;  3TDU A;  3OB1 B;  2KI4 C;  3I5H B;  4NDD A;  3JVT C;  1DJI A;  1M63 B;  2LLU A;  1XA5 A;  2ZRS A;  1YVH A;  4IL1 A;  3AKA A;  1TCF A;  1R2U A;  2MRD A;  1CMG A;  2LM5 A;  4QJ3 B;  1G4Y R;  2F33 A;  1A2X A;  1NCY A;  3EVR A;  3BOW A;  3NXA A;  2NLN A;  4DUQ A;  1UHJ A;  1JFJ A;  2JXC A;  1ODB A;  2PRU A;  1WRK A;  1MHO A;  1CM4 A;  1QTX A;  1CDM A;  4HRG A;  5HKW A;  2OPO A;  5TNC A;  1XO5 A;  2EGD A;  3SG5 A;  1QV0 A;  3GK2 A;  1KFU L;  1L7Z A;  1NP8 A;  4I5L B;  2ZND A;  3SG3 A;  4AQI A;  1Y1A A;  4MRY A;  3SIB A;  3CS1 A;  4XJK A;  4YI9 A;  5HKZ A;  3KF9 A;  1PVB A;  4MBE A;  1J7P A;  1ZOT B;  1KK7 Y;  1RFJ A;  2WND A;  5CPV A;  1DGU A;  3EKH A;  1DTL A;  2FJU B;  2I94 A;  2IS9 A;  2MHH A;  5D69 A;  5DKQ A;  1EXR A;  1YUT A;  1PVA A;  3PSR A;  4Q04 A;  2CNP A;  4ORA B;  2JU0 A;  5G08 A;  2OTG C;  3BXK A;  1H4B A;  2HQ8 A;  2HQW A;  4E68 A;  1A03 A;  2M7N A;  2M49 B;  5CSI A;  5CSF A;  5J3X A;  5B8I B;  2NZ0 A;  2LLS A;  3AAJ A;  1DF0 B;  3EK8 A;  1K94 A;  1BR4 B;  1J7Q A;  4F0Z B;  2BBM A;  2HF5 A;  2D8N A;  1Y1U A;  1TCO B;  4MZJ A;  1FF1 A;  1CTR A;  2K7C A;  3CZT X;  3BQ3 A;  1YRT B;  1MF8 B;  4GGF A;  1K93 D;  2KAY A;  1CKK A;  2NXQ A;  1RRO A;  1QX5 B;  2LCP A;  2CCM A;  2BL0 B;  1EL4 A;  2L5X B;  4OKH A;  3CWG A;  4WRI A;  2M9G A;  1QIW A;  2OS8 B;  1KSM A;  2F3Z A;  1CFF A;  3JTD C;  2L0P A;  3JTD B;  4M2O A;  1WLZ A;  2G9B A;  1BJF A;  2KDH A;  1YVL A;  3PAL A;  1XFV O;  1K9P A;  2AAO A;  4OR9 B;  4BY4 A;  1G33 A;  1TIZ A;  1BF5 A;  3C1V A;  1DJX A;  3BOW B;  3WNX B;  2L2E A;  2ZN8 A;  4FTG A;  1LXF C;  1KQM C;  1U5I A;  2K61 A;  2L4I A;  1QLS A;  3D0Y A;  4JPZ B;  1CLM A;  1RK9 A;  4PAL A;  5DKN A;  1UUS A;  1S1E A;  1IJ5 A;  2MA2 A;  1B7T Z;  2QPT A;  2QAC A; 
#chains in the Genus database with same CATH topology
 1ALV A;  1EG3 A;  1M31 A;  2H2K A;  4XYN A;  3LLE A;  1SYM A;  2KFG A;  1BOC A;  3D78 A;  2F3Y A;  2KHN A;  4XJK B;  2KGB C;  2L4H A;  4ORB B;  1C3Z A;  1QS7 A;  1CMF A;  1CDN A;  2KGR A;  2KNE A;  2P6B B;  4NDB A;  2RGI A;  3EVU A;  1CM1 A;  1XFY O;  3KEV A;  2M3W A;  1NX3 A;  2PAL A;  2BNX A;  3D10 A;  1A75 A;  4INW A;  1XFU O;  1NX0 A;  1YUS A;  1DT7 B;  1F4O A;  2K60 A;  4F7F A;  1K95 A;  1UUR A;  4JWQ A;  2JZI A;  3ZNI A;  1B8L A;  1NX2 A;  3DVE A;  3IQO A;  2KI6 D;  3NGV A;  3VGO A;  3PJI A;  1GGZ A;  1EH2 A;  1XFZ O;  3A4U B;  3CZ2 A;  3I5I B;  3SG4 A;  4IJ7 A;  2KYF A;  1F55 A;  2CT9 A;  2Y5I A;  3B88 A;  5CSJ A;  1FW4 A;  2K8M B;  5DKN A;  1SCM C;  3FWB A;  1QVI Z;  1QJT A;  4CPV A;  2KLE A;  1K8U A;  1HQV A;  4M2Q A;  1TNQ A;  2MLE C;  3PN7 B;  2Q91 A;  4MZK A;  1KWO B;  1B9A A;  1ZFS A;  1CFD A;  3B87 A;  1BU3 A;  3FWC A;  3CGA A;  2JNX A;  1M45 A;  2JTZ A;  4GBA A;  2QEV A;  1LIN A;  1OOJ A;  3D77 A;  2JNF A;  2O5G A;  1G8I A;  3D74 A;  2JT8 A;  3DVK A;  2R2I A;  2KI4 B;  3QRX A;  3JVT B;  5BPJ A;  3OHM B;  2KQY A;  1S6I A;  2B1U A;  1OOI X;  4YGA A;  4N1G A;  2LE9 B;  4PE7 A;  1C3Y A;  4DCK A;  3BUO B;  1MR8 A;  1U5I B;  3D0Y B;  4I5K A;  1TNW A;  1DQE A;  1SBJ A;  1UHK A;  1TWO A;  3OB2 B;  3VRN A;  3KO0 A;  1FI5 A;  1IQ5 A;  3IF7 A;  1KFX S;  1W7J B;  2Y1M A;  1NX1 A;  3DZT A;  3NSK A;  1XK4 A;  1EG4 A;  3SIA A;  3FE6 A;  2PYQ A;  3BUX B;  2ISD A;  5FYX A;  1KSO A;  1XFW O;  1AJ4 A;  2LNK A;  4YRU A;  1F71 A;  2KLD A;  3DF0 A;  1OOH A;  1YX7 A;  2JUL A;  3EK4 A;  1A75 B;  2BKI B;  2FCD A;  1OMV A;  2OTG B;  1J1D A;  3EG5 B;  4YI8 A;  2L50 A;  2Y4Q A;  1SL8 A;  1H8B A;  2TN4 A;  1IJ6 A;  4CID A;  1PUL A;  5D7F A;  1IRJ A;  2NCO A;  2KBI A;  4OV2 A;  1CFP A;  2Y1N A;  2FJY A;  4C0J A;  3OP0 A;  1C7V A;  1RWY A;  1WLM A;  3FS7 A;  2K2F A;  2MLF C;  2WCK A;  2WC6 A;  3DVM A;  2M1K B;  4JKT A;  4MRX A;  3BFB A;  2NCP A;  3HCM A;  3BJH A;  4AQJ A;  1WDC C;  1B47 A;  2KAV A;  1OSA A;  1Q80 A;  2LAN A;  2WC8 A;  3LK1 A;  4ZCV A;  2WCM A;  1V1G A;  3UO9 A;  1KCY A;  1N2D A;  1AVS A;  4DRW A;  3RZS A;  3E3R A;  1S26 D;  1J1E A;  1QAT A;  4ORC B;  1M46 A;  2LP2 A;  5AER A;  1NUB A;  1C07 A;  1FBV A;  1CLB A;  2WCB A;  2KQ6 A;  1K9K A;  1K90 D;  4YGE B;  1FI6 A;  1MXE A;  4P5O E;  4ICB A;  2MJW B;  2O60 A;  3O4Y A;  4I5J A;  2KFF A;  4YGD B;  1IKU A;  5EL2 A;  3H4S E;  3R72 A;  3L4L A;  1NPQ A;  2JRF A;  4C0L A;  5HYD A;  3TS5 C;  1VRK A;  3NHI A;  3O2P A;  2I7A A;  5AFP A;  2BBN A;  1SRA A;  2ERB A;  3DXL A;  1TOP A;  2ZRT A;  3L47 A;  3V2L A;  1DEK A;  2JT0 A;  1S5G Z;  3EK7 A;  1JFK A;  2GTE A;  2BEC A;  3PM2 A;  4CLN A;  2LMT A;  5IBW A;  1QIV A;  3OGN A;  1ORG A;  3R1V A;  5KU1 A;  2MBX A;  1JC2 A;  1JUO A;  1KQM B;  2L98 A;  2LP3 A;  1DJY A;  2LVJ A;  4FQO A;  1JF0 A;  1OOF A;  3VRR A;  1UHI A;  3CR5 X;  1XK4 C;  1XVJ A;  3NSL A;  4N1F A;  2KSP A;  1ALW A;  1KK7 Z;  2EHB A;  1QAS A;  2LMU A;  3FIA A;  5F6T A;  3SG7 A;  1YR5 A;  3ZWH A;  3VRO A;  3S0F A;  3BYA A;  1C7W A;  4I5N B;  2PVB A;  2LAP A;  3DF0 B;  2PAS A;  3DY9 A;  3K1E A;  5D3O A;  1B4C A;  3Q8I A;  1R6P A;  1GGW A;  3CTN A;  2PSR A;  2QEB A;  1PSB A;  2JPT A;  3CYZ A;  3WHU B;  4CFR A;  2P71 A;  3MSE B;  3PFV A;  4M2P A;  4PT1 A;  2SCP A;  3SG2 A;  1M39 A;  4GAO A;  2JTT A;  2K7D A;  5KSZ A;  4INX A;  1J55 A;  1S3P A;  2M1U A;  1SNL A;  1TRF A;  4AOM A;  1IH0 A;  3QME A;  1DJW A;  3SS5 A;  2LC5 A;  1S6J A;  1V1F A;  2KOT A;  2VRG A;  2BE4 A;  2KBM A;  2KI6 C;  2L51 A;  3DD4 A;  1IIO A;  4QJ4 B;  1KFU S;  3EKJ A;  1SCM B;  3M0W A;  1ZAC A;  2JQ6 A;  1SK6 D;  4OZD A;  2HPS A;  2BE6 A;  4PE4 A;  2AUC A;  3S0E A;  3BUM B;  1F70 A;  1E8A A;  1OOG A;  1XFX O;  1TNP A;  2P70 A;  5AXI A;  3TDI A;  2M0R A;  1SSE B;  4PCW A;  1KK8 C;  2AMI A;  1J7O A;  1MQ1 A;  3VRQ A;  5I8N A;  2BCB A;  2FOT A;  1AUI B;  3BFH A;  4WQ2 A;  1XYD A;  2JPO A;  5ER4 X;  5HKY A;  1SW8 A;  1WY9 A;  2LUC A;  1WRL A;  2H8V A;  1OW4 A;  3D75 A;  3LCP C;  2M7L A;  3PM8 A;  1BG1 A;  2QEO A;  4D1E A;  2GGM A;  1AP4 A;  1Y6W A;  3BUW B;  4U8D A;  1F8H A;  1TNX A;  1SR6 C;  4PHN A;  1SR6 B;  1UWO A;  2JC2 A;  3CLN A;  3K21 A;  1BMO A;  3NHT A;  4UPG A;  1L2O C;  2COL B;  1L2O B;  2LUX A;  1B8R A;  2SAS A;  5PAL A;  1PSR A;  3I5H C;  3WXA A;  1K96 A;  1NCX A;  4MSP A;  5JOL A;  5AAN A;  1QWV A;  1YUU A;  2H61 A;  2E30 A;  2KYC A;  3S0A A;  1NSH A;  1A29 A;  1S5G Y;  5AEQ A;  3D76 A;  1DMO A;  1S36 A;  4MVF A;  2WCJ A;  5I2Q A;  1NWD A;  1F54 A;  3O6B A;  3I5G C;  3I5G B;  2HET A;  3LK0 A;  5GQQ C;  2F2P A;  1DJG A;  1CB1 A;  1OMR A;  2CBL A;  1Y0V H;  1Z2C B;  2L5Y A;  1B7T Y;  5DKR A;  3PAT A;  5KTY A;  2BKH B;  4PHJ A;  4PHK A;  2LVI A;  1D1O A;  1BOD A;  1FPW A;  1BR1 B;  4YBH B;  1WDC B;  1DJZ A;  1AJ5 A;  1TN4 A;  1SMG A;  2WC5 A;  4CFQ A;  3O78 A;  4R1E A;  1RTP 1;  3ICB A;  5HLV A;  2QDI A;  1EJ3 A;  3WHT B;  3LL8 B;  1LA0 A;  3VRP A;  2WCE A;  1HT9 A;  4TNC A;  3RLZ A;  1J7R A;  5ER5 A;  3R1O A;  3CZ1 A;  1QXP A;  5DIC A;  2LMV A;  1SPY A;  2YGU A;  3IQQ A;  4GPL B;  1SL9 A;  2MAZ A;  1OE9 B;  2PQL A;  1JBA A;  1UHN A;  1OZS A;  4OCI A;  4FQT A;  4A4B A;  2Q4U A;  3TS5 B;  4PE1 A;  1A4P A;  1DGV A;  1TUJ A;  2WCH A;  2JXL A;  2M29 A;  2JWW A;  1XFR A;  2JOJ A;  3HX4 A;  1KFX L;  4MZL A;  5I2O A;  3NSO A;  2V53 A;  1QVI Y;  2LHI A;  1IWQ A;  2BL0 C;  1YTZ C;  1X02 A;  3SJS A;  4HRH A;  1GQM A;  2OS8 C;  1YRU B;  4USL A;  4BY5 A;  3S0B A;  4YGB B;  1QX7 A;  2L2C A;  1JF2 A;  4PHM A;  2CXJ A;  2JT3 A;  1W7I B;  1OMD A;  2KFH A;  4PDZ A;  1QX2 A;  2I18 A;  1OQP A;  1GM0 A;  3GK1 A;  2H61 C;  3OX5 A;  1PAL A;  2K0J A;  1CLL A;  3FE9 A;  1MUX A;  4GNK B;  3NSI A;  1DJH A;  2LLT A;  1RJV A;  3AKB A;  3TUY B;  3TUY C;  3N7H A;  3TZ1 A;  1CDL A;  1BLQ A;  1P28 A;  4NQG A;  1AK8 A;  1K2H A;  4DIR A;  4NDC A;  1PRW A;  2QEH A;  1MWN A;  2G2B A;  3I5F C;  3AAK A;  3I5F B;  1B1G A;  1LS8 A;  2M8U A;  1SKT A;  1Z4H A;  1F4Q A;  3B7A A;  4PE0 A;  4WQ3 A;  4HRE E;  3IVT A;  2A4J A;  2WOR A;  2ZNE A;  1IG5 A;  3OX6 A;  4YGC B;  1CDP A;  2F8P A;  1SL7 A;  1Y1X A;  2CTN A;  1AHR A;  1NCZ A;  1S6C A;  1UHH A;  2F2O A;  2GGZ A;  3FE8 A;  5CSN A;  1REC A;  3S0D A;  1ZMZ A;  4ETO A;  5I2L A;  5JJG A;  1OZO A;  1GJY A;  1B8C A;  1LKJ A;  3EVV A;  1CNP A;  1TTX A;  3DVJ A;  4A4C A;  4DS7 A;  5FI2 A;  1TUZ A;  1LVC D;  4MLW A;  4JD9 A;  1JSA A;  1JWD A;  2LHL A;  2PMY A;  4ZCU A;  1CFC A;  1IQ3 A;  1LA3 A;  2GV5 A;  5K89 A;  1DEL A;  2KAX A;  3SS4 A;  1KQV A;  2K2A A;  1YUR A;  1N0Y A;  3UNW A;  2ZN9 A;  4MEW A;  1DF0 A;  1K9U A;  1N65 A;  1QLK A;  1NYA A;  4GUK A;  1KK8 B;  3CR4 X;  2K7B A;  2ZKM X;  3I5I C;  4HSZ A;  4OVN F;  2E6W A;  3KHE A;  2M97 A;  1YX8 A;  4QJ5 B;  3B6X A;  3KPX A;  2WOS A;  3SG6 A;  1UP5 A;  1QV1 A;  3BUN B;  4GGF C;  4L9M A;  3CR2 A;  1DVI A;  2BCA A;  3B86 A;  1IGV A;  5I94 A;  2DOQ A;  3A8R A;  2I2R E;  2LV7 A;  4N5X A;  1MXL C;  3BFA A;  1WRZ A;  1BT6 A;  1ZUZ A;  1PK0 D;  3RM1 A;  1NIW A;  3PN7 C;  5HLO A;  2EC6 C;  1KWO C;  2EC6 B;  2LVV A;  4MN0 A;  3L4A A;  4JQ0 D;  4C0K A;  4P2Y B;  1SY9 A;  3F45 A;  2K7O A;  4GFT A;  3PLF B;  3D73 A;  3TDZ A;  2WCF A;  2FCE A;  3GK4 X;  3GOF A;  4GGN A;  1SCV A;  2BCX A;  2LVK A;  2ZFD A;  3CAB A;  3OB1 B;  1T14 A;  3TDU A;  2KI4 C;  3I5H B;  4NDD A;  3JVT C;  1DJI A;  1M63 B;  2LLU A;  1XA5 A;  2ZRS A;  1YVH A;  4IL1 A;  3AKA A;  1TCF A;  1R2U A;  2MRD A;  1CMG A;  2LM5 A;  4QJ3 B;  1G4Y R;  2F33 A;  1A2X A;  1NCY A;  3EVR A;  3BOW A;  3NXA A;  2NLN A;  4DUQ A;  1UHJ A;  1JFJ A;  2JXC A;  1ODB A;  2PRU A;  5FI7 A;  1WRK A;  1MHO A;  2BAP A;  1CM4 A;  1QTX A;  1CDM A;  4HRG A;  5HKW A;  2OPO A;  5TNC A;  1XO5 A;  2EGD A;  3SG5 A;  1QV0 A;  3GK2 A;  1KFU L;  1L7Z A;  1NP8 A;  4I5L B;  2ZND A;  3SG3 A;  4AQI A;  1Y1A A;  4MRY A;  3SIB A;  3CS1 A;  4XJK A;  4YI9 A;  5HKZ A;  3KF9 A;  1PVB A;  3OBV A;  4MBE A;  5HL1 A;  1ZOT B;  1J7P A;  1KK7 Y;  1RFJ A;  2WND A;  5CPV A;  1DGU A;  3EKH A;  1DTL A;  2FJU B;  2I94 A;  2IS9 A;  2MHH A;  5D69 A;  5DKQ A;  1EXR A;  1YUT A;  1PVA A;  3PSR A;  4Q04 A;  2CNP A;  4ORA B;  2JU0 A;  5G08 A;  2OTG C;  3BXK A;  1H4B A;  2HQ8 A;  2HQW A;  3CZ0 A;  4E68 A;  2M7N A;  2M49 B;  5CSI A;  5CSF A;  5J3X A;  5B8I B;  1A03 A;  2NZ0 A;  2LLS A;  3AAJ A;  1DF0 B;  3EK8 A;  1K94 A;  3VB1 A;  1BR4 B;  1J7Q A;  4F0Z B;  2BBM A;  2HF5 A;  2D8N A;  3S0G A;  5FI6 A;  1Y1U A;  3DYE A;  1TCO B;  4MZJ A;  1FF1 A;  1CTR A;  2K7C A;  3CZT X;  3BQ3 A;  1YRT B;  3SS3 A;  1MF8 B;  4GGF A;  1K93 D;  2KAY A;  1CKK A;  2NXQ A;  1RRO A;  1QX5 B;  2LCP A;  2CCM A;  2BL0 B;  1EL4 A;  2L5X B;  4OKH A;  3CWG A;  4WRI A;  2M9G A;  1QIW A;  2OS8 B;  1KSM A;  2F3Z A;  1CFF A;  1W9Z A;  3JTD C;  2L0P A;  3JTD B;  3R1P A;  4M2O A;  1WLZ A;  2G9B A;  1DC1 A;  1BJF A;  2KDH A;  1YVL A;  3PAL A;  1XFV O;  1K9P A;  2AAO A;  4OR9 B;  4BY4 A;  2KPH A;  1G33 A;  1TIZ A;  1BF5 A;  3C1V A;  1DJX A;  3BOW B;  3WNX B;  2L2E A;  3CDN A;  2ZN8 A;  4FTG A;  4KYN A;  1LXF C;  1KQM C;  1U5I A;  2K61 A;  2L4I A;  1QLS A;  3D0Y A;  3O4X A;  1CLM A;  1RK9 A;  4JPZ B;  4PAL A;  1UUS A;  2WCL A;  1S1E A;  1IJ5 A;  2MA2 A;  1B7T Z;  2QPT A;  2QAC A; 
#chains in the Genus database with same CATH homology
 1ALV A;  1EG3 A;  1M31 A;  2H2K A;  4XYN A;  3LLE A;  1SYM A;  2KFG A;  1BOC A;  4XJK B;  2F3Y A;  2KHN A;  2KGB C;  2L4H A;  4ORB B;  1QS7 A;  1CMF A;  1CDN A;  2KGR A;  2KNE A;  2P6B B;  4NDB A;  2RGI A;  3EVU A;  1CM1 A;  1XFY O;  3KEV A;  2M3W A;  1NX3 A;  2PAL A;  3D10 A;  1A75 A;  1XFU O;  1NX0 A;  1YUS A;  1DT7 B;  1F4O A;  1K95 A;  1UUR A;  4JWQ A;  2JZI A;  3ZNI A;  1B8L A;  1NX2 A;  3DVE A;  3IQO A;  2KI6 D;  3VGO A;  1GGZ A;  1EH2 A;  1XFZ O;  3A4U B;  3I5I B;  3SG4 A;  2KYF A;  1F55 A;  2CT9 A;  2Y5I A;  5CSJ A;  4CPV A;  1FW4 A;  2K8M B;  1SCM C;  3FWB A;  1QVI Z;  1QJT A;  1K8U A;  1HQV A;  4M2Q A;  1TNQ A;  2MLE C;  3PN7 B;  2Q91 A;  4MZK A;  1KWO B;  1B9A A;  1ZFS A;  1CFD A;  1BU3 A;  3FWC A;  3CGA A;  2JNX A;  1M45 A;  2JTZ A;  4GBA A;  1LIN A;  1OOJ A;  2JNF A;  2O5G A;  1G8I A;  2JT8 A;  3DVK A;  2R2I A;  2KI4 B;  3QRX A;  3JVT B;  5BPJ A;  3OHM B;  2KQY A;  1S6I A;  2B1U A;  4YGA A;  4N1G A;  2LE9 B;  4PE7 A;  4DCK A;  3BUO B;  1MR8 A;  1U5I B;  3D0Y B;  4I5K A;  1TNW A;  1SBJ A;  1UHK A;  3OB2 B;  3VRN A;  3KO0 A;  1FI5 A;  1IQ5 A;  3IF7 A;  1KFX S;  1W7J B;  2Y1M A;  1NX1 A;  3NSK A;  1XK4 A;  1EG4 A;  3SIA A;  3BUX B;  2ISD A;  5FYX A;  1KSO A;  1XFW O;  1AJ4 A;  2LNK A;  4YRU A;  1F71 A;  3DF0 A;  1YX7 A;  2JUL A;  3EK4 A;  2BKI B;  1A75 B;  2FCD A;  1OMV A;  2OTG B;  1J1D A;  4YI8 A;  2L50 A;  2Y4Q A;  1SL8 A;  1H8B A;  2TN4 A;  1IJ6 A;  4CID A;  1PUL A;  5D7F A;  1IRJ A;  2NCO A;  2KBI A;  4OV2 A;  1CFP A;  2Y1N A;  4C0J A;  3OP0 A;  1C7V A;  1RWY A;  1WLM A;  3FS7 A;  2K2F A;  2MLF C;  3DVM A;  2M1K B;  4MRX A;  2NCP A;  3HCM A;  4AQJ A;  1WDC C;  1B47 A;  2KAV A;  1OSA A;  1Q80 A;  2LAN A;  2WC8 A;  3LK1 A;  4ZCV A;  1V1G A;  1KCY A;  1N2D A;  1AVS A;  4DRW A;  3E3R A;  1S26 D;  1J1E A;  1QAT A;  4ORC B;  1M46 A;  2LP2 A;  5AER A;  1NUB A;  1C07 A;  1FBV A;  1CLB A;  2WCB A;  2KQ6 A;  1K9K A;  1K90 D;  4YGE B;  1FI6 A;  1MXE A;  4P5O E;  4ICB A;  2MJW B;  2O60 A;  3O4Y A;  4I5J A;  2KFF A;  4YGD B;  1IKU A;  3H4S E;  1NPQ A;  2JRF A;  4C0L A;  5HYD A;  3TS5 C;  1VRK A;  5AFP A;  3O2P A;  2I7A A;  2BBN A;  1SRA A;  1TOP A;  2ZRT A;  2JT0 A;  3EK7 A;  1S5G Z;  1JFK A;  2BEC A;  4CLN A;  2LMT A;  5IBW A;  1QIV A;  5KU1 A;  2MBX A;  1JC2 A;  1JUO A;  1KQM B;  2L98 A;  2LP3 A;  1DJY A;  2LVJ A;  4FQO A;  1JF0 A;  3VRR A;  1UHI A;  3CR5 X;  1XK4 C;  1XVJ A;  3NSL A;  4N1F A;  2KSP A;  1ALW A;  1KK7 Z;  2EHB A;  1QAS A;  2LMU A;  3FIA A;  5F6T A;  3SG7 A;  1YR5 A;  3ZWH A;  3VRO A;  3BYA A;  1C7W A;  4I5N B;  2PVB A;  2LAP A;  3DF0 B;  2PAS A;  1B4C A;  1GGW A;  1R6P A;  3CTN A;  2PSR A;  1PSB A;  2JPT A;  3WHU B;  4CFR A;  3MSE B;  3PFV A;  4M2P A;  2SCP A;  3SG2 A;  1M39 A;  4GAO A;  2JTT A;  2K7D A;  5KSZ A;  1J55 A;  1S3P A;  2M1U A;  1SNL A;  1TRF A;  4AOM A;  1IH0 A;  1DJW A;  2LC5 A;  1S6J A;  1V1F A;  2KOT A;  2VRG A;  2BE4 A;  2KBM A;  2KI6 C;  2L51 A;  3DD4 A;  4QJ4 B;  1KFU S;  3EKJ A;  1SCM B;  3M0W A;  1ZAC A;  2JQ6 A;  1SK6 D;  2HPS A;  2BE6 A;  4PE4 A;  2AUC A;  3BUM B;  1F70 A;  1E8A A;  1XFX O;  1TNP A;  3TDI A;  5AXI A;  2M0R A;  4PCW A;  1KK8 C;  2AMI A;  1J7O A;  1MQ1 A;  3VRQ A;  5I8N A;  2BCB A;  2FOT A;  1AUI B;  4WQ2 A;  1XYD A;  5ER4 X;  5HKY A;  1SW8 A;  1WY9 A;  2LUC A;  1WRL A;  3LCP C;  2M7L A;  3PM8 A;  1BG1 A;  4D1E A;  2GGM A;  1AP4 A;  1Y6W A;  3BUW B;  4U8D A;  1F8H A;  1TNX A;  1SR6 C;  4PHN A;  1SR6 B;  1UWO A;  2JC2 A;  3CLN A;  3K21 A;  1BMO A;  4UPG A;  1L2O C;  2COL B;  1L2O B;  2LUX A;  1B8R A;  2SAS A;  5PAL A;  1PSR A;  3I5H C;  3WXA A;  1K96 A;  1NCX A;  4MSP A;  5JOL A;  5AAN A;  1YUU A;  2H61 A;  2E30 A;  2KYC A;  1NSH A;  1A29 A;  1S5G Y;  5AEQ A;  1DMO A;  1S36 A;  4MVF A;  5I2Q A;  1NWD A;  1F54 A;  3O6B A;  3I5G C;  3I5G B;  2HET A;  3LK0 A;  5GQQ C;  2F2P A;  1DJG A;  1CB1 A;  1OMR A;  2CBL A;  1Y0V H;  5DKR A;  1B7T Y;  3PAT A;  5KTY A;  2BKH B;  4PHJ A;  4PHK A;  2LVI A;  1D1O A;  1BOD A;  1FPW A;  1BR1 B;  4YBH B;  1WDC B;  1DJZ A;  1AJ5 A;  1TN4 A;  1SMG A;  4CFQ A;  3O78 A;  4R1E A;  1RTP 1;  3ICB A;  5HLV A;  1EJ3 A;  3WHT B;  3LL8 B;  1LA0 A;  3VRP A;  2WCE A;  1HT9 A;  4TNC A;  3RLZ A;  1J7R A;  5ER5 A;  1QXP A;  2LMV A;  1SPY A;  3IQQ A;  4GPL B;  1SL9 A;  2MAZ A;  1OE9 B;  1JBA A;  1UHN A;  1OZS A;  4OCI A;  4A4B A;  2Q4U A;  3TS5 B;  4PE1 A;  1A4P A;  1DGV A;  2JXL A;  2M29 A;  2JWW A;  2JOJ A;  3HX4 A;  1KFX L;  4MZL A;  5I2O A;  3NSO A;  2V53 A;  1QVI Y;  2LHI A;  1IWQ A;  2BL0 C;  1YTZ C;  1X02 A;  3SJS A;  4HRH A;  1GQM A;  2OS8 C;  1YRU B;  4USL A;  4BY5 A;  4YGB B;  1QX7 A;  1JF2 A;  4PHM A;  2CXJ A;  2JT3 A;  1W7I B;  1OMD A;  2KFH A;  4PDZ A;  1QX2 A;  2I18 A;  1OQP A;  3GK1 A;  2H61 C;  3OX5 A;  1PAL A;  2K0J A;  1CLL A;  1MUX A;  4GNK B;  3NSI A;  1DJH A;  2LLT A;  1RJV A;  3AKB A;  3TUY B;  3TUY C;  3TZ1 A;  1CDL A;  1BLQ A;  4NQG A;  1AK8 A;  1K2H A;  4DIR A;  4NDC A;  1PRW A;  1MWN A;  2G2B A;  3I5F C;  3AAK A;  3I5F B;  1B1G A;  2M8U A;  1SKT A;  1F4Q A;  4PE0 A;  4WQ3 A;  4HRE E;  2A4J A;  2WOR A;  2ZNE A;  1IG5 A;  3OX6 A;  4YGC B;  1CDP A;  2F8P A;  1SL7 A;  1Y1X A;  2CTN A;  1AHR A;  1NCZ A;  1S6C A;  1UHH A;  2F2O A;  2GGZ A;  5CSN A;  4ETO A;  1REC A;  1ZMZ A;  5I2L A;  5JJG A;  1OZO A;  1GJY A;  1B8C A;  1LKJ A;  3EVV A;  1CNP A;  1TTX A;  3DVJ A;  4A4C A;  4DS7 A;  1LVC D;  4MLW A;  1JSA A;  1JWD A;  2LHL A;  2PMY A;  4ZCU A;  1CFC A;  1IQ3 A;  1LA3 A;  2GV5 A;  5K89 A;  2KAX A;  1KQV A;  2K2A A;  1YUR A;  1N0Y A;  2ZN9 A;  4MEW A;  1DF0 A;  1K9U A;  1N65 A;  1QLK A;  1NYA A;  4GUK A;  1KK8 B;  3CR4 X;  2K7B A;  2ZKM X;  3I5I C;  4HSZ A;  4OVN F;  2E6W A;  3KHE A;  2M97 A;  1YX8 A;  4QJ5 B;  3KPX A;  2WOS A;  3SG6 A;  1UP5 A;  1QV1 A;  3BUN B;  4GGF C;  4L9M A;  3CR2 A;  1DVI A;  2BCA A;  1IGV A;  2DOQ A;  3A8R A;  2I2R E;  2LV7 A;  4N5X A;  1MXL C;  1WRZ A;  1BT6 A;  1ZUZ A;  1PK0 D;  3RM1 A;  1NIW A;  3PN7 C;  5HLO A;  2EC6 C;  1KWO C;  2EC6 B;  2LVV A;  4MN0 A;  4JQ0 D;  4C0K A;  4P2Y B;  1SY9 A;  3F45 A;  2K7O A;  4GFT A;  3PLF B;  3TDZ A;  2WCF A;  2FCE A;  3GK4 X;  3GOF A;  4GGN A;  1SCV A;  2BCX A;  2LVK A;  2ZFD A;  3TDU A;  3OB1 B;  2KI4 C;  3I5H B;  4NDD A;  3JVT C;  1DJI A;  1M63 B;  2LLU A;  1XA5 A;  2ZRS A;  1YVH A;  4IL1 A;  3AKA A;  1TCF A;  1R2U A;  2MRD A;  1CMG A;  2LM5 A;  4QJ3 B;  1G4Y R;  2F33 A;  1A2X A;  1NCY A;  3EVR A;  3BOW A;  3NXA A;  2NLN A;  4DUQ A;  1UHJ A;  1JFJ A;  2JXC A;  1ODB A;  2PRU A;  1WRK A;  1MHO A;  1CM4 A;  1QTX A;  1CDM A;  4HRG A;  5HKW A;  2OPO A;  5TNC A;  1XO5 A;  2EGD A;  3SG5 A;  1QV0 A;  3GK2 A;  1KFU L;  1L7Z A;  1NP8 A;  4I5L B;  2ZND A;  3SG3 A;  4AQI A;  1Y1A A;  4MRY A;  3SIB A;  3CS1 A;  4XJK A;  4YI9 A;  5HKZ A;  3KF9 A;  1PVB A;  4MBE A;  1J7P A;  1ZOT B;  1KK7 Y;  1RFJ A;  2WND A;  5CPV A;  1DGU A;  3EKH A;  1DTL A;  2FJU B;  2I94 A;  2IS9 A;  2MHH A;  5D69 A;  5DKQ A;  1EXR A;  1YUT A;  1PVA A;  3PSR A;  4Q04 A;  2CNP A;  4ORA B;  2JU0 A;  5G08 A;  2OTG C;  3BXK A;  1H4B A;  2HQ8 A;  2HQW A;  4E68 A;  1A03 A;  2M7N A;  2M49 B;  5CSI A;  5CSF A;  5J3X A;  5B8I B;  2NZ0 A;  2LLS A;  3AAJ A;  1DF0 B;  3EK8 A;  1K94 A;  1BR4 B;  1J7Q A;  4F0Z B;  2BBM A;  2HF5 A;  2D8N A;  1Y1U A;  1TCO B;  4MZJ A;  1FF1 A;  1CTR A;  2K7C A;  3CZT X;  3BQ3 A;  1YRT B;  1MF8 B;  4GGF A;  1K93 D;  2KAY A;  1CKK A;  2NXQ A;  1RRO A;  1QX5 B;  2LCP A;  2CCM A;  2BL0 B;  1EL4 A;  2L5X B;  4OKH A;  3CWG A;  4WRI A;  2M9G A;  1QIW A;  2OS8 B;  1KSM A;  2F3Z A;  1CFF A;  3JTD C;  2L0P A;  3JTD B;  4M2O A;  1WLZ A;  2G9B A;  1BJF A;  2KDH A;  1YVL A;  3PAL A;  1XFV O;  1K9P A;  2AAO A;  4OR9 B;  4BY4 A;  1G33 A;  1TIZ A;  1BF5 A;  3C1V A;  1DJX A;  3BOW B;  3WNX B;  2L2E A;  2ZN8 A;  4FTG A;  1LXF C;  1KQM C;  1U5I A;  2K61 A;  2L4I A;  1QLS A;  3D0Y A;  4JPZ B;  1CLM A;  1RK9 A;  4PAL A;  5DKN A;  1UUS A;  1S1E A;  1IJ5 A;  2MA2 A;  1B7T Z;  2QPT A;  2QAC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...