2K8MB

S100a13-c2a binary complex structure
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
98
structure length
98
Chain Sequence
MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title S100A13-C2A binary complex structure-a key component in the acidic fibroblast growth factor for the non-classical pathway.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Putative uncharacterized protein
total genus 29
structure length 98
sequence length 98
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2k8mB00
3CR4X 3DF0A 1A75B 1XFVO 2JT8A 2QPTA 3LK0A 4GUKA 4N5XA 3FS7A 1WDCC 4XJKA 2LLUA 1CNPA 5AFPA 3IF7A 2P6BB 1WRZA 1IGVA 2BECA 1JWDA 1NX0A 4M2OA 3EVVA 5J3XA 1CTRA 1GJYA 1ODBA 1UUSA 2CTNA 2ZN9A 2PMYA 1B7TY 1G4YR 1Y6WA 2LMUA 3D0YB 4ICBA 1UHNA 2L5XB 4AQIA 1RJVA 2JQ6A 1QS7A 1L7ZA 2PASA 1Y1UA 3EK8A 1KFUL 1RFJA 1SMGA 4MBEA 1B8CA 4PE7A 2CNPA 4WQ2A 1KFXL 3TUYC 1CKKA 4USLA 3WXAA 1K9PA 5I8NA 1K9KA 2TN4A 2JWWA 5I2QA 3OP0A 1SL7A 1XK4C 4GAOA 1BOCA 4FQOA 2MBXA 2BCBA 3O78A 4Q04A 2FJUB 1RROA 1KSMA 2BE4A 3WNXB 5KSZA 2O60A 1GQMA 2M0RA 3DVKA 3BXKA 3KEVA 3SIBA 2M97A 1UP5A 5CPVA 2MLFC 1QX2A 2L2EA 1ZMZA 2WCBA 4NDCA 2Y1NA 2KAVA 1N2DA 2KI6C 3ICBA 2HQ8A 1CFDA 1GGZA 3E3RA 1WY9A 5K89A 4XJKB 5DKNA 1XFYO 1C7WA 1NYAA 2WCFA 3ZNIA 2I94A 1QVIY 4TNCA 1KWOC 3PFVA 1DVIA 5HYDA 1PK0D 4CFQA 2LE9B 3EVUA 4AOMA 1M63B 2HETA 1SR6C 5FYXA 1MHOA 3PLFB 4YGAA 1FI6A 1R2UA 5IBWA 3GOFA 2KQ6A 5GQQC 4YBHB 2L0PA 2KQYA 1S6IA 1TNWA 1QXPA 4PHKA 2I2RE 1X02A 5G08A 1BF5A 1QTXA 2JU0A 1K90D 1KWOB 2K2FA 1B8LA 3CLNA 4ZCVA 5AANA 5KTYA 2JULA 2QACA 5I2OA 2O5GA 1TCFA 1KFXS 4PE4A 2M7NA 4GNKB 4C0KA 1OSAA 2M1UA 1OZOA 4NDBA 1EG3A 1NCYA 1LA0A 1GGWA 1UHIA 1IQ5A 1LXFC 1N0YA 1CLLA 1YX8A 2EHBA 1TIZA 3VRNA 1LVCD 2LVVA 1M45A 4DCKA 4WRIA 2ZN8A 3EVRA 2K7BA 4MLWA 3OX5A 1R6PA 2M7LA 3VRQA 4DRWA 1WRLA 3SIAA 1DF0B 3MSEB 1BT6A 1W7JB 2LV7A 1IJ6A 4R1EA 4BY4A 2JNFA 1BG1A 1DJWA 1OOJA 1RECA 1S5GY 2LUXA 4QJ5B 4YGCB 3OX6A 1BR1B 3RLZA 2K7CA 1FW4A 4I5NB 3DVMA 1S1EA 3BUOB 2F33A 3VGOA 1SL8A 2WNDA 1C07A 1QASA 3LCPC 1NCXA 1TOPA 2LUCA 3CWGA 2A4JA 2KNEA 1YUUA 1E8AA 2Y1MA 3QRXA 5F6TA 2BCXA 2G9BA 2JT0A 2JZIA 4MRYA 1SYMA 1TNQA 3PN7B 1PVBA 4GPLB 5HLOA 3TUYB 1YR5A 2JOJA 3SG4A 3WHTB 2LHLA 3DD4A 3IQOA 3OHMB 4N1GA 1WLMA 1CLBA 1XFUO 2WC8A 3PALA 4P5OE 1A2XA 4PALA 2JXCA 1CB1A 1ALVA 2Q4UA 4PE1A 3D0YA 5D69A 2IS9A 1NP8A 2KI4C 2BE6A 5ER4X 2I7AA 1G33A 1OZSA 2F2PA 4ORBB 1AJ4A 1KSOA 1MQ1A 3EKHA 2FCEA 3I5GB 3IQQA 3O2PA 1TNXA 3PATA 1TCOB 5HKZA 2M9GA 1DJZA 1DJIA 1B47A 1RTP1 4YGDB 1SCMB 3NSOA 2L98A 1B7TZ 1J55A 1NX3A 1YURA 3VRPA 2NXQA 4OR9B 1SL9A 3CS1A 3CR2A 3O4YA 2LMTA 1TRFA 3CZTX 3NSIA 3AKBA 4PHJA 1FPWA 1XO5A 4MSPA 3I5GC 3JTDC 1J1DA 1AP4A 2MHHA 1YUSA 3NXAA 4PCWA 5KU1A 1MWNA 1QIVA 2K7OA 1QX5B 3AAKA 3HX4A 1XFZO 3JVTC 1F71A 4C0LA 1LINA 5JOLA 3OB2B 2F8PA 4CFRA 1JF2A 3BYAA 5CSIA 4YRUA 4OCIA 4MZKA 1V1FA 4IL1A 1PULA 1KK7Y 1HT9A 2F3YA 1C7VA 3SG6A 1DGVA 2JC2A 1MR8A 2KGBC 2EC6B 5B8IB 3I5FC 4C0JA 1JFJA 1FI5A 4PHNA 1KQMB 1IJ5A 1FF1A 2K61A 2KFHA 1S6JA 2JNXA 2KAYA 2GGZA 4DUQA 2M3WA 5CSFA 4GBAA 1A75A 2R2IA 3FWCA 4YI8A 1OQPA 4N1FA 2V53A 1UHHA 4GGFC 2DOQA 1DJYA 1F4QA 1VRKA 1NX1A 1Y1XA 2KDHA 2NCOA 1BR4B 1NIWA 1ZFSA 1MXLC 3CR5X 4HRHA 1CDPA 3VRRA 3JVTB 4MZLA 1SRAA 3PM8A 2LLTA 2WCEA 1N65A 1EXRA 1KK8B 2KI6D 2NLNA 1JUOA 1MF8B 1ZACA 2CBLA 2M1KB 4CLNA 3DVEA 1NSHA 2BL0C 2MLEC 2PRUA 3D10A 1DTLA 3EK4A 3BUNB 1YRTB 1K8UA 2LMVA 2CT9A 3BQ3A 1MXEA 2B1UA 4GGFA 1L2OB 1XK4A 4QJ3B 2COLB 3I5IB 3KHEA 4E68A 3TDZA 2M8UA 1SPYA 2ZRTA 1SKTA 3OB1B 5HKYA 2K8MB 3TDIA 3I5FB 1Y0VH 1ALWA 3BOWA 4MN0A 2KAXA 1QV1A 3NSKA 3GK4X 2FCDA 3KF9A 4GFTA 4UPGA 1RK9A 1A29A 1CM1A 3FIAA 1JFKA 1AK8A 1F70A 1U5IB 3I5IC 1AHRA 2JTZA 3SG3A 1K95A 1L2OC 1B4CA 3A4UB 2LANA 3F45A 5PALA 1BODA 3SG2A 2BKIB 1EJ3A 1W7IB 2WORA 4JQ0D 3H4SE 1SCVA 4U8DA 5CSJA 4M2QA 2LVJA 1J7QA 4JPZB 1IQ3A 3DF0B 1V1GA 2LCPA 4NQGA 2BL0B 2ZRSA 3BOWB 4MRXA 1OE9B 2PALA 1DF0A 4GGNA 2KSPA 1PRWA 2LP3A 3LK1A 1OMDA 1YVHA 3WHUB 1DGUA 1UHJA 1G8IA 5I2LA 1QX7A 3PSRA 2HF5A 5DKRA 2BKHB 2G2BA 1YVLA 2F2OA 2NZ0A 4CPVA 1CMGA 2KI4B 2AAOA 1XVJA 2KOTA 4HRGA 4WQ3A 3LL8B 2KGRA 4ZCUA 4HSZA 4YI9A 2K7DA 3TS5C 1B9AA 2ZKMX 1JF0A 2LHIA 3BUMB 4FTGA 4OVNF 1KQMC 1SW8A 2CXJA 1QIWA 1Y1AA 4F0ZB 5CSNA 4NDDA 4L9MA 2L50A 2GV5A 2WOSA 2D8NA 1YX7A 3M0WA 1BJFA 1OMRA 2JXLA 1CDNA 1K2HA 3TS5B 2LLSA 3KO0A 1QJTA 2K2AA 2KFGA 1QVIZ 1XYDA 1KQVA 3SG7A 1JC2A 2LVKA 1NX2A 3PN7C 1WDCB 1NWDA 1TTXA 2SASA 4JWQA 1M31A 1IH0A 3AKAA 3EKJA 4I5KA 2M49B 4DIRA 1IRJA 4MVFA 3JTDB 1F55A 1S3PA 2LC5A 2LAPA 3RM1A 1K9UA 1LKJA 3BUWB 1UURA 1KK7Z 1LA3A 1CDLA 1PVAA 2JPTA 3CGAA 3CTNA 3SG5A 2BBNA 1DT7B 1CDMA 4QJ4B 1HQVA 1S36A 1F4OA 1F8HA 3GK2A 4MZJA 2NCPA 1XFXO 1A03A 1KK8C 2OS8B 1AJ5A 1SBJA 1WRKA 1BU3A 1D1OA 3O6BA 5DKQA 1IWQA 1BLQA 1DMOA 1XFWO 2Y5IA 1DJGA 3FWBA 1CLMA 1J7RA 1EG4A 5ER5A 1RWYA 2CCMA 1J1EA 1NUBA 4M2PA 3TZ1A 2SCPA 2AMIA 2E30A 2LVIA 1DJXA 1J7PA 1KCYA 3SJSA 2LM5A 2F3ZA 4PHMA 2VRGA 1YTZC 1UWOA 4YGBB 2KBIA 1TN4A 2MAZA 1K93D 4I5LB 1EH2A 4D1EA 1B1GA 5JJGA 2H61A 4ORAB 4CIDA 2L4HA 1WLZA 2AUCA 2M29A 2ZNEA 3BUXB 4I5JA 1H4BA 1B8RA 4OKHA 1XA5A 1CMFA 2BBMA 1SR6B 1FBVA 2L51A 2KYCA 1TNPA 4ETOA 3HCMA 3TDUA 1H8BA 2HPSA 3EK7A 4BY5A 2MJWB 2OS8C 5BPJA 1CFFA 2KYFA 4XYNA 2KBMA 1ZUZA 2KHNA 1IKUA 2MRDA 2BCAA 1CM4A 4HREE 2Q91A 5HLVA 2OPOA 3C1VA 4DS7A 2E6WA 2JRFA 1U5IA 3NSLA 3A8RA 2JT3A 5D7FA 4OV2A 1SCMC 1DJHA 5TNCA 1S6CA 1JSAA 1QLKA 2KFFA 1JBAA 1QATA 1KFUS 2GGMA 1M39A 1M46A 1MUXA 1BMOA 1NCZA 4PDZA 1F54A 2H2KA 1QV0A 2L4IA 3I5HB 4ORCB 4AQJA 3DVJA 2Y4QA 1PSBA 2HQWA 1S5GZ 1YRUB 2H61C 3VROA 1AUIB 2K0JA 4MEWA 2PSRA 5AEQA 1A4PA 2LNKA 3AAJA 4PE0A 4A4CA 4A4BA 1CFCA 4P2YB 4YGEB 1K96A 2ISDA 5AERA 1YUTA 2I18A 2RGIA 3I5HC 1CFPA 1PSRA 1QLSA 2EC6C 1SK6D 1NPQA 2OTGB 3ZWHA 1AVSA 2EGDA 2PVBA 3LLEA 3K21A 2FOTA 1PALA 2MA2A 3KPXA 5HKWA 1Q80A 1SNLA 1IG5A 1S26D 1K94A 1UHKA 1SY9A 2ZFDA 1EL4A 2LP2A 2ZNDA 2JTTA 3GK1A 1OMVA 1J7OA 1ZOTB 5AXIA 2OTGC
chains in the Genus database with same CATH superfamily
3CR4X 3DF0A 1A75B 1XFVO 2JT8A 2QPTA 3LK0A 4GUKA 4N5XA 3FS7A 1WDCC 3DZTA 2LLUA 2GTEA 2QEHA 4XJKA 3B7AA 3IF7A 2P6BB 5AFPA 1WRZA 1IGVA 2BECA 1JWDA 1NX0A 4M2OA 3EVVA 3OBVA 5J3XA 1CTRA 1GJYA 1ODBA 1UUSA 2CTNA 2ZN9A 2PMYA 1B7TY 1G4YR 1Y6WA 2LMUA 3D0YB 3B87A 4ICBA 3VRPA 1UHNA 2L5XB 4AQIA 1RJVA 3S0AA 2JQ6A 1QS7A 1L7ZA 2PASA 1Y1UA 3EK8A 1KFUL 1RFJA 1SMGA 4MBEA 3N7HA 1B8CA 4PE7A 5I94A 2CNPA 4WQ2A 1KFXL 3TUYC 1CKKA 4USLA 3WXAA 1K9PA 1TUJA 5EL2A 5I8NA 1K9KA 2TN4A 2JWWA 5I2QA 3OP0A 1SL7A 1XK4C 4GAOA 1P28A 1BOCA 4FQOA 2MBXA 3D78A 3L47A 2BCBA 3O78A 4Q04A 2FJUB 1RROA 1KSMA 1T14A 2BE4A 3WNXB 5KSZA 2O60A 1GQMA 2M0RA 3DVKA 3BXKA 3KEVA 3R1OA 3SIBA 3D76A 2M97A 1UP5A 5CPVA 2MLFC 1QX2A 1OOGA 2L2EA 1ZMZA 2WCBA 4NDCA 2Y1NA 2KAVA 1N2DA 2KI6C 1Z4HA 3ICBA 2HQ8A 1CFDA 1GGZA 3E3RA 2WC5A 1QWVA 1WY9A 5K89A 2WC6A 4XJKB 5DKNA 1XFYO 1C7WA 3D74A 1NYAA 2WCFA 3ZNIA 2I94A 1QVIY 4TNCA 1KWOC 3PFVA 1DVIA 5HYDA 1PK0D 4CFQA 2QEVA 2LE9B 3EVUA 4AOMA 1M63B 1SR6C 2HETA 5FYXA 1MHOA 3PLFB 4YGAA 1FI6A 3B6XA 3EG5B 1R2UA 5IBWA 3GOFA 2KQ6A 5GQQC 4YBHB 2L0PA 3DYEA 2KQYA 1S6IA 1TNWA 1QXPA 4PHKA 2I2RE 1X02A 5G08A 1BF5A 1QTXA 2JU0A 1K90D 1KWOB 2K2FA 1B8LA 2PQLA 3CLNA 3PJIA 4ZCVA 2JULA 2QACA 5KTYA 5I2OA 2O5GA 1TCFA 2L5YA 1KFXS 4PE4A 3DY9A 2M7NA 4GNKB 4C0KA 1OSAA 2M1UA 1OZOA 4NDBA 1EG3A 1NCYA 1LA0A 1GGWA 1UHIA 2WCJA 1IQ5A 3L4AA 1LXFC 1N0YA 1CLLA 1YX8A 2EHBA 1TIZA 3VRNA 1LVCD 2LVVA 1M45A 4DCKA 4WRIA 2ZN8A 3EVRA 2K7BA 4MLWA 3OX5A 1R6PA 2M7LA 3VRQA 4DRWA 1WRLA 3SIAA 1DF0B 3MSEB 1BT6A 1W7JB 2LV7A 1IJ6A 4INXA 4R1EA 2JNFA 4BY4A 1DJWA 1OOJA 1RECA 1S5GY 2LUXA 4QJ5B 4YGCB 3OX6A 1BR1B 3RLZA 2K7CA 1FW4A 4I5NB 3DVMA 2H8VA 3S0FA 1S1EA 3BUOB 2F33A 3VGOA 1SL8A 2WNDA 1C07A 1QASA 3LCPC 1NCXA 1TOPA 2LUCA 3CWGA 2A4JA 2KNEA 1YUUA 1E8AA 2Y1MA 3QRXA 5F6TA 3RZSA 2BCXA 2G9BA 2JT0A 2JZIA 4MRYA 1SYMA 1TNQA 3PN7B 1PVBA 4GPLB 5HLOA 3TUYB 4FQTA 1YR5A 2JOJA 3UNWA 3B88A 3SG4A 3WHTB 2LHLA 3DD4A 3S0BA 3IQOA 3D77A 3OHMB 1WLMA 4N1GA 2BAPA 1CLBA 1XFUO 2WC8A 3PALA 4P5OE 1A2XA 3NHTA 4PALA 2JXCA 3UO9A 1CB1A 1ALVA 2Q4UA 4PE1A 3CDNA 3D0YA 5D69A 2IS9A 1NP8A 2KI4C 2BE6A 1XFRA 2I7AA 5ER4X 3PM2A 1G33A 1OZSA 2F2PA 4ORBB 3OGNA 1AJ4A 1KSOA 1MQ1A 3EKHA 2FCEA 1OOFA 3FE9A 3I5GB 3IQQA 3O2PA 1TNXA 3PATA 1TCOB 5HKZA 2M9GA 3BFAA 1DJZA 1DJIA 1B47A 1RTP1 4YGDB 1SCMB 2FJYA 2L98A 3NSOA 1B7TZ 1J55A 1NX3A 1YURA 3IVTA 2NXQA 1W9ZA 1SL9A 2K60A 3CS1A 4OR9B 3CR2A 3O4YA 2LMTA 1TRFA 3CZTX 3NSIA 3AKBA 2PYQA 4PHJA 1FPWA 1XO5A 4MSPA 1BG1A 3I5GC 3JTDC 5D3OA 1J1DA 1AP4A 2MHHA 1YUSA 3NXAA 4PCWA 5KU1A 1MWNA 1QIVA 2K7OA 1QX5B 3AAKA 3HX4A 1XFZO 3JVTC 1F71A 4C0LA 1LINA 5JOLA 3OB2B 2F8PA 4CFRA 1JF2A 3BYAA 5CSIA 4YRUA 4OCIA 1GM0A 4MZKA 1V1FA 4IL1A 1PULA 1KK7Y 1DEKA 1HT9A 2F3YA 3SG6A 1C7VA 1DGVA 2JC2A 1MR8A 2KGBC 1C3YA 2EC6B 5B8IB 3I5FC 4C0JA 1JFJA 1FI5A 4PHNA 1KQMB 1IJ5A 1OW4A 5DICA 2K61A 2KFHA 1S6JA 2JNXA 1FF1A 2KAYA 2GGZA 4DUQA 2M3WA 5CSFA 4GBAA 1A75A 2R2IA 2WCKA 3FWCA 4YI8A 1OQPA 4INWA 2V53A 4N1FA 1UHHA 4GGFC 2DOQA 1DJYA 1F4QA 4JKTA 1VRKA 1NX1A 1Y1XA 1LS8A 2KDHA 2NCOA 1ZFSA 1BR4B 1NIWA 1MXLC 3CR5X 4HRHA 1CDPA 1DELA 3VRRA 3JVTB 4MZLA 1SRAA 3FE6A 3PM8A 2LLTA 2WCEA 3CZ1A 2KLEA 1N65A 1EXRA 1KK8B 2KI6D 2NLNA 1JUOA 3R1PA 1MF8B 1ZACA 2CBLA 2M1KB 4CLNA 3DVEA 1NSHA 2BL0C 2MLEC 2QEOA 2PRUA 3D10A 1DTLA 3EK4A 3BUNB 1YRTB 1K8UA 5FI2A 2LMVA 2CT9A 2P70A 3BQ3A 1MXEA 2B1UA 4GGFA 1L2OB 1XK4A 3SS4A 4QJ3B 2COLB 2YGUA 3I5IB 3KHEA 4E68A 3TDZA 2M8UA 1SPYA 3R72A 2ZRTA 1SKTA 4PT1A 3OB1B 5HKYA 2K8MB 3TDIA 3I5FB 1Y0VH 1ALWA 3BOWA 4MN0A 2KAXA 1QV1A 3NSKA 3GK4X 2FCDA 1SSEB 3KF9A 4GFTA 1CNPA 4UPGA 1RK9A 1A29A 1CM1A 3FIAA 1JFKA 1AK8A 1C3ZA 1U5IB 3I5IC 1OOIX 1F70A 1AHRA 2JTZA 3SG3A 1K95A 1L2OC 3CYZA 1B4CA 3A4UB 3S0GA 2LANA 3F45A 3S0DA 5PALA 1BODA 3SG2A 2BKIB 1EJ3A 1W7IB 2WORA 4JQ0D 3H4SE 1SCVA 4U8DA 5CSJA 4M2QA 2LVJA 1J7QA 4JPZB 5FI6A 1IQ3A 3DF0B 1V1GA 2LCPA 4NQGA 2BL0B 2ZRSA 3BOWB 4MRXA 3V2LA 1OE9B 2PALA 1DF0A 4GGNA 2KSPA 1PRWA 2LP3A 3LK1A 1OMDA 3SS3A 1DQEA 1YVHA 1DGUA 3WHUB 1UHJA 1G8IA 5I2LA 1QX7A 3PSRA 2HF5A 2P71A 2BKHB 2G2BA 1YVLA 2F2OA 2NZ0A 5DKRA 4CPVA 1CMGA 2KI4B 2AAOA 3L4LA 1XVJA 2KOTA 4HRGA 3CZ2A 3LL8B 2WCMA 2KGRA 4WQ3A 1TUZA 4ZCUA 4HSZA 4YI9A 2K7DA 3TS5C 1B9AA 2ZKMX 1JF0A 2LHIA 3BUMB 4FTGA 4OVNF 1KQMC 1SW8A 2CXJA 1QIWA 1Y1AA 4F0ZB 5CSNA 4NDDA 4L9MA 2L50A 2GV5A 2WOSA 4OZDA 2D8NA 1YX7A 3M0WA 3R1VA 2QEBA 1BJFA 1OMRA 2JXLA 1CDNA 3NHIA 1K2HA 3TS5B 3B86A 2LLSA 3KO0A 1QJTA 1TWOA 2K2AA 2KFGA 1QVIZ 5HL1A 1XYDA 1KQVA 3SG7A 3SS5A 1JC2A 2LVKA 1NX2A 3PN7C 1WDCB 1NWDA 1TTXA 2SASA 4JWQA 3S0EA 1M31A 1IH0A 3AKAA 3EKJA 4I5KA 4IJ7A 2M49B 4DIRA 1IRJA 4MVFA 3JTDB 1F55A 1S3PA 2LC5A 2LAPA 3RM1A 1K9UA 1LKJA 3BUWB 1UURA 1KK7Z 1LA3A 1CDLA 1PVAA 2JPTA 3CGAA 3CTNA 1OOHA 3SG5A 2BBNA 3NGVA 1DT7B 1CDMA 4QJ4B 1HQVA 1S36A 1F4OA 2WCLA 3GK2A 1F8HA 4MZJA 2NCPA 1XFXO 1A03A 1KK8C 2OS8B 1AJ5A 1SBJA 1WRKA 5FI7A 1BU3A 1D1OA 3FE8A 3O6BA 5DKQA 1IWQA 1BLQA 1DMOA 1XFWO 2Y5IA 1DJGA 3FWBA 1Z2CB 1CLMA 1J7RA 3CZ0A 1EG4A 5ER5A 1RWYA 2CCMA 1J1EA 1NUBA 2WCHA 4M2PA 3TZ1A 5AANA 2SCPA 2AMIA 2E30A 2LVIA 1DJXA 1J7PA 1KCYA 3SJSA 2LM5A 3D75A 2KPHA 2F3ZA 3Q8IA 4PHMA 2VRGA 3BFHA 1YTZC 1UWOA 4YGBB 2KBIA 3K1EA 1TN4A 2MAZA 1K93D 4I5LB 1EH2A 3O4XA 4D1EA 5JJGA 1B1GA 2H61A 4KYNA 4ORAB 4CIDA 2L4HA 3BJHA 1WLZA 2AUCA 2M29A 2ZNEA 3BUXB 4I5JA 1H4BA 1B8RA 1ORGA 1XA5A 4OKHA 1CMFA 1IIOA 2BBMA 1SR6B 1FBVA 2L51A 2KYCA 1TNPA 4ETOA 3HCMA 3TDUA 1H8BA 2HPSA 3EK7A 4BY5A 2MJWB 2OS8C 5BPJA 1CFFA 2KYFA 3QMEA 4XYNA 2KBMA 1ZUZA 2KHNA 1IKUA 2MRDA 2BCAA 4JD9A 1CM4A 4HREE 2Q91A 3VB1A 5HLVA 2OPOA 3C1VA 4DS7A 2E6WA 2JRFA 1U5IA 2KLDA 3A8RA 2JT3A 3NSLA 5D7FA 4OV2A 1SCMC 1DJHA 1DC1A 5TNCA 1S6CA 1JSAA 1QLKA 2KFFA 1JBAA 1QATA 1KFUS 2GGMA 1M39A 1M46A 1MUXA 1BMOA 1NCZA 4PDZA 1F54A 2H2KA 1QV0A 2L4IA 3I5HB 4ORCB 4AQJA 3DVJA 2Y4QA 1PSBA 2HQWA 1S5GZ 1YRUB 2L2CA 2H61C 3D73A 3VROA 2JPOA 1AUIB 2K0JA 3CABA 4MEWA 4F7FA 2PSRA 5AEQA 1A4PA 2LNKA 3AAJA 2ERBA 4PE0A 4A4CA 4A4BA 1CFCA 4P2YB 4YGEB 3DXLA 2QDIA 1K96A 2ISDA 5AERA 1YUTA 2I18A 2RGIA 3I5HC 1CFPA 1PSRA 1QLSA 2EC6C 1SK6D 1NPQA 2OTGB 3ZWHA 1AVSA 2EGDA 2PVBA 3LLEA 3K21A 2FOTA 1PALA 2MA2A 3KPXA 5HKWA 1Q80A 1SNLA 1IG5A 3BFBA 1S26D 1K94A 1UHKA 1SY9A 2ZFDA 1EL4A 2LP2A 2ZNDA 2BNXA 2JTTA 3GK1A 1OMVA 1J7OA 1ZOTB 5AXIA 2OTGC
chains in the Genus database with same CATH topology
3CR4X 3DF0A 1A75B 1XFVO 2JT8A 2QPTA 3LK0A 4GUKA 4N5XA 3FS7A 1WDCC 4XJKA 2LLUA 1CNPA 5AFPA 3IF7A 2P6BB 1WRZA 1IGVA 2BECA 1JWDA 1NX0A 4M2OA 3EVVA 5J3XA 1CTRA 1GJYA 1ODBA 1UUSA 2CTNA 2ZN9A 2PMYA 1B7TY 1G4YR 1Y6WA 2LMUA 3D0YB 4ICBA 1UHNA 2L5XB 4AQIA 1RJVA 2JQ6A 1QS7A 1L7ZA 2PASA 1Y1UA 3EK8A 1KFUL 1RFJA 1SMGA 4MBEA 1B8CA 4PE7A 2CNPA 4WQ2A 1KFXL 3TUYC 1CKKA 4USLA 3WXAA 1K9PA 5I8NA 1K9KA 2TN4A 2JWWA 5I2QA 3OP0A 1SL7A 1XK4C 4GAOA 1BOCA 4FQOA 2MBXA 2BCBA 3O78A 4Q04A 2FJUB 1RROA 1KSMA 2BE4A 3WNXB 5KSZA 2O60A 1GQMA 2M0RA 3DVKA 3BXKA 3KEVA 3SIBA 2M97A 1UP5A 5CPVA 2MLFC 1QX2A 2L2EA 1ZMZA 2WCBA 4NDCA 2Y1NA 2KAVA 1N2DA 2KI6C 3ICBA 2HQ8A 1CFDA 1GGZA 3E3RA 1WY9A 5K89A 4XJKB 5DKNA 1XFYO 1C7WA 1NYAA 2WCFA 3ZNIA 2I94A 1QVIY 4TNCA 1KWOC 3PFVA 1DVIA 5HYDA 1PK0D 4CFQA 2LE9B 3EVUA 4AOMA 1M63B 2HETA 1SR6C 5FYXA 1MHOA 3PLFB 4YGAA 1FI6A 1R2UA 5IBWA 3GOFA 2KQ6A 5GQQC 4YBHB 2L0PA 2KQYA 1S6IA 1TNWA 1QXPA 4PHKA 2I2RE 1X02A 5G08A 1BF5A 1QTXA 2JU0A 1K90D 1KWOB 2K2FA 1B8LA 3CLNA 4ZCVA 5AANA 5KTYA 2JULA 2QACA 5I2OA 2O5GA 1TCFA 1KFXS 4PE4A 2M7NA 4GNKB 4C0KA 1OSAA 2M1UA 1OZOA 4NDBA 1EG3A 1NCYA 1LA0A 1GGWA 1UHIA 1IQ5A 1LXFC 1N0YA 1CLLA 1YX8A 2EHBA 1TIZA 3VRNA 1LVCD 2LVVA 1M45A 4DCKA 4WRIA 2ZN8A 3EVRA 2K7BA 4MLWA 3OX5A 1R6PA 2M7LA 3VRQA 4DRWA 1WRLA 3SIAA 1DF0B 3MSEB 1BT6A 1W7JB 2LV7A 1IJ6A 4R1EA 4BY4A 2JNFA 1BG1A 1DJWA 1OOJA 1RECA 1S5GY 2LUXA 4QJ5B 4YGCB 3OX6A 1BR1B 3RLZA 2K7CA 1FW4A 4I5NB 3DVMA 1S1EA 3BUOB 2F33A 3VGOA 1SL8A 2WNDA 1C07A 1QASA 3LCPC 1NCXA 1TOPA 2LUCA 3CWGA 2A4JA 2KNEA 1YUUA 1E8AA 2Y1MA 3QRXA 5F6TA 2BCXA 2G9BA 2JT0A 2JZIA 4MRYA 1SYMA 1TNQA 3PN7B 1PVBA 4GPLB 5HLOA 3TUYB 1YR5A 2JOJA 3SG4A 3WHTB 2LHLA 3DD4A 3IQOA 3OHMB 4N1GA 1WLMA 1CLBA 1XFUO 2WC8A 3PALA 4P5OE 1A2XA 4PALA 2JXCA 1CB1A 1ALVA 2Q4UA 4PE1A 3D0YA 5D69A 2IS9A 1NP8A 2KI4C 2BE6A 5ER4X 2I7AA 1G33A 1OZSA 2F2PA 4ORBB 1AJ4A 1KSOA 1MQ1A 3EKHA 2FCEA 3I5GB 3IQQA 3O2PA 1TNXA 3PATA 1TCOB 5HKZA 2M9GA 1DJZA 1DJIA 1B47A 1RTP1 4YGDB 1SCMB 3NSOA 2L98A 1B7TZ 1J55A 1NX3A 1YURA 3VRPA 2NXQA 4OR9B 1SL9A 3CS1A 3CR2A 3O4YA 2LMTA 1TRFA 3CZTX 3NSIA 3AKBA 4PHJA 1FPWA 1XO5A 4MSPA 3I5GC 3JTDC 1J1DA 1AP4A 2MHHA 1YUSA 3NXAA 4PCWA 5KU1A 1MWNA 1QIVA 2K7OA 1QX5B 3AAKA 3HX4A 1XFZO 3JVTC 1F71A 4C0LA 1LINA 5JOLA 3OB2B 2F8PA 4CFRA 1JF2A 3BYAA 5CSIA 4YRUA 4OCIA 4MZKA 1V1FA 4IL1A 1PULA 1KK7Y 1HT9A 2F3YA 1C7VA 3SG6A 1DGVA 2JC2A 1MR8A 2KGBC 2EC6B 5B8IB 3I5FC 4C0JA 1JFJA 1FI5A 4PHNA 1KQMB 1IJ5A 1FF1A 2K61A 2KFHA 1S6JA 2JNXA 2KAYA 2GGZA 4DUQA 2M3WA 5CSFA 4GBAA 1A75A 2R2IA 3FWCA 4YI8A 1OQPA 4N1FA 2V53A 1UHHA 4GGFC 2DOQA 1DJYA 1F4QA 1VRKA 1NX1A 1Y1XA 2KDHA 2NCOA 1BR4B 1NIWA 1ZFSA 1MXLC 3CR5X 4HRHA 1CDPA 3VRRA 3JVTB 4MZLA 1SRAA 3PM8A 2LLTA 2WCEA 1N65A 1EXRA 1KK8B 2KI6D 2NLNA 1JUOA 1MF8B 1ZACA 2CBLA 2M1KB 4CLNA 3DVEA 1NSHA 2BL0C 2MLEC 2PRUA 3D10A 1DTLA 3EK4A 3BUNB 1YRTB 1K8UA 2LMVA 2CT9A 3BQ3A 1MXEA 2B1UA 4GGFA 1L2OB 1XK4A 4QJ3B 2COLB 3I5IB 3KHEA 4E68A 3TDZA 2M8UA 1SPYA 2ZRTA 1SKTA 3OB1B 5HKYA 2K8MB 3TDIA 3I5FB 1Y0VH 1ALWA 3BOWA 4MN0A 2KAXA 1QV1A 3NSKA 3GK4X 2FCDA 3KF9A 4GFTA 4UPGA 1RK9A 1A29A 1CM1A 3FIAA 1JFKA 1AK8A 1F70A 1U5IB 3I5IC 1AHRA 2JTZA 3SG3A 1K95A 1L2OC 1B4CA 3A4UB 2LANA 3F45A 5PALA 1BODA 3SG2A 2BKIB 1EJ3A 1W7IB 2WORA 4JQ0D 3H4SE 1SCVA 4U8DA 5CSJA 4M2QA 2LVJA 1J7QA 4JPZB 1IQ3A 3DF0B 1V1GA 2LCPA 4NQGA 2BL0B 2ZRSA 3BOWB 4MRXA 1OE9B 2PALA 1DF0A 4GGNA 2KSPA 1PRWA 2LP3A 3LK1A 1OMDA 1YVHA 3WHUB 1DGUA 1UHJA 1G8IA 5I2LA 1QX7A 3PSRA 2HF5A 5DKRA 2BKHB 2G2BA 1YVLA 2F2OA 2NZ0A 4CPVA 1CMGA 2KI4B 2AAOA 1XVJA 2KOTA 4HRGA 4WQ3A 3LL8B 2KGRA 4ZCUA 4HSZA 4YI9A 2K7DA 3TS5C 1B9AA 2ZKMX 1JF0A 2LHIA 3BUMB 4FTGA 4OVNF 1KQMC 1SW8A 2CXJA 1QIWA 1Y1AA 4F0ZB 5CSNA 4NDDA 4L9MA 2L50A 2GV5A 2WOSA 2D8NA 1YX7A 3M0WA 1BJFA 1OMRA 2JXLA 1CDNA 1K2HA 3TS5B 2LLSA 3KO0A 1QJTA 2K2AA 2KFGA 1QVIZ 1XYDA 1KQVA 3SG7A 1JC2A 2LVKA 1NX2A 3PN7C 1WDCB 1NWDA 1TTXA 2SASA 4JWQA 1M31A 1IH0A 3AKAA 3EKJA 4I5KA 2M49B 4DIRA 1IRJA 4MVFA 3JTDB 1F55A 1S3PA 2LC5A 2LAPA 3RM1A 1K9UA 1LKJA 3BUWB 1UURA 1KK7Z 1LA3A 1CDLA 1PVAA 2JPTA 3CGAA 3CTNA 3SG5A 2BBNA 1DT7B 1CDMA 4QJ4B 1HQVA 1S36A 1F4OA 1F8HA 3GK2A 4MZJA 2NCPA 1XFXO 1A03A 1KK8C 2OS8B 1AJ5A 1SBJA 1WRKA 1BU3A 1D1OA 3O6BA 5DKQA 1IWQA 1BLQA 1DMOA 1XFWO 2Y5IA 1DJGA 3FWBA 1CLMA 1J7RA 1EG4A 5ER5A 1RWYA 2CCMA 1J1EA 1NUBA 4M2PA 3TZ1A 2SCPA 2AMIA 2E30A 2LVIA 1DJXA 1J7PA 1KCYA 3SJSA 2LM5A 2F3ZA 4PHMA 2VRGA 1YTZC 1UWOA 4YGBB 2KBIA 1TN4A 2MAZA 1K93D 4I5LB 1EH2A 4D1EA 1B1GA 5JJGA 2H61A 4ORAB 4CIDA 2L4HA 1WLZA 2AUCA 2M29A 2ZNEA 3BUXB 4I5JA 1H4BA 1B8RA 4OKHA 1XA5A 1CMFA 2BBMA 1SR6B 1FBVA 2L51A 2KYCA 1TNPA 4ETOA 3HCMA 3TDUA 1H8BA 2HPSA 3EK7A 4BY5A 2MJWB 2OS8C 5BPJA 1CFFA 2KYFA 4XYNA 2KBMA 1ZUZA 2KHNA 1IKUA 2MRDA 2BCAA 1CM4A 4HREE 2Q91A 5HLVA 2OPOA 3C1VA 4DS7A 2E6WA 2JRFA 1U5IA 3NSLA 3A8RA 2JT3A 5D7FA 4OV2A 1SCMC 1DJHA 5TNCA 1S6CA 1JSAA 1QLKA 2KFFA 1JBAA 1QATA 1KFUS 2GGMA 1M39A 1M46A 1MUXA 1BMOA 1NCZA 4PDZA 1F54A 2H2KA 1QV0A 2L4IA 3I5HB 4ORCB 4AQJA 3DVJA 2Y4QA 1PSBA 2HQWA 1S5GZ 1YRUB 2H61C 3VROA 1AUIB 2K0JA 4MEWA 2PSRA 5AEQA 1A4PA 2LNKA 3AAJA 4PE0A 4A4CA 4A4BA 1CFCA 4P2YB 4YGEB 1K96A 2ISDA 5AERA 1YUTA 2I18A 2RGIA 3I5HC 1CFPA 1PSRA 1QLSA 2EC6C 1SK6D 1NPQA 2OTGB 3ZWHA 1AVSA 2EGDA 2PVBA 3LLEA 3K21A 2FOTA 1PALA 2MA2A 3KPXA 5HKWA 1Q80A 1SNLA 1IG5A 1S26D 1K94A 1UHKA 1SY9A 2ZFDA 1EL4A 2LP2A 2ZNDA 2JTTA 3GK1A 1OMVA 1J7OA 1ZOTB 5AXIA 2OTGC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CR4 X;  3DF0 A;  1A75 B;  1XFV O;  2JT8 A;  2QPT A;  3LK0 A;  4GUK A;  4N5X A;  3FS7 A;  1WDC C;  4XJK A;  2LLU A;  1CNP A;  5AFP A;  3IF7 A;  2P6B B;  1WRZ A;  1IGV A;  2BEC A;  1JWD A;  1NX0 A;  4M2O A;  3EVV A;  5J3X A;  1CTR A;  1GJY A;  1ODB A;  1UUS A;  2CTN A;  2ZN9 A;  2PMY A;  1B7T Y;  1G4Y R;  1Y6W A;  2LMU A;  3D0Y B;  4ICB A;  1UHN A;  2L5X B;  4AQI A;  1RJV A;  2JQ6 A;  1QS7 A;  1L7Z A;  2PAS A;  1Y1U A;  3EK8 A;  1KFU L;  1RFJ A;  1SMG A;  4MBE A;  1B8C A;  4PE7 A;  2CNP A;  4WQ2 A;  1KFX L;  3TUY C;  1CKK A;  4USL A;  3WXA A;  1K9P A;  5I8N A;  1K9K A;  2TN4 A;  2JWW A;  5I2Q A;  3OP0 A;  1SL7 A;  1XK4 C;  4GAO A;  1BOC A;  4FQO A;  2MBX A;  2BCB A;  3O78 A;  4Q04 A;  2FJU B;  1RRO A;  1KSM A;  2BE4 A;  3WNX B;  5KSZ A;  2O60 A;  1GQM A;  2M0R A;  3DVK A;  3BXK A;  3KEV A;  3SIB A;  2M97 A;  1UP5 A;  5CPV A;  2MLF C;  1QX2 A;  2L2E A;  1ZMZ A;  2WCB A;  4NDC A;  2Y1N A;  2KAV A;  1N2D A;  2KI6 C;  3ICB A;  2HQ8 A;  1CFD A;  1GGZ A;  3E3R A;  1WY9 A;  5K89 A;  4XJK B;  5DKN A;  1XFY O;  1C7W A;  1NYA A;  2WCF A;  3ZNI A;  2I94 A;  1QVI Y;  4TNC A;  1KWO C;  3PFV A;  1DVI A;  5HYD A;  1PK0 D;  4CFQ A;  2LE9 B;  3EVU A;  4AOM A;  1M63 B;  2HET A;  1SR6 C;  5FYX A;  1MHO A;  3PLF B;  4YGA A;  1FI6 A;  1R2U A;  5IBW A;  3GOF A;  2KQ6 A;  5GQQ C;  4YBH B;  2L0P A;  2KQY A;  1S6I A;  1TNW A;  1QXP A;  4PHK A;  2I2R E;  1X02 A;  5G08 A;  1BF5 A;  1QTX A;  2JU0 A;  1K90 D;  1KWO B;  2K2F A;  1B8L A;  3CLN A;  4ZCV A;  5AAN A;  5KTY A;  2JUL A;  2QAC A;  5I2O A;  2O5G A;  1TCF A;  1KFX S;  4PE4 A;  2M7N A;  4GNK B;  4C0K A;  1OSA A;  2M1U A;  1OZO A;  4NDB A;  1EG3 A;  1NCY A;  1LA0 A;  1GGW A;  1UHI A;  1IQ5 A;  1LXF C;  1N0Y A;  1CLL A;  1YX8 A;  2EHB A;  1TIZ A;  3VRN A;  1LVC D;  2LVV A;  1M45 A;  4DCK A;  4WRI A;  2ZN8 A;  3EVR A;  2K7B A;  4MLW A;  3OX5 A;  1R6P A;  2M7L A;  3VRQ A;  4DRW A;  1WRL A;  3SIA A;  1DF0 B;  3MSE B;  1BT6 A;  1W7J B;  2LV7 A;  1IJ6 A;  4R1E A;  4BY4 A;  2JNF A;  1BG1 A;  1DJW A;  1OOJ A;  1REC A;  1S5G Y;  2LUX A;  4QJ5 B;  4YGC B;  3OX6 A;  1BR1 B;  3RLZ A;  2K7C A;  1FW4 A;  4I5N B;  3DVM A;  1S1E A;  3BUO B;  2F33 A;  3VGO A;  1SL8 A;  2WND A;  1C07 A;  1QAS A;  3LCP C;  1NCX A;  1TOP A;  2LUC A;  3CWG A;  2A4J A;  2KNE A;  1YUU A;  1E8A A;  2Y1M A;  3QRX A;  5F6T A;  2BCX A;  2G9B A;  2JT0 A;  2JZI A;  4MRY A;  1SYM A;  1TNQ A;  3PN7 B;  1PVB A;  4GPL B;  5HLO A;  3TUY B;  1YR5 A;  2JOJ A;  3SG4 A;  3WHT B;  2LHL A;  3DD4 A;  3IQO A;  3OHM B;  4N1G A;  1WLM A;  1CLB A;  1XFU O;  2WC8 A;  3PAL A;  4P5O E;  1A2X A;  4PAL A;  2JXC A;  1CB1 A;  1ALV A;  2Q4U A;  4PE1 A;  3D0Y A;  5D69 A;  2IS9 A;  1NP8 A;  2KI4 C;  2BE6 A;  5ER4 X;  2I7A A;  1G33 A;  1OZS A;  2F2P A;  4ORB B;  1AJ4 A;  1KSO A;  1MQ1 A;  3EKH A;  2FCE A;  3I5G B;  3IQQ A;  3O2P A;  1TNX A;  3PAT A;  1TCO B;  5HKZ A;  2M9G A;  1DJZ A;  1DJI A;  1B47 A;  1RTP 1;  4YGD B;  1SCM B;  3NSO A;  2L98 A;  1B7T Z;  1J55 A;  1NX3 A;  1YUR A;  3VRP A;  2NXQ A;  4OR9 B;  1SL9 A;  3CS1 A;  3CR2 A;  3O4Y A;  2LMT A;  1TRF A;  3CZT X;  3NSI A;  3AKB A;  4PHJ A;  1FPW A;  1XO5 A;  4MSP A;  3I5G C;  3JTD C;  1J1D A;  1AP4 A;  2MHH A;  1YUS A;  3NXA A;  4PCW A;  5KU1 A;  1MWN A;  1QIV A;  2K7O A;  1QX5 B;  3AAK A;  3HX4 A;  1XFZ O;  3JVT C;  1F71 A;  4C0L A;  1LIN A;  5JOL A;  3OB2 B;  2F8P A;  4CFR A;  1JF2 A;  3BYA A;  5CSI A;  4YRU A;  4OCI A;  4MZK A;  1V1F A;  4IL1 A;  1PUL A;  1KK7 Y;  1HT9 A;  2F3Y A;  1C7V A;  3SG6 A;  1DGV A;  2JC2 A;  1MR8 A;  2KGB C;  2EC6 B;  5B8I B;  3I5F C;  4C0J A;  1JFJ A;  1FI5 A;  4PHN A;  1KQM B;  1IJ5 A;  1FF1 A;  2K61 A;  2KFH A;  1S6J A;  2JNX A;  2KAY A;  2GGZ A;  4DUQ A;  2M3W A;  5CSF A;  4GBA A;  1A75 A;  2R2I A;  3FWC A;  4YI8 A;  1OQP A;  4N1F A;  2V53 A;  1UHH A;  4GGF C;  2DOQ A;  1DJY A;  1F4Q A;  1VRK A;  1NX1 A;  1Y1X A;  2KDH A;  2NCO A;  1BR4 B;  1NIW A;  1ZFS A;  1MXL C;  3CR5 X;  4HRH A;  1CDP A;  3VRR A;  3JVT B;  4MZL A;  1SRA A;  3PM8 A;  2LLT A;  2WCE A;  1N65 A;  1EXR A;  1KK8 B;  2KI6 D;  2NLN A;  1JUO A;  1MF8 B;  1ZAC A;  2CBL A;  2M1K B;  4CLN A;  3DVE A;  1NSH A;  2BL0 C;  2MLE C;  2PRU A;  3D10 A;  1DTL A;  3EK4 A;  3BUN B;  1YRT B;  1K8U A;  2LMV A;  2CT9 A;  3BQ3 A;  1MXE A;  2B1U A;  4GGF A;  1L2O B;  1XK4 A;  4QJ3 B;  2COL B;  3I5I B;  3KHE A;  4E68 A;  3TDZ A;  2M8U A;  1SPY A;  2ZRT A;  1SKT A;  3OB1 B;  5HKY A;  2K8M B;  3TDI A;  3I5F B;  1Y0V H;  1ALW A;  3BOW A;  4MN0 A;  2KAX A;  1QV1 A;  3NSK A;  3GK4 X;  2FCD A;  3KF9 A;  4GFT A;  4UPG A;  1RK9 A;  1A29 A;  1CM1 A;  3FIA A;  1JFK A;  1AK8 A;  1F70 A;  1U5I B;  3I5I C;  1AHR A;  2JTZ A;  3SG3 A;  1K95 A;  1L2O C;  1B4C A;  3A4U B;  2LAN A;  3F45 A;  5PAL A;  1BOD A;  3SG2 A;  2BKI B;  1EJ3 A;  1W7I B;  2WOR A;  4JQ0 D;  3H4S E;  1SCV A;  4U8D A;  5CSJ A;  4M2Q A;  2LVJ A;  1J7Q A;  4JPZ B;  1IQ3 A;  3DF0 B;  1V1G A;  2LCP A;  4NQG A;  2BL0 B;  2ZRS A;  3BOW B;  4MRX A;  1OE9 B;  2PAL A;  1DF0 A;  4GGN A;  2KSP A;  1PRW A;  2LP3 A;  3LK1 A;  1OMD A;  1YVH A;  3WHU B;  1DGU A;  1UHJ A;  1G8I A;  5I2L A;  1QX7 A;  3PSR A;  2HF5 A;  5DKR A;  2BKH B;  2G2B A;  1YVL A;  2F2O A;  2NZ0 A;  4CPV A;  1CMG A;  2KI4 B;  2AAO A;  1XVJ A;  2KOT A;  4HRG A;  4WQ3 A;  3LL8 B;  2KGR A;  4ZCU A;  4HSZ A;  4YI9 A;  2K7D A;  3TS5 C;  1B9A A;  2ZKM X;  1JF0 A;  2LHI A;  3BUM B;  4FTG A;  4OVN F;  1KQM C;  1SW8 A;  2CXJ A;  1QIW A;  1Y1A A;  4F0Z B;  5CSN A;  4NDD A;  4L9M A;  2L50 A;  2GV5 A;  2WOS A;  2D8N A;  1YX7 A;  3M0W A;  1BJF A;  1OMR A;  2JXL A;  1CDN A;  1K2H A;  3TS5 B;  2LLS A;  3KO0 A;  1QJT A;  2K2A A;  2KFG A;  1QVI Z;  1XYD A;  1KQV A;  3SG7 A;  1JC2 A;  2LVK A;  1NX2 A;  3PN7 C;  1WDC B;  1NWD A;  1TTX A;  2SAS A;  4JWQ A;  1M31 A;  1IH0 A;  3AKA A;  3EKJ A;  4I5K A;  2M49 B;  4DIR A;  1IRJ A;  4MVF A;  3JTD B;  1F55 A;  1S3P A;  2LC5 A;  2LAP A;  3RM1 A;  1K9U A;  1LKJ A;  3BUW B;  1UUR A;  1KK7 Z;  1LA3 A;  1CDL A;  1PVA A;  2JPT A;  3CGA A;  3CTN A;  3SG5 A;  2BBN A;  1DT7 B;  1CDM A;  4QJ4 B;  1HQV A;  1S36 A;  1F4O A;  1F8H A;  3GK2 A;  4MZJ A;  2NCP A;  1XFX O;  1A03 A;  1KK8 C;  2OS8 B;  1AJ5 A;  1SBJ A;  1WRK A;  1BU3 A;  1D1O A;  3O6B A;  5DKQ A;  1IWQ A;  1BLQ A;  1DMO A;  1XFW O;  2Y5I A;  1DJG A;  3FWB A;  1CLM A;  1J7R A;  1EG4 A;  5ER5 A;  1RWY A;  2CCM A;  1J1E A;  1NUB A;  4M2P A;  3TZ1 A;  2SCP A;  2AMI A;  2E30 A;  2LVI A;  1DJX A;  1J7P A;  1KCY A;  3SJS A;  2LM5 A;  2F3Z A;  4PHM A;  2VRG A;  1YTZ C;  1UWO A;  4YGB B;  2KBI A;  1TN4 A;  2MAZ A;  1K93 D;  4I5L B;  1EH2 A;  4D1E A;  1B1G A;  5JJG A;  2H61 A;  4ORA B;  4CID A;  2L4H A;  1WLZ A;  2AUC A;  2M29 A;  2ZNE A;  3BUX B;  4I5J A;  1H4B A;  1B8R A;  4OKH A;  1XA5 A;  1CMF A;  2BBM A;  1SR6 B;  1FBV A;  2L51 A;  2KYC A;  1TNP A;  4ETO A;  3HCM A;  3TDU A;  1H8B A;  2HPS A;  3EK7 A;  4BY5 A;  2MJW B;  2OS8 C;  5BPJ A;  1CFF A;  2KYF A;  4XYN A;  2KBM A;  1ZUZ A;  2KHN A;  1IKU A;  2MRD A;  2BCA A;  1CM4 A;  4HRE E;  2Q91 A;  5HLV A;  2OPO A;  3C1V A;  4DS7 A;  2E6W A;  2JRF A;  1U5I A;  3NSL A;  3A8R A;  2JT3 A;  5D7F A;  4OV2 A;  1SCM C;  1DJH A;  5TNC A;  1S6C A;  1JSA A;  1QLK A;  2KFF A;  1JBA A;  1QAT A;  1KFU S;  2GGM A;  1M39 A;  1M46 A;  1MUX A;  1BMO A;  1NCZ A;  4PDZ A;  1F54 A;  2H2K A;  1QV0 A;  2L4I A;  3I5H B;  4ORC B;  4AQJ A;  3DVJ A;  2Y4Q A;  1PSB A;  2HQW A;  1S5G Z;  1YRU B;  2H61 C;  3VRO A;  1AUI B;  2K0J A;  4MEW A;  2PSR A;  5AEQ A;  1A4P A;  2LNK A;  3AAJ A;  4PE0 A;  4A4C A;  4A4B A;  1CFC A;  4P2Y B;  4YGE B;  1K96 A;  2ISD A;  5AER A;  1YUT A;  2I18 A;  2RGI A;  3I5H C;  1CFP A;  1PSR A;  1QLS A;  2EC6 C;  1SK6 D;  1NPQ A;  2OTG B;  3ZWH A;  1AVS A;  2EGD A;  2PVB A;  3LLE A;  3K21 A;  2FOT A;  1PAL A;  2MA2 A;  3KPX A;  5HKW A;  1Q80 A;  1SNL A;  1IG5 A;  1S26 D;  1K94 A;  1UHK A;  1SY9 A;  2ZFD A;  1EL4 A;  2LP2 A;  2ZND A;  2JTT A;  3GK1 A;  1OMV A;  1J7O A;  1ZOT B;  5AXI A;  2OTG C; 
#chains in the Genus database with same CATH topology
 3CR4 X;  3DF0 A;  1A75 B;  1XFV O;  2JT8 A;  2QPT A;  3LK0 A;  4GUK A;  4N5X A;  3FS7 A;  1WDC C;  3DZT A;  2LLU A;  2GTE A;  2QEH A;  4XJK A;  3B7A A;  3IF7 A;  2P6B B;  5AFP A;  1WRZ A;  1IGV A;  2BEC A;  1JWD A;  1NX0 A;  4M2O A;  3EVV A;  3OBV A;  5J3X A;  1CTR A;  1GJY A;  1ODB A;  1UUS A;  2CTN A;  2ZN9 A;  2PMY A;  1B7T Y;  1G4Y R;  1Y6W A;  2LMU A;  3D0Y B;  3B87 A;  4ICB A;  3VRP A;  1UHN A;  2L5X B;  4AQI A;  1RJV A;  3S0A A;  2JQ6 A;  1QS7 A;  1L7Z A;  2PAS A;  1Y1U A;  3EK8 A;  1KFU L;  1RFJ A;  1SMG A;  4MBE A;  3N7H A;  1B8C A;  4PE7 A;  5I94 A;  2CNP A;  4WQ2 A;  1KFX L;  3TUY C;  1CKK A;  4USL A;  3WXA A;  1K9P A;  1TUJ A;  5EL2 A;  5I8N A;  1K9K A;  2TN4 A;  2JWW A;  5I2Q A;  3OP0 A;  1SL7 A;  1XK4 C;  4GAO A;  1P28 A;  1BOC A;  4FQO A;  2MBX A;  3D78 A;  3L47 A;  2BCB A;  3O78 A;  4Q04 A;  2FJU B;  1RRO A;  1KSM A;  1T14 A;  2BE4 A;  3WNX B;  5KSZ A;  2O60 A;  1GQM A;  2M0R A;  3DVK A;  3BXK A;  3KEV A;  3R1O A;  3SIB A;  3D76 A;  2M97 A;  1UP5 A;  5CPV A;  2MLF C;  1QX2 A;  1OOG A;  2L2E A;  1ZMZ A;  2WCB A;  4NDC A;  2Y1N A;  2KAV A;  1N2D A;  2KI6 C;  1Z4H A;  3ICB A;  2HQ8 A;  1CFD A;  1GGZ A;  3E3R A;  2WC5 A;  1QWV A;  1WY9 A;  5K89 A;  2WC6 A;  4XJK B;  5DKN A;  1XFY O;  1C7W A;  3D74 A;  1NYA A;  2WCF A;  3ZNI A;  2I94 A;  1QVI Y;  4TNC A;  1KWO C;  3PFV A;  1DVI A;  5HYD A;  1PK0 D;  4CFQ A;  2QEV A;  2LE9 B;  3EVU A;  4AOM A;  1M63 B;  1SR6 C;  2HET A;  5FYX A;  1MHO A;  3PLF B;  4YGA A;  1FI6 A;  3B6X A;  3EG5 B;  1R2U A;  5IBW A;  3GOF A;  2KQ6 A;  5GQQ C;  4YBH B;  2L0P A;  3DYE A;  2KQY A;  1S6I A;  1TNW A;  1QXP A;  4PHK A;  2I2R E;  1X02 A;  5G08 A;  1BF5 A;  1QTX A;  2JU0 A;  1K90 D;  1KWO B;  2K2F A;  1B8L A;  2PQL A;  3CLN A;  3PJI A;  4ZCV A;  2JUL A;  2QAC A;  5KTY A;  5I2O A;  2O5G A;  1TCF A;  2L5Y A;  1KFX S;  4PE4 A;  3DY9 A;  2M7N A;  4GNK B;  4C0K A;  1OSA A;  2M1U A;  1OZO A;  4NDB A;  1EG3 A;  1NCY A;  1LA0 A;  1GGW A;  1UHI A;  2WCJ A;  1IQ5 A;  3L4A A;  1LXF C;  1N0Y A;  1CLL A;  1YX8 A;  2EHB A;  1TIZ A;  3VRN A;  1LVC D;  2LVV A;  1M45 A;  4DCK A;  4WRI A;  2ZN8 A;  3EVR A;  2K7B A;  4MLW A;  3OX5 A;  1R6P A;  2M7L A;  3VRQ A;  4DRW A;  1WRL A;  3SIA A;  1DF0 B;  3MSE B;  1BT6 A;  1W7J B;  2LV7 A;  1IJ6 A;  4INX A;  4R1E A;  2JNF A;  4BY4 A;  1DJW A;  1OOJ A;  1REC A;  1S5G Y;  2LUX A;  4QJ5 B;  4YGC B;  3OX6 A;  1BR1 B;  3RLZ A;  2K7C A;  1FW4 A;  4I5N B;  3DVM A;  2H8V A;  3S0F A;  1S1E A;  3BUO B;  2F33 A;  3VGO A;  1SL8 A;  2WND A;  1C07 A;  1QAS A;  3LCP C;  1NCX A;  1TOP A;  2LUC A;  3CWG A;  2A4J A;  2KNE A;  1YUU A;  1E8A A;  2Y1M A;  3QRX A;  5F6T A;  3RZS A;  2BCX A;  2G9B A;  2JT0 A;  2JZI A;  4MRY A;  1SYM A;  1TNQ A;  3PN7 B;  1PVB A;  4GPL B;  5HLO A;  3TUY B;  4FQT A;  1YR5 A;  2JOJ A;  3UNW A;  3B88 A;  3SG4 A;  3WHT B;  2LHL A;  3DD4 A;  3S0B A;  3IQO A;  3D77 A;  3OHM B;  1WLM A;  4N1G A;  2BAP A;  1CLB A;  1XFU O;  2WC8 A;  3PAL A;  4P5O E;  1A2X A;  3NHT A;  4PAL A;  2JXC A;  3UO9 A;  1CB1 A;  1ALV A;  2Q4U A;  4PE1 A;  3CDN A;  3D0Y A;  5D69 A;  2IS9 A;  1NP8 A;  2KI4 C;  2BE6 A;  1XFR A;  2I7A A;  5ER4 X;  3PM2 A;  1G33 A;  1OZS A;  2F2P A;  4ORB B;  3OGN A;  1AJ4 A;  1KSO A;  1MQ1 A;  3EKH A;  2FCE A;  1OOF A;  3FE9 A;  3I5G B;  3IQQ A;  3O2P A;  1TNX A;  3PAT A;  1TCO B;  5HKZ A;  2M9G A;  3BFA A;  1DJZ A;  1DJI A;  1B47 A;  1RTP 1;  4YGD B;  1SCM B;  2FJY A;  2L98 A;  3NSO A;  1B7T Z;  1J55 A;  1NX3 A;  1YUR A;  3IVT A;  2NXQ A;  1W9Z A;  1SL9 A;  2K60 A;  3CS1 A;  4OR9 B;  3CR2 A;  3O4Y A;  2LMT A;  1TRF A;  3CZT X;  3NSI A;  3AKB A;  2PYQ A;  4PHJ A;  1FPW A;  1XO5 A;  4MSP A;  1BG1 A;  3I5G C;  3JTD C;  5D3O A;  1J1D A;  1AP4 A;  2MHH A;  1YUS A;  3NXA A;  4PCW A;  5KU1 A;  1MWN A;  1QIV A;  2K7O A;  1QX5 B;  3AAK A;  3HX4 A;  1XFZ O;  3JVT C;  1F71 A;  4C0L A;  1LIN A;  5JOL A;  3OB2 B;  2F8P A;  4CFR A;  1JF2 A;  3BYA A;  5CSI A;  4YRU A;  4OCI A;  1GM0 A;  4MZK A;  1V1F A;  4IL1 A;  1PUL A;  1KK7 Y;  1DEK A;  1HT9 A;  2F3Y A;  3SG6 A;  1C7V A;  1DGV A;  2JC2 A;  1MR8 A;  2KGB C;  1C3Y A;  2EC6 B;  5B8I B;  3I5F C;  4C0J A;  1JFJ A;  1FI5 A;  4PHN A;  1KQM B;  1IJ5 A;  1OW4 A;  5DIC A;  2K61 A;  2KFH A;  1S6J A;  2JNX A;  1FF1 A;  2KAY A;  2GGZ A;  4DUQ A;  2M3W A;  5CSF A;  4GBA A;  1A75 A;  2R2I A;  2WCK A;  3FWC A;  4YI8 A;  1OQP A;  4INW A;  2V53 A;  4N1F A;  1UHH A;  4GGF C;  2DOQ A;  1DJY A;  1F4Q A;  4JKT A;  1VRK A;  1NX1 A;  1Y1X A;  1LS8 A;  2KDH A;  2NCO A;  1ZFS A;  1BR4 B;  1NIW A;  1MXL C;  3CR5 X;  4HRH A;  1CDP A;  1DEL A;  3VRR A;  3JVT B;  4MZL A;  1SRA A;  3FE6 A;  3PM8 A;  2LLT A;  2WCE A;  3CZ1 A;  2KLE A;  1N65 A;  1EXR A;  1KK8 B;  2KI6 D;  2NLN A;  1JUO A;  3R1P A;  1MF8 B;  1ZAC A;  2CBL A;  2M1K B;  4CLN A;  3DVE A;  1NSH A;  2BL0 C;  2MLE C;  2QEO A;  2PRU A;  3D10 A;  1DTL A;  3EK4 A;  3BUN B;  1YRT B;  1K8U A;  5FI2 A;  2LMV A;  2CT9 A;  2P70 A;  3BQ3 A;  1MXE A;  2B1U A;  4GGF A;  1L2O B;  1XK4 A;  3SS4 A;  4QJ3 B;  2COL B;  2YGU A;  3I5I B;  3KHE A;  4E68 A;  3TDZ A;  2M8U A;  1SPY A;  3R72 A;  2ZRT A;  1SKT A;  4PT1 A;  3OB1 B;  5HKY A;  2K8M B;  3TDI A;  3I5F B;  1Y0V H;  1ALW A;  3BOW A;  4MN0 A;  2KAX A;  1QV1 A;  3NSK A;  3GK4 X;  2FCD A;  1SSE B;  3KF9 A;  4GFT A;  1CNP A;  4UPG A;  1RK9 A;  1A29 A;  1CM1 A;  3FIA A;  1JFK A;  1AK8 A;  1C3Z A;  1U5I B;  3I5I C;  1OOI X;  1F70 A;  1AHR A;  2JTZ A;  3SG3 A;  1K95 A;  1L2O C;  3CYZ A;  1B4C A;  3A4U B;  3S0G A;  2LAN A;  3F45 A;  3S0D A;  5PAL A;  1BOD A;  3SG2 A;  2BKI B;  1EJ3 A;  1W7I B;  2WOR A;  4JQ0 D;  3H4S E;  1SCV A;  4U8D A;  5CSJ A;  4M2Q A;  2LVJ A;  1J7Q A;  4JPZ B;  5FI6 A;  1IQ3 A;  3DF0 B;  1V1G A;  2LCP A;  4NQG A;  2BL0 B;  2ZRS A;  3BOW B;  4MRX A;  3V2L A;  1OE9 B;  2PAL A;  1DF0 A;  4GGN A;  2KSP A;  1PRW A;  2LP3 A;  3LK1 A;  1OMD A;  3SS3 A;  1DQE A;  1YVH A;  1DGU A;  3WHU B;  1UHJ A;  1G8I A;  5I2L A;  1QX7 A;  3PSR A;  2HF5 A;  2P71 A;  2BKH B;  2G2B A;  1YVL A;  2F2O A;  2NZ0 A;  5DKR A;  4CPV A;  1CMG A;  2KI4 B;  2AAO A;  3L4L A;  1XVJ A;  2KOT A;  4HRG A;  3CZ2 A;  3LL8 B;  2WCM A;  2KGR A;  4WQ3 A;  1TUZ A;  4ZCU A;  4HSZ A;  4YI9 A;  2K7D A;  3TS5 C;  1B9A A;  2ZKM X;  1JF0 A;  2LHI A;  3BUM B;  4FTG A;  4OVN F;  1KQM C;  1SW8 A;  2CXJ A;  1QIW A;  1Y1A A;  4F0Z B;  5CSN A;  4NDD A;  4L9M A;  2L50 A;  2GV5 A;  2WOS A;  4OZD A;  2D8N A;  1YX7 A;  3M0W A;  3R1V A;  2QEB A;  1BJF A;  1OMR A;  2JXL A;  1CDN A;  3NHI A;  1K2H A;  3TS5 B;  3B86 A;  2LLS A;  3KO0 A;  1QJT A;  1TWO A;  2K2A A;  2KFG A;  1QVI Z;  5HL1 A;  1XYD A;  1KQV A;  3SG7 A;  3SS5 A;  1JC2 A;  2LVK A;  1NX2 A;  3PN7 C;  1WDC B;  1NWD A;  1TTX A;  2SAS A;  4JWQ A;  3S0E A;  1M31 A;  1IH0 A;  3AKA A;  3EKJ A;  4I5K A;  4IJ7 A;  2M49 B;  4DIR A;  1IRJ A;  4MVF A;  3JTD B;  1F55 A;  1S3P A;  2LC5 A;  2LAP A;  3RM1 A;  1K9U A;  1LKJ A;  3BUW B;  1UUR A;  1KK7 Z;  1LA3 A;  1CDL A;  1PVA A;  2JPT A;  3CGA A;  3CTN A;  1OOH A;  3SG5 A;  2BBN A;  3NGV A;  1DT7 B;  1CDM A;  4QJ4 B;  1HQV A;  1S36 A;  1F4O A;  2WCL A;  3GK2 A;  1F8H A;  4MZJ A;  2NCP A;  1XFX O;  1A03 A;  1KK8 C;  2OS8 B;  1AJ5 A;  1SBJ A;  1WRK A;  5FI7 A;  1BU3 A;  1D1O A;  3FE8 A;  3O6B A;  5DKQ A;  1IWQ A;  1BLQ A;  1DMO A;  1XFW O;  2Y5I A;  1DJG A;  3FWB A;  1Z2C B;  1CLM A;  1J7R A;  3CZ0 A;  1EG4 A;  5ER5 A;  1RWY A;  2CCM A;  1J1E A;  1NUB A;  2WCH A;  4M2P A;  3TZ1 A;  5AAN A;  2SCP A;  2AMI A;  2E30 A;  2LVI A;  1DJX A;  1J7P A;  1KCY A;  3SJS A;  2LM5 A;  3D75 A;  2KPH A;  2F3Z A;  3Q8I A;  4PHM A;  2VRG A;  3BFH A;  1YTZ C;  1UWO A;  4YGB B;  2KBI A;  3K1E A;  1TN4 A;  2MAZ A;  1K93 D;  4I5L B;  1EH2 A;  3O4X A;  4D1E A;  5JJG A;  1B1G A;  2H61 A;  4KYN A;  4ORA B;  4CID A;  2L4H A;  3BJH A;  1WLZ A;  2AUC A;  2M29 A;  2ZNE A;  3BUX B;  4I5J A;  1H4B A;  1B8R A;  1ORG A;  1XA5 A;  4OKH A;  1CMF A;  1IIO A;  2BBM A;  1SR6 B;  1FBV A;  2L51 A;  2KYC A;  1TNP A;  4ETO A;  3HCM A;  3TDU A;  1H8B A;  2HPS A;  3EK7 A;  4BY5 A;  2MJW B;  2OS8 C;  5BPJ A;  1CFF A;  2KYF A;  3QME A;  4XYN A;  2KBM A;  1ZUZ A;  2KHN A;  1IKU A;  2MRD A;  2BCA A;  4JD9 A;  1CM4 A;  4HRE E;  2Q91 A;  3VB1 A;  5HLV A;  2OPO A;  3C1V A;  4DS7 A;  2E6W A;  2JRF A;  1U5I A;  2KLD A;  3A8R A;  2JT3 A;  3NSL A;  5D7F A;  4OV2 A;  1SCM C;  1DJH A;  1DC1 A;  5TNC A;  1S6C A;  1JSA A;  1QLK A;  2KFF A;  1JBA A;  1QAT A;  1KFU S;  2GGM A;  1M39 A;  1M46 A;  1MUX A;  1BMO A;  1NCZ A;  4PDZ A;  1F54 A;  2H2K A;  1QV0 A;  2L4I A;  3I5H B;  4ORC B;  4AQJ A;  3DVJ A;  2Y4Q A;  1PSB A;  2HQW A;  1S5G Z;  1YRU B;  2L2C A;  2H61 C;  3D73 A;  3VRO A;  2JPO A;  1AUI B;  2K0J A;  3CAB A;  4MEW A;  4F7F A;  2PSR A;  5AEQ A;  1A4P A;  2LNK A;  3AAJ A;  2ERB A;  4PE0 A;  4A4C A;  4A4B A;  1CFC A;  4P2Y B;  4YGE B;  3DXL A;  2QDI A;  1K96 A;  2ISD A;  5AER A;  1YUT A;  2I18 A;  2RGI A;  3I5H C;  1CFP A;  1PSR A;  1QLS A;  2EC6 C;  1SK6 D;  1NPQ A;  2OTG B;  3ZWH A;  1AVS A;  2EGD A;  2PVB A;  3LLE A;  3K21 A;  2FOT A;  1PAL A;  2MA2 A;  3KPX A;  5HKW A;  1Q80 A;  1SNL A;  1IG5 A;  3BFB A;  1S26 D;  1K94 A;  1UHK A;  1SY9 A;  2ZFD A;  1EL4 A;  2LP2 A;  2ZND A;  2BNX A;  2JTT A;  3GK1 A;  1OMV A;  1J7O A;  1ZOT B;  5AXI A;  2OTG C; 
#chains in the Genus database with same CATH homology
 3CR4 X;  3DF0 A;  1A75 B;  1XFV O;  2JT8 A;  2QPT A;  3LK0 A;  4GUK A;  4N5X A;  3FS7 A;  1WDC C;  4XJK A;  2LLU A;  1CNP A;  5AFP A;  3IF7 A;  2P6B B;  1WRZ A;  1IGV A;  2BEC A;  1JWD A;  1NX0 A;  4M2O A;  3EVV A;  5J3X A;  1CTR A;  1GJY A;  1ODB A;  1UUS A;  2CTN A;  2ZN9 A;  2PMY A;  1B7T Y;  1G4Y R;  1Y6W A;  2LMU A;  3D0Y B;  4ICB A;  1UHN A;  2L5X B;  4AQI A;  1RJV A;  2JQ6 A;  1QS7 A;  1L7Z A;  2PAS A;  1Y1U A;  3EK8 A;  1KFU L;  1RFJ A;  1SMG A;  4MBE A;  1B8C A;  4PE7 A;  2CNP A;  4WQ2 A;  1KFX L;  3TUY C;  1CKK A;  4USL A;  3WXA A;  1K9P A;  5I8N A;  1K9K A;  2TN4 A;  2JWW A;  5I2Q A;  3OP0 A;  1SL7 A;  1XK4 C;  4GAO A;  1BOC A;  4FQO A;  2MBX A;  2BCB A;  3O78 A;  4Q04 A;  2FJU B;  1RRO A;  1KSM A;  2BE4 A;  3WNX B;  5KSZ A;  2O60 A;  1GQM A;  2M0R A;  3DVK A;  3BXK A;  3KEV A;  3SIB A;  2M97 A;  1UP5 A;  5CPV A;  2MLF C;  1QX2 A;  2L2E A;  1ZMZ A;  2WCB A;  4NDC A;  2Y1N A;  2KAV A;  1N2D A;  2KI6 C;  3ICB A;  2HQ8 A;  1CFD A;  1GGZ A;  3E3R A;  1WY9 A;  5K89 A;  4XJK B;  5DKN A;  1XFY O;  1C7W A;  1NYA A;  2WCF A;  3ZNI A;  2I94 A;  1QVI Y;  4TNC A;  1KWO C;  3PFV A;  1DVI A;  5HYD A;  1PK0 D;  4CFQ A;  2LE9 B;  3EVU A;  4AOM A;  1M63 B;  2HET A;  1SR6 C;  5FYX A;  1MHO A;  3PLF B;  4YGA A;  1FI6 A;  1R2U A;  5IBW A;  3GOF A;  2KQ6 A;  5GQQ C;  4YBH B;  2L0P A;  2KQY A;  1S6I A;  1TNW A;  1QXP A;  4PHK A;  2I2R E;  1X02 A;  5G08 A;  1BF5 A;  1QTX A;  2JU0 A;  1K90 D;  1KWO B;  2K2F A;  1B8L A;  3CLN A;  4ZCV A;  5AAN A;  5KTY A;  2JUL A;  2QAC A;  5I2O A;  2O5G A;  1TCF A;  1KFX S;  4PE4 A;  2M7N A;  4GNK B;  4C0K A;  1OSA A;  2M1U A;  1OZO A;  4NDB A;  1EG3 A;  1NCY A;  1LA0 A;  1GGW A;  1UHI A;  1IQ5 A;  1LXF C;  1N0Y A;  1CLL A;  1YX8 A;  2EHB A;  1TIZ A;  3VRN A;  1LVC D;  2LVV A;  1M45 A;  4DCK A;  4WRI A;  2ZN8 A;  3EVR A;  2K7B A;  4MLW A;  3OX5 A;  1R6P A;  2M7L A;  3VRQ A;  4DRW A;  1WRL A;  3SIA A;  1DF0 B;  3MSE B;  1BT6 A;  1W7J B;  2LV7 A;  1IJ6 A;  4R1E A;  4BY4 A;  2JNF A;  1BG1 A;  1DJW A;  1OOJ A;  1REC A;  1S5G Y;  2LUX A;  4QJ5 B;  4YGC B;  3OX6 A;  1BR1 B;  3RLZ A;  2K7C A;  1FW4 A;  4I5N B;  3DVM A;  1S1E A;  3BUO B;  2F33 A;  3VGO A;  1SL8 A;  2WND A;  1C07 A;  1QAS A;  3LCP C;  1NCX A;  1TOP A;  2LUC A;  3CWG A;  2A4J A;  2KNE A;  1YUU A;  1E8A A;  2Y1M A;  3QRX A;  5F6T A;  2BCX A;  2G9B A;  2JT0 A;  2JZI A;  4MRY A;  1SYM A;  1TNQ A;  3PN7 B;  1PVB A;  4GPL B;  5HLO A;  3TUY B;  1YR5 A;  2JOJ A;  3SG4 A;  3WHT B;  2LHL A;  3DD4 A;  3IQO A;  3OHM B;  4N1G A;  1WLM A;  1CLB A;  1XFU O;  2WC8 A;  3PAL A;  4P5O E;  1A2X A;  4PAL A;  2JXC A;  1CB1 A;  1ALV A;  2Q4U A;  4PE1 A;  3D0Y A;  5D69 A;  2IS9 A;  1NP8 A;  2KI4 C;  2BE6 A;  5ER4 X;  2I7A A;  1G33 A;  1OZS A;  2F2P A;  4ORB B;  1AJ4 A;  1KSO A;  1MQ1 A;  3EKH A;  2FCE A;  3I5G B;  3IQQ A;  3O2P A;  1TNX A;  3PAT A;  1TCO B;  5HKZ A;  2M9G A;  1DJZ A;  1DJI A;  1B47 A;  1RTP 1;  4YGD B;  1SCM B;  3NSO A;  2L98 A;  1B7T Z;  1J55 A;  1NX3 A;  1YUR A;  3VRP A;  2NXQ A;  4OR9 B;  1SL9 A;  3CS1 A;  3CR2 A;  3O4Y A;  2LMT A;  1TRF A;  3CZT X;  3NSI A;  3AKB A;  4PHJ A;  1FPW A;  1XO5 A;  4MSP A;  3I5G C;  3JTD C;  1J1D A;  1AP4 A;  2MHH A;  1YUS A;  3NXA A;  4PCW A;  5KU1 A;  1MWN A;  1QIV A;  2K7O A;  1QX5 B;  3AAK A;  3HX4 A;  1XFZ O;  3JVT C;  1F71 A;  4C0L A;  1LIN A;  5JOL A;  3OB2 B;  2F8P A;  4CFR A;  1JF2 A;  3BYA A;  5CSI A;  4YRU A;  4OCI A;  4MZK A;  1V1F A;  4IL1 A;  1PUL A;  1KK7 Y;  1HT9 A;  2F3Y A;  1C7V A;  3SG6 A;  1DGV A;  2JC2 A;  1MR8 A;  2KGB C;  2EC6 B;  5B8I B;  3I5F C;  4C0J A;  1JFJ A;  1FI5 A;  4PHN A;  1KQM B;  1IJ5 A;  1FF1 A;  2K61 A;  2KFH A;  1S6J A;  2JNX A;  2KAY A;  2GGZ A;  4DUQ A;  2M3W A;  5CSF A;  4GBA A;  1A75 A;  2R2I A;  3FWC A;  4YI8 A;  1OQP A;  4N1F A;  2V53 A;  1UHH A;  4GGF C;  2DOQ A;  1DJY A;  1F4Q A;  1VRK A;  1NX1 A;  1Y1X A;  2KDH A;  2NCO A;  1BR4 B;  1NIW A;  1ZFS A;  1MXL C;  3CR5 X;  4HRH A;  1CDP A;  3VRR A;  3JVT B;  4MZL A;  1SRA A;  3PM8 A;  2LLT A;  2WCE A;  1N65 A;  1EXR A;  1KK8 B;  2KI6 D;  2NLN A;  1JUO A;  1MF8 B;  1ZAC A;  2CBL A;  2M1K B;  4CLN A;  3DVE A;  1NSH A;  2BL0 C;  2MLE C;  2PRU A;  3D10 A;  1DTL A;  3EK4 A;  3BUN B;  1YRT B;  1K8U A;  2LMV A;  2CT9 A;  3BQ3 A;  1MXE A;  2B1U A;  4GGF A;  1L2O B;  1XK4 A;  4QJ3 B;  2COL B;  3I5I B;  3KHE A;  4E68 A;  3TDZ A;  2M8U A;  1SPY A;  2ZRT A;  1SKT A;  3OB1 B;  5HKY A;  2K8M B;  3TDI A;  3I5F B;  1Y0V H;  1ALW A;  3BOW A;  4MN0 A;  2KAX A;  1QV1 A;  3NSK A;  3GK4 X;  2FCD A;  3KF9 A;  4GFT A;  4UPG A;  1RK9 A;  1A29 A;  1CM1 A;  3FIA A;  1JFK A;  1AK8 A;  1F70 A;  1U5I B;  3I5I C;  1AHR A;  2JTZ A;  3SG3 A;  1K95 A;  1L2O C;  1B4C A;  3A4U B;  2LAN A;  3F45 A;  5PAL A;  1BOD A;  3SG2 A;  2BKI B;  1EJ3 A;  1W7I B;  2WOR A;  4JQ0 D;  3H4S E;  1SCV A;  4U8D A;  5CSJ A;  4M2Q A;  2LVJ A;  1J7Q A;  4JPZ B;  1IQ3 A;  3DF0 B;  1V1G A;  2LCP A;  4NQG A;  2BL0 B;  2ZRS A;  3BOW B;  4MRX A;  1OE9 B;  2PAL A;  1DF0 A;  4GGN A;  2KSP A;  1PRW A;  2LP3 A;  3LK1 A;  1OMD A;  1YVH A;  3WHU B;  1DGU A;  1UHJ A;  1G8I A;  5I2L A;  1QX7 A;  3PSR A;  2HF5 A;  5DKR A;  2BKH B;  2G2B A;  1YVL A;  2F2O A;  2NZ0 A;  4CPV A;  1CMG A;  2KI4 B;  2AAO A;  1XVJ A;  2KOT A;  4HRG A;  4WQ3 A;  3LL8 B;  2KGR A;  4ZCU A;  4HSZ A;  4YI9 A;  2K7D A;  3TS5 C;  1B9A A;  2ZKM X;  1JF0 A;  2LHI A;  3BUM B;  4FTG A;  4OVN F;  1KQM C;  1SW8 A;  2CXJ A;  1QIW A;  1Y1A A;  4F0Z B;  5CSN A;  4NDD A;  4L9M A;  2L50 A;  2GV5 A;  2WOS A;  2D8N A;  1YX7 A;  3M0W A;  1BJF A;  1OMR A;  2JXL A;  1CDN A;  1K2H A;  3TS5 B;  2LLS A;  3KO0 A;  1QJT A;  2K2A A;  2KFG A;  1QVI Z;  1XYD A;  1KQV A;  3SG7 A;  1JC2 A;  2LVK A;  1NX2 A;  3PN7 C;  1WDC B;  1NWD A;  1TTX A;  2SAS A;  4JWQ A;  1M31 A;  1IH0 A;  3AKA A;  3EKJ A;  4I5K A;  2M49 B;  4DIR A;  1IRJ A;  4MVF A;  3JTD B;  1F55 A;  1S3P A;  2LC5 A;  2LAP A;  3RM1 A;  1K9U A;  1LKJ A;  3BUW B;  1UUR A;  1KK7 Z;  1LA3 A;  1CDL A;  1PVA A;  2JPT A;  3CGA A;  3CTN A;  3SG5 A;  2BBN A;  1DT7 B;  1CDM A;  4QJ4 B;  1HQV A;  1S36 A;  1F4O A;  1F8H A;  3GK2 A;  4MZJ A;  2NCP A;  1XFX O;  1A03 A;  1KK8 C;  2OS8 B;  1AJ5 A;  1SBJ A;  1WRK A;  1BU3 A;  1D1O A;  3O6B A;  5DKQ A;  1IWQ A;  1BLQ A;  1DMO A;  1XFW O;  2Y5I A;  1DJG A;  3FWB A;  1CLM A;  1J7R A;  1EG4 A;  5ER5 A;  1RWY A;  2CCM A;  1J1E A;  1NUB A;  4M2P A;  3TZ1 A;  2SCP A;  2AMI A;  2E30 A;  2LVI A;  1DJX A;  1J7P A;  1KCY A;  3SJS A;  2LM5 A;  2F3Z A;  4PHM A;  2VRG A;  1YTZ C;  1UWO A;  4YGB B;  2KBI A;  1TN4 A;  2MAZ A;  1K93 D;  4I5L B;  1EH2 A;  4D1E A;  1B1G A;  5JJG A;  2H61 A;  4ORA B;  4CID A;  2L4H A;  1WLZ A;  2AUC A;  2M29 A;  2ZNE A;  3BUX B;  4I5J A;  1H4B A;  1B8R A;  4OKH A;  1XA5 A;  1CMF A;  2BBM A;  1SR6 B;  1FBV A;  2L51 A;  2KYC A;  1TNP A;  4ETO A;  3HCM A;  3TDU A;  1H8B A;  2HPS A;  3EK7 A;  4BY5 A;  2MJW B;  2OS8 C;  5BPJ A;  1CFF A;  2KYF A;  4XYN A;  2KBM A;  1ZUZ A;  2KHN A;  1IKU A;  2MRD A;  2BCA A;  1CM4 A;  4HRE E;  2Q91 A;  5HLV A;  2OPO A;  3C1V A;  4DS7 A;  2E6W A;  2JRF A;  1U5I A;  3NSL A;  3A8R A;  2JT3 A;  5D7F A;  4OV2 A;  1SCM C;  1DJH A;  5TNC A;  1S6C A;  1JSA A;  1QLK A;  2KFF A;  1JBA A;  1QAT A;  1KFU S;  2GGM A;  1M39 A;  1M46 A;  1MUX A;  1BMO A;  1NCZ A;  4PDZ A;  1F54 A;  2H2K A;  1QV0 A;  2L4I A;  3I5H B;  4ORC B;  4AQJ A;  3DVJ A;  2Y4Q A;  1PSB A;  2HQW A;  1S5G Z;  1YRU B;  2H61 C;  3VRO A;  1AUI B;  2K0J A;  4MEW A;  2PSR A;  5AEQ A;  1A4P A;  2LNK A;  3AAJ A;  4PE0 A;  4A4C A;  4A4B A;  1CFC A;  4P2Y B;  4YGE B;  1K96 A;  2ISD A;  5AER A;  1YUT A;  2I18 A;  2RGI A;  3I5H C;  1CFP A;  1PSR A;  1QLS A;  2EC6 C;  1SK6 D;  1NPQ A;  2OTG B;  3ZWH A;  1AVS A;  2EGD A;  2PVB A;  3LLE A;  3K21 A;  2FOT A;  1PAL A;  2MA2 A;  3KPX A;  5HKW A;  1Q80 A;  1SNL A;  1IG5 A;  1S26 D;  1K94 A;  1UHK A;  1SY9 A;  2ZFD A;  1EL4 A;  2LP2 A;  2ZND A;  2JTT A;  3GK1 A;  1OMV A;  1J7O A;  1ZOT B;  5AXI A;  2OTG C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...