2K8MB

S100a13-c2a binary complex structure
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
98
structure length
98
Chain Sequence
MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title S100A13-C2A binary complex structure-a key component in the acidic fibroblast growth factor for the non-classical pathway.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 29
structure length 98
sequence length 98
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2k8mB00
4C0LA 1K96A 3FIAA 1J1DA 1AK8A 1CTRA 3SIBA 1KFUL 1QJTA 1QV0A 1TOPA 2M0RA 2KAYA 2M8UA 1CDLA 2I7AA 1A29A 1YX8A 4N1FA 2BBMA 1K2HA 1GJYA 3SG7A 4JWQA 1V1FA 1YUTA 1JC2A 1L7ZA 2O5GA 1DJZA 1J7PA 1RROA 1SR6B 1NP8A 1YR5A 2M29A 1DVIA 2KYFA 3TZ1A 1TIZA 2L4HA 1LA3A 1JSAA 5D7FA 4TNCA 3GK4X 1LA0A 1UHNA 4I5LB 1PVAA 1JUOA 2LC5A 1S5GY 2A4JA 2LUCA 2PVBA 1KWOB 3FWBA 3VRQA 4YI8A 1CM1A 2V53A 3EVRA 2JT8A 3RLZA 2CCMA 1IKUA 1KFXL 1KK7Z 2F33A 1FW4A 2D8NA 1KFUS 1OZSA 3CR5X 4YGBB 4CPVA 1LVCD 1MF8B 4MRXA 2L98A 2G2BA 2VRGA 2R2IA 4FTGA 3LK0A 3PM8A 4USLA 1TRFA 1XA5A 3BUWB 2M49B 1ZUZA 4CLNA 3KEVA 1K9KA 1S3PA 4JPZB 3PFVA 1CLBA 1EL4A 3O78A 3WHUB 1VRKA 3PLFB 4IL1A 3DVKA 2NLNA 1SYMA 1RK9A 4R1EA 2BCAA 3TUYB 1ZOTB 1K8UA 1Y6WA 1WDCB 2LCPA 5I8NA 1PSBA 3A4UB 4DRWA 2K2AA 3DVMA 3OX6A 1UWOA 1PALA 2KGBC 2WCBA 5JOLA 1DGUA 1YRTB 2KI6D 1SL9A 1J7RA 5CSNA 4ICBA 1OQPA 1QASA 4C0JA 5KTYA 4P5OE 2K7OA 1NWDA 1Q80A 1XFUO 4AOMA 1KFXS 4HSZA 4PALA 3AAJA 1KQVA 3ZWHA 2MLFC 2F8PA 1WRKA 3HX4A 2F2OA 2OTGB 1KK7Y 5HKWA 1G4YR 1WRLA 4L9MA 3AKAA 1AVSA 1XFXO 2L50A 3CLNA 2BE4A 2LMVA 5CSIA 2AAOA 3BUMB 2CBLA 2LANA 3FWCA 3DD4A 2ZN8A 4U8DA 1XYDA 1XFVO 4YRUA 1BF5A 2ZNEA 1XO5A 1DF0A 3I5IC 2LLTA 4P2YB 1KSMA 4GGNA 4MBEA 2LLUA 3VRPA 1YVHA 3NSKA 1DF0B 4GGFC 2P6BB 5KSZA 3EK8A 2LLSA 1N2DA 1QIWA 3WHTB 1F71A 4ORBB 2LVKA 1QATA 1BMOA 4ORCB 1ZACA 2MLEC 3BXKA 1IQ3A 3I5FC 2HETA 5PALA 2Y4QA 2JULA 1A03A 1TNQA 2LM5A 2EGDA 1PULA 1S6IA 1V1GA 1BJFA 2F3YA 1XK4C 1U5IA 2CNPA 1F4QA 1QX7A 2K8MB 3I5HC 1KK8C 5G08A 1NIWA 2RGIA 2NXQA 3PN7B 1BODA 1EG4A 4WQ2A 1S6JA 2LVJA 1UHJA 1JBAA 1K93D 1CLMA 3JVTB 3TDUA 5FYXA 2KSPA 1QIVA 2LP2A 4PE7A 1TCFA 1EH2A 2WNDA 1J7OA 2MAZA 1CDPA 3D10A 1B47A 5DKNA 1G8IA 2KI4C 2OPOA 2ZN9A 3JTDB 3WXAA 2JU0A 5HKZA 4M2PA 2O60A 1YRUB 3I5GC 4GFTA 4MRYA 1RJVA 3FS7A 4CFQA 1IJ5A 1NCZA 1F54A 3F45A 2LAPA 2EC6B 1B8CA 2BL0B 2KFHA 3BQ3A 2K7CA 1UUSA 1QXPA 1SBJA 4OV2A 1Y0VH 2KFGA 5HLOA 1ALVA 2ZFDA 3TS5C 1ODBA 1SL7A 2QPTA 2Y1MA 4HRHA 1CKKA 1OE9B 2BKIB 4A4CA 1FPWA 3CR4X 1F8HA 4NDBA 5TNCA 1NYAA 4QJ4B 1PVBA 3DVEA 1UHIA 1F4OA 2JC2A 5AERA 1LKJA 3O6BA 4YGDB 2WCFA 1NSHA 2JXLA 3BYAA 1CB1A 2HQWA 3QRXA 1J7QA 4OR9B 3GOFA 4YGEB 1OSAA 2FCEA 2I2RE 2JNFA 2LVIA 2WOSA 1ZMZA 1RECA 3CTNA 3PSRA 2KI6C 3NXAA 2GGMA 5AEQA 2LE9B 3LK1A 1SNLA 5K89A 1XK4A 5D69A 1SCMC 1FI6A 4HRGA 2M9GA 1OZOA 1WRZA 2Y1NA 1DGVA 1SRAA 2M97A 2F3ZA 1OMRA 1QTXA 2KQYA 1JFKA 4XJKA 4AQJA 2CTNA 3TDZA 1BR1B 1BLQA 2FOTA 1L2OB 3IQOA 2KNEA 2OS8B 3HCMA 4YI9A 5DKQA 3VRNA 4UPGA 1CDMA 2BCXA 3SJSA 3BUXB 1Y1XA 2MBXA 2E30A 5HYDA 1QV1A 1MR8A 2JT0A 2KBMA 1MQ1A 1RFJA 2JT3A 1CFPA 3BUOB 2LVVA 4AQIA 1ZFSA 5ER4X 2LMTA 1MUXA 1CFCA 1IQ5A 3DVJA 1AJ4A 3EVUA 1E8AA 1K9PA 1K9UA 2NZ0A 1KCYA 2L4IA 4E68A 2ZNDA 1SL8A 4N5XA 1MHOA 2KFFA 4BY4A 1IH0A 3SG6A 4MZKA 1TNPA 4PHKA 2G9BA 1DTLA 1QX2A 1TNXA 1AUIB 1FBVA 2JTZA 2M3WA 4A4BA 3BUNB 4OVNF 5CSFA 1IJ6A 3GK2A 3KHEA 1C7WA 4OCIA 1B4CA 1SPYA 2KDHA 1DMOA 1IG5A 1NX2A 4PDZA 2WORA 1K94A 3MSEB 3LL8B 1QLKA 3OP0A 2LMUA 3EKHA 1SR6C 2KAVA 3IF7A 4NDCA 2HF5A 2L5XB 2I18A 2ISDA 1NPQA 1GGWA 3A8RA 1JF0A 1S36A 3CGAA 3SG3A 3H4SE 4I5JA 4ETOA 1CM4A 1KSOA 1A75A 1GGZA 2AUCA 2F2PA 1SW8A 1CNPA 1BOCA 2LP3A 3VROA 3M0WA 4DIRA 1KWOC 1IWQA 1YUUA 4DUQA 1RWYA 5GQQC 4HREE 5DKRA 2SASA 2LV7A 1A75B 4I5KA 2LHIA 1Y1UA 3ICBA 1BG1A 1G33A 2JWWA 4NDDA 1K95A 2B1UA 3VRRA 2PMYA 2TN4A 1U5IB 2AMIA 5I2OA 1J1EA 1WLZA 1QVIZ 2K2FA 4PE1A 5IBWA 2BBNA 2H61C 3BOWA 4N1GA 5ER5A 1B8RA 5I2LA 2BCBA 2JQ6A 4PCWA 3TUYC 2PALA 3EVVA 1WDCC 3D0YA 1YVLA 4YBHB 1CFDA 4D1EA 2I94A 3LLEA 1M39A 1DJIA 4F0ZB 1MWNA 2HQ8A 3PALA 2PASA 2JXCA 4NQGA 1Y1AA 2CT9A 3D0YB 2L0PA 1B1GA 1S1EA 4MN0A 1M45A 1WLMA 5HKYA 1H4BA 1KQMC 1YTZC 1NX1A 2K7BA 2LNKA 5B8IB 1R2UA 2M7NA 2OTGC 2LUXA 2M1KB 1HT9A 1CDNA 3PATA 2NCPA 2JNXA 4WRIA 1AHRA 2MRDA 2ZKMX 1CMGA 4M2OA 1RTP1 1CFFA 1S26D 1OMDA 1J55A 4MLWA 1JF2A 4GBAA 1A4PA 1QVIY 4QJ5B 2KYCA 4DS7A 1AJ5A 2BECA 2FCDA 4PE4A 1DT7B 4OKHA 3I5IB 4I5NB 1YX7A 4GGFA 1XFWO 2MJWB 2M1UA 1N0YA 2WCEA 1DJXA 4M2QA 4C0KA 1AP4A 1DJYA 1UHHA 3WNXB 1PK0D 2PSRA 5BPJA 1W7IB 2FJUB 2KOTA 4PE0A 2JOJA 3KF9A 4Q04A 1A2XA 3I5FB 1BR4B 2NCOA 2E6WA 3NSLA 1CLLA 2Q4UA 3OHMB 1HQVA 1LINA 1UP5A 4PHJA 2KHNA 4MZJA 1BU3A 3SG4A 2JTTA 1XVJA 3NSOA 4ZCVA 2KAXA 3I5HB 1KK8B 3AKBA 5I2QA 2H61A 1OMVA 1F55A 1TNWA 3VGOA 1IGVA 4BY5A 5CSJA 3CR2A 1K90D 5CPVA 1MXLC 4MSPA 3EK7A 4XJKB 4YGCB 4XYNA 4PHMA 5J3XA 1XFYO 3PN7C 1C7VA 1SCVA 3E3RA 1SK6D 3TDIA 1WY9A 2GGZA 4DCKA 2KI4B 3JVTC 2BE6A 2ZRSA 3KO0A 2JRFA 3O2PA 5AANA 4CFRA 3I5GB 1DJWA 1PSRA 2COLB 1D1OA 2SCPA 3JTDC 3O4YA 2Y5IA 1QS7A 4CIDA 1EXRA 1JFJA 5AXIA 1EG3A 1XFZO 1M63B 2MA2A 4QJ3B 1KQMB 2EC6C 2BL0C 5KU1A 3TS5B 1YURA 1C07A 1BT6A 3KPXA 5F6TA 3OB1B 1CMFA 2IS9A 2L2EA 3ZNIA 1DJGA 3GK1A 4JQ0D 3CWGA 1FI5A 2L51A 1SY9A 2BKHB 3LCPC 3OB2B 4GAOA 1UHKA 2CXJA 3SG2A 1X02A 3K21A 1LXFC 3SIAA 2H2KA 1DJHA 2K0JA 1NX3A 3NSIA 1H8BA 3CS1A 1B7TZ 1QLSA 2ZRTA 1OOJA 4MEWA 1QX5B 2K7DA 3IQQA 1SKTA 2DOQA 2K61A 4WQ3A 3RM1A 1FF1A 5AFPA 1MXEA 2PRUA 2LHLA 2Q91A 1TTXA 4GPLB 4ORAB 2GV5A 3CZTX 4ZCUA 2M7LA 1B9AA 1SMGA 4YGAA 4MVFA 1NCYA 1NX0A 1PRWA 1N65A 2JPTA 4FQOA 4GNKB 1SCMB 4PHNA 1F70A 1R6PA 3SG5A 1JWDA 1EJ3A 3EKJA 1M31A 3AAKA 2KBIA 2MHHA 1TCOB 3BOWB 1ALWA 1UURA 4MZLA 5JJGA 1B8LA 3DF0A 2JZIA 1IRJA 2WC8A 3OX5A 1S6CA 1YUSA 2KGRA 1B7TY 3EK4A 1GQMA 2HPSA 1M46A 1L2OC 3DF0B 5HLVA 4GUKA 1W7JB 2OS8C 1NUBA 1TN4A 1NCXA 2QACA 1S5GZ 2EHBA 2KQ6A 3C1VA
chains in the Genus database with same CATH superfamily
1OOFA 4C0LA 1ORGA 1K96A 3FIAA 2WC5A 1J1DA 1AK8A 1CTRA 3SIBA 1KFUL 1QJTA 1TWOA 1QV0A 1TOPA 2M0RA 2QEOA 2KAYA 2M8UA 1CDLA 2I7AA 1A29A 2L2CA 1YX8A 4N1FA 2BBMA 1K2HA 1GJYA 3SG7A 4JWQA 1V1FA 1YUTA 1JC2A 1GM0A 1L7ZA 2O5GA 1DJZA 1J7PA 1RROA 1SR6B 2KLEA 1NP8A 1YR5A 2M29A 1DVIA 2KYFA 3TZ1A 1TIZA 3D74A 2L4HA 1C3ZA 1LA3A 1JSAA 3Q8IA 5D7FA 4TNCA 3GK4X 1LA0A 1UHNA 1IIOA 4I5LB 3L4AA 1PVAA 1JUOA 2LC5A 1QWVA 1S5GY 2A4JA 2LUCA 1KWOB 2PVBA 3FWBA 3VRQA 4YI8A 1CM1A 2V53A 3EVRA 2JT8A 3RLZA 2CCMA 3R1VA 1IKUA 1KFXL 1KK7Z 2F33A 1FW4A 2D8NA 1KFUS 1OZSA 3CABA 3CR5X 4YGBB 4CPVA 1LVCD 1MF8B 4MRXA 2L98A 2G2BA 2VRGA 2R2IA 4FTGA 3LK0A 3PM8A 4USLA 1TRFA 1XA5A 3BUWB 2M49B 1ZUZA 4CLNA 3IVTA 1K9KA 3KEVA 3S0FA 1S3PA 4JPZB 3PFVA 1CLBA 1EL4A 3O78A 3WHUB 1VRKA 3PLFB 4IL1A 3DVKA 2NLNA 1SYMA 1RK9A 4R1EA 2BCAA 3TUYB 1ZOTB 1K8UA 1Y6WA 1WDCB 2LCPA 5I8NA 1PSBA 3B87A 3A4UB 4DRWA 1TUJA 2K2AA 3DVMA 3OX6A 1UWOA 1PALA 2KGBC 2WCBA 5JOLA 1DGUA 1YRTB 2KI6D 2WCLA 1SL9A 1J7RA 5CSNA 4ICBA 1OQPA 1DQEA 1QASA 1T14A 4C0JA 4P5OE 2K7OA 1NWDA 1Q80A 1XFUO 4AOMA 1KFXS 4HSZA 4PALA 3AAJA 1KQVA 3ZWHA 2MLFC 2F8PA 1WRKA 3HX4A 2F2OA 2OTGB 1KK7Y 5HKWA 2FJYA 1G4YR 1WRLA 4L9MA 3AKAA 3SS3A 1AVSA 3S0DA 1XFXO 2L50A 3CLNA 2BE4A 2LMVA 5CSIA 2AAOA 3BUMB 2CBLA 2YGUA 1Z2CB 2PYQA 1OW4A 2ERBA 2LANA 3FWCA 3UO9A 3DD4A 2ZN8A 5EL2A 4U8DA 1XYDA 1XFVO 4YRUA 1BF5A 2ZNEA 1XO5A 1DF0A 3I5IC 3FE8A 2LLTA 4P2YB 1KSMA 4GGNA 4MBEA 2LLUA 1LS8A 3VRPA 1YVHA 3NSKA 2P70A 1DF0B 4GGFC 4JKTA 2P6BB 5KSZA 3EK8A 2LLSA 1N2DA 1QIWA 3WHTB 1F71A 4ORBB 2LVKA 3DY9A 1QATA 1BMOA 4ORCB 3S0EA 1ZACA 2MLEC 3L47A 3BXKA 1IQ3A 3I5FC 2HETA 5PALA 2Y4QA 2JULA 1A03A 1TNQA 2LM5A 2EGDA 1PULA 1DC1A 1S6IA 1V1GA 3DXLA 1BJFA 2F3YA 1XK4C 1U5IA 2CNPA 1F4QA 1QX7A 3R72A 3B88A 2K8MB 3I5HC 1KK8C 5G08A 1NIWA 2RGIA 2NXQA 3PN7B 1BODA 1EG4A 4WQ2A 1S6JA 2LVJA 1UHJA 3CZ1A 1JBAA 1K93D 1CLMA 3JVTB 3TDUA 5FYXA 2KSPA 1QIVA 2LP2A 4PE7A 1TCFA 1EH2A 2WNDA 1J7OA 3CDNA 2MAZA 1CDPA 3D10A 1B47A 5DKNA 1G8IA 2KI4C 2OPOA 2ZN9A 3JTDB 3WXAA 2JU0A 5HKZA 4M2PA 2O60A 1YRUB 2WCKA 3I5GC 4GFTA 1RJVA 4MRYA 3FS7A 4CFQA 1IJ5A 1NCZA 1F54A 3F45A 2LAPA 2EC6B 1B8CA 2BL0B 3NHIA 2KFHA 3BQ3A 2K7CA 1UUSA 4PT1A 1QXPA 1SBJA 1SSEB 3QMEA 4OV2A 1Y0VH 2KFGA 5HLOA 1ALVA 2ZFDA 3TS5C 1ODBA 1SL7A 2QPTA 2Y1MA 4HRHA 3S0AA 1OE9B 1CKKA 2BKIB 4A4CA 1FPWA 3CR4X 1F8HA 4NDBA 5TNCA 1NYAA 4QJ4B 1PVBA 3DVEA 1UHIA 1F4OA 2QEBA 2JC2A 5AERA 1LKJA 4F7FA 3O6BA 4YGDB 2WCFA 3NGVA 1NSHA 2JXLA 3BYAA 1P28A 1CB1A 2HQWA 3QRXA 1J7QA 4OR9B 3GOFA 4YGEB 5DICA 1OSAA 2FCEA 2QEVA 2I2RE 2JNFA 2LVIA 2WCJA 2WOSA 1ZMZA 1RECA 5FI7A 3CTNA 3PSRA 2KI6C 2WCMA 3NXAA 2GGMA 5AEQA 2LE9B 3CZ2A 3LK1A 1SNLA 5K89A 1XK4A 5D69A 3N7HA 1SCMC 1FI6A 1W9ZA 4HRGA 2M9GA 1OZOA 1WRZA 2Y1NA 1DGVA 1SRAA 2M97A 2F3ZA 4KYNA 1OMRA 1QTXA 2KQYA 1JFKA 4XJKA 4AQJA 2CTNA 3TDZA 1BR1B 1BLQA 2FOTA 3V2LA 1L2OB 1DELA 3IQOA 2KNEA 2OS8B 2P71A 3HCMA 4YI9A 5DKQA 3SS5A 3VRNA 4UPGA 1CDMA 2BCXA 3SJSA 3BUXB 1Y1XA 3FE6A 2E30A 2MBXA 5HYDA 1QV1A 1MR8A 2JT0A 2KBMA 1MQ1A 1OOGA 1RFJA 2BNXA 2JT3A 1CFPA 2JPOA 3BUOB 2LVVA 4AQIA 1ZFSA 5ER4X 2LMTA 1MUXA 3DYEA 1CFCA 1IQ5A 3DVJA 1AJ4A 3EVUA 1E8AA 1K9PA 1K9UA 2NZ0A 1KCYA 3NHTA 2L4IA 4E68A 1XFRA 2ZNDA 1SL8A 3BFHA 2L5YA 4N5XA 1MHOA 2KFFA 4BY4A 1IH0A 3SG6A 4MZKA 1TNPA 4PHKA 2G9BA 1DTLA 1QX2A 1TNXA 1AUIB 1FBVA 2JTZA 2M3WA 4A4BA 3BUNB 4OVNF 5CSFA 1IJ6A 3GK2A 3KHEA 1C7WA 3PM2A 4OCIA 1SPYA 2KDHA 1B4CA 1IG5A 1NX2A 1DMOA 4PDZA 2WORA 1K94A 3MSEB 3LL8B 1QLKA 3OP0A 2LMUA 3EKHA 1SR6C 2KAVA 3IF7A 4NDCA 2HF5A 2L5XB 2I18A 2ISDA 1NPQA 1GGWA 3A8RA 1JF0A 1S36A 3CGAA 3SG3A 3H4SE 4I5JA 4ETOA 1CM4A 1KSOA 1A75A 1GGZA 2AUCA 2F2PA 2K60A 1SW8A 1CNPA 1BOCA 2LP3A 3VROA 3M0WA 4DIRA 1KWOC 1IWQA 1YUUA 4DUQA 1RWYA 5GQQC 4HREE 5DKRA 2SASA 2LV7A 3D78A 1A75B 3OGNA 2LHIA 1Y1UA 4I5KA 3ICBA 3S0BA 1BG1A 1G33A 2JWWA 5I94A 3PJIA 3BFAA 4NDDA 1K95A 3VB1A 2B1UA 3VRRA 3DZTA 2PMYA 2TN4A 1U5IB 2AMIA 5I2OA 1J1EA 1C3YA 1WLZA 5FI2A 1QVIZ 2K2FA 4PE1A 5IBWA 2BBNA 2H61C 3BOWA 4N1GA 5ER5A 1B8RA 3L4LA 5I2LA 2QDIA 2BCBA 3EG5B 2JQ6A 4PCWA 3TUYC 2PALA 3EVVA 1WDCC 3D0YA 1YVLA 4YBHB 1CFDA 3R1OA 4D1EA 2I94A 3LLEA 1M39A 1DJIA 4F0ZB 1MWNA 2HQ8A 3PALA 2PASA 2JXCA 4NQGA 1Y1AA 2CT9A 3D0YB 2L0PA 1B1GA 1DEKA 1S1EA 4MN0A 1M45A 1WLMA 5HKYA 1H4BA 2WCHA 1KQMC 1YTZC 1NX1A 2K7BA 2LNKA 3CYZA 5B8IB 1R2UA 2M7NA 2OTGC 2LUXA 2M1KB 1HT9A 1CDNA 3PATA 2NCPA 2JNXA 3OBVA 4WRIA 1AHRA 2MRDA 2ZKMX 1CMGA 3D77A 1RTP1 4M2OA 1S26D 5HL1A 1CFFA 1OMDA 1J55A 4INXA 4MLWA 1JF2A 4GBAA 1A4PA 1QVIY 4QJ5B 2KYCA 4DS7A 1AJ5A 2BECA 3S0GA 2FCDA 4PE4A 1DT7B 4OKHA 2GTEA 3I5IB 1YX7A 4GGFA 4I5NB 1XFWO 2MJWB 2M1UA 1N0YA 2WCEA 3SS4A 1OOHA 1DJXA 4M2QA 4C0KA 1AP4A 1DJYA 1UHHA 3WNXB 1PK0D 2PSRA 3BJHA 3K1EA 1W7IB 4INWA 5BPJA 2FJUB 2KOTA 4PE0A 2JOJA 3KF9A 4Q04A 1A2XA 3I5FB 1BR4B 2NCOA 2E6WA 3NSLA 1CLLA 2Q4UA 3OHMB 1HQVA 1LINA 1UP5A 4PHJA 2KHNA 4MZJA 1BU3A 3D76A 3SG4A 2BAPA 2JTTA 1XVJA 3BFBA 3NSOA 4ZCVA 2KAXA 5KTYA 3D75A 3I5HB 1KK8B 3AKBA 5I2QA 2H61A 1OMVA 1F55A 1TNWA 3O4XA 3VGOA 1IGVA 4BY5A 5CSJA 3CR2A 1K90D 5CPVA 1MXLC 4MSPA 3EK7A 4XJKB 4YGCB 3RZSA 4XYNA 5FI6A 4PHMA 5J3XA 1XFYO 3PN7C 1C7VA 1SCVA 3E3RA 3R1PA 1SK6D 3CZ0A 3TDIA 1WY9A 2GGZA 3B6XA 4DCKA 2KI4B 3JVTC 2BE6A 2ZRSA 3KO0A 2JRFA 3O2PA 5AANA 1TUZA 4CFRA 3I5GB 1DJWA 1PSRA 2COLB 1D1OA 2SCPA 3JTDC 3O4YA 2Y5IA 1QS7A 4CIDA 1EXRA 2KLDA 1JFJA 2WC6A 1EG3A 5AXIA 1XFZO 2H8VA 1M63B 2MA2A 3FE9A 4QJ3B 1KQMB 2EC6C 2BL0C 5KU1A 1OOIX 1YURA 3TS5B 1BT6A 3KPXA 5F6TA 2QEHA 3OB1B 1C07A 1CMFA 2IS9A 2L2EA 3ZNIA 1DJGA 3GK1A 4JQ0D 3CWGA 4OZDA 1FI5A 2L51A 4IJ7A 1SY9A 2BKHB 3LCPC 3OB2B 4GAOA 1UHKA 2CXJA 3SG2A 1X02A 3K21A 1LXFC 3SIAA 2H2KA 1DJHA 2K0JA 1NX3A 3NSIA 1H8BA 3CS1A 1B7TZ 1QLSA 2ZRTA 3UNWA 1OOJA 4MEWA 1QX5B 2K7DA 3IQQA 1SKTA 2DOQA 2K61A 4WQ3A 3RM1A 1FF1A 5AFPA 1MXEA 2PRUA 1Z4HA 2LHLA 2PQLA 2Q91A 1TTXA 4GPLB 4ORAB 2GV5A 3CZTX 4ZCUA 2M7LA 1B9AA 1SMGA 4JD9A 4YGAA 3D73A 4MVFA 1NCYA 1NX0A 1PRWA 5D3OA 1N65A 2JPTA 4FQOA 4GNKB 1SCMB 4PHNA 1F70A 4FQTA 1R6PA 3SG5A 1JWDA 1EJ3A 3EKJA 1M31A 2KPHA 3AAKA 2KBIA 3B86A 2MHHA 1TCOB 3BOWB 1ALWA 1UURA 4MZLA 5JJGA 3B7AA 1B8LA 3DF0A 2JZIA 1IRJA 2WC8A 3OX5A 1S6CA 1YUSA 2KGRA 1B7TY 3EK4A 1GQMA 2HPSA 1M46A 1L2OC 3DF0B 5HLVA 4GUKA 1W7JB 2OS8C 1NUBA 1TN4A 1NCXA 2QACA 1S5GZ 2EHBA 2KQ6A 3C1VA
chains in the Genus database with same CATH topology
4C0LA 1K96A 3FIAA 1J1DA 1AK8A 1CTRA 3SIBA 1KFUL 1QJTA 1QV0A 1TOPA 2M0RA 2KAYA 2M8UA 1CDLA 2I7AA 1A29A 1YX8A 4N1FA 2BBMA 1K2HA 1GJYA 3SG7A 4JWQA 1V1FA 1YUTA 1JC2A 1L7ZA 2O5GA 1DJZA 1J7PA 1RROA 1SR6B 1NP8A 1YR5A 2M29A 1DVIA 2KYFA 3TZ1A 1TIZA 2L4HA 1LA3A 1JSAA 5D7FA 4TNCA 3GK4X 1LA0A 1UHNA 4I5LB 1PVAA 1JUOA 2LC5A 1S5GY 2A4JA 2LUCA 2PVBA 1KWOB 3FWBA 3VRQA 4YI8A 1CM1A 2V53A 3EVRA 2JT8A 3RLZA 2CCMA 1IKUA 1KFXL 1KK7Z 2F33A 1FW4A 2D8NA 1KFUS 1OZSA 3CR5X 4YGBB 4CPVA 1LVCD 1MF8B 4MRXA 2L98A 2G2BA 2VRGA 2R2IA 4FTGA 3LK0A 3PM8A 4USLA 1TRFA 1XA5A 3BUWB 2M49B 1ZUZA 4CLNA 3KEVA 1K9KA 1S3PA 4JPZB 3PFVA 1CLBA 1EL4A 3O78A 3WHUB 1VRKA 3PLFB 4IL1A 3DVKA 2NLNA 1SYMA 1RK9A 4R1EA 2BCAA 3TUYB 1ZOTB 1K8UA 1Y6WA 1WDCB 2LCPA 5I8NA 1PSBA 3A4UB 4DRWA 2K2AA 3DVMA 3OX6A 1UWOA 1PALA 2KGBC 2WCBA 5JOLA 1DGUA 1YRTB 2KI6D 1SL9A 1J7RA 5CSNA 4ICBA 1OQPA 1QASA 4C0JA 5KTYA 4P5OE 2K7OA 1NWDA 1Q80A 1XFUO 4AOMA 1KFXS 4HSZA 4PALA 3AAJA 1KQVA 3ZWHA 2MLFC 2F8PA 1WRKA 3HX4A 2F2OA 2OTGB 1KK7Y 5HKWA 1G4YR 1WRLA 4L9MA 3AKAA 1AVSA 1XFXO 2L50A 3CLNA 2BE4A 2LMVA 5CSIA 2AAOA 3BUMB 2CBLA 2LANA 3FWCA 3DD4A 2ZN8A 4U8DA 1XYDA 1XFVO 4YRUA 1BF5A 2ZNEA 1XO5A 1DF0A 3I5IC 2LLTA 4P2YB 1KSMA 4GGNA 4MBEA 2LLUA 3VRPA 1YVHA 3NSKA 1DF0B 4GGFC 2P6BB 5KSZA 3EK8A 2LLSA 1N2DA 1QIWA 3WHTB 1F71A 4ORBB 2LVKA 1QATA 1BMOA 4ORCB 1ZACA 2MLEC 3BXKA 1IQ3A 3I5FC 2HETA 5PALA 2Y4QA 2JULA 1A03A 1TNQA 2LM5A 2EGDA 1PULA 1S6IA 1V1GA 1BJFA 2F3YA 1XK4C 1U5IA 2CNPA 1F4QA 1QX7A 2K8MB 3I5HC 1KK8C 5G08A 1NIWA 2RGIA 2NXQA 3PN7B 1BODA 1EG4A 4WQ2A 1S6JA 2LVJA 1UHJA 1JBAA 1K93D 1CLMA 3JVTB 3TDUA 5FYXA 2KSPA 1QIVA 2LP2A 4PE7A 1TCFA 1EH2A 2WNDA 1J7OA 2MAZA 1CDPA 3D10A 1B47A 5DKNA 1G8IA 2KI4C 2OPOA 2ZN9A 3JTDB 3WXAA 2JU0A 5HKZA 4M2PA 2O60A 1YRUB 3I5GC 4GFTA 4MRYA 1RJVA 3FS7A 4CFQA 1IJ5A 1NCZA 1F54A 3F45A 2LAPA 2EC6B 1B8CA 2BL0B 2KFHA 3BQ3A 2K7CA 1UUSA 1QXPA 1SBJA 4OV2A 1Y0VH 2KFGA 5HLOA 1ALVA 2ZFDA 3TS5C 1ODBA 1SL7A 2QPTA 2Y1MA 4HRHA 1CKKA 1OE9B 2BKIB 4A4CA 1FPWA 3CR4X 1F8HA 4NDBA 5TNCA 1NYAA 4QJ4B 1PVBA 3DVEA 1UHIA 1F4OA 2JC2A 5AERA 1LKJA 3O6BA 4YGDB 2WCFA 1NSHA 2JXLA 3BYAA 1CB1A 2HQWA 3QRXA 1J7QA 4OR9B 3GOFA 4YGEB 1OSAA 2FCEA 2I2RE 2JNFA 2LVIA 2WOSA 1ZMZA 1RECA 3CTNA 3PSRA 2KI6C 3NXAA 2GGMA 5AEQA 2LE9B 3LK1A 1SNLA 5K89A 1XK4A 5D69A 1SCMC 1FI6A 4HRGA 2M9GA 1OZOA 1WRZA 2Y1NA 1DGVA 1SRAA 2M97A 2F3ZA 1OMRA 1QTXA 2KQYA 1JFKA 4XJKA 4AQJA 2CTNA 3TDZA 1BR1B 1BLQA 2FOTA 1L2OB 3IQOA 2KNEA 2OS8B 3HCMA 4YI9A 5DKQA 3VRNA 4UPGA 1CDMA 2BCXA 3SJSA 3BUXB 1Y1XA 2MBXA 2E30A 5HYDA 1QV1A 1MR8A 2JT0A 2KBMA 1MQ1A 1RFJA 2JT3A 1CFPA 3BUOB 2LVVA 4AQIA 1ZFSA 5ER4X 2LMTA 1MUXA 1CFCA 1IQ5A 3DVJA 1AJ4A 3EVUA 1E8AA 1K9PA 1K9UA 2NZ0A 1KCYA 2L4IA 4E68A 2ZNDA 1SL8A 4N5XA 1MHOA 2KFFA 4BY4A 1IH0A 3SG6A 4MZKA 1TNPA 4PHKA 2G9BA 1DTLA 1QX2A 1TNXA 1AUIB 1FBVA 2JTZA 2M3WA 4A4BA 3BUNB 4OVNF 5CSFA 1IJ6A 3GK2A 3KHEA 1C7WA 4OCIA 1B4CA 1SPYA 2KDHA 1DMOA 1IG5A 1NX2A 4PDZA 2WORA 1K94A 3MSEB 3LL8B 1QLKA 3OP0A 2LMUA 3EKHA 1SR6C 2KAVA 3IF7A 4NDCA 2HF5A 2L5XB 2I18A 2ISDA 1NPQA 1GGWA 3A8RA 1JF0A 1S36A 3CGAA 3SG3A 3H4SE 4I5JA 4ETOA 1CM4A 1KSOA 1A75A 1GGZA 2AUCA 2F2PA 1SW8A 1CNPA 1BOCA 2LP3A 3VROA 3M0WA 4DIRA 1KWOC 1IWQA 1YUUA 4DUQA 1RWYA 5GQQC 4HREE 5DKRA 2SASA 2LV7A 1A75B 4I5KA 2LHIA 1Y1UA 3ICBA 1BG1A 1G33A 2JWWA 4NDDA 1K95A 2B1UA 3VRRA 2PMYA 2TN4A 1U5IB 2AMIA 5I2OA 1J1EA 1WLZA 1QVIZ 2K2FA 4PE1A 5IBWA 2BBNA 2H61C 3BOWA 4N1GA 5ER5A 1B8RA 5I2LA 2BCBA 2JQ6A 4PCWA 3TUYC 2PALA 3EVVA 1WDCC 3D0YA 1YVLA 4YBHB 1CFDA 4D1EA 2I94A 3LLEA 1M39A 1DJIA 4F0ZB 1MWNA 2HQ8A 3PALA 2PASA 2JXCA 4NQGA 1Y1AA 2CT9A 3D0YB 2L0PA 1B1GA 1S1EA 4MN0A 1M45A 1WLMA 5HKYA 1H4BA 1KQMC 1YTZC 1NX1A 2K7BA 2LNKA 5B8IB 1R2UA 2M7NA 2OTGC 2LUXA 2M1KB 1HT9A 1CDNA 3PATA 2NCPA 2JNXA 4WRIA 1AHRA 2MRDA 2ZKMX 1CMGA 4M2OA 1RTP1 1CFFA 1S26D 1OMDA 1J55A 4MLWA 1JF2A 4GBAA 1A4PA 1QVIY 4QJ5B 2KYCA 4DS7A 1AJ5A 2BECA 2FCDA 4PE4A 1DT7B 4OKHA 3I5IB 4I5NB 1YX7A 4GGFA 1XFWO 2MJWB 2M1UA 1N0YA 2WCEA 1DJXA 4M2QA 4C0KA 1AP4A 1DJYA 1UHHA 3WNXB 1PK0D 2PSRA 5BPJA 1W7IB 2FJUB 2KOTA 4PE0A 2JOJA 3KF9A 4Q04A 1A2XA 3I5FB 1BR4B 2NCOA 2E6WA 3NSLA 1CLLA 2Q4UA 3OHMB 1HQVA 1LINA 1UP5A 4PHJA 2KHNA 4MZJA 1BU3A 3SG4A 2JTTA 1XVJA 3NSOA 4ZCVA 2KAXA 3I5HB 1KK8B 3AKBA 5I2QA 2H61A 1OMVA 1F55A 1TNWA 3VGOA 1IGVA 4BY5A 5CSJA 3CR2A 1K90D 5CPVA 1MXLC 4MSPA 3EK7A 4XJKB 4YGCB 4XYNA 4PHMA 5J3XA 1XFYO 3PN7C 1C7VA 1SCVA 3E3RA 1SK6D 3TDIA 1WY9A 2GGZA 4DCKA 2KI4B 3JVTC 2BE6A 2ZRSA 3KO0A 2JRFA 3O2PA 5AANA 4CFRA 3I5GB 1DJWA 1PSRA 2COLB 1D1OA 2SCPA 3JTDC 3O4YA 2Y5IA 1QS7A 4CIDA 1EXRA 1JFJA 5AXIA 1EG3A 1XFZO 1M63B 2MA2A 4QJ3B 1KQMB 2EC6C 2BL0C 5KU1A 3TS5B 1YURA 1C07A 1BT6A 3KPXA 5F6TA 3OB1B 1CMFA 2IS9A 2L2EA 3ZNIA 1DJGA 3GK1A 4JQ0D 3CWGA 1FI5A 2L51A 1SY9A 2BKHB 3LCPC 3OB2B 4GAOA 1UHKA 2CXJA 3SG2A 1X02A 3K21A 1LXFC 3SIAA 2H2KA 1DJHA 2K0JA 1NX3A 3NSIA 1H8BA 3CS1A 1B7TZ 1QLSA 2ZRTA 1OOJA 4MEWA 1QX5B 2K7DA 3IQQA 1SKTA 2DOQA 2K61A 4WQ3A 3RM1A 1FF1A 5AFPA 1MXEA 2PRUA 2LHLA 2Q91A 1TTXA 4GPLB 4ORAB 2GV5A 3CZTX 4ZCUA 2M7LA 1B9AA 1SMGA 4YGAA 4MVFA 1NCYA 1NX0A 1PRWA 1N65A 2JPTA 4FQOA 4GNKB 1SCMB 4PHNA 1F70A 1R6PA 3SG5A 1JWDA 1EJ3A 3EKJA 1M31A 3AAKA 2KBIA 2MHHA 1TCOB 3BOWB 1ALWA 1UURA 4MZLA 5JJGA 1B8LA 3DF0A 2JZIA 1IRJA 2WC8A 3OX5A 1S6CA 1YUSA 2KGRA 1B7TY 3EK4A 1GQMA 2HPSA 1M46A 1L2OC 3DF0B 5HLVA 4GUKA 1W7JB 2OS8C 1NUBA 1TN4A 1NCXA 2QACA 1S5GZ 2EHBA 2KQ6A 3C1VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C0L A;  1K96 A;  3FIA A;  1J1D A;  1AK8 A;  1CTR A;  3SIB A;  1KFU L;  1QJT A;  1QV0 A;  1TOP A;  2M0R A;  2KAY A;  2M8U A;  1CDL A;  2I7A A;  1A29 A;  1YX8 A;  4N1F A;  2BBM A;  1K2H A;  1GJY A;  3SG7 A;  4JWQ A;  1V1F A;  1YUT A;  1JC2 A;  1L7Z A;  2O5G A;  1DJZ A;  1J7P A;  1RRO A;  1SR6 B;  1NP8 A;  1YR5 A;  2M29 A;  1DVI A;  2KYF A;  3TZ1 A;  1TIZ A;  2L4H A;  1LA3 A;  1JSA A;  5D7F A;  4TNC A;  3GK4 X;  1LA0 A;  1UHN A;  4I5L B;  1PVA A;  1JUO A;  2LC5 A;  1S5G Y;  2A4J A;  2LUC A;  2PVB A;  1KWO B;  3FWB A;  3VRQ A;  4YI8 A;  1CM1 A;  2V53 A;  3EVR A;  2JT8 A;  3RLZ A;  2CCM A;  1IKU A;  1KFX L;  1KK7 Z;  2F33 A;  1FW4 A;  2D8N A;  1KFU S;  1OZS A;  3CR5 X;  4YGB B;  4CPV A;  1LVC D;  1MF8 B;  4MRX A;  2L98 A;  2G2B A;  2VRG A;  2R2I A;  4FTG A;  3LK0 A;  3PM8 A;  4USL A;  1TRF A;  1XA5 A;  3BUW B;  2M49 B;  1ZUZ A;  4CLN A;  3KEV A;  1K9K A;  1S3P A;  4JPZ B;  3PFV A;  1CLB A;  1EL4 A;  3O78 A;  3WHU B;  1VRK A;  3PLF B;  4IL1 A;  3DVK A;  2NLN A;  1SYM A;  1RK9 A;  4R1E A;  2BCA A;  3TUY B;  1ZOT B;  1K8U A;  1Y6W A;  1WDC B;  2LCP A;  5I8N A;  1PSB A;  3A4U B;  4DRW A;  2K2A A;  3DVM A;  3OX6 A;  1UWO A;  1PAL A;  2KGB C;  2WCB A;  5JOL A;  1DGU A;  1YRT B;  2KI6 D;  1SL9 A;  1J7R A;  5CSN A;  4ICB A;  1OQP A;  1QAS A;  4C0J A;  5KTY A;  4P5O E;  2K7O A;  1NWD A;  1Q80 A;  1XFU O;  4AOM A;  1KFX S;  4HSZ A;  4PAL A;  3AAJ A;  1KQV A;  3ZWH A;  2MLF C;  2F8P A;  1WRK A;  3HX4 A;  2F2O A;  2OTG B;  1KK7 Y;  5HKW A;  1G4Y R;  1WRL A;  4L9M A;  3AKA A;  1AVS A;  1XFX O;  2L50 A;  3CLN A;  2BE4 A;  2LMV A;  5CSI A;  2AAO A;  3BUM B;  2CBL A;  2LAN A;  3FWC A;  3DD4 A;  2ZN8 A;  4U8D A;  1XYD A;  1XFV O;  4YRU A;  1BF5 A;  2ZNE A;  1XO5 A;  1DF0 A;  3I5I C;  2LLT A;  4P2Y B;  1KSM A;  4GGN A;  4MBE A;  2LLU A;  3VRP A;  1YVH A;  3NSK A;  1DF0 B;  4GGF C;  2P6B B;  5KSZ A;  3EK8 A;  2LLS A;  1N2D A;  1QIW A;  3WHT B;  1F71 A;  4ORB B;  2LVK A;  1QAT A;  1BMO A;  4ORC B;  1ZAC A;  2MLE C;  3BXK A;  1IQ3 A;  3I5F C;  2HET A;  5PAL A;  2Y4Q A;  2JUL A;  1A03 A;  1TNQ A;  2LM5 A;  2EGD A;  1PUL A;  1S6I A;  1V1G A;  1BJF A;  2F3Y A;  1XK4 C;  1U5I A;  2CNP A;  1F4Q A;  1QX7 A;  2K8M B;  3I5H C;  1KK8 C;  5G08 A;  1NIW A;  2RGI A;  2NXQ A;  3PN7 B;  1BOD A;  1EG4 A;  4WQ2 A;  1S6J A;  2LVJ A;  1UHJ A;  1JBA A;  1K93 D;  1CLM A;  3JVT B;  3TDU A;  5FYX A;  2KSP A;  1QIV A;  2LP2 A;  4PE7 A;  1TCF A;  1EH2 A;  2WND A;  1J7O A;  2MAZ A;  1CDP A;  3D10 A;  1B47 A;  5DKN A;  1G8I A;  2KI4 C;  2OPO A;  2ZN9 A;  3JTD B;  3WXA A;  2JU0 A;  5HKZ A;  4M2P A;  2O60 A;  1YRU B;  3I5G C;  4GFT A;  4MRY A;  1RJV A;  3FS7 A;  4CFQ A;  1IJ5 A;  1NCZ A;  1F54 A;  3F45 A;  2LAP A;  2EC6 B;  1B8C A;  2BL0 B;  2KFH A;  3BQ3 A;  2K7C A;  1UUS A;  1QXP A;  1SBJ A;  4OV2 A;  1Y0V H;  2KFG A;  5HLO A;  1ALV A;  2ZFD A;  3TS5 C;  1ODB A;  1SL7 A;  2QPT A;  2Y1M A;  4HRH A;  1CKK A;  1OE9 B;  2BKI B;  4A4C A;  1FPW A;  3CR4 X;  1F8H A;  4NDB A;  5TNC A;  1NYA A;  4QJ4 B;  1PVB A;  3DVE A;  1UHI A;  1F4O A;  2JC2 A;  5AER A;  1LKJ A;  3O6B A;  4YGD B;  2WCF A;  1NSH A;  2JXL A;  3BYA A;  1CB1 A;  2HQW A;  3QRX A;  1J7Q A;  4OR9 B;  3GOF A;  4YGE B;  1OSA A;  2FCE A;  2I2R E;  2JNF A;  2LVI A;  2WOS A;  1ZMZ A;  1REC A;  3CTN A;  3PSR A;  2KI6 C;  3NXA A;  2GGM A;  5AEQ A;  2LE9 B;  3LK1 A;  1SNL A;  5K89 A;  1XK4 A;  5D69 A;  1SCM C;  1FI6 A;  4HRG A;  2M9G A;  1OZO A;  1WRZ A;  2Y1N A;  1DGV A;  1SRA A;  2M97 A;  2F3Z A;  1OMR A;  1QTX A;  2KQY A;  1JFK A;  4XJK A;  4AQJ A;  2CTN A;  3TDZ A;  1BR1 B;  1BLQ A;  2FOT A;  1L2O B;  3IQO A;  2KNE A;  2OS8 B;  3HCM A;  4YI9 A;  5DKQ A;  3VRN A;  4UPG A;  1CDM A;  2BCX A;  3SJS A;  3BUX B;  1Y1X A;  2MBX A;  2E30 A;  5HYD A;  1QV1 A;  1MR8 A;  2JT0 A;  2KBM A;  1MQ1 A;  1RFJ A;  2JT3 A;  1CFP A;  3BUO B;  2LVV A;  4AQI A;  1ZFS A;  5ER4 X;  2LMT A;  1MUX A;  1CFC A;  1IQ5 A;  3DVJ A;  1AJ4 A;  3EVU A;  1E8A A;  1K9P A;  1K9U A;  2NZ0 A;  1KCY A;  2L4I A;  4E68 A;  2ZND A;  1SL8 A;  4N5X A;  1MHO A;  2KFF A;  4BY4 A;  1IH0 A;  3SG6 A;  4MZK A;  1TNP A;  4PHK A;  2G9B A;  1DTL A;  1QX2 A;  1TNX A;  1AUI B;  1FBV A;  2JTZ A;  2M3W A;  4A4B A;  3BUN B;  4OVN F;  5CSF A;  1IJ6 A;  3GK2 A;  3KHE A;  1C7W A;  4OCI A;  1B4C A;  1SPY A;  2KDH A;  1DMO A;  1IG5 A;  1NX2 A;  4PDZ A;  2WOR A;  1K94 A;  3MSE B;  3LL8 B;  1QLK A;  3OP0 A;  2LMU A;  3EKH A;  1SR6 C;  2KAV A;  3IF7 A;  4NDC A;  2HF5 A;  2L5X B;  2I18 A;  2ISD A;  1NPQ A;  1GGW A;  3A8R A;  1JF0 A;  1S36 A;  3CGA A;  3SG3 A;  3H4S E;  4I5J A;  4ETO A;  1CM4 A;  1KSO A;  1A75 A;  1GGZ A;  2AUC A;  2F2P A;  1SW8 A;  1CNP A;  1BOC A;  2LP3 A;  3VRO A;  3M0W A;  4DIR A;  1KWO C;  1IWQ A;  1YUU A;  4DUQ A;  1RWY A;  5GQQ C;  4HRE E;  5DKR A;  2SAS A;  2LV7 A;  1A75 B;  4I5K A;  2LHI A;  1Y1U A;  3ICB A;  1BG1 A;  1G33 A;  2JWW A;  4NDD A;  1K95 A;  2B1U A;  3VRR A;  2PMY A;  2TN4 A;  1U5I B;  2AMI A;  5I2O A;  1J1E A;  1WLZ A;  1QVI Z;  2K2F A;  4PE1 A;  5IBW A;  2BBN A;  2H61 C;  3BOW A;  4N1G A;  5ER5 A;  1B8R A;  5I2L A;  2BCB A;  2JQ6 A;  4PCW A;  3TUY C;  2PAL A;  3EVV A;  1WDC C;  3D0Y A;  1YVL A;  4YBH B;  1CFD A;  4D1E A;  2I94 A;  3LLE A;  1M39 A;  1DJI A;  4F0Z B;  1MWN A;  2HQ8 A;  3PAL A;  2PAS A;  2JXC A;  4NQG A;  1Y1A A;  2CT9 A;  3D0Y B;  2L0P A;  1B1G A;  1S1E A;  4MN0 A;  1M45 A;  1WLM A;  5HKY A;  1H4B A;  1KQM C;  1YTZ C;  1NX1 A;  2K7B A;  2LNK A;  5B8I B;  1R2U A;  2M7N A;  2OTG C;  2LUX A;  2M1K B;  1HT9 A;  1CDN A;  3PAT A;  2NCP A;  2JNX A;  4WRI A;  1AHR A;  2MRD A;  2ZKM X;  1CMG A;  4M2O A;  1RTP 1;  1CFF A;  1S26 D;  1OMD A;  1J55 A;  4MLW A;  1JF2 A;  4GBA A;  1A4P A;  1QVI Y;  4QJ5 B;  2KYC A;  4DS7 A;  1AJ5 A;  2BEC A;  2FCD A;  4PE4 A;  1DT7 B;  4OKH A;  3I5I B;  4I5N B;  1YX7 A;  4GGF A;  1XFW O;  2MJW B;  2M1U A;  1N0Y A;  2WCE A;  1DJX A;  4M2Q A;  4C0K A;  1AP4 A;  1DJY A;  1UHH A;  3WNX B;  1PK0 D;  2PSR A;  5BPJ A;  1W7I B;  2FJU B;  2KOT A;  4PE0 A;  2JOJ A;  3KF9 A;  4Q04 A;  1A2X A;  3I5F B;  1BR4 B;  2NCO A;  2E6W A;  3NSL A;  1CLL A;  2Q4U A;  3OHM B;  1HQV A;  1LIN A;  1UP5 A;  4PHJ A;  2KHN A;  4MZJ A;  1BU3 A;  3SG4 A;  2JTT A;  1XVJ A;  3NSO A;  4ZCV A;  2KAX A;  3I5H B;  1KK8 B;  3AKB A;  5I2Q A;  2H61 A;  1OMV A;  1F55 A;  1TNW A;  3VGO A;  1IGV A;  4BY5 A;  5CSJ A;  3CR2 A;  1K90 D;  5CPV A;  1MXL C;  4MSP A;  3EK7 A;  4XJK B;  4YGC B;  4XYN A;  4PHM A;  5J3X A;  1XFY O;  3PN7 C;  1C7V A;  1SCV A;  3E3R A;  1SK6 D;  3TDI A;  1WY9 A;  2GGZ A;  4DCK A;  2KI4 B;  3JVT C;  2BE6 A;  2ZRS A;  3KO0 A;  2JRF A;  3O2P A;  5AAN A;  4CFR A;  3I5G B;  1DJW A;  1PSR A;  2COL B;  1D1O A;  2SCP A;  3JTD C;  3O4Y A;  2Y5I A;  1QS7 A;  4CID A;  1EXR A;  1JFJ A;  5AXI A;  1EG3 A;  1XFZ O;  1M63 B;  2MA2 A;  4QJ3 B;  1KQM B;  2EC6 C;  2BL0 C;  5KU1 A;  3TS5 B;  1YUR A;  1C07 A;  1BT6 A;  3KPX A;  5F6T A;  3OB1 B;  1CMF A;  2IS9 A;  2L2E A;  3ZNI A;  1DJG A;  3GK1 A;  4JQ0 D;  3CWG A;  1FI5 A;  2L51 A;  1SY9 A;  2BKH B;  3LCP C;  3OB2 B;  4GAO A;  1UHK A;  2CXJ A;  3SG2 A;  1X02 A;  3K21 A;  1LXF C;  3SIA A;  2H2K A;  1DJH A;  2K0J A;  1NX3 A;  3NSI A;  1H8B A;  3CS1 A;  1B7T Z;  1QLS A;  2ZRT A;  1OOJ A;  4MEW A;  1QX5 B;  2K7D A;  3IQQ A;  1SKT A;  2DOQ A;  2K61 A;  4WQ3 A;  3RM1 A;  1FF1 A;  5AFP A;  1MXE A;  2PRU A;  2LHL A;  2Q91 A;  1TTX A;  4GPL B;  4ORA B;  2GV5 A;  3CZT X;  4ZCU A;  2M7L A;  1B9A A;  1SMG A;  4YGA A;  4MVF A;  1NCY A;  1NX0 A;  1PRW A;  1N65 A;  2JPT A;  4FQO A;  4GNK B;  1SCM B;  4PHN A;  1F70 A;  1R6P A;  3SG5 A;  1JWD A;  1EJ3 A;  3EKJ A;  1M31 A;  3AAK A;  2KBI A;  2MHH A;  1TCO B;  3BOW B;  1ALW A;  1UUR A;  4MZL A;  5JJG A;  1B8L A;  3DF0 A;  2JZI A;  1IRJ A;  2WC8 A;  3OX5 A;  1S6C A;  1YUS A;  2KGR A;  1B7T Y;  3EK4 A;  1GQM A;  2HPS A;  1M46 A;  1L2O C;  3DF0 B;  5HLV A;  4GUK A;  1W7J B;  2OS8 C;  1NUB A;  1TN4 A;  1NCX A;  2QAC A;  1S5G Z;  2EHB A;  2KQ6 A;  3C1V A; 
#chains in the Genus database with same CATH topology
 1OOF A;  4C0L A;  1ORG A;  1K96 A;  3FIA A;  2WC5 A;  1J1D A;  1AK8 A;  1CTR A;  3SIB A;  1KFU L;  1QJT A;  1TWO A;  1QV0 A;  1TOP A;  2M0R A;  2QEO A;  2KAY A;  2M8U A;  1CDL A;  2I7A A;  1A29 A;  2L2C A;  1YX8 A;  4N1F A;  2BBM A;  1K2H A;  1GJY A;  3SG7 A;  4JWQ A;  1V1F A;  1YUT A;  1JC2 A;  1GM0 A;  1L7Z A;  2O5G A;  1DJZ A;  1J7P A;  1RRO A;  1SR6 B;  2KLE A;  1NP8 A;  1YR5 A;  2M29 A;  1DVI A;  2KYF A;  3TZ1 A;  1TIZ A;  3D74 A;  2L4H A;  1C3Z A;  1LA3 A;  1JSA A;  3Q8I A;  5D7F A;  4TNC A;  3GK4 X;  1LA0 A;  1UHN A;  1IIO A;  4I5L B;  3L4A A;  1PVA A;  1JUO A;  2LC5 A;  1QWV A;  1S5G Y;  2A4J A;  2LUC A;  1KWO B;  2PVB A;  3FWB A;  3VRQ A;  4YI8 A;  1CM1 A;  2V53 A;  3EVR A;  2JT8 A;  3RLZ A;  2CCM A;  3R1V A;  1IKU A;  1KFX L;  1KK7 Z;  2F33 A;  1FW4 A;  2D8N A;  1KFU S;  1OZS A;  3CAB A;  3CR5 X;  4YGB B;  4CPV A;  1LVC D;  1MF8 B;  4MRX A;  2L98 A;  2G2B A;  2VRG A;  2R2I A;  4FTG A;  3LK0 A;  3PM8 A;  4USL A;  1TRF A;  1XA5 A;  3BUW B;  2M49 B;  1ZUZ A;  4CLN A;  3IVT A;  1K9K A;  3KEV A;  3S0F A;  1S3P A;  4JPZ B;  3PFV A;  1CLB A;  1EL4 A;  3O78 A;  3WHU B;  1VRK A;  3PLF B;  4IL1 A;  3DVK A;  2NLN A;  1SYM A;  1RK9 A;  4R1E A;  2BCA A;  3TUY B;  1ZOT B;  1K8U A;  1Y6W A;  1WDC B;  2LCP A;  5I8N A;  1PSB A;  3B87 A;  3A4U B;  4DRW A;  1TUJ A;  2K2A A;  3DVM A;  3OX6 A;  1UWO A;  1PAL A;  2KGB C;  2WCB A;  5JOL A;  1DGU A;  1YRT B;  2KI6 D;  2WCL A;  1SL9 A;  1J7R A;  5CSN A;  4ICB A;  1OQP A;  1DQE A;  1QAS A;  1T14 A;  4C0J A;  4P5O E;  2K7O A;  1NWD A;  1Q80 A;  1XFU O;  4AOM A;  1KFX S;  4HSZ A;  4PAL A;  3AAJ A;  1KQV A;  3ZWH A;  2MLF C;  2F8P A;  1WRK A;  3HX4 A;  2F2O A;  2OTG B;  1KK7 Y;  5HKW A;  2FJY A;  1G4Y R;  1WRL A;  4L9M A;  3AKA A;  3SS3 A;  1AVS A;  3S0D A;  1XFX O;  2L50 A;  3CLN A;  2BE4 A;  2LMV A;  5CSI A;  2AAO A;  3BUM B;  2CBL A;  2YGU A;  1Z2C B;  2PYQ A;  1OW4 A;  2ERB A;  2LAN A;  3FWC A;  3UO9 A;  3DD4 A;  2ZN8 A;  5EL2 A;  4U8D A;  1XYD A;  1XFV O;  4YRU A;  1BF5 A;  2ZNE A;  1XO5 A;  1DF0 A;  3I5I C;  3FE8 A;  2LLT A;  4P2Y B;  1KSM A;  4GGN A;  4MBE A;  2LLU A;  1LS8 A;  3VRP A;  1YVH A;  3NSK A;  2P70 A;  1DF0 B;  4GGF C;  4JKT A;  2P6B B;  5KSZ A;  3EK8 A;  2LLS A;  1N2D A;  1QIW A;  3WHT B;  1F71 A;  4ORB B;  2LVK A;  3DY9 A;  1QAT A;  1BMO A;  4ORC B;  3S0E A;  1ZAC A;  2MLE C;  3L47 A;  3BXK A;  1IQ3 A;  3I5F C;  2HET A;  5PAL A;  2Y4Q A;  2JUL A;  1A03 A;  1TNQ A;  2LM5 A;  2EGD A;  1PUL A;  1DC1 A;  1S6I A;  1V1G A;  3DXL A;  1BJF A;  2F3Y A;  1XK4 C;  1U5I A;  2CNP A;  1F4Q A;  1QX7 A;  3R72 A;  3B88 A;  2K8M B;  3I5H C;  1KK8 C;  5G08 A;  1NIW A;  2RGI A;  2NXQ A;  3PN7 B;  1BOD A;  1EG4 A;  4WQ2 A;  1S6J A;  2LVJ A;  1UHJ A;  3CZ1 A;  1JBA A;  1K93 D;  1CLM A;  3JVT B;  3TDU A;  5FYX A;  2KSP A;  1QIV A;  2LP2 A;  4PE7 A;  1TCF A;  1EH2 A;  2WND A;  1J7O A;  3CDN A;  2MAZ A;  1CDP A;  3D10 A;  1B47 A;  5DKN A;  1G8I A;  2KI4 C;  2OPO A;  2ZN9 A;  3JTD B;  3WXA A;  2JU0 A;  5HKZ A;  4M2P A;  2O60 A;  1YRU B;  2WCK A;  3I5G C;  4GFT A;  1RJV A;  4MRY A;  3FS7 A;  4CFQ A;  1IJ5 A;  1NCZ A;  1F54 A;  3F45 A;  2LAP A;  2EC6 B;  1B8C A;  2BL0 B;  3NHI A;  2KFH A;  3BQ3 A;  2K7C A;  1UUS A;  4PT1 A;  1QXP A;  1SBJ A;  1SSE B;  3QME A;  4OV2 A;  1Y0V H;  2KFG A;  5HLO A;  1ALV A;  2ZFD A;  3TS5 C;  1ODB A;  1SL7 A;  2QPT A;  2Y1M A;  4HRH A;  3S0A A;  1OE9 B;  1CKK A;  2BKI B;  4A4C A;  1FPW A;  3CR4 X;  1F8H A;  4NDB A;  5TNC A;  1NYA A;  4QJ4 B;  1PVB A;  3DVE A;  1UHI A;  1F4O A;  2QEB A;  2JC2 A;  5AER A;  1LKJ A;  4F7F A;  3O6B A;  4YGD B;  2WCF A;  3NGV A;  1NSH A;  2JXL A;  3BYA A;  1P28 A;  1CB1 A;  2HQW A;  3QRX A;  1J7Q A;  4OR9 B;  3GOF A;  4YGE B;  5DIC A;  1OSA A;  2FCE A;  2QEV A;  2I2R E;  2JNF A;  2LVI A;  2WCJ A;  2WOS A;  1ZMZ A;  1REC A;  5FI7 A;  3CTN A;  3PSR A;  2KI6 C;  2WCM A;  3NXA A;  2GGM A;  5AEQ A;  2LE9 B;  3CZ2 A;  3LK1 A;  1SNL A;  5K89 A;  1XK4 A;  5D69 A;  3N7H A;  1SCM C;  1FI6 A;  1W9Z A;  4HRG A;  2M9G A;  1OZO A;  1WRZ A;  2Y1N A;  1DGV A;  1SRA A;  2M97 A;  2F3Z A;  4KYN A;  1OMR A;  1QTX A;  2KQY A;  1JFK A;  4XJK A;  4AQJ A;  2CTN A;  3TDZ A;  1BR1 B;  1BLQ A;  2FOT A;  3V2L A;  1L2O B;  1DEL A;  3IQO A;  2KNE A;  2OS8 B;  2P71 A;  3HCM A;  4YI9 A;  5DKQ A;  3SS5 A;  3VRN A;  4UPG A;  1CDM A;  2BCX A;  3SJS A;  3BUX B;  1Y1X A;  3FE6 A;  2E30 A;  2MBX A;  5HYD A;  1QV1 A;  1MR8 A;  2JT0 A;  2KBM A;  1MQ1 A;  1OOG A;  1RFJ A;  2BNX A;  2JT3 A;  1CFP A;  2JPO A;  3BUO B;  2LVV A;  4AQI A;  1ZFS A;  5ER4 X;  2LMT A;  1MUX A;  3DYE A;  1CFC A;  1IQ5 A;  3DVJ A;  1AJ4 A;  3EVU A;  1E8A A;  1K9P A;  1K9U A;  2NZ0 A;  1KCY A;  3NHT A;  2L4I A;  4E68 A;  1XFR A;  2ZND A;  1SL8 A;  3BFH A;  2L5Y A;  4N5X A;  1MHO A;  2KFF A;  4BY4 A;  1IH0 A;  3SG6 A;  4MZK A;  1TNP A;  4PHK A;  2G9B A;  1DTL A;  1QX2 A;  1TNX A;  1AUI B;  1FBV A;  2JTZ A;  2M3W A;  4A4B A;  3BUN B;  4OVN F;  5CSF A;  1IJ6 A;  3GK2 A;  3KHE A;  1C7W A;  3PM2 A;  4OCI A;  1SPY A;  2KDH A;  1B4C A;  1IG5 A;  1NX2 A;  1DMO A;  4PDZ A;  2WOR A;  1K94 A;  3MSE B;  3LL8 B;  1QLK A;  3OP0 A;  2LMU A;  3EKH A;  1SR6 C;  2KAV A;  3IF7 A;  4NDC A;  2HF5 A;  2L5X B;  2I18 A;  2ISD A;  1NPQ A;  1GGW A;  3A8R A;  1JF0 A;  1S36 A;  3CGA A;  3SG3 A;  3H4S E;  4I5J A;  4ETO A;  1CM4 A;  1KSO A;  1A75 A;  1GGZ A;  2AUC A;  2F2P A;  2K60 A;  1SW8 A;  1CNP A;  1BOC A;  2LP3 A;  3VRO A;  3M0W A;  4DIR A;  1KWO C;  1IWQ A;  1YUU A;  4DUQ A;  1RWY A;  5GQQ C;  4HRE E;  5DKR A;  2SAS A;  2LV7 A;  3D78 A;  1A75 B;  3OGN A;  2LHI A;  1Y1U A;  4I5K A;  3ICB A;  3S0B A;  1BG1 A;  1G33 A;  2JWW A;  5I94 A;  3PJI A;  3BFA A;  4NDD A;  1K95 A;  3VB1 A;  2B1U A;  3VRR A;  3DZT A;  2PMY A;  2TN4 A;  1U5I B;  2AMI A;  5I2O A;  1J1E A;  1C3Y A;  1WLZ A;  5FI2 A;  1QVI Z;  2K2F A;  4PE1 A;  5IBW A;  2BBN A;  2H61 C;  3BOW A;  4N1G A;  5ER5 A;  1B8R A;  3L4L A;  5I2L A;  2QDI A;  2BCB A;  3EG5 B;  2JQ6 A;  4PCW A;  3TUY C;  2PAL A;  3EVV A;  1WDC C;  3D0Y A;  1YVL A;  4YBH B;  1CFD A;  3R1O A;  4D1E A;  2I94 A;  3LLE A;  1M39 A;  1DJI A;  4F0Z B;  1MWN A;  2HQ8 A;  3PAL A;  2PAS A;  2JXC A;  4NQG A;  1Y1A A;  2CT9 A;  3D0Y B;  2L0P A;  1B1G A;  1DEK A;  1S1E A;  4MN0 A;  1M45 A;  1WLM A;  5HKY A;  1H4B A;  2WCH A;  1KQM C;  1YTZ C;  1NX1 A;  2K7B A;  2LNK A;  3CYZ A;  5B8I B;  1R2U A;  2M7N A;  2OTG C;  2LUX A;  2M1K B;  1HT9 A;  1CDN A;  3PAT A;  2NCP A;  2JNX A;  3OBV A;  4WRI A;  1AHR A;  2MRD A;  2ZKM X;  1CMG A;  3D77 A;  1RTP 1;  4M2O A;  1S26 D;  5HL1 A;  1CFF A;  1OMD A;  1J55 A;  4INX A;  4MLW A;  1JF2 A;  4GBA A;  1A4P A;  1QVI Y;  4QJ5 B;  2KYC A;  4DS7 A;  1AJ5 A;  2BEC A;  3S0G A;  2FCD A;  4PE4 A;  1DT7 B;  4OKH A;  2GTE A;  3I5I B;  1YX7 A;  4GGF A;  4I5N B;  1XFW O;  2MJW B;  2M1U A;  1N0Y A;  2WCE A;  3SS4 A;  1OOH A;  1DJX A;  4M2Q A;  4C0K A;  1AP4 A;  1DJY A;  1UHH A;  3WNX B;  1PK0 D;  2PSR A;  3BJH A;  3K1E A;  1W7I B;  4INW A;  5BPJ A;  2FJU B;  2KOT A;  4PE0 A;  2JOJ A;  3KF9 A;  4Q04 A;  1A2X A;  3I5F B;  1BR4 B;  2NCO A;  2E6W A;  3NSL A;  1CLL A;  2Q4U A;  3OHM B;  1HQV A;  1LIN A;  1UP5 A;  4PHJ A;  2KHN A;  4MZJ A;  1BU3 A;  3D76 A;  3SG4 A;  2BAP A;  2JTT A;  1XVJ A;  3BFB A;  3NSO A;  4ZCV A;  2KAX A;  5KTY A;  3D75 A;  3I5H B;  1KK8 B;  3AKB A;  5I2Q A;  2H61 A;  1OMV A;  1F55 A;  1TNW A;  3O4X A;  3VGO A;  1IGV A;  4BY5 A;  5CSJ A;  3CR2 A;  1K90 D;  5CPV A;  1MXL C;  4MSP A;  3EK7 A;  4XJK B;  4YGC B;  3RZS A;  4XYN A;  5FI6 A;  4PHM A;  5J3X A;  1XFY O;  3PN7 C;  1C7V A;  1SCV A;  3E3R A;  3R1P A;  1SK6 D;  3CZ0 A;  3TDI A;  1WY9 A;  2GGZ A;  3B6X A;  4DCK A;  2KI4 B;  3JVT C;  2BE6 A;  2ZRS A;  3KO0 A;  2JRF A;  3O2P A;  5AAN A;  1TUZ A;  4CFR A;  3I5G B;  1DJW A;  1PSR A;  2COL B;  1D1O A;  2SCP A;  3JTD C;  3O4Y A;  2Y5I A;  1QS7 A;  4CID A;  1EXR A;  2KLD A;  1JFJ A;  2WC6 A;  1EG3 A;  5AXI A;  1XFZ O;  2H8V A;  1M63 B;  2MA2 A;  3FE9 A;  4QJ3 B;  1KQM B;  2EC6 C;  2BL0 C;  5KU1 A;  1OOI X;  1YUR A;  3TS5 B;  1BT6 A;  3KPX A;  5F6T A;  2QEH A;  3OB1 B;  1C07 A;  1CMF A;  2IS9 A;  2L2E A;  3ZNI A;  1DJG A;  3GK1 A;  4JQ0 D;  3CWG A;  4OZD A;  1FI5 A;  2L51 A;  4IJ7 A;  1SY9 A;  2BKH B;  3LCP C;  3OB2 B;  4GAO A;  1UHK A;  2CXJ A;  3SG2 A;  1X02 A;  3K21 A;  1LXF C;  3SIA A;  2H2K A;  1DJH A;  2K0J A;  1NX3 A;  3NSI A;  1H8B A;  3CS1 A;  1B7T Z;  1QLS A;  2ZRT A;  3UNW A;  1OOJ A;  4MEW A;  1QX5 B;  2K7D A;  3IQQ A;  1SKT A;  2DOQ A;  2K61 A;  4WQ3 A;  3RM1 A;  1FF1 A;  5AFP A;  1MXE A;  2PRU A;  1Z4H A;  2LHL A;  2PQL A;  2Q91 A;  1TTX A;  4GPL B;  4ORA B;  2GV5 A;  3CZT X;  4ZCU A;  2M7L A;  1B9A A;  1SMG A;  4JD9 A;  4YGA A;  3D73 A;  4MVF A;  1NCY A;  1NX0 A;  1PRW A;  5D3O A;  1N65 A;  2JPT A;  4FQO A;  4GNK B;  1SCM B;  4PHN A;  1F70 A;  4FQT A;  1R6P A;  3SG5 A;  1JWD A;  1EJ3 A;  3EKJ A;  1M31 A;  2KPH A;  3AAK A;  2KBI A;  3B86 A;  2MHH A;  1TCO B;  3BOW B;  1ALW A;  1UUR A;  4MZL A;  5JJG A;  3B7A A;  1B8L A;  3DF0 A;  2JZI A;  1IRJ A;  2WC8 A;  3OX5 A;  1S6C A;  1YUS A;  2KGR A;  1B7T Y;  3EK4 A;  1GQM A;  2HPS A;  1M46 A;  1L2O C;  3DF0 B;  5HLV A;  4GUK A;  1W7J B;  2OS8 C;  1NUB A;  1TN4 A;  1NCX A;  2QAC A;  1S5G Z;  2EHB A;  2KQ6 A;  3C1V A; 
#chains in the Genus database with same CATH homology
 4C0L A;  1K96 A;  3FIA A;  1J1D A;  1AK8 A;  1CTR A;  3SIB A;  1KFU L;  1QJT A;  1QV0 A;  1TOP A;  2M0R A;  2KAY A;  2M8U A;  1CDL A;  2I7A A;  1A29 A;  1YX8 A;  4N1F A;  2BBM A;  1K2H A;  1GJY A;  3SG7 A;  4JWQ A;  1V1F A;  1YUT A;  1JC2 A;  1L7Z A;  2O5G A;  1DJZ A;  1J7P A;  1RRO A;  1SR6 B;  1NP8 A;  1YR5 A;  2M29 A;  1DVI A;  2KYF A;  3TZ1 A;  1TIZ A;  2L4H A;  1LA3 A;  1JSA A;  5D7F A;  4TNC A;  3GK4 X;  1LA0 A;  1UHN A;  4I5L B;  1PVA A;  1JUO A;  2LC5 A;  1S5G Y;  2A4J A;  2LUC A;  2PVB A;  1KWO B;  3FWB A;  3VRQ A;  4YI8 A;  1CM1 A;  2V53 A;  3EVR A;  2JT8 A;  3RLZ A;  2CCM A;  1IKU A;  1KFX L;  1KK7 Z;  2F33 A;  1FW4 A;  2D8N A;  1KFU S;  1OZS A;  3CR5 X;  4YGB B;  4CPV A;  1LVC D;  1MF8 B;  4MRX A;  2L98 A;  2G2B A;  2VRG A;  2R2I A;  4FTG A;  3LK0 A;  3PM8 A;  4USL A;  1TRF A;  1XA5 A;  3BUW B;  2M49 B;  1ZUZ A;  4CLN A;  3KEV A;  1K9K A;  1S3P A;  4JPZ B;  3PFV A;  1CLB A;  1EL4 A;  3O78 A;  3WHU B;  1VRK A;  3PLF B;  4IL1 A;  3DVK A;  2NLN A;  1SYM A;  1RK9 A;  4R1E A;  2BCA A;  3TUY B;  1ZOT B;  1K8U A;  1Y6W A;  1WDC B;  2LCP A;  5I8N A;  1PSB A;  3A4U B;  4DRW A;  2K2A A;  3DVM A;  3OX6 A;  1UWO A;  1PAL A;  2KGB C;  2WCB A;  5JOL A;  1DGU A;  1YRT B;  2KI6 D;  1SL9 A;  1J7R A;  5CSN A;  4ICB A;  1OQP A;  1QAS A;  4C0J A;  5KTY A;  4P5O E;  2K7O A;  1NWD A;  1Q80 A;  1XFU O;  4AOM A;  1KFX S;  4HSZ A;  4PAL A;  3AAJ A;  1KQV A;  3ZWH A;  2MLF C;  2F8P A;  1WRK A;  3HX4 A;  2F2O A;  2OTG B;  1KK7 Y;  5HKW A;  1G4Y R;  1WRL A;  4L9M A;  3AKA A;  1AVS A;  1XFX O;  2L50 A;  3CLN A;  2BE4 A;  2LMV A;  5CSI A;  2AAO A;  3BUM B;  2CBL A;  2LAN A;  3FWC A;  3DD4 A;  2ZN8 A;  4U8D A;  1XYD A;  1XFV O;  4YRU A;  1BF5 A;  2ZNE A;  1XO5 A;  1DF0 A;  3I5I C;  2LLT A;  4P2Y B;  1KSM A;  4GGN A;  4MBE A;  2LLU A;  3VRP A;  1YVH A;  3NSK A;  1DF0 B;  4GGF C;  2P6B B;  5KSZ A;  3EK8 A;  2LLS A;  1N2D A;  1QIW A;  3WHT B;  1F71 A;  4ORB B;  2LVK A;  1QAT A;  1BMO A;  4ORC B;  1ZAC A;  2MLE C;  3BXK A;  1IQ3 A;  3I5F C;  2HET A;  5PAL A;  2Y4Q A;  2JUL A;  1A03 A;  1TNQ A;  2LM5 A;  2EGD A;  1PUL A;  1S6I A;  1V1G A;  1BJF A;  2F3Y A;  1XK4 C;  1U5I A;  2CNP A;  1F4Q A;  1QX7 A;  2K8M B;  3I5H C;  1KK8 C;  5G08 A;  1NIW A;  2RGI A;  2NXQ A;  3PN7 B;  1BOD A;  1EG4 A;  4WQ2 A;  1S6J A;  2LVJ A;  1UHJ A;  1JBA A;  1K93 D;  1CLM A;  3JVT B;  3TDU A;  5FYX A;  2KSP A;  1QIV A;  2LP2 A;  4PE7 A;  1TCF A;  1EH2 A;  2WND A;  1J7O A;  2MAZ A;  1CDP A;  3D10 A;  1B47 A;  5DKN A;  1G8I A;  2KI4 C;  2OPO A;  2ZN9 A;  3JTD B;  3WXA A;  2JU0 A;  5HKZ A;  4M2P A;  2O60 A;  1YRU B;  3I5G C;  4GFT A;  4MRY A;  1RJV A;  3FS7 A;  4CFQ A;  1IJ5 A;  1NCZ A;  1F54 A;  3F45 A;  2LAP A;  2EC6 B;  1B8C A;  2BL0 B;  2KFH A;  3BQ3 A;  2K7C A;  1UUS A;  1QXP A;  1SBJ A;  4OV2 A;  1Y0V H;  2KFG A;  5HLO A;  1ALV A;  2ZFD A;  3TS5 C;  1ODB A;  1SL7 A;  2QPT A;  2Y1M A;  4HRH A;  1CKK A;  1OE9 B;  2BKI B;  4A4C A;  1FPW A;  3CR4 X;  1F8H A;  4NDB A;  5TNC A;  1NYA A;  4QJ4 B;  1PVB A;  3DVE A;  1UHI A;  1F4O A;  2JC2 A;  5AER A;  1LKJ A;  3O6B A;  4YGD B;  2WCF A;  1NSH A;  2JXL A;  3BYA A;  1CB1 A;  2HQW A;  3QRX A;  1J7Q A;  4OR9 B;  3GOF A;  4YGE B;  1OSA A;  2FCE A;  2I2R E;  2JNF A;  2LVI A;  2WOS A;  1ZMZ A;  1REC A;  3CTN A;  3PSR A;  2KI6 C;  3NXA A;  2GGM A;  5AEQ A;  2LE9 B;  3LK1 A;  1SNL A;  5K89 A;  1XK4 A;  5D69 A;  1SCM C;  1FI6 A;  4HRG A;  2M9G A;  1OZO A;  1WRZ A;  2Y1N A;  1DGV A;  1SRA A;  2M97 A;  2F3Z A;  1OMR A;  1QTX A;  2KQY A;  1JFK A;  4XJK A;  4AQJ A;  2CTN A;  3TDZ A;  1BR1 B;  1BLQ A;  2FOT A;  1L2O B;  3IQO A;  2KNE A;  2OS8 B;  3HCM A;  4YI9 A;  5DKQ A;  3VRN A;  4UPG A;  1CDM A;  2BCX A;  3SJS A;  3BUX B;  1Y1X A;  2MBX A;  2E30 A;  5HYD A;  1QV1 A;  1MR8 A;  2JT0 A;  2KBM A;  1MQ1 A;  1RFJ A;  2JT3 A;  1CFP A;  3BUO B;  2LVV A;  4AQI A;  1ZFS A;  5ER4 X;  2LMT A;  1MUX A;  1CFC A;  1IQ5 A;  3DVJ A;  1AJ4 A;  3EVU A;  1E8A A;  1K9P A;  1K9U A;  2NZ0 A;  1KCY A;  2L4I A;  4E68 A;  2ZND A;  1SL8 A;  4N5X A;  1MHO A;  2KFF A;  4BY4 A;  1IH0 A;  3SG6 A;  4MZK A;  1TNP A;  4PHK A;  2G9B A;  1DTL A;  1QX2 A;  1TNX A;  1AUI B;  1FBV A;  2JTZ A;  2M3W A;  4A4B A;  3BUN B;  4OVN F;  5CSF A;  1IJ6 A;  3GK2 A;  3KHE A;  1C7W A;  4OCI A;  1B4C A;  1SPY A;  2KDH A;  1DMO A;  1IG5 A;  1NX2 A;  4PDZ A;  2WOR A;  1K94 A;  3MSE B;  3LL8 B;  1QLK A;  3OP0 A;  2LMU A;  3EKH A;  1SR6 C;  2KAV A;  3IF7 A;  4NDC A;  2HF5 A;  2L5X B;  2I18 A;  2ISD A;  1NPQ A;  1GGW A;  3A8R A;  1JF0 A;  1S36 A;  3CGA A;  3SG3 A;  3H4S E;  4I5J A;  4ETO A;  1CM4 A;  1KSO A;  1A75 A;  1GGZ A;  2AUC A;  2F2P A;  1SW8 A;  1CNP A;  1BOC A;  2LP3 A;  3VRO A;  3M0W A;  4DIR A;  1KWO C;  1IWQ A;  1YUU A;  4DUQ A;  1RWY A;  5GQQ C;  4HRE E;  5DKR A;  2SAS A;  2LV7 A;  1A75 B;  4I5K A;  2LHI A;  1Y1U A;  3ICB A;  1BG1 A;  1G33 A;  2JWW A;  4NDD A;  1K95 A;  2B1U A;  3VRR A;  2PMY A;  2TN4 A;  1U5I B;  2AMI A;  5I2O A;  1J1E A;  1WLZ A;  1QVI Z;  2K2F A;  4PE1 A;  5IBW A;  2BBN A;  2H61 C;  3BOW A;  4N1G A;  5ER5 A;  1B8R A;  5I2L A;  2BCB A;  2JQ6 A;  4PCW A;  3TUY C;  2PAL A;  3EVV A;  1WDC C;  3D0Y A;  1YVL A;  4YBH B;  1CFD A;  4D1E A;  2I94 A;  3LLE A;  1M39 A;  1DJI A;  4F0Z B;  1MWN A;  2HQ8 A;  3PAL A;  2PAS A;  2JXC A;  4NQG A;  1Y1A A;  2CT9 A;  3D0Y B;  2L0P A;  1B1G A;  1S1E A;  4MN0 A;  1M45 A;  1WLM A;  5HKY A;  1H4B A;  1KQM C;  1YTZ C;  1NX1 A;  2K7B A;  2LNK A;  5B8I B;  1R2U A;  2M7N A;  2OTG C;  2LUX A;  2M1K B;  1HT9 A;  1CDN A;  3PAT A;  2NCP A;  2JNX A;  4WRI A;  1AHR A;  2MRD A;  2ZKM X;  1CMG A;  4M2O A;  1RTP 1;  1CFF A;  1S26 D;  1OMD A;  1J55 A;  4MLW A;  1JF2 A;  4GBA A;  1A4P A;  1QVI Y;  4QJ5 B;  2KYC A;  4DS7 A;  1AJ5 A;  2BEC A;  2FCD A;  4PE4 A;  1DT7 B;  4OKH A;  3I5I B;  4I5N B;  1YX7 A;  4GGF A;  1XFW O;  2MJW B;  2M1U A;  1N0Y A;  2WCE A;  1DJX A;  4M2Q A;  4C0K A;  1AP4 A;  1DJY A;  1UHH A;  3WNX B;  1PK0 D;  2PSR A;  5BPJ A;  1W7I B;  2FJU B;  2KOT A;  4PE0 A;  2JOJ A;  3KF9 A;  4Q04 A;  1A2X A;  3I5F B;  1BR4 B;  2NCO A;  2E6W A;  3NSL A;  1CLL A;  2Q4U A;  3OHM B;  1HQV A;  1LIN A;  1UP5 A;  4PHJ A;  2KHN A;  4MZJ A;  1BU3 A;  3SG4 A;  2JTT A;  1XVJ A;  3NSO A;  4ZCV A;  2KAX A;  3I5H B;  1KK8 B;  3AKB A;  5I2Q A;  2H61 A;  1OMV A;  1F55 A;  1TNW A;  3VGO A;  1IGV A;  4BY5 A;  5CSJ A;  3CR2 A;  1K90 D;  5CPV A;  1MXL C;  4MSP A;  3EK7 A;  4XJK B;  4YGC B;  4XYN A;  4PHM A;  5J3X A;  1XFY O;  3PN7 C;  1C7V A;  1SCV A;  3E3R A;  1SK6 D;  3TDI A;  1WY9 A;  2GGZ A;  4DCK A;  2KI4 B;  3JVT C;  2BE6 A;  2ZRS A;  3KO0 A;  2JRF A;  3O2P A;  5AAN A;  4CFR A;  3I5G B;  1DJW A;  1PSR A;  2COL B;  1D1O A;  2SCP A;  3JTD C;  3O4Y A;  2Y5I A;  1QS7 A;  4CID A;  1EXR A;  1JFJ A;  5AXI A;  1EG3 A;  1XFZ O;  1M63 B;  2MA2 A;  4QJ3 B;  1KQM B;  2EC6 C;  2BL0 C;  5KU1 A;  3TS5 B;  1YUR A;  1C07 A;  1BT6 A;  3KPX A;  5F6T A;  3OB1 B;  1CMF A;  2IS9 A;  2L2E A;  3ZNI A;  1DJG A;  3GK1 A;  4JQ0 D;  3CWG A;  1FI5 A;  2L51 A;  1SY9 A;  2BKH B;  3LCP C;  3OB2 B;  4GAO A;  1UHK A;  2CXJ A;  3SG2 A;  1X02 A;  3K21 A;  1LXF C;  3SIA A;  2H2K A;  1DJH A;  2K0J A;  1NX3 A;  3NSI A;  1H8B A;  3CS1 A;  1B7T Z;  1QLS A;  2ZRT A;  1OOJ A;  4MEW A;  1QX5 B;  2K7D A;  3IQQ A;  1SKT A;  2DOQ A;  2K61 A;  4WQ3 A;  3RM1 A;  1FF1 A;  5AFP A;  1MXE A;  2PRU A;  2LHL A;  2Q91 A;  1TTX A;  4GPL B;  4ORA B;  2GV5 A;  3CZT X;  4ZCU A;  2M7L A;  1B9A A;  1SMG A;  4YGA A;  4MVF A;  1NCY A;  1NX0 A;  1PRW A;  1N65 A;  2JPT A;  4FQO A;  4GNK B;  1SCM B;  4PHN A;  1F70 A;  1R6P A;  3SG5 A;  1JWD A;  1EJ3 A;  3EKJ A;  1M31 A;  3AAK A;  2KBI A;  2MHH A;  1TCO B;  3BOW B;  1ALW A;  1UUR A;  4MZL A;  5JJG A;  1B8L A;  3DF0 A;  2JZI A;  1IRJ A;  2WC8 A;  3OX5 A;  1S6C A;  1YUS A;  2KGR A;  1B7T Y;  3EK4 A;  1GQM A;  2HPS A;  1M46 A;  1L2O C;  3DF0 B;  5HLV A;  4GUK A;  1W7J B;  2OS8 C;  1NUB A;  1TN4 A;  1NCX A;  2QAC A;  1S5G Z;  2EHB A;  2KQ6 A;  3C1V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...