2K8MB

S100a13-c2a binary complex structure
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
98
structure length
98
Chain Sequence
MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title S100A13-C2A binary complex structure-a key component in the acidic fibroblast growth factor for the non-classical pathway.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Putative uncharacterized protein
total genus 29
structure length 98
sequence length 98
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2k8mB00
1YX7A 1ZMZA 2JRFA 1PALA 2PMYA 4QJ3B 1DJHA 1G4YR 1CDPA 2WORA 2B1UA 3BYAA 1UHIA 1OZSA 1QASA 3NSKA 1NYAA 3TUYB 3KEVA 2MBXA 1MQ1A 2G2BA 2LVIA 4GBAA 3WXAA 1BR4B 1K96A 1B1GA 2TN4A 2KI6D 3CGAA 5IBWA 4ORAB 3CR5X 2LANA 4MRXA 4DS7A 1R6PA 2O60A 1XK4C 2LP2A 1KSOA 3H4SE 4MBEA 1K90D 1NX3A 3BOWA 2G9BA 4NDDA 1F70A 5AANA 1F55A 1J7RA 1YUTA 2CBLA 2LVKA 4N1GA 1SY9A 2ZKMX 1PRWA 1KWOC 1UHJA 3C1VA 3CS1A 3DVJA 1XO5A 3DD4A 1U5IB 1JUOA 1UUSA 2K7OA 2MHHA 4MSPA 2LP3A 4YGEB 1JWDA 1OE9B 1K95A 1YRTB 4DCKA 1Y6WA 1FW4A 2CNPA 2KQYA 4GNKB 1SBJA 2I18A 4HRHA 3ZWHA 1B47A 2L5XB 1JF2A 1PULA 5ER5A 1YVLA 3AKBA 1QIVA 1IH0A 4IL1A 1KK8B 1BMOA 1YR5A 1A29A 2SCPA 2LHIA 3BQ3A 3IF7A 3NXAA 4XJKB 1J7PA 1IQ3A 4I5KA 2V53A 3LL8B 2QACA 1DJXA 4MVFA 2DOQA 1PK0D 1EH2A 3AKAA 1BR1B 1EG4A 4A4CA 1YUUA 1SYMA 3AAJA 1A03A 5DKRA 1TCFA 2NXQA 1S6CA 2VRGA 4BY4A 1A75A 1NWDA 1TOPA 3PN7B 2ZNDA 1BT6A 2ZNEA 1XFXO 1SL8A 4NQGA 1CMGA 1XFUO 1CKKA 1GGZA 3SG7A 1F4OA 1NX2A 1LVCD 3I5FC 1JBAA 4ZCUA 5B8IB 1S1EA 2CCMA 1FPWA 3EK4A 4NDBA 3JTDB 2JT3A 3VRPA 4JWQA 1IGVA 2WCBA 1L7ZA 1WLMA 5AXIA 1SMGA 1B7TY 1TTXA 2M3WA 1S3PA 1J7OA 5HKWA 2KYFA 2M1UA 4GGNA 1FBVA 1JSAA 2JNXA 3BOWB 1NIWA 3PSRA 1LINA 3BUMB 5J3XA 3IQOA 4C0LA 3E3RA 1JC2A 2EHBA 1SPYA 3O6BA 1EL4A 2K2FA 4PE0A 2EGDA 2L4IA 1MR8A 2HQWA 2M0RA 3O2PA 1U5IA 1PVBA 4HSZA 3HCMA 1PSBA 2JT8A 1WDCC 1TRFA 5D7FA 2LMTA 4MRYA 2F8PA 2BKIB 2M7LA 4ZCVA 1BF5A 2WOSA 2JPTA 2Q4UA 1ALWA 1WRZA 2PASA 1YURA 2BECA 3D10A 4Q04A 1B9AA 1F4QA 4C0JA 2IS9A 4DUQA 1CLBA 3I5IC 2PALA 2F2OA 1GGWA 2P6BB 1WY9A 4PE7A 3CR4X 5KSZA 1L2OC 4YGAA 1IWQA 2HQ8A 2JXCA 2M29A 2MLFC 4I5JA 3PLFB 4MN0A 1B7TZ 1H4BA 1TNPA 4PDZA 1HT9A 2Y1NA 3SG5A 1YUSA 2KAYA 5DKNA 1QLSA 1K94A 2LUXA 4XYNA 2KAVA 2A4JA 1QVIY 3VRQA 1DGVA 1SKTA 2F2PA 3TS5B 1W7IB 1VRKA 3CWGA 4I5LB 1EJ3A 1DF0B 1A2XA 5I8NA 4YGCB 1IKUA 2JTZA 2WNDA 5HKYA 4AOMA 1S6JA 1AJ5A 3NSLA 2LE9B 1OMVA 3MSEB 5CSNA 5K89A 2LM5A 2ZRTA 1WRKA 4OV2A 1QS7A 1AVSA 3BUWB 1TNQA 1IJ6A 2OTGB 4M2OA 4JQ0D 1M39A 2LV7A 3CR2A 1K93D 2L2EA 1Y0VH 1DJZA 3EKHA 1N2DA 3BUNB 1KFUS 4D1EA 1S36A 3RM1A 2BKHB 4CFRA 2ZFDA 2LLTA 3PFVA 1FI6A 1KCYA 2LUCA 3FWCA 2M8UA 1DJGA 4CPVA 5ER4X 2QPTA 3DF0B 4PALA 1CLLA 3EVVA 1DMOA 1RK9A 3M0WA 4CFQA 4AQJA 2K2AA 1SNLA 2KNEA 5HLOA 2LVVA 3PM8A 3JVTC 1DTLA 1M63B 1J1EA 1BG1A 3KHEA 1N65A 3PATA 1B4CA 1NSHA 2CXJA 2R2IA 3WHTB 4XJKA 2KDHA 1AUIB 1CLMA 1RROA 1TNXA 5CSIA 1M45A 2PRUA 5AERA 1KQVA 2LCPA 1OOJA 2BCAA 3DVEA 3LK0A 3O4YA 4ORBB 2BE6A 2FJUB 2KFHA 1CM1A 1PSRA 3CLNA 1KFXL 1SR6B 4PE4A 1TCOB 1TN4A 1J55A 1IRJA 1LKJA 1RFJA 2BL0B 1S5GY 1A4PA 1WDCB 2KFGA 1MUXA 2F3YA 2D8NA 1RWYA 4WQ2A 2F3ZA 3VROA 3FIAA 3NSOA 4YI9A 1DJYA 1F71A 4TNCA 4PHMA 1SCVA 1NCXA 5I2LA 1SL7A 3FWBA 1DJWA 1C07A 2AUCA 5KTYA 1K9UA 4E68A 4M2QA 2K0JA 1MXEA 4P5OE 1B8LA 3VRRA 1QVIZ 1DF0A 4F0ZB 3K21A 2H61A 5F6TA 2KI6C 1XFZO 2LNKA 4WQ3A 1QX5B 3DVKA 1N0YA 1AHRA 3PALA 1M31A 2OS8B 1AK8A 1K9KA 1L2OB 4CIDA 1Y1UA 3BXKA 1LA0A 1UHKA 2ZRSA 3GK1A 2KBMA 4MEWA 3EVUA 3EKJA 2JQ6A 1WLZA 1CFCA 1S5GZ 1CM4A 4OVNF 3OP0A 2LHLA 2K7BA 1NX1A 1QIWA 1YX8A 4L9MA 5KU1A 1SRAA 3VRNA 5HLVA 1S6IA 1F54A 2KBIA 1B8RA 1F8HA 1OQPA 2F33A 4GPLB 2L51A 1XFYO 1Y1XA 2FCDA 3JVTB 2COLB 2MA2A 1JF0A 1SR6C 1K2HA 2NZ0A 3I5HC 1MXLC 2M7NA 3EK7A 2BBNA 1H8BA 4ETOA 2KHNA 2M97A 3SG2A 1UHHA 3D0YA 2OS8C 5D69A 1ZOTB 1EXRA 1V1FA 2WCFA 1GJYA 1J7QA 4GGFC 1M46A 3VGOA 1HQVA 4YGDB 1CFPA 4AQIA 2AMIA 4ORCB 2H2KA 4GAOA 3EK8A 4QJ5B 1CDNA 2LMVA 1J1DA 4DRWA 4OR9B 3CZTX 4YRUA 3I5GC 2L0PA 1G33A 5BPJA 2KGRA 1DGUA 4HRGA 1IQ5A 1CDLA 2M49B 2OPOA 1RJVA 2Y5IA 1KQMC 3CTNA 3OHMB 1ZUZA 2K7CA 2LAPA 1IG5A 3TZ1A 1BJFA 2PVBA 5DKQA 5I2QA 2GGMA 1SL9A 5AFPA 1S26D 1QLKA 2NCPA 1K9PA 1SCMC 1KFXS 4WRIA 2JXLA 2K7DA 1KK7Y 2AAOA 3D0YB 1MWNA 2KGBC 3OX5A 1XFVO 2GV5A 2K8MB 1YRUB 1KFUL 3WNXB 1QJTA 1XYDA 3PN7C 1CDMA 3DF0A 1KQMB 2JOJA 2L50A 2KSPA 3GK2A 1UP5A 2K61A 3F45A 2CTNA 2KAXA 4PCWA 3TDIA 4MLWA 4OCIA 1Q80A 4C0KA 1MHOA 1QX2A 1ALVA 2LLUA 2LLSA 3SJSA 1AP4A 5FYXA 3A8RA 3A4UB 2ZN8A 4YI8A 1KWOB 1OZOA 1XFWO 3QRXA 4JPZB 2SASA 3ICBA 1NCYA 4GFTA 1B8CA 1OSAA 3LLEA 5PALA 2H61C 1JFKA 3GK4X 1CFDA 2LVJA 3LK1A 1KSMA 1C7VA 4HREE 3BUXB 1SK6D 3I5IB 3OX6A 2KQ6A 1EG3A 2MAZA 2WCEA 1NPQA 4DIRA 4PE1A 1R2UA 3TDZA 1CFFA 2I94A 4N5XA 5HKZA 3WHUB 1GQMA 3TUYC 2FCEA 1OMDA 3AAKA 1QV1A 2EC6B 2I7AA 4U8DA 2MRDA 2L98A 1OMRA 2Y1MA 2BCBA 1DT7B 2KOTA 2E6WA 4YGBB 4UPGA 2GGZA 4YBHB 1UHNA 1JFJA 1NP8A 4PHKA 1LXFC 1XA5A 1C7WA 2NCOA 4I5NB 4MZKA 2HETA 2L4HA 1V1GA 1UURA 4R1EA 1E8AA 4NDCA 1X02A 3KO0A 1FI5A 1DJIA 3SG4A 1XVJA 1QXPA 2KFFA 1Y1AA 1W7JB 2BL0C 1CTRA 1QTXA 2ZN9A 1NUBA 1QATA 2M9GA 3DVMA 2OTGC 4FQOA 3GOFA 1WRLA 1A75B 2BBMA 2FOTA 3KPXA 1DVIA 4GGFA 3BUOB 4A4BA 3ZNIA 1D1OA 2HPSA 1QX7A 1YVHA 2PSRA 2M1KB 2JNFA 1CNPA 3SG6A 3TDUA 1NX0A 2JT0A 3JTDC 1BU3A 2MLEC 1BOCA 1MF8B 3KF9A 1NCZA 2E30A 3I5GB 5HYDA 1TNWA 3NSIA 5TNCA 1CMFA 4PHNA 3I5HB 4N1FA 5CPVA 2KI4B 5JOLA 4MZJA 1SCMB 4CLNA 4MZLA 2HF5A 5GQQC 1KK8C 2Y4QA 5CSJA 1SW8A 1PVAA 2CT9A 1CB1A 5I2OA 2EC6C 1RTP1 2NLNA 2JC2A 2LMUA 2KYCA 4QJ4B 2JZIA 3TS5C 5AEQA 2JULA 4GUKA 2O5GA 4P2YB 1BLQA 3IQQA 1YTZC 4FTGA 3SG3A 1FF1A 1ZACA 1AJ4A 1LA3A 2WC8A 2KI4C 3I5FB 4ICBA 2LC5A 1UWOA 1G8IA 5G08A 4BY5A 1KK7Z 2BE4A 2JTTA 2ISDA 5JJGA 2Q91A 1ZFSA 3SIBA 3HX4A 1QV0A 4USLA 1IJ5A 1ODBA 3OB1B 2JWWA 1TIZA 3FS7A 3OB2B 2I2RE 4OKHA 3RLZA 1K8UA 5CSFA 1RECA 2JU0A 1BODA 3LCPC 1XK4A 3SIAA 3EVRA 4M2PA 2BCXA 2MJWB 3O78A 4PHJA 2RGIA
chains in the Genus database with same CATH superfamily
1YX7A 1ZMZA 2JRFA 1PALA 2PMYA 4QJ3B 1DJHA 1G4YR 1CDPA 1OOIX 2WORA 2B1UA 3RZSA 3BYAA 1UHIA 1OZSA 1QASA 3NSKA 2WCKA 1NYAA 3TUYB 3KEVA 2MBXA 1MQ1A 2G2BA 2LVIA 4GBAA 3WXAA 3BJHA 1BR4B 1K96A 1B1GA 2TN4A 2KI6D 3CGAA 5IBWA 4ORAB 3CR5X 2LANA 4MRXA 4DS7A 1R6PA 5HL1A 2O60A 1XK4C 2LP2A 1KSOA 3H4SE 4MBEA 1K90D 1NX3A 3BOWA 2G9BA 4NDDA 1F70A 2P71A 5AANA 1F55A 1J7RA 1YUTA 2CBLA 2LVKA 4N1GA 1SY9A 2ZKMX 1PRWA 1KWOC 1UHJA 3C1VA 3CS1A 3DVJA 1OOHA 1XO5A 3DD4A 1U5IB 1JUOA 1UUSA 2K7OA 2MHHA 4MSPA 5DICA 2LP3A 4YGEB 5FI2A 2L2CA 1JWDA 1OE9B 1K95A 1YRTB 4DCKA 1Y6WA 1FW4A 2CNPA 2KQYA 4GNKB 1SBJA 2I18A 4HRHA 3ZWHA 1B47A 2L5XB 1JF2A 1PULA 5ER5A 1YVLA 3AKBA 1QIVA 1IH0A 4IL1A 3L4AA 1KK8B 1BMOA 1YR5A 1A29A 2SCPA 2LHIA 3BQ3A 3CZ2A 3IF7A 3NXAA 4XJKB 1J7PA 1IQ3A 4I5KA 2V53A 3LL8B 2QACA 1DJXA 4MVFA 2DOQA 1PK0D 1EH2A 2L5YA 3AKAA 1C3ZA 1BR1B 1EG4A 3SS4A 4A4CA 1YUUA 1SYMA 3AAJA 1A03A 5DKRA 1TCFA 2NXQA 1S6CA 2VRGA 4BY4A 1SSEB 1A75A 1NWDA 2WC5A 1TOPA 3PN7B 2ZNDA 1BT6A 3QMEA 2ZNEA 1XFXO 1SL8A 4NQGA 1CMGA 1XFUO 2H8VA 1CKKA 1GGZA 3SG7A 3R1VA 1F4OA 1NX2A 1LVCD 3I5FC 1JBAA 4ZCUA 5B8IB 1S1EA 2CCMA 1FPWA 3EK4A 4NDBA 3JTDB 2JT3A 2BAPA 4KYNA 3VRPA 4JWQA 1IGVA 2WCBA 1L7ZA 1WLMA 5AXIA 1SMGA 1B7TY 1TTXA 2M3WA 1S3PA 1J7OA 1DEKA 5HKWA 2KYFA 2M1UA 4GGNA 1FBVA 1JSAA 2JNXA 3BOWB 1NIWA 3PSRA 1LINA 3BUMB 5J3XA 3IQOA 4C0LA 3E3RA 1JC2A 3PM2A 2EHBA 1SPYA 3O6BA 1EL4A 2K2FA 4PE0A 2EGDA 2L4IA 1MR8A 2HQWA 2M0RA 3O2PA 1U5IA 1PVBA 4HSZA 3HCMA 1PSBA 2JT8A 1WDCC 1TRFA 1Z2CB 3EG5B 5D7FA 2LMTA 4MRYA 2F8PA 2BKIB 2M7LA 3VB1A 4ZCVA 1BF5A 2WOSA 2JPTA 2Q4UA 1ALWA 1WRZA 2PASA 1YURA 2BECA 3D10A 4Q04A 1B9AA 1F4QA 3R72A 2IS9A 4C0JA 4DUQA 1CLBA 3I5IC 2PALA 2F2OA 1GGWA 1OOFA 2P6BB 1WY9A 4PE7A 3CR4X 3N7HA 5KSZA 1L2OC 4YGAA 1IWQA 2HQ8A 2JXCA 2M29A 2MLFC 4I5JA 3PLFB 4MN0A 3L4LA 1B7TZ 1H4BA 1TNPA 4PDZA 1HT9A 3S0FA 2Y1NA 3SG5A 1YUSA 2KAYA 5DKNA 2PQLA 1QLSA 1K94A 2LUXA 4XYNA 2KAVA 2A4JA 1QVIY 3VRQA 1DGVA 1SKTA 3K1EA 2F2PA 3TS5B 1W7IB 1VRKA 3CWGA 4I5LB 1EJ3A 1DF0B 1A2XA 2QEBA 4YGCB 5I8NA 1IKUA 2JTZA 2WNDA 3BFBA 5HKYA 4AOMA 1S6JA 1AJ5A 3NSLA 2LE9B 1OMVA 3MSEB 5CSNA 5K89A 2LM5A 2ZRTA 4PT1A 1WRKA 3BFAA 1QS7A 4OV2A 1AVSA 3BUWB 3Q8IA 1TNQA 1IJ6A 2OTGB 4M2OA 4JQ0D 3FE6A 1M39A 2LV7A 3CR2A 1K93D 3IVTA 2PYQA 2L2EA 1Y0VH 1DJZA 3B86A 3EKHA 1N2DA 3BUNB 1KFUS 3UNWA 4D1EA 1S36A 3RM1A 2BKHB 4CFRA 2ZFDA 2LLTA 2YGUA 3PFVA 1FI6A 1KCYA 5FI7A 2LUCA 3FWCA 2M8UA 1DJGA 4CPVA 5ER4X 2QPTA 3DF0B 1XFRA 4PALA 1CLLA 3EVVA 1DMOA 1RK9A 3M0WA 3V2LA 4CFQA 4AQJA 2K2AA 1SNLA 2KNEA 5HLOA 2ERBA 2LVVA 3PM8A 3JVTC 1DTLA 1M63B 3S0GA 1J1EA 1BG1A 3KHEA 1N65A 3PATA 1B4CA 1NSHA 2CXJA 2R2IA 3WHTB 4XJKA 3NHTA 2KDHA 2WC6A 1AUIB 1CLMA 1RROA 1TNXA 1Z4HA 5CSIA 1M45A 2PRUA 3SS5A 5AERA 1KQVA 2LCPA 1OOJA 2BCAA 3DVEA 3LK0A 3O4YA 4ORBB 2BE6A 2FJUB 2KFHA 1CM1A 1PSRA 3CLNA 1KFXL 1SR6B 4PE4A 1TCOB 1TN4A 2QEVA 1J55A 1IRJA 1LKJA 1RFJA 2BL0B 1S5GY 1A4PA 1WDCB 2KFGA 1MUXA 2F3YA 3D75A 2D8NA 1RWYA 4WQ2A 2F3ZA 3VROA 3BFHA 3FIAA 3NSOA 4YI9A 1DJYA 1F71A 4TNCA 4PHMA 1SCVA 1NCXA 5I2LA 1SL7A 3FWBA 1DJWA 1C07A 4IJ7A 2AUCA 3S0AA 1DC1A 1LS8A 5KTYA 1K9UA 4E68A 4M2QA 2K0JA 1MXEA 4P5OE 1B8LA 3VRRA 1QVIZ 1DF0A 5EL2A 3K21A 4F0ZB 2H61A 5F6TA 2KI6C 2KLEA 1XFZO 2LNKA 4WQ3A 1QX5B 3DVKA 1N0YA 1AHRA 3PALA 1M31A 2OS8B 2WCJA 1AK8A 1K9KA 1L2OB 1TUZA 4CIDA 1DELA 1Y1UA 3BXKA 1LA0A 1UHKA 2ZRSA 3GK1A 2KBMA 1TWOA 4MEWA 3EVUA 3EKJA 2JQ6A 1WLZA 1CFCA 1S5GZ 1CM4A 4OVNF 3OP0A 2LHLA 2K7BA 1NX1A 1QIWA 1YX8A 2JPOA 4L9MA 5KU1A 1SRAA 3B6XA 5HLVA 1S6IA 3VRNA 2FJYA 1F54A 2KBIA 1GM0A 1B8RA 3UO9A 1F8HA 3S0EA 1OQPA 2F33A 4GPLB 2L51A 1XFYO 1Y1XA 2FCDA 3JVTB 2COLB 2MA2A 1JF0A 2QEHA 1SR6C 1K2HA 2K60A 2NZ0A 3I5HC 1MXLC 2M7NA 3EK7A 2BBNA 3NGVA 3S0DA 4ETOA 1H8BA 2KHNA 2M97A 3OBVA 1UHHA 3SG2A 3D0YA 2OS8C 5D69A 1ZOTB 1EXRA 1V1FA 2WCFA 1GJYA 1J7QA 4GGFC 1M46A 3VGOA 1HQVA 2KPHA 4YGDB 2QEOA 1ORGA 1CFPA 4AQIA 2AMIA 4ORCB 2H2KA 4GAOA 3EK8A 4QJ5B 1CDNA 2LMVA 1J1DA 4DRWA 4OR9B 3CZTX 4YRUA 3I5GC 2L0PA 1G33A 5BPJA 3OGNA 3DXLA 1C3YA 2KGRA 3DZTA 1DGUA 4OZDA 4HRGA 1IQ5A 1CDLA 2M49B 2WCMA 3CABA 2OPOA 1RJVA 2Y5IA 1KQMC 3FE8A 3CTNA 3OHMB 1ZUZA 3D74A 2K7CA 2LAPA 1IIOA 1IG5A 3TZ1A 1BJFA 2PVBA 5DKQA 5I2QA 2GGMA 1SL9A 5AFPA 1S26D 1QLKA 2NCPA 1K9PA 1SCMC 1KFXS 3D78A 4WRIA 2JXLA 2K7DA 1KK7Y 2AAOA 3D0YB 1MWNA 2KGBC 3OX5A 1XFVO 2GV5A 2K8MB 1YRUB 1KFUL 3WNXB 1QJTA 1XYDA 3PN7C 1CDMA 3CZ1A 3DF0A 1KQMB 2GTEA 2JOJA 2L50A 2KSPA 1T14A 1UP5A 3GK2A 3R1PA 5I94A 2K61A 3F45A 2CTNA 2KAXA 4PCWA 3TDIA 4MLWA 4OCIA 1Q80A 4C0KA 1MHOA 1QX2A 1ALVA 4F7FA 2LLUA 2LLSA 3SJSA 1AP4A 5FYXA 3A8RA 3A4UB 2ZN8A 4YI8A 1KWOB 1OZOA 1XFWO 3QRXA 4JPZB 2SASA 3ICBA 1NCYA 4GFTA 1B8CA 1OSAA 3LLEA 5PALA 2H61C 1JFKA 3GK4X 1CFDA 2LVJA 3LK1A 1KSMA 1C7VA 2WCHA 3O4XA 4HREE 3R1OA 3BUXB 1SK6D 3I5IB 3OX6A 2KQ6A 1EG3A 2P70A 2MAZA 2WCEA 1NPQA 4DIRA 4PE1A 1R2UA 3TDZA 1CFFA 2I94A 4FQTA 4N5XA 5HKZA 3WHUB 1GQMA 3TUYC 2FCEA 1OMDA 3AAKA 1QV1A 2EC6B 2I7AA 4U8DA 2MRDA 3DY9A 2L98A 1OMRA 2Y1MA 5D3OA 2BCBA 1DT7B 2KOTA 2E6WA 4YGBB 4UPGA 2GGZA 4YBHB 1UHNA 1JFJA 1NP8A 4PHKA 1LXFC 1XA5A 3L47A 1C7WA 2NCOA 4I5NB 4MZKA 2HETA 1OW4A 1V1GA 2L4HA 1UURA 3D73A 4R1EA 2BNXA 1E8AA 4NDCA 1X02A 3KO0A 1FI5A 1W9ZA 1DJIA 3SG4A 1XVJA 1QXPA 2KFFA 2WCLA 1Y1AA 1W7JB 2BL0C 1CTRA 1QTXA 2ZN9A 1NUBA 1QATA 2M9GA 3DVMA 3FE9A 3CZ0A 2OTGC 4FQOA 3GOFA 1WRLA 4JKTA 3B7AA 4INWA 1A75B 2BBMA 2FOTA 3KPXA 1DVIA 4GGFA 3BUOB 4A4BA 3DYEA 3ZNIA 1D1OA 2HPSA 1QX7A 1YVHA 2PSRA 2M1KB 2JNFA 1CNPA 3S0BA 3SG6A 3TDUA 1NX0A 2JT0A 3JTDC 5FI6A 1BU3A 2MLEC 1BOCA 1MF8B 3KF9A 1OOGA 1NCZA 1P28A 3NHIA 2E30A 3I5GB 5HYDA 1TNWA 3NSIA 5TNCA 1CMFA 4PHNA 3I5HB 3CYZA 4N1FA 5CPVA 2KI4B 5JOLA 4MZJA 1SCMB 4CLNA 3PJIA 4MZLA 2HF5A 3CDNA 5GQQC 1KK8C 2Y4QA 5CSJA 1SW8A 1PVAA 2CT9A 1CB1A 5I2OA 2EC6C 3D77A 1RTP1 2NLNA 2JC2A 2LMUA 2KYCA 4QJ4B 2JZIA 3TS5C 5AEQA 2JULA 4GUKA 2O5GA 4P2YB 1BLQA 3IQQA 1YTZC 4FTGA 3SG3A 1FF1A 1ZACA 1AJ4A 1LA3A 2WC8A 2KI4C 3I5FB 4ICBA 2KLDA 2LC5A 1UWOA 1G8IA 3D76A 4INXA 5G08A 4BY5A 1KK7Z 2BE4A 2JTTA 2QDIA 2ISDA 5JJGA 2Q91A 1ZFSA 1TUJA 3SIBA 3HX4A 1QV0A 4USLA 1IJ5A 1ODBA 3OB1B 2JWWA 1TIZA 3B88A 3FS7A 2I2RE 3OB2B 4JD9A 4OKHA 3RLZA 1K8UA 1DQEA 1RECA 5CSFA 1QWVA 2JU0A 1BODA 3LCPC 1XK4A 3SIAA 3B87A 3EVRA 4M2PA 2BCXA 2MJWB 3O78A 4PHJA 2RGIA 3SS3A
chains in the Genus database with same CATH topology
1YX7A 1ZMZA 2JRFA 1PALA 2PMYA 4QJ3B 1DJHA 1G4YR 1CDPA 2WORA 2B1UA 3BYAA 1UHIA 1OZSA 1QASA 3NSKA 1NYAA 3TUYB 3KEVA 2MBXA 1MQ1A 2G2BA 2LVIA 4GBAA 3WXAA 1BR4B 1K96A 1B1GA 2TN4A 2KI6D 3CGAA 5IBWA 4ORAB 3CR5X 2LANA 4MRXA 4DS7A 1R6PA 2O60A 1XK4C 2LP2A 1KSOA 3H4SE 4MBEA 1K90D 1NX3A 3BOWA 2G9BA 4NDDA 1F70A 5AANA 1F55A 1J7RA 1YUTA 2CBLA 2LVKA 4N1GA 1SY9A 2ZKMX 1PRWA 1KWOC 1UHJA 3C1VA 3CS1A 3DVJA 1XO5A 3DD4A 1U5IB 1JUOA 1UUSA 2K7OA 2MHHA 4MSPA 2LP3A 4YGEB 1JWDA 1OE9B 1K95A 1YRTB 4DCKA 1Y6WA 1FW4A 2CNPA 2KQYA 4GNKB 1SBJA 2I18A 4HRHA 3ZWHA 1B47A 2L5XB 1JF2A 1PULA 5ER5A 1YVLA 3AKBA 1QIVA 1IH0A 4IL1A 1KK8B 1BMOA 1YR5A 1A29A 2SCPA 2LHIA 3BQ3A 3IF7A 3NXAA 4XJKB 1J7PA 1IQ3A 4I5KA 2V53A 3LL8B 2QACA 1DJXA 4MVFA 2DOQA 1PK0D 1EH2A 3AKAA 1BR1B 1EG4A 4A4CA 1YUUA 1SYMA 3AAJA 1A03A 5DKRA 1TCFA 2NXQA 1S6CA 2VRGA 4BY4A 1A75A 1NWDA 1TOPA 3PN7B 2ZNDA 1BT6A 2ZNEA 1XFXO 1SL8A 4NQGA 1CMGA 1XFUO 1CKKA 1GGZA 3SG7A 1F4OA 1NX2A 1LVCD 3I5FC 1JBAA 4ZCUA 5B8IB 1S1EA 2CCMA 1FPWA 3EK4A 4NDBA 3JTDB 2JT3A 3VRPA 4JWQA 1IGVA 2WCBA 1L7ZA 1WLMA 5AXIA 1SMGA 1B7TY 1TTXA 2M3WA 1S3PA 1J7OA 5HKWA 2KYFA 2M1UA 4GGNA 1FBVA 1JSAA 2JNXA 3BOWB 1NIWA 3PSRA 1LINA 3BUMB 5J3XA 3IQOA 4C0LA 3E3RA 1JC2A 2EHBA 1SPYA 3O6BA 1EL4A 2K2FA 4PE0A 2EGDA 2L4IA 1MR8A 2HQWA 2M0RA 3O2PA 1U5IA 1PVBA 4HSZA 3HCMA 1PSBA 2JT8A 1WDCC 1TRFA 5D7FA 2LMTA 4MRYA 2F8PA 2BKIB 2M7LA 4ZCVA 1BF5A 2WOSA 2JPTA 2Q4UA 1ALWA 1WRZA 2PASA 1YURA 2BECA 3D10A 4Q04A 1B9AA 1F4QA 4C0JA 2IS9A 4DUQA 1CLBA 3I5IC 2PALA 2F2OA 1GGWA 2P6BB 1WY9A 4PE7A 3CR4X 5KSZA 1L2OC 4YGAA 1IWQA 2HQ8A 2JXCA 2M29A 2MLFC 4I5JA 3PLFB 4MN0A 1B7TZ 1H4BA 1TNPA 4PDZA 1HT9A 2Y1NA 3SG5A 1YUSA 2KAYA 5DKNA 1QLSA 1K94A 2LUXA 4XYNA 2KAVA 2A4JA 1QVIY 3VRQA 1DGVA 1SKTA 2F2PA 3TS5B 1W7IB 1VRKA 3CWGA 4I5LB 1EJ3A 1DF0B 1A2XA 5I8NA 4YGCB 1IKUA 2JTZA 2WNDA 5HKYA 4AOMA 1S6JA 1AJ5A 3NSLA 2LE9B 1OMVA 3MSEB 5CSNA 5K89A 2LM5A 2ZRTA 1WRKA 4OV2A 1QS7A 1AVSA 3BUWB 1TNQA 1IJ6A 2OTGB 4M2OA 4JQ0D 1M39A 2LV7A 3CR2A 1K93D 2L2EA 1Y0VH 1DJZA 3EKHA 1N2DA 3BUNB 1KFUS 4D1EA 1S36A 3RM1A 2BKHB 4CFRA 2ZFDA 2LLTA 3PFVA 1FI6A 1KCYA 2LUCA 3FWCA 2M8UA 1DJGA 4CPVA 5ER4X 2QPTA 3DF0B 4PALA 1CLLA 3EVVA 1DMOA 1RK9A 3M0WA 4CFQA 4AQJA 2K2AA 1SNLA 2KNEA 5HLOA 2LVVA 3PM8A 3JVTC 1DTLA 1M63B 1J1EA 1BG1A 3KHEA 1N65A 3PATA 1B4CA 1NSHA 2CXJA 2R2IA 3WHTB 4XJKA 2KDHA 1AUIB 1CLMA 1RROA 1TNXA 5CSIA 1M45A 2PRUA 5AERA 1KQVA 2LCPA 1OOJA 2BCAA 3DVEA 3LK0A 3O4YA 4ORBB 2BE6A 2FJUB 2KFHA 1CM1A 1PSRA 3CLNA 1KFXL 1SR6B 4PE4A 1TCOB 1TN4A 1J55A 1IRJA 1LKJA 1RFJA 2BL0B 1S5GY 1A4PA 1WDCB 2KFGA 1MUXA 2F3YA 2D8NA 1RWYA 4WQ2A 2F3ZA 3VROA 3FIAA 3NSOA 4YI9A 1DJYA 1F71A 4TNCA 4PHMA 1SCVA 1NCXA 5I2LA 1SL7A 3FWBA 1DJWA 1C07A 2AUCA 5KTYA 1K9UA 4E68A 4M2QA 2K0JA 1MXEA 4P5OE 1B8LA 3VRRA 1QVIZ 1DF0A 4F0ZB 3K21A 2H61A 5F6TA 2KI6C 1XFZO 2LNKA 4WQ3A 1QX5B 3DVKA 1N0YA 1AHRA 3PALA 1M31A 2OS8B 1AK8A 1K9KA 1L2OB 4CIDA 1Y1UA 3BXKA 1LA0A 1UHKA 2ZRSA 3GK1A 2KBMA 4MEWA 3EVUA 3EKJA 2JQ6A 1WLZA 1CFCA 1S5GZ 1CM4A 4OVNF 3OP0A 2LHLA 2K7BA 1NX1A 1QIWA 1YX8A 4L9MA 5KU1A 1SRAA 3VRNA 5HLVA 1S6IA 1F54A 2KBIA 1B8RA 1F8HA 1OQPA 2F33A 4GPLB 2L51A 1XFYO 1Y1XA 2FCDA 3JVTB 2COLB 2MA2A 1JF0A 1SR6C 1K2HA 2NZ0A 3I5HC 1MXLC 2M7NA 3EK7A 2BBNA 1H8BA 4ETOA 2KHNA 2M97A 3SG2A 1UHHA 3D0YA 2OS8C 5D69A 1ZOTB 1EXRA 1V1FA 2WCFA 1GJYA 1J7QA 4GGFC 1M46A 3VGOA 1HQVA 4YGDB 1CFPA 4AQIA 2AMIA 4ORCB 2H2KA 4GAOA 3EK8A 4QJ5B 1CDNA 2LMVA 1J1DA 4DRWA 4OR9B 3CZTX 4YRUA 3I5GC 2L0PA 1G33A 5BPJA 2KGRA 1DGUA 4HRGA 1IQ5A 1CDLA 2M49B 2OPOA 1RJVA 2Y5IA 1KQMC 3CTNA 3OHMB 1ZUZA 2K7CA 2LAPA 1IG5A 3TZ1A 1BJFA 2PVBA 5DKQA 5I2QA 2GGMA 1SL9A 5AFPA 1S26D 1QLKA 2NCPA 1K9PA 1SCMC 1KFXS 4WRIA 2JXLA 2K7DA 1KK7Y 2AAOA 3D0YB 1MWNA 2KGBC 3OX5A 1XFVO 2GV5A 2K8MB 1YRUB 1KFUL 3WNXB 1QJTA 1XYDA 3PN7C 1CDMA 3DF0A 1KQMB 2JOJA 2L50A 2KSPA 3GK2A 1UP5A 2K61A 3F45A 2CTNA 2KAXA 4PCWA 3TDIA 4MLWA 4OCIA 1Q80A 4C0KA 1MHOA 1QX2A 1ALVA 2LLUA 2LLSA 3SJSA 1AP4A 5FYXA 3A8RA 3A4UB 2ZN8A 4YI8A 1KWOB 1OZOA 1XFWO 3QRXA 4JPZB 2SASA 3ICBA 1NCYA 4GFTA 1B8CA 1OSAA 3LLEA 5PALA 2H61C 1JFKA 3GK4X 1CFDA 2LVJA 3LK1A 1KSMA 1C7VA 4HREE 3BUXB 1SK6D 3I5IB 3OX6A 2KQ6A 1EG3A 2MAZA 2WCEA 1NPQA 4DIRA 4PE1A 1R2UA 3TDZA 1CFFA 2I94A 4N5XA 5HKZA 3WHUB 1GQMA 3TUYC 2FCEA 1OMDA 3AAKA 1QV1A 2EC6B 2I7AA 4U8DA 2MRDA 2L98A 1OMRA 2Y1MA 2BCBA 1DT7B 2KOTA 2E6WA 4YGBB 4UPGA 2GGZA 4YBHB 1UHNA 1JFJA 1NP8A 4PHKA 1LXFC 1XA5A 1C7WA 2NCOA 4I5NB 4MZKA 2HETA 2L4HA 1V1GA 1UURA 4R1EA 1E8AA 4NDCA 1X02A 3KO0A 1FI5A 1DJIA 3SG4A 1XVJA 1QXPA 2KFFA 1Y1AA 1W7JB 2BL0C 1CTRA 1QTXA 2ZN9A 1NUBA 1QATA 2M9GA 3DVMA 2OTGC 4FQOA 3GOFA 1WRLA 1A75B 2BBMA 2FOTA 3KPXA 1DVIA 4GGFA 3BUOB 4A4BA 3ZNIA 1D1OA 2HPSA 1QX7A 1YVHA 2PSRA 2M1KB 2JNFA 1CNPA 3SG6A 3TDUA 1NX0A 2JT0A 3JTDC 1BU3A 2MLEC 1BOCA 1MF8B 3KF9A 1NCZA 2E30A 3I5GB 5HYDA 1TNWA 3NSIA 5TNCA 1CMFA 4PHNA 3I5HB 4N1FA 5CPVA 2KI4B 5JOLA 4MZJA 1SCMB 4CLNA 4MZLA 2HF5A 5GQQC 1KK8C 2Y4QA 5CSJA 1SW8A 1PVAA 2CT9A 1CB1A 5I2OA 2EC6C 1RTP1 2NLNA 2JC2A 2LMUA 2KYCA 4QJ4B 2JZIA 3TS5C 5AEQA 2JULA 4GUKA 2O5GA 4P2YB 1BLQA 3IQQA 1YTZC 4FTGA 3SG3A 1FF1A 1ZACA 1AJ4A 1LA3A 2WC8A 2KI4C 3I5FB 4ICBA 2LC5A 1UWOA 1G8IA 5G08A 4BY5A 1KK7Z 2BE4A 2JTTA 2ISDA 5JJGA 2Q91A 1ZFSA 3SIBA 3HX4A 1QV0A 4USLA 1IJ5A 1ODBA 3OB1B 2JWWA 1TIZA 3FS7A 3OB2B 2I2RE 4OKHA 3RLZA 1K8UA 5CSFA 1RECA 2JU0A 1BODA 3LCPC 1XK4A 3SIAA 3EVRA 4M2PA 2BCXA 2MJWB 3O78A 4PHJA 2RGIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YX7 A;  1ZMZ A;  2JRF A;  1PAL A;  2PMY A;  4QJ3 B;  1DJH A;  1G4Y R;  1CDP A;  2WOR A;  2B1U A;  3BYA A;  1UHI A;  1OZS A;  1QAS A;  3NSK A;  1NYA A;  3TUY B;  3KEV A;  2MBX A;  1MQ1 A;  2G2B A;  2LVI A;  4GBA A;  3WXA A;  1BR4 B;  1K96 A;  1B1G A;  2TN4 A;  2KI6 D;  3CGA A;  5IBW A;  4ORA B;  3CR5 X;  2LAN A;  4MRX A;  4DS7 A;  1R6P A;  2O60 A;  1XK4 C;  2LP2 A;  1KSO A;  3H4S E;  4MBE A;  1K90 D;  1NX3 A;  3BOW A;  2G9B A;  4NDD A;  1F70 A;  5AAN A;  1F55 A;  1J7R A;  1YUT A;  2CBL A;  2LVK A;  4N1G A;  1SY9 A;  2ZKM X;  1PRW A;  1KWO C;  1UHJ A;  3C1V A;  3CS1 A;  3DVJ A;  1XO5 A;  3DD4 A;  1U5I B;  1JUO A;  1UUS A;  2K7O A;  2MHH A;  4MSP A;  2LP3 A;  4YGE B;  1JWD A;  1OE9 B;  1K95 A;  1YRT B;  4DCK A;  1Y6W A;  1FW4 A;  2CNP A;  2KQY A;  4GNK B;  1SBJ A;  2I18 A;  4HRH A;  3ZWH A;  1B47 A;  2L5X B;  1JF2 A;  1PUL A;  5ER5 A;  1YVL A;  3AKB A;  1QIV A;  1IH0 A;  4IL1 A;  1KK8 B;  1BMO A;  1YR5 A;  1A29 A;  2SCP A;  2LHI A;  3BQ3 A;  3IF7 A;  3NXA A;  4XJK B;  1J7P A;  1IQ3 A;  4I5K A;  2V53 A;  3LL8 B;  2QAC A;  1DJX A;  4MVF A;  2DOQ A;  1PK0 D;  1EH2 A;  3AKA A;  1BR1 B;  1EG4 A;  4A4C A;  1YUU A;  1SYM A;  3AAJ A;  1A03 A;  5DKR A;  1TCF A;  2NXQ A;  1S6C A;  2VRG A;  4BY4 A;  1A75 A;  1NWD A;  1TOP A;  3PN7 B;  2ZND A;  1BT6 A;  2ZNE A;  1XFX O;  1SL8 A;  4NQG A;  1CMG A;  1XFU O;  1CKK A;  1GGZ A;  3SG7 A;  1F4O A;  1NX2 A;  1LVC D;  3I5F C;  1JBA A;  4ZCU A;  5B8I B;  1S1E A;  2CCM A;  1FPW A;  3EK4 A;  4NDB A;  3JTD B;  2JT3 A;  3VRP A;  4JWQ A;  1IGV A;  2WCB A;  1L7Z A;  1WLM A;  5AXI A;  1SMG A;  1B7T Y;  1TTX A;  2M3W A;  1S3P A;  1J7O A;  5HKW A;  2KYF A;  2M1U A;  4GGN A;  1FBV A;  1JSA A;  2JNX A;  3BOW B;  1NIW A;  3PSR A;  1LIN A;  3BUM B;  5J3X A;  3IQO A;  4C0L A;  3E3R A;  1JC2 A;  2EHB A;  1SPY A;  3O6B A;  1EL4 A;  2K2F A;  4PE0 A;  2EGD A;  2L4I A;  1MR8 A;  2HQW A;  2M0R A;  3O2P A;  1U5I A;  1PVB A;  4HSZ A;  3HCM A;  1PSB A;  2JT8 A;  1WDC C;  1TRF A;  5D7F A;  2LMT A;  4MRY A;  2F8P A;  2BKI B;  2M7L A;  4ZCV A;  1BF5 A;  2WOS A;  2JPT A;  2Q4U A;  1ALW A;  1WRZ A;  2PAS A;  1YUR A;  2BEC A;  3D10 A;  4Q04 A;  1B9A A;  1F4Q A;  4C0J A;  2IS9 A;  4DUQ A;  1CLB A;  3I5I C;  2PAL A;  2F2O A;  1GGW A;  2P6B B;  1WY9 A;  4PE7 A;  3CR4 X;  5KSZ A;  1L2O C;  4YGA A;  1IWQ A;  2HQ8 A;  2JXC A;  2M29 A;  2MLF C;  4I5J A;  3PLF B;  4MN0 A;  1B7T Z;  1H4B A;  1TNP A;  4PDZ A;  1HT9 A;  2Y1N A;  3SG5 A;  1YUS A;  2KAY A;  5DKN A;  1QLS A;  1K94 A;  2LUX A;  4XYN A;  2KAV A;  2A4J A;  1QVI Y;  3VRQ A;  1DGV A;  1SKT A;  2F2P A;  3TS5 B;  1W7I B;  1VRK A;  3CWG A;  4I5L B;  1EJ3 A;  1DF0 B;  1A2X A;  5I8N A;  4YGC B;  1IKU A;  2JTZ A;  2WND A;  5HKY A;  4AOM A;  1S6J A;  1AJ5 A;  3NSL A;  2LE9 B;  1OMV A;  3MSE B;  5CSN A;  5K89 A;  2LM5 A;  2ZRT A;  1WRK A;  4OV2 A;  1QS7 A;  1AVS A;  3BUW B;  1TNQ A;  1IJ6 A;  2OTG B;  4M2O A;  4JQ0 D;  1M39 A;  2LV7 A;  3CR2 A;  1K93 D;  2L2E A;  1Y0V H;  1DJZ A;  3EKH A;  1N2D A;  3BUN B;  1KFU S;  4D1E A;  1S36 A;  3RM1 A;  2BKH B;  4CFR A;  2ZFD A;  2LLT A;  3PFV A;  1FI6 A;  1KCY A;  2LUC A;  3FWC A;  2M8U A;  1DJG A;  4CPV A;  5ER4 X;  2QPT A;  3DF0 B;  4PAL A;  1CLL A;  3EVV A;  1DMO A;  1RK9 A;  3M0W A;  4CFQ A;  4AQJ A;  2K2A A;  1SNL A;  2KNE A;  5HLO A;  2LVV A;  3PM8 A;  3JVT C;  1DTL A;  1M63 B;  1J1E A;  1BG1 A;  3KHE A;  1N65 A;  3PAT A;  1B4C A;  1NSH A;  2CXJ A;  2R2I A;  3WHT B;  4XJK A;  2KDH A;  1AUI B;  1CLM A;  1RRO A;  1TNX A;  5CSI A;  1M45 A;  2PRU A;  5AER A;  1KQV A;  2LCP A;  1OOJ A;  2BCA A;  3DVE A;  3LK0 A;  3O4Y A;  4ORB B;  2BE6 A;  2FJU B;  2KFH A;  1CM1 A;  1PSR A;  3CLN A;  1KFX L;  1SR6 B;  4PE4 A;  1TCO B;  1TN4 A;  1J55 A;  1IRJ A;  1LKJ A;  1RFJ A;  2BL0 B;  1S5G Y;  1A4P A;  1WDC B;  2KFG A;  1MUX A;  2F3Y A;  2D8N A;  1RWY A;  4WQ2 A;  2F3Z A;  3VRO A;  3FIA A;  3NSO A;  4YI9 A;  1DJY A;  1F71 A;  4TNC A;  4PHM A;  1SCV A;  1NCX A;  5I2L A;  1SL7 A;  3FWB A;  1DJW A;  1C07 A;  2AUC A;  5KTY A;  1K9U A;  4E68 A;  4M2Q A;  2K0J A;  1MXE A;  4P5O E;  1B8L A;  3VRR A;  1QVI Z;  1DF0 A;  4F0Z B;  3K21 A;  2H61 A;  5F6T A;  2KI6 C;  1XFZ O;  2LNK A;  4WQ3 A;  1QX5 B;  3DVK A;  1N0Y A;  1AHR A;  3PAL A;  1M31 A;  2OS8 B;  1AK8 A;  1K9K A;  1L2O B;  4CID A;  1Y1U A;  3BXK A;  1LA0 A;  1UHK A;  2ZRS A;  3GK1 A;  2KBM A;  4MEW A;  3EVU A;  3EKJ A;  2JQ6 A;  1WLZ A;  1CFC A;  1S5G Z;  1CM4 A;  4OVN F;  3OP0 A;  2LHL A;  2K7B A;  1NX1 A;  1QIW A;  1YX8 A;  4L9M A;  5KU1 A;  1SRA A;  3VRN A;  5HLV A;  1S6I A;  1F54 A;  2KBI A;  1B8R A;  1F8H A;  1OQP A;  2F33 A;  4GPL B;  2L51 A;  1XFY O;  1Y1X A;  2FCD A;  3JVT B;  2COL B;  2MA2 A;  1JF0 A;  1SR6 C;  1K2H A;  2NZ0 A;  3I5H C;  1MXL C;  2M7N A;  3EK7 A;  2BBN A;  1H8B A;  4ETO A;  2KHN A;  2M97 A;  3SG2 A;  1UHH A;  3D0Y A;  2OS8 C;  5D69 A;  1ZOT B;  1EXR A;  1V1F A;  2WCF A;  1GJY A;  1J7Q A;  4GGF C;  1M46 A;  3VGO A;  1HQV A;  4YGD B;  1CFP A;  4AQI A;  2AMI A;  4ORC B;  2H2K A;  4GAO A;  3EK8 A;  4QJ5 B;  1CDN A;  2LMV A;  1J1D A;  4DRW A;  4OR9 B;  3CZT X;  4YRU A;  3I5G C;  2L0P A;  1G33 A;  5BPJ A;  2KGR A;  1DGU A;  4HRG A;  1IQ5 A;  1CDL A;  2M49 B;  2OPO A;  1RJV A;  2Y5I A;  1KQM C;  3CTN A;  3OHM B;  1ZUZ A;  2K7C A;  2LAP A;  1IG5 A;  3TZ1 A;  1BJF A;  2PVB A;  5DKQ A;  5I2Q A;  2GGM A;  1SL9 A;  5AFP A;  1S26 D;  1QLK A;  2NCP A;  1K9P A;  1SCM C;  1KFX S;  4WRI A;  2JXL A;  2K7D A;  1KK7 Y;  2AAO A;  3D0Y B;  1MWN A;  2KGB C;  3OX5 A;  1XFV O;  2GV5 A;  2K8M B;  1YRU B;  1KFU L;  3WNX B;  1QJT A;  1XYD A;  3PN7 C;  1CDM A;  3DF0 A;  1KQM B;  2JOJ A;  2L50 A;  2KSP A;  3GK2 A;  1UP5 A;  2K61 A;  3F45 A;  2CTN A;  2KAX A;  4PCW A;  3TDI A;  4MLW A;  4OCI A;  1Q80 A;  4C0K A;  1MHO A;  1QX2 A;  1ALV A;  2LLU A;  2LLS A;  3SJS A;  1AP4 A;  5FYX A;  3A8R A;  3A4U B;  2ZN8 A;  4YI8 A;  1KWO B;  1OZO A;  1XFW O;  3QRX A;  4JPZ B;  2SAS A;  3ICB A;  1NCY A;  4GFT A;  1B8C A;  1OSA A;  3LLE A;  5PAL A;  2H61 C;  1JFK A;  3GK4 X;  1CFD A;  2LVJ A;  3LK1 A;  1KSM A;  1C7V A;  4HRE E;  3BUX B;  1SK6 D;  3I5I B;  3OX6 A;  2KQ6 A;  1EG3 A;  2MAZ A;  2WCE A;  1NPQ A;  4DIR A;  4PE1 A;  1R2U A;  3TDZ A;  1CFF A;  2I94 A;  4N5X A;  5HKZ A;  3WHU B;  1GQM A;  3TUY C;  2FCE A;  1OMD A;  3AAK A;  1QV1 A;  2EC6 B;  2I7A A;  4U8D A;  2MRD A;  2L98 A;  1OMR A;  2Y1M A;  2BCB A;  1DT7 B;  2KOT A;  2E6W A;  4YGB B;  4UPG A;  2GGZ A;  4YBH B;  1UHN A;  1JFJ A;  1NP8 A;  4PHK A;  1LXF C;  1XA5 A;  1C7W A;  2NCO A;  4I5N B;  4MZK A;  2HET A;  2L4H A;  1V1G A;  1UUR A;  4R1E A;  1E8A A;  4NDC A;  1X02 A;  3KO0 A;  1FI5 A;  1DJI A;  3SG4 A;  1XVJ A;  1QXP A;  2KFF A;  1Y1A A;  1W7J B;  2BL0 C;  1CTR A;  1QTX A;  2ZN9 A;  1NUB A;  1QAT A;  2M9G A;  3DVM A;  2OTG C;  4FQO A;  3GOF A;  1WRL A;  1A75 B;  2BBM A;  2FOT A;  3KPX A;  1DVI A;  4GGF A;  3BUO B;  4A4B A;  3ZNI A;  1D1O A;  2HPS A;  1QX7 A;  1YVH A;  2PSR A;  2M1K B;  2JNF A;  1CNP A;  3SG6 A;  3TDU A;  1NX0 A;  2JT0 A;  3JTD C;  1BU3 A;  2MLE C;  1BOC A;  1MF8 B;  3KF9 A;  1NCZ A;  2E30 A;  3I5G B;  5HYD A;  1TNW A;  3NSI A;  5TNC A;  1CMF A;  4PHN A;  3I5H B;  4N1F A;  5CPV A;  2KI4 B;  5JOL A;  4MZJ A;  1SCM B;  4CLN A;  4MZL A;  2HF5 A;  5GQQ C;  1KK8 C;  2Y4Q A;  5CSJ A;  1SW8 A;  1PVA A;  2CT9 A;  1CB1 A;  5I2O A;  2EC6 C;  1RTP 1;  2NLN A;  2JC2 A;  2LMU A;  2KYC A;  4QJ4 B;  2JZI A;  3TS5 C;  5AEQ A;  2JUL A;  4GUK A;  2O5G A;  4P2Y B;  1BLQ A;  3IQQ A;  1YTZ C;  4FTG A;  3SG3 A;  1FF1 A;  1ZAC A;  1AJ4 A;  1LA3 A;  2WC8 A;  2KI4 C;  3I5F B;  4ICB A;  2LC5 A;  1UWO A;  1G8I A;  5G08 A;  4BY5 A;  1KK7 Z;  2BE4 A;  2JTT A;  2ISD A;  5JJG A;  2Q91 A;  1ZFS A;  3SIB A;  3HX4 A;  1QV0 A;  4USL A;  1IJ5 A;  1ODB A;  3OB1 B;  2JWW A;  1TIZ A;  3FS7 A;  3OB2 B;  2I2R E;  4OKH A;  3RLZ A;  1K8U A;  5CSF A;  1REC A;  2JU0 A;  1BOD A;  3LCP C;  1XK4 A;  3SIA A;  3EVR A;  4M2P A;  2BCX A;  2MJW B;  3O78 A;  4PHJ A;  2RGI A; 
#chains in the Genus database with same CATH topology
 1YX7 A;  1ZMZ A;  2JRF A;  1PAL A;  2PMY A;  4QJ3 B;  1DJH A;  1G4Y R;  1CDP A;  1OOI X;  2WOR A;  2B1U A;  3RZS A;  3BYA A;  1UHI A;  1OZS A;  1QAS A;  3NSK A;  2WCK A;  1NYA A;  3TUY B;  3KEV A;  2MBX A;  1MQ1 A;  2G2B A;  2LVI A;  4GBA A;  3WXA A;  3BJH A;  1BR4 B;  1K96 A;  1B1G A;  2TN4 A;  2KI6 D;  3CGA A;  5IBW A;  4ORA B;  3CR5 X;  2LAN A;  4MRX A;  4DS7 A;  1R6P A;  5HL1 A;  2O60 A;  1XK4 C;  2LP2 A;  1KSO A;  3H4S E;  4MBE A;  1K90 D;  1NX3 A;  3BOW A;  2G9B A;  4NDD A;  1F70 A;  2P71 A;  5AAN A;  1F55 A;  1J7R A;  1YUT A;  2CBL A;  2LVK A;  4N1G A;  1SY9 A;  2ZKM X;  1PRW A;  1KWO C;  1UHJ A;  3C1V A;  3CS1 A;  3DVJ A;  1OOH A;  1XO5 A;  3DD4 A;  1U5I B;  1JUO A;  1UUS A;  2K7O A;  2MHH A;  4MSP A;  5DIC A;  2LP3 A;  4YGE B;  5FI2 A;  2L2C A;  1JWD A;  1OE9 B;  1K95 A;  1YRT B;  4DCK A;  1Y6W A;  1FW4 A;  2CNP A;  2KQY A;  4GNK B;  1SBJ A;  2I18 A;  4HRH A;  3ZWH A;  1B47 A;  2L5X B;  1JF2 A;  1PUL A;  5ER5 A;  1YVL A;  3AKB A;  1QIV A;  1IH0 A;  4IL1 A;  3L4A A;  1KK8 B;  1BMO A;  1YR5 A;  1A29 A;  2SCP A;  2LHI A;  3BQ3 A;  3CZ2 A;  3IF7 A;  3NXA A;  4XJK B;  1J7P A;  1IQ3 A;  4I5K A;  2V53 A;  3LL8 B;  2QAC A;  1DJX A;  4MVF A;  2DOQ A;  1PK0 D;  1EH2 A;  2L5Y A;  3AKA A;  1C3Z A;  1BR1 B;  1EG4 A;  3SS4 A;  4A4C A;  1YUU A;  1SYM A;  3AAJ A;  1A03 A;  5DKR A;  1TCF A;  2NXQ A;  1S6C A;  2VRG A;  4BY4 A;  1SSE B;  1A75 A;  1NWD A;  2WC5 A;  1TOP A;  3PN7 B;  2ZND A;  1BT6 A;  3QME A;  2ZNE A;  1XFX O;  1SL8 A;  4NQG A;  1CMG A;  1XFU O;  2H8V A;  1CKK A;  1GGZ A;  3SG7 A;  3R1V A;  1F4O A;  1NX2 A;  1LVC D;  3I5F C;  1JBA A;  4ZCU A;  5B8I B;  1S1E A;  2CCM A;  1FPW A;  3EK4 A;  4NDB A;  3JTD B;  2JT3 A;  2BAP A;  4KYN A;  3VRP A;  4JWQ A;  1IGV A;  2WCB A;  1L7Z A;  1WLM A;  5AXI A;  1SMG A;  1B7T Y;  1TTX A;  2M3W A;  1S3P A;  1J7O A;  1DEK A;  5HKW A;  2KYF A;  2M1U A;  4GGN A;  1FBV A;  1JSA A;  2JNX A;  3BOW B;  1NIW A;  3PSR A;  1LIN A;  3BUM B;  5J3X A;  3IQO A;  4C0L A;  3E3R A;  1JC2 A;  3PM2 A;  2EHB A;  1SPY A;  3O6B A;  1EL4 A;  2K2F A;  4PE0 A;  2EGD A;  2L4I A;  1MR8 A;  2HQW A;  2M0R A;  3O2P A;  1U5I A;  1PVB A;  4HSZ A;  3HCM A;  1PSB A;  2JT8 A;  1WDC C;  1TRF A;  1Z2C B;  3EG5 B;  5D7F A;  2LMT A;  4MRY A;  2F8P A;  2BKI B;  2M7L A;  3VB1 A;  4ZCV A;  1BF5 A;  2WOS A;  2JPT A;  2Q4U A;  1ALW A;  1WRZ A;  2PAS A;  1YUR A;  2BEC A;  3D10 A;  4Q04 A;  1B9A A;  1F4Q A;  3R72 A;  2IS9 A;  4C0J A;  4DUQ A;  1CLB A;  3I5I C;  2PAL A;  2F2O A;  1GGW A;  1OOF A;  2P6B B;  1WY9 A;  4PE7 A;  3CR4 X;  3N7H A;  5KSZ A;  1L2O C;  4YGA A;  1IWQ A;  2HQ8 A;  2JXC A;  2M29 A;  2MLF C;  4I5J A;  3PLF B;  4MN0 A;  3L4L A;  1B7T Z;  1H4B A;  1TNP A;  4PDZ A;  1HT9 A;  3S0F A;  2Y1N A;  3SG5 A;  1YUS A;  2KAY A;  5DKN A;  2PQL A;  1QLS A;  1K94 A;  2LUX A;  4XYN A;  2KAV A;  2A4J A;  1QVI Y;  3VRQ A;  1DGV A;  1SKT A;  3K1E A;  2F2P A;  3TS5 B;  1W7I B;  1VRK A;  3CWG A;  4I5L B;  1EJ3 A;  1DF0 B;  1A2X A;  2QEB A;  4YGC B;  5I8N A;  1IKU A;  2JTZ A;  2WND A;  3BFB A;  5HKY A;  4AOM A;  1S6J A;  1AJ5 A;  3NSL A;  2LE9 B;  1OMV A;  3MSE B;  5CSN A;  5K89 A;  2LM5 A;  2ZRT A;  4PT1 A;  1WRK A;  3BFA A;  1QS7 A;  4OV2 A;  1AVS A;  3BUW B;  3Q8I A;  1TNQ A;  1IJ6 A;  2OTG B;  4M2O A;  4JQ0 D;  3FE6 A;  1M39 A;  2LV7 A;  3CR2 A;  1K93 D;  3IVT A;  2PYQ A;  2L2E A;  1Y0V H;  1DJZ A;  3B86 A;  3EKH A;  1N2D A;  3BUN B;  1KFU S;  3UNW A;  4D1E A;  1S36 A;  3RM1 A;  2BKH B;  4CFR A;  2ZFD A;  2LLT A;  2YGU A;  3PFV A;  1FI6 A;  1KCY A;  5FI7 A;  2LUC A;  3FWC A;  2M8U A;  1DJG A;  4CPV A;  5ER4 X;  2QPT A;  3DF0 B;  1XFR A;  4PAL A;  1CLL A;  3EVV A;  1DMO A;  1RK9 A;  3M0W A;  3V2L A;  4CFQ A;  4AQJ A;  2K2A A;  1SNL A;  2KNE A;  5HLO A;  2ERB A;  2LVV A;  3PM8 A;  3JVT C;  1DTL A;  1M63 B;  3S0G A;  1J1E A;  1BG1 A;  3KHE A;  1N65 A;  3PAT A;  1B4C A;  1NSH A;  2CXJ A;  2R2I A;  3WHT B;  4XJK A;  3NHT A;  2KDH A;  2WC6 A;  1AUI B;  1CLM A;  1RRO A;  1TNX A;  1Z4H A;  5CSI A;  1M45 A;  2PRU A;  3SS5 A;  5AER A;  1KQV A;  2LCP A;  1OOJ A;  2BCA A;  3DVE A;  3LK0 A;  3O4Y A;  4ORB B;  2BE6 A;  2FJU B;  2KFH A;  1CM1 A;  1PSR A;  3CLN A;  1KFX L;  1SR6 B;  4PE4 A;  1TCO B;  1TN4 A;  2QEV A;  1J55 A;  1IRJ A;  1LKJ A;  1RFJ A;  2BL0 B;  1S5G Y;  1A4P A;  1WDC B;  2KFG A;  1MUX A;  2F3Y A;  3D75 A;  2D8N A;  1RWY A;  4WQ2 A;  2F3Z A;  3VRO A;  3BFH A;  3FIA A;  3NSO A;  4YI9 A;  1DJY A;  1F71 A;  4TNC A;  4PHM A;  1SCV A;  1NCX A;  5I2L A;  1SL7 A;  3FWB A;  1DJW A;  1C07 A;  4IJ7 A;  2AUC A;  3S0A A;  1DC1 A;  1LS8 A;  5KTY A;  1K9U A;  4E68 A;  4M2Q A;  2K0J A;  1MXE A;  4P5O E;  1B8L A;  3VRR A;  1QVI Z;  1DF0 A;  5EL2 A;  3K21 A;  4F0Z B;  2H61 A;  5F6T A;  2KI6 C;  2KLE A;  1XFZ O;  2LNK A;  4WQ3 A;  1QX5 B;  3DVK A;  1N0Y A;  1AHR A;  3PAL A;  1M31 A;  2OS8 B;  2WCJ A;  1AK8 A;  1K9K A;  1L2O B;  1TUZ A;  4CID A;  1DEL A;  1Y1U A;  3BXK A;  1LA0 A;  1UHK A;  2ZRS A;  3GK1 A;  2KBM A;  1TWO A;  4MEW A;  3EVU A;  3EKJ A;  2JQ6 A;  1WLZ A;  1CFC A;  1S5G Z;  1CM4 A;  4OVN F;  3OP0 A;  2LHL A;  2K7B A;  1NX1 A;  1QIW A;  1YX8 A;  2JPO A;  4L9M A;  5KU1 A;  1SRA A;  3B6X A;  5HLV A;  1S6I A;  3VRN A;  2FJY A;  1F54 A;  2KBI A;  1GM0 A;  1B8R A;  3UO9 A;  1F8H A;  3S0E A;  1OQP A;  2F33 A;  4GPL B;  2L51 A;  1XFY O;  1Y1X A;  2FCD A;  3JVT B;  2COL B;  2MA2 A;  1JF0 A;  2QEH A;  1SR6 C;  1K2H A;  2K60 A;  2NZ0 A;  3I5H C;  1MXL C;  2M7N A;  3EK7 A;  2BBN A;  3NGV A;  3S0D A;  4ETO A;  1H8B A;  2KHN A;  2M97 A;  3OBV A;  1UHH A;  3SG2 A;  3D0Y A;  2OS8 C;  5D69 A;  1ZOT B;  1EXR A;  1V1F A;  2WCF A;  1GJY A;  1J7Q A;  4GGF C;  1M46 A;  3VGO A;  1HQV A;  2KPH A;  4YGD B;  2QEO A;  1ORG A;  1CFP A;  4AQI A;  2AMI A;  4ORC B;  2H2K A;  4GAO A;  3EK8 A;  4QJ5 B;  1CDN A;  2LMV A;  1J1D A;  4DRW A;  4OR9 B;  3CZT X;  4YRU A;  3I5G C;  2L0P A;  1G33 A;  5BPJ A;  3OGN A;  3DXL A;  1C3Y A;  2KGR A;  3DZT A;  1DGU A;  4OZD A;  4HRG A;  1IQ5 A;  1CDL A;  2M49 B;  2WCM A;  3CAB A;  2OPO A;  1RJV A;  2Y5I A;  1KQM C;  3FE8 A;  3CTN A;  3OHM B;  1ZUZ A;  3D74 A;  2K7C A;  2LAP A;  1IIO A;  1IG5 A;  3TZ1 A;  1BJF A;  2PVB A;  5DKQ A;  5I2Q A;  2GGM A;  1SL9 A;  5AFP A;  1S26 D;  1QLK A;  2NCP A;  1K9P A;  1SCM C;  1KFX S;  3D78 A;  4WRI A;  2JXL A;  2K7D A;  1KK7 Y;  2AAO A;  3D0Y B;  1MWN A;  2KGB C;  3OX5 A;  1XFV O;  2GV5 A;  2K8M B;  1YRU B;  1KFU L;  3WNX B;  1QJT A;  1XYD A;  3PN7 C;  1CDM A;  3CZ1 A;  3DF0 A;  1KQM B;  2GTE A;  2JOJ A;  2L50 A;  2KSP A;  1T14 A;  1UP5 A;  3GK2 A;  3R1P A;  5I94 A;  2K61 A;  3F45 A;  2CTN A;  2KAX A;  4PCW A;  3TDI A;  4MLW A;  4OCI A;  1Q80 A;  4C0K A;  1MHO A;  1QX2 A;  1ALV A;  4F7F A;  2LLU A;  2LLS A;  3SJS A;  1AP4 A;  5FYX A;  3A8R A;  3A4U B;  2ZN8 A;  4YI8 A;  1KWO B;  1OZO A;  1XFW O;  3QRX A;  4JPZ B;  2SAS A;  3ICB A;  1NCY A;  4GFT A;  1B8C A;  1OSA A;  3LLE A;  5PAL A;  2H61 C;  1JFK A;  3GK4 X;  1CFD A;  2LVJ A;  3LK1 A;  1KSM A;  1C7V A;  2WCH A;  3O4X A;  4HRE E;  3R1O A;  3BUX B;  1SK6 D;  3I5I B;  3OX6 A;  2KQ6 A;  1EG3 A;  2P70 A;  2MAZ A;  2WCE A;  1NPQ A;  4DIR A;  4PE1 A;  1R2U A;  3TDZ A;  1CFF A;  2I94 A;  4FQT A;  4N5X A;  5HKZ A;  3WHU B;  1GQM A;  3TUY C;  2FCE A;  1OMD A;  3AAK A;  1QV1 A;  2EC6 B;  2I7A A;  4U8D A;  2MRD A;  3DY9 A;  2L98 A;  1OMR A;  2Y1M A;  5D3O A;  2BCB A;  1DT7 B;  2KOT A;  2E6W A;  4YGB B;  4UPG A;  2GGZ A;  4YBH B;  1UHN A;  1JFJ A;  1NP8 A;  4PHK A;  1LXF C;  1XA5 A;  3L47 A;  1C7W A;  2NCO A;  4I5N B;  4MZK A;  2HET A;  1OW4 A;  1V1G A;  2L4H A;  1UUR A;  3D73 A;  4R1E A;  2BNX A;  1E8A A;  4NDC A;  1X02 A;  3KO0 A;  1FI5 A;  1W9Z A;  1DJI A;  3SG4 A;  1XVJ A;  1QXP A;  2KFF A;  2WCL A;  1Y1A A;  1W7J B;  2BL0 C;  1CTR A;  1QTX A;  2ZN9 A;  1NUB A;  1QAT A;  2M9G A;  3DVM A;  3FE9 A;  3CZ0 A;  2OTG C;  4FQO A;  3GOF A;  1WRL A;  4JKT A;  3B7A A;  4INW A;  1A75 B;  2BBM A;  2FOT A;  3KPX A;  1DVI A;  4GGF A;  3BUO B;  4A4B A;  3DYE A;  3ZNI A;  1D1O A;  2HPS A;  1QX7 A;  1YVH A;  2PSR A;  2M1K B;  2JNF A;  1CNP A;  3S0B A;  3SG6 A;  3TDU A;  1NX0 A;  2JT0 A;  3JTD C;  5FI6 A;  1BU3 A;  2MLE C;  1BOC A;  1MF8 B;  3KF9 A;  1OOG A;  1NCZ A;  1P28 A;  3NHI A;  2E30 A;  3I5G B;  5HYD A;  1TNW A;  3NSI A;  5TNC A;  1CMF A;  4PHN A;  3I5H B;  3CYZ A;  4N1F A;  5CPV A;  2KI4 B;  5JOL A;  4MZJ A;  1SCM B;  4CLN A;  3PJI A;  4MZL A;  2HF5 A;  3CDN A;  5GQQ C;  1KK8 C;  2Y4Q A;  5CSJ A;  1SW8 A;  1PVA A;  2CT9 A;  1CB1 A;  5I2O A;  2EC6 C;  3D77 A;  1RTP 1;  2NLN A;  2JC2 A;  2LMU A;  2KYC A;  4QJ4 B;  2JZI A;  3TS5 C;  5AEQ A;  2JUL A;  4GUK A;  2O5G A;  4P2Y B;  1BLQ A;  3IQQ A;  1YTZ C;  4FTG A;  3SG3 A;  1FF1 A;  1ZAC A;  1AJ4 A;  1LA3 A;  2WC8 A;  2KI4 C;  3I5F B;  4ICB A;  2KLD A;  2LC5 A;  1UWO A;  1G8I A;  3D76 A;  4INX A;  5G08 A;  4BY5 A;  1KK7 Z;  2BE4 A;  2JTT A;  2QDI A;  2ISD A;  5JJG A;  2Q91 A;  1ZFS A;  1TUJ A;  3SIB A;  3HX4 A;  1QV0 A;  4USL A;  1IJ5 A;  1ODB A;  3OB1 B;  2JWW A;  1TIZ A;  3B88 A;  3FS7 A;  2I2R E;  3OB2 B;  4JD9 A;  4OKH A;  3RLZ A;  1K8U A;  1DQE A;  1REC A;  5CSF A;  1QWV A;  2JU0 A;  1BOD A;  3LCP C;  1XK4 A;  3SIA A;  3B87 A;  3EVR A;  4M2P A;  2BCX A;  2MJW B;  3O78 A;  4PHJ A;  2RGI A;  3SS3 A; 
#chains in the Genus database with same CATH homology
 1YX7 A;  1ZMZ A;  2JRF A;  1PAL A;  2PMY A;  4QJ3 B;  1DJH A;  1G4Y R;  1CDP A;  2WOR A;  2B1U A;  3BYA A;  1UHI A;  1OZS A;  1QAS A;  3NSK A;  1NYA A;  3TUY B;  3KEV A;  2MBX A;  1MQ1 A;  2G2B A;  2LVI A;  4GBA A;  3WXA A;  1BR4 B;  1K96 A;  1B1G A;  2TN4 A;  2KI6 D;  3CGA A;  5IBW A;  4ORA B;  3CR5 X;  2LAN A;  4MRX A;  4DS7 A;  1R6P A;  2O60 A;  1XK4 C;  2LP2 A;  1KSO A;  3H4S E;  4MBE A;  1K90 D;  1NX3 A;  3BOW A;  2G9B A;  4NDD A;  1F70 A;  5AAN A;  1F55 A;  1J7R A;  1YUT A;  2CBL A;  2LVK A;  4N1G A;  1SY9 A;  2ZKM X;  1PRW A;  1KWO C;  1UHJ A;  3C1V A;  3CS1 A;  3DVJ A;  1XO5 A;  3DD4 A;  1U5I B;  1JUO A;  1UUS A;  2K7O A;  2MHH A;  4MSP A;  2LP3 A;  4YGE B;  1JWD A;  1OE9 B;  1K95 A;  1YRT B;  4DCK A;  1Y6W A;  1FW4 A;  2CNP A;  2KQY A;  4GNK B;  1SBJ A;  2I18 A;  4HRH A;  3ZWH A;  1B47 A;  2L5X B;  1JF2 A;  1PUL A;  5ER5 A;  1YVL A;  3AKB A;  1QIV A;  1IH0 A;  4IL1 A;  1KK8 B;  1BMO A;  1YR5 A;  1A29 A;  2SCP A;  2LHI A;  3BQ3 A;  3IF7 A;  3NXA A;  4XJK B;  1J7P A;  1IQ3 A;  4I5K A;  2V53 A;  3LL8 B;  2QAC A;  1DJX A;  4MVF A;  2DOQ A;  1PK0 D;  1EH2 A;  3AKA A;  1BR1 B;  1EG4 A;  4A4C A;  1YUU A;  1SYM A;  3AAJ A;  1A03 A;  5DKR A;  1TCF A;  2NXQ A;  1S6C A;  2VRG A;  4BY4 A;  1A75 A;  1NWD A;  1TOP A;  3PN7 B;  2ZND A;  1BT6 A;  2ZNE A;  1XFX O;  1SL8 A;  4NQG A;  1CMG A;  1XFU O;  1CKK A;  1GGZ A;  3SG7 A;  1F4O A;  1NX2 A;  1LVC D;  3I5F C;  1JBA A;  4ZCU A;  5B8I B;  1S1E A;  2CCM A;  1FPW A;  3EK4 A;  4NDB A;  3JTD B;  2JT3 A;  3VRP A;  4JWQ A;  1IGV A;  2WCB A;  1L7Z A;  1WLM A;  5AXI A;  1SMG A;  1B7T Y;  1TTX A;  2M3W A;  1S3P A;  1J7O A;  5HKW A;  2KYF A;  2M1U A;  4GGN A;  1FBV A;  1JSA A;  2JNX A;  3BOW B;  1NIW A;  3PSR A;  1LIN A;  3BUM B;  5J3X A;  3IQO A;  4C0L A;  3E3R A;  1JC2 A;  2EHB A;  1SPY A;  3O6B A;  1EL4 A;  2K2F A;  4PE0 A;  2EGD A;  2L4I A;  1MR8 A;  2HQW A;  2M0R A;  3O2P A;  1U5I A;  1PVB A;  4HSZ A;  3HCM A;  1PSB A;  2JT8 A;  1WDC C;  1TRF A;  5D7F A;  2LMT A;  4MRY A;  2F8P A;  2BKI B;  2M7L A;  4ZCV A;  1BF5 A;  2WOS A;  2JPT A;  2Q4U A;  1ALW A;  1WRZ A;  2PAS A;  1YUR A;  2BEC A;  3D10 A;  4Q04 A;  1B9A A;  1F4Q A;  4C0J A;  2IS9 A;  4DUQ A;  1CLB A;  3I5I C;  2PAL A;  2F2O A;  1GGW A;  2P6B B;  1WY9 A;  4PE7 A;  3CR4 X;  5KSZ A;  1L2O C;  4YGA A;  1IWQ A;  2HQ8 A;  2JXC A;  2M29 A;  2MLF C;  4I5J A;  3PLF B;  4MN0 A;  1B7T Z;  1H4B A;  1TNP A;  4PDZ A;  1HT9 A;  2Y1N A;  3SG5 A;  1YUS A;  2KAY A;  5DKN A;  1QLS A;  1K94 A;  2LUX A;  4XYN A;  2KAV A;  2A4J A;  1QVI Y;  3VRQ A;  1DGV A;  1SKT A;  2F2P A;  3TS5 B;  1W7I B;  1VRK A;  3CWG A;  4I5L B;  1EJ3 A;  1DF0 B;  1A2X A;  5I8N A;  4YGC B;  1IKU A;  2JTZ A;  2WND A;  5HKY A;  4AOM A;  1S6J A;  1AJ5 A;  3NSL A;  2LE9 B;  1OMV A;  3MSE B;  5CSN A;  5K89 A;  2LM5 A;  2ZRT A;  1WRK A;  4OV2 A;  1QS7 A;  1AVS A;  3BUW B;  1TNQ A;  1IJ6 A;  2OTG B;  4M2O A;  4JQ0 D;  1M39 A;  2LV7 A;  3CR2 A;  1K93 D;  2L2E A;  1Y0V H;  1DJZ A;  3EKH A;  1N2D A;  3BUN B;  1KFU S;  4D1E A;  1S36 A;  3RM1 A;  2BKH B;  4CFR A;  2ZFD A;  2LLT A;  3PFV A;  1FI6 A;  1KCY A;  2LUC A;  3FWC A;  2M8U A;  1DJG A;  4CPV A;  5ER4 X;  2QPT A;  3DF0 B;  4PAL A;  1CLL A;  3EVV A;  1DMO A;  1RK9 A;  3M0W A;  4CFQ A;  4AQJ A;  2K2A A;  1SNL A;  2KNE A;  5HLO A;  2LVV A;  3PM8 A;  3JVT C;  1DTL A;  1M63 B;  1J1E A;  1BG1 A;  3KHE A;  1N65 A;  3PAT A;  1B4C A;  1NSH A;  2CXJ A;  2R2I A;  3WHT B;  4XJK A;  2KDH A;  1AUI B;  1CLM A;  1RRO A;  1TNX A;  5CSI A;  1M45 A;  2PRU A;  5AER A;  1KQV A;  2LCP A;  1OOJ A;  2BCA A;  3DVE A;  3LK0 A;  3O4Y A;  4ORB B;  2BE6 A;  2FJU B;  2KFH A;  1CM1 A;  1PSR A;  3CLN A;  1KFX L;  1SR6 B;  4PE4 A;  1TCO B;  1TN4 A;  1J55 A;  1IRJ A;  1LKJ A;  1RFJ A;  2BL0 B;  1S5G Y;  1A4P A;  1WDC B;  2KFG A;  1MUX A;  2F3Y A;  2D8N A;  1RWY A;  4WQ2 A;  2F3Z A;  3VRO A;  3FIA A;  3NSO A;  4YI9 A;  1DJY A;  1F71 A;  4TNC A;  4PHM A;  1SCV A;  1NCX A;  5I2L A;  1SL7 A;  3FWB A;  1DJW A;  1C07 A;  2AUC A;  5KTY A;  1K9U A;  4E68 A;  4M2Q A;  2K0J A;  1MXE A;  4P5O E;  1B8L A;  3VRR A;  1QVI Z;  1DF0 A;  4F0Z B;  3K21 A;  2H61 A;  5F6T A;  2KI6 C;  1XFZ O;  2LNK A;  4WQ3 A;  1QX5 B;  3DVK A;  1N0Y A;  1AHR A;  3PAL A;  1M31 A;  2OS8 B;  1AK8 A;  1K9K A;  1L2O B;  4CID A;  1Y1U A;  3BXK A;  1LA0 A;  1UHK A;  2ZRS A;  3GK1 A;  2KBM A;  4MEW A;  3EVU A;  3EKJ A;  2JQ6 A;  1WLZ A;  1CFC A;  1S5G Z;  1CM4 A;  4OVN F;  3OP0 A;  2LHL A;  2K7B A;  1NX1 A;  1QIW A;  1YX8 A;  4L9M A;  5KU1 A;  1SRA A;  3VRN A;  5HLV A;  1S6I A;  1F54 A;  2KBI A;  1B8R A;  1F8H A;  1OQP A;  2F33 A;  4GPL B;  2L51 A;  1XFY O;  1Y1X A;  2FCD A;  3JVT B;  2COL B;  2MA2 A;  1JF0 A;  1SR6 C;  1K2H A;  2NZ0 A;  3I5H C;  1MXL C;  2M7N A;  3EK7 A;  2BBN A;  1H8B A;  4ETO A;  2KHN A;  2M97 A;  3SG2 A;  1UHH A;  3D0Y A;  2OS8 C;  5D69 A;  1ZOT B;  1EXR A;  1V1F A;  2WCF A;  1GJY A;  1J7Q A;  4GGF C;  1M46 A;  3VGO A;  1HQV A;  4YGD B;  1CFP A;  4AQI A;  2AMI A;  4ORC B;  2H2K A;  4GAO A;  3EK8 A;  4QJ5 B;  1CDN A;  2LMV A;  1J1D A;  4DRW A;  4OR9 B;  3CZT X;  4YRU A;  3I5G C;  2L0P A;  1G33 A;  5BPJ A;  2KGR A;  1DGU A;  4HRG A;  1IQ5 A;  1CDL A;  2M49 B;  2OPO A;  1RJV A;  2Y5I A;  1KQM C;  3CTN A;  3OHM B;  1ZUZ A;  2K7C A;  2LAP A;  1IG5 A;  3TZ1 A;  1BJF A;  2PVB A;  5DKQ A;  5I2Q A;  2GGM A;  1SL9 A;  5AFP A;  1S26 D;  1QLK A;  2NCP A;  1K9P A;  1SCM C;  1KFX S;  4WRI A;  2JXL A;  2K7D A;  1KK7 Y;  2AAO A;  3D0Y B;  1MWN A;  2KGB C;  3OX5 A;  1XFV O;  2GV5 A;  2K8M B;  1YRU B;  1KFU L;  3WNX B;  1QJT A;  1XYD A;  3PN7 C;  1CDM A;  3DF0 A;  1KQM B;  2JOJ A;  2L50 A;  2KSP A;  3GK2 A;  1UP5 A;  2K61 A;  3F45 A;  2CTN A;  2KAX A;  4PCW A;  3TDI A;  4MLW A;  4OCI A;  1Q80 A;  4C0K A;  1MHO A;  1QX2 A;  1ALV A;  2LLU A;  2LLS A;  3SJS A;  1AP4 A;  5FYX A;  3A8R A;  3A4U B;  2ZN8 A;  4YI8 A;  1KWO B;  1OZO A;  1XFW O;  3QRX A;  4JPZ B;  2SAS A;  3ICB A;  1NCY A;  4GFT A;  1B8C A;  1OSA A;  3LLE A;  5PAL A;  2H61 C;  1JFK A;  3GK4 X;  1CFD A;  2LVJ A;  3LK1 A;  1KSM A;  1C7V A;  4HRE E;  3BUX B;  1SK6 D;  3I5I B;  3OX6 A;  2KQ6 A;  1EG3 A;  2MAZ A;  2WCE A;  1NPQ A;  4DIR A;  4PE1 A;  1R2U A;  3TDZ A;  1CFF A;  2I94 A;  4N5X A;  5HKZ A;  3WHU B;  1GQM A;  3TUY C;  2FCE A;  1OMD A;  3AAK A;  1QV1 A;  2EC6 B;  2I7A A;  4U8D A;  2MRD A;  2L98 A;  1OMR A;  2Y1M A;  2BCB A;  1DT7 B;  2KOT A;  2E6W A;  4YGB B;  4UPG A;  2GGZ A;  4YBH B;  1UHN A;  1JFJ A;  1NP8 A;  4PHK A;  1LXF C;  1XA5 A;  1C7W A;  2NCO A;  4I5N B;  4MZK A;  2HET A;  2L4H A;  1V1G A;  1UUR A;  4R1E A;  1E8A A;  4NDC A;  1X02 A;  3KO0 A;  1FI5 A;  1DJI A;  3SG4 A;  1XVJ A;  1QXP A;  2KFF A;  1Y1A A;  1W7J B;  2BL0 C;  1CTR A;  1QTX A;  2ZN9 A;  1NUB A;  1QAT A;  2M9G A;  3DVM A;  2OTG C;  4FQO A;  3GOF A;  1WRL A;  1A75 B;  2BBM A;  2FOT A;  3KPX A;  1DVI A;  4GGF A;  3BUO B;  4A4B A;  3ZNI A;  1D1O A;  2HPS A;  1QX7 A;  1YVH A;  2PSR A;  2M1K B;  2JNF A;  1CNP A;  3SG6 A;  3TDU A;  1NX0 A;  2JT0 A;  3JTD C;  1BU3 A;  2MLE C;  1BOC A;  1MF8 B;  3KF9 A;  1NCZ A;  2E30 A;  3I5G B;  5HYD A;  1TNW A;  3NSI A;  5TNC A;  1CMF A;  4PHN A;  3I5H B;  4N1F A;  5CPV A;  2KI4 B;  5JOL A;  4MZJ A;  1SCM B;  4CLN A;  4MZL A;  2HF5 A;  5GQQ C;  1KK8 C;  2Y4Q A;  5CSJ A;  1SW8 A;  1PVA A;  2CT9 A;  1CB1 A;  5I2O A;  2EC6 C;  1RTP 1;  2NLN A;  2JC2 A;  2LMU A;  2KYC A;  4QJ4 B;  2JZI A;  3TS5 C;  5AEQ A;  2JUL A;  4GUK A;  2O5G A;  4P2Y B;  1BLQ A;  3IQQ A;  1YTZ C;  4FTG A;  3SG3 A;  1FF1 A;  1ZAC A;  1AJ4 A;  1LA3 A;  2WC8 A;  2KI4 C;  3I5F B;  4ICB A;  2LC5 A;  1UWO A;  1G8I A;  5G08 A;  4BY5 A;  1KK7 Z;  2BE4 A;  2JTT A;  2ISD A;  5JJG A;  2Q91 A;  1ZFS A;  3SIB A;  3HX4 A;  1QV0 A;  4USL A;  1IJ5 A;  1ODB A;  3OB1 B;  2JWW A;  1TIZ A;  3FS7 A;  3OB2 B;  2I2R E;  4OKH A;  3RLZ A;  1K8U A;  5CSF A;  1REC A;  2JU0 A;  1BOD A;  3LCP C;  1XK4 A;  3SIA A;  3EVR A;  4M2P A;  2BCX A;  2MJW B;  3O78 A;  4PHJ A;  2RGI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...