2K8MB

S100a13-c2a binary complex structure
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
98
structure length
98
Chain Sequence
b'MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title S100A13-C2A binary complex structure-a key component in the acidic fibroblast growth factor for the non-classical pathway.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 29
structure length 98
sequence length 98
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2k8mB00
3BOWA 1IQ5A 1CDPA 1N0YA 1J7PA 2KGBC 3FS7A 4HREE 2MHHA 1KWOB 2BCXA 3PSRA 2ZNEA 1J7RA 1K8UA 4N1GA 1C7WA 3WHUB 1B1GA 2LHIA 2KOTA 4I5KA 1SW8A 3PN7C 2JRFA 1BOCA 1XFYO 1E8AA 1BF5A 1RFJA 4A4BA 3PLFB 1QVIY 3OB1B 1KSOA 1YURA 1JFKA 5K89A 3EVRA 1EL4A 1ODBA 1TNPA 1Q80A 1NCZA 1UHNA 2JXLA 3LL8B 1B9AA 1SPYA 3SJSA 1Y6WA 1YX8A 1MQ1A 2K2AA 1QX2A 3C1VA 3CR2A 2JTZA 2DOQA 5KTYA 2FOTA 2KYFA 2KYCA 1GQMA 4L9MA 3EVVA 1CB1A 1FW4A 1KK7Y 2JC2A 2LVIA 5D7FA 3SG2A 2BCAA 4MRXA 2KNEA 5AEQA 1R2UA 1QJTA 1QLKA 2BL0C 1DJHA 1YUUA 5CSJA 2K7DA 4ICBA 1TOPA 2F8PA 1IJ5A 2KFFA 4NDBA 3WXAA 1NX0A 3OX6A 3I5HC 4N5XA 3HX4A 3JVTB 2F2OA 1B8CA 3QRXA 1BR4B 2RGIA 1CM1A 2WCBA 1S3PA 1IRJA 1ZFSA 5HKYA 2H61A 4GUKA 3VRPA 3DVMA 1XYDA 2KHNA 2L2EA 2O60A 1NX3A 1QX7A 4XJKB 1WLZA 5CSFA 1DJXA 4TNCA 1KFUL 1J7OA 1JC2A 5DKRA 1L2OC 3EVUA 4MZLA 2JZIA 1RROA 2TN4A 1WY9A 1OMRA 2K2FA 5J3XA 1XVJA 5FYXA 2LMTA 2ZRSA 1AUIB 2O5GA 1AK8A 1SK6D 2OS8C 3EKJA 2OTGC 3OHMB 3AAKA 1MR8A 3LCPC 2LP2A 3PM8A 1CFFA 1Y1UA 2CTNA 2JQ6A 2Y4QA 1B7TZ 1UHHA 3NSOA 2PASA 1CTRA 2JNXA 3K21A 4GNKB 4MEWA 4I5LB 1G8IA 1YRTB 2LANA 3FWBA 1OOJA 4MSPA 4QJ5B 1TNQA 1KWOC 2KAVA 3O6BA 1F71A 2Y1MA 5PALA 3BQ3A 4CIDA 5DKNA 1A2XA 3SG3A 2AAOA 2E30A 2KBIA 1A4PA 2MAZA 1C7VA 1N2DA 4PHMA 3SIBA 2H61C 1CFCA 1M39A 4XJKA 4N1FA 5I2QA 2GV5A 1DT7B 5B8IB 2JT0A 1NCYA 1M31A 2KGRA 1IH0A 2BKHB 1B4CA 2HETA 3SG6A 2ISDA 3H4SE 1IGVA 3D0YA 3FWCA 4BY5A 1PALA 1OE9B 2KSPA 4DCKA 2MJWB 1RWYA 3FIAA 2EHBA 3KPXA 4MBEA 2WC8A 1LXFC 1N65A 3TUYB 1JFJA 1UP5A 1NX2A 1SY9A 2CBLA 5JOLA 2B1UA 2OS8B 1AVSA 1RECA 4NDCA 1TN4A 2M9GA 4PALA 4ZCUA 1MHOA 2BBMA 3SG7A 2HQWA 1KK8B 2R2IA 2M7NA 3CTNA 1YUTA 1KQMB 3VRRA 2I2RE 1NPQA 1S26D 3MSEB 5TNCA 3NSLA 3GK2A 1YVLA 1BR1B 1DJGA 5HYDA 3GK4X 3I5GB 3TS5B 1S5GY 2M49B 2WOSA 1ZUZA 3PALA 3LLEA 5KSZA 2I18A 1Y0VH 4ZCVA 1K9UA 1NYAA 2LUCA 4YI8A 2KBMA 1TCOB 1JUOA 2LUXA 2ZNDA 2OPOA 4MRYA 2KQYA 2KAXA 1V1FA 3BYAA 5HLVA 1BODA 1BU3A 1PK0D 2LC5A 1QATA 1QXPA 2ZKMX 1B47A 1SNLA 5KU1A 1DVIA 4ETOA 2LV7A 4GAOA 5JJGA 2NZ0A 2M8UA 2BE4A 1BT6A 1SCVA 1XFZO 3CS1A 2ZN9A 1F55A 3SIAA 1G33A 1F4QA 2NCPA 1AP4A 2GGMA 4AOMA 1S6CA 1WDCC 1PRWA 3DVJA 3DD4A 1PVAA 1NWDA 1UWOA 1LVCD 2BKIB 2NLNA 3TZ1A 1SR6B 4M2QA 2M29A 2KI4B 2COLB 4I5NB 5D69A 1PVBA 1S36A 1W7JB 2MBXA 2G2BA 2PVBA 1DJWA 2JULA 3O78A 3KEVA 4YBHB 4GGFC 4PDZA 1KSMA 2PRUA 3DVEA 1DF0B 2CNPA 2FCDA 2L51A 2CXJA 2ZFDA 4OR9B 5G08A 1KFXS 1QV0A 5AXIA 1EH2A 5HKZA 2QPTA 1B7TY 1AHRA 1SCMC 2M0RA 2AUCA 1AJ5A 1X02A 3TDZA 3O4YA 1QVIZ 2LVKA 2EGDA 3CWGA 1B8RA 3AKBA 3KF9A 3OX5A 1OSAA 2WNDA 3TUYC 1PULA 1ALVA 1K9KA 3SG4A 3VGOA 3LK0A 3JTDB 3IQQA 1IJ6A 4OVNF 3AAJA 1YVHA 3LK1A 1WRKA 4PHJA 3CR5X 4MZKA 2LHLA 4C0JA 3BUMB 1QX5B 1B8LA 1OZOA 4M2PA 2MLFC 1WDCB 2M3WA 1KK8C 3NSIA 1S1EA 1SMGA 1KQMC 2KI6D 2LMVA 4R1EA 4WQ2A 2K8MB 1SYMA 1A29A 4YGBB 4NDDA 1RTP1 3D10A 5AERA 3I5GC 3TS5C 5CSNA 4PHNA 4F0ZB 2JXCA 1BJFA 4BY4A 1M45A 4MN0A 1H4BA 1NUBA 3WNXB 4AQIA 4Q04A 1EXRA 4WRIA 4YI9A 2SCPA 4ORBB 1CM4A 1QTXA 1YRUB 3AKAA 2PMYA 4ORCB 4YGCB 1RJVA 2LCPA 3SG5A 2L98A 1SCMB 1UUSA 4P5OE 3RLZA 3EKHA 1NSHA 4PCWA 1K96A 1J1DA 4PE1A 2BCBA 1K93D 1SKTA 1Y1AA 2LM5A 2M97A 1KFXL 3CZTX 1LINA 4CFQA 1SR6C 1DTLA 3HCMA 2KI4C 2GGZA 4D1EA 1QIWA 1FBVA 1VRKA 1CNPA 4HRGA 1GGZA 2HPSA 4MZJA 2LLSA 2BECA 1K95A 2JOJA 2JU0A 4PE0A 1H8BA 3KHEA 1IWQA 2HQ8A 4GGFA 5IBWA 2JTTA 1LA0A 4MLWA 5CSIA 5ER5A 1FPWA 1JWDA 1BMOA 2IS9A 1YR5A 2M1KB 4OV2A 2EC6B 1TNWA 1CDLA 1IQ3A 1UHIA 4QJ3B 3O2PA 1F70A 1CLBA 2NCOA 3A8RA 1MWNA 2VRGA 1M63B 2G9BA 2M7LA 3VRNA 5I2OA 4PE4A 1L7ZA 1OQPA 1JF0A 4PE7A 1F4OA 3JTDC 1ZOTB 4NQGA 1CKKA 4FQOA 4XYNA 3BXKA 3EK8A 3GOFA 1NP8A 2Y5IA 3WHTB 1YUSA 1K9PA 3ICBA 1MF8B 4AQJA 1CDNA 5BPJA 1F8HA 5F6TA 5HLOA 4CLNA 1SL9A 3I5IB 3EK7A 2WCEA 1XFWO 3TDUA 3OB2B 5AFPA 1TIZA 1DJYA 3NXAA 4DRWA 1K2HA 2JWWA 1XK4C 2L0PA 2MLEC 2WCFA 3I5FC 3VRQA 1AJ4A 2LP3A 1U5IB 1QASA 1DJIA 4DS7A 1WRLA 1S5GZ 4YGEB 1A75B 4YRUA 2QACA 5I8NA 5HKWA 1WRZA 1FI5A 1CMFA 4QJ4B 1S6JA 1UHKA 3GK1A 1DGVA 2KAYA 2AMIA 4JPZB 2L50A 2NXQA 1TCFA 1DJZA 3KO0A 2Y1NA 3ZWHA 1TRFA 3ZNIA 1GGWA 2KDHA 1R6PA 2F33A 1D1OA 1CFDA 2K7OA 1YX7A 1S6IA 3BUNB 3EK4A 1SBJA 1GJYA 4I5JA 1XFUO 2ZRTA 1HT9A 1FF1A 3OP0A 1C07A 4U8DA 2FCEA 3CGAA 2LNKA 4OKHA 1WLMA 3IF7A 2F3ZA 5GQQC 1F54A 2FJUB 1Y1XA 1KQVA 1DMOA 1BLQA 1KK7Z 1MXLC 1FI6A 1J55A 1CFPA 2LAPA 2MA2A 3CR4X 2BBNA 1TNXA 1CLMA 3NSKA 1NCXA 1OMVA 3PN7B 5ER4X 4WQ3A 4OCIA 3BUXB 2LE9B 3DF0B 2JT3A 4USLA 1MUXA 3IQOA 1KCYA 3PATA 2LVVA 4YGDB 1XFVO 3VROA 1U5IA 1TTXA 4C0LA 3CLNA 1PSBA 1MXEA 1UURA 2K7CA 2MRDA 1A75A 3D0YB 1JF2A 1J1EA 3I5FB 1DF0A 3A4UB 1IG5A 1QLSA 2BE6A 2KQ6A 1CMGA 1SL7A 2EC6C 5CPVA 2LMUA 4M2OA 4A4CA 1RK9A 2I94A 2LLTA 3PFVA 3F45A 4GBAA 4DUQA 3BUWB 1YTZC 4UPGA 1IKUA 1JSAA 1CDMA 5I2LA 2L5XB 2E6WA 1LKJA 2CCMA 2P6BB 2BL0B 1A03A 2KFGA 1PSRA 2PSRA 1G4YR 2KFHA 2SASA 5DKQA 2JT8A 4IL1A 1BG1A 1XFXO 2CT9A 1OZSA 1NIWA 1ALWA 1UHJA 3E3RA 3BOWB 1QS7A 2K7BA 4P2YB 3I5HB 3DVKA 3RM1A 1JBAA 3M0WA 4CPVA 2L4HA 4JWQA 4CFRA 3I5IC 1SRAA 5AANA 2I7AA 2HF5A 1K94A 2Q4UA 3DF0A 2Q91A 4PHKA 1LA3A 2KI6C 2LLUA 1EG4A 2WORA 4C0KA 4DIRA 1EG3A 2F2PA 1CLLA 1L2OB 1XK4A 1M46A 2JPTA 1K90D 2F3YA 2K61A 4JQ0D 4GFTA 3TDIA 1QV1A 4YGAA 4ORAB 2H2KA 3BUOB 1SL8A 1XO5A 4HRHA 1HQVA 4HSZA 4GPLB 1XA5A 2L4IA 1OMDA 1QIVA 2V53A 1DGUA 2K0JA 2JNFA 4FTGA 4MVFA 1NX1A 2OTGB 4E68A 1V1GA 1ZACA 1J7QA 1W7IB 2D8NA 1KFUS 2M1UA 2ZN8A 4GGNA 2PALA 1EJ3A 2LVJA 1ZMZA 3JVTC 2A4JA
chains in the Genus database with same CATH superfamily
3BOWA 1IQ5A 1CDPA 1N0YA 1J7PA 2KGBC 3FS7A 4HREE 2MHHA 1KWOB 2BCXA 3PSRA 2ZNEA 1J7RA 1K8UA 4N1GA 1C7WA 3WHUB 1B1GA 2LHIA 2QEVA 2KOTA 4I5KA 1SW8A 3PN7C 2JRFA 1BOCA 1XFYO 1E8AA 1BF5A 1RFJA 4A4BA 3UO9A 3PLFB 1QVIY 3OB1B 1KSOA 1YURA 1JFKA 5K89A 3CZ0A 3EVRA 1EL4A 1ODBA 1TNPA 1Q80A 1NCZA 1UHNA 2JXLA 3LL8B 1B9AA 2QEHA 1SPYA 3SJSA 1Y6WA 1YX8A 1MQ1A 2K2AA 1QX2A 3C1VA 3CR2A 2JTZA 2DOQA 5KTYA 2FOTA 2KYFA 2KYCA 1GQMA 4L9MA 3EVVA 1CB1A 1FW4A 1KK7Y 2JC2A 2LVIA 5D7FA 3SG2A 1OOFA 2BCAA 2P71A 4MRXA 2KNEA 5AEQA 1R2UA 1QJTA 1QLKA 2BL0C 1DJHA 1YUUA 5CSJA 2K7DA 5EL2A 4ICBA 1TOPA 2F8PA 1IJ5A 2KFFA 4NDBA 1W9ZA 3WXAA 1NX0A 3OX6A 3I5HC 4N5XA 2QEOA 3HX4A 3JVTB 1TUJA 2F2OA 2JPOA 1B8CA 3QRXA 1BR4B 2RGIA 1CM1A 2WCBA 1S3PA 1IRJA 3DXLA 1ZFSA 1C3YA 5HKYA 2H61A 4GUKA 3VRPA 3DVMA 2QDIA 1XYDA 2KHNA 2L2EA 2O60A 1NX3A 1QX7A 4XJKB 1WLZA 4IJ7A 5CSFA 1DJXA 3SS4A 4TNCA 1KFUL 1J7OA 1JC2A 3L4AA 5DKRA 1L2OC 3EVUA 4MZLA 2JZIA 3CZ2A 1RROA 2TN4A 1WY9A 1OMRA 2K2FA 5J3XA 1XVJA 5FYXA 2LMTA 2ZRSA 1AUIB 2O5GA 1AK8A 1SK6D 2OS8C 3EKJA 2OTGC 3OHMB 3AAKA 1MR8A 3LCPC 2LP2A 3PM8A 1CFFA 3L47A 1Y1UA 2CTNA 2JQ6A 1TUZA 2Y4QA 3D75A 3PJIA 4PT1A 1B7TZ 1UHHA 3NSOA 2PASA 1CTRA 2JNXA 3K21A 4GNKB 4MEWA 3S0AA 4I5LB 1G8IA 1YRTB 2LANA 2L5YA 3FWBA 1OOJA 4MSPA 3N7HA 4QJ5B 1TNQA 1KWOC 2KAVA 3O6BA 1F71A 2Y1MA 5PALA 3BQ3A 4CIDA 5DKNA 1A2XA 3SG3A 2AAOA 2E30A 3B86A 2KBIA 1A4PA 2MAZA 1C7VA 1N2DA 4PHMA 3SIBA 2H61C 1CFCA 1Z2CB 1M39A 4XJKA 4N1FA 5I2QA 2GV5A 3O4XA 1DT7B 5B8IB 2JT0A 1NCYA 1M31A 2KGRA 1IH0A 2BKHB 3BJHA 1B4CA 2HETA 3SG6A 2ISDA 3H4SE 1IGVA 3D0YA 3FWCA 5D3OA 1LS8A 1PALA 4BY5A 1OE9B 2KSPA 4DCKA 2MJWB 1RWYA 3FIAA 3FE8A 2EHBA 3KPXA 2PYQA 4MBEA 2WC8A 3SS3A 3QMEA 1LXFC 1N65A 3TUYB 1JFJA 1UP5A 1NX2A 3CDNA 1SY9A 2CBLA 5JOLA 3R1VA 2B1UA 2OS8B 1AVSA 1RECA 4NDCA 1TN4A 2M9GA 3DZTA 4PALA 4OZDA 4ZCUA 1MHOA 2BBMA 3SG7A 2L2CA 2HQWA 1KK8B 2R2IA 2M7NA 3CTNA 1YUTA 1DQEA 1KQMB 2I2RE 3VRRA 1NPQA 1S26D 3MSEB 5TNCA 3BFHA 3NSLA 3GK2A 1YVLA 1BR1B 1DJGA 5HYDA 3GK4X 3I5GB 3TS5B 4C0LA 1S5GY 2M49B 2WOSA 1ZUZA 3PALA 3LLEA 3UNWA 5KSZA 2I18A 2K60A 1Y0VH 3S0BA 4ZCVA 1K9UA 1NYAA 2LUCA 4YI8A 2KBMA 1TCOB 1JUOA 3FE6A 2LUXA 2ZNDA 3SS5A 2GTEA 2OPOA 4MRYA 2KQYA 2KAXA 1V1FA 3BYAA 5HLVA 1BODA 1BU3A 1PK0D 2LC5A 2WC6A 1QATA 1QXPA 2ZKMX 3S0DA 1B47A 1SNLA 5KU1A 1DVIA 4ETOA 2LV7A 4GAOA 5JJGA 2NZ0A 3S0FA 2M8UA 3B7AA 2BE4A 1BT6A 1SCVA 1XFZO 3B6XA 3CS1A 2ZN9A 1F55A 3SIAA 1G33A 1F4QA 2NCPA 1AP4A 2GGMA 4AOMA 2YGUA 1S6CA 1WDCC 1PRWA 3DVJA 3DD4A 1PVAA 1NWDA 1UWOA 2ERBA 1LVCD 2BKIB 2NLNA 3TZ1A 1SR6B 4M2QA 2M29A 2KI4B 2COLB 3NHTA 2WCJA 4I5NB 1PVBA 5D69A 1S36A 1W7JB 2KLEA 3BFAA 2MBXA 2G2BA 2PVBA 3FE9A 1DJWA 2JULA 3O78A 3KEVA 4YBHB 4GGFC 4PDZA 1KSMA 2PRUA 3DVEA 3L4LA 1DF0B 2CNPA 2FCDA 2L51A 2CXJA 2ZFDA 4OR9B 5G08A 1KFXS 4F7FA 3R1PA 1QV0A 5AXIA 1EH2A 1XFRA 5HKZA 2QPTA 1B7TY 1AHRA 1SCMC 2M0RA 3PM2A 2AUCA 1AJ5A 1X02A 3TDZA 3O4YA 1QVIZ 2LVKA 2EGDA 3CWGA 1B8RA 3AKBA 3KF9A 1ORGA 3CZ1A 3OX5A 1OSAA 2BAPA 2WNDA 3TUYC 1PULA 1ALVA 1K9KA 3SG4A 3VGOA 3LK0A 3JTDB 3IQQA 1IJ6A 4OVNF 3AAJA 1YVHA 2BNXA 3LK1A 3CABA 1WRKA 4PHJA 3CR5X 4MZKA 2LHLA 4C0JA 3BUMB 1QX5B 1B8LA 1OZOA 4M2PA 2MLFC 1WDCB 4JKTA 3OGNA 2M3WA 1KK8C 3NSIA 2WCHA 3VB1A 1S1EA 1SMGA 1KQMC 2KI6D 2LMVA 4R1EA 4WQ2A 2K8MB 3R72A 1SYMA 1A29A 4YGBB 4NDDA 1RTP1 3D10A 5AERA 1Z4HA 3I5GC 3TS5C 5CSNA 4PHNA 4F0ZB 2JXCA 1BJFA 1QWVA 4BY4A 1M45A 4MN0A 1H4BA 1NUBA 3WNXB 4AQIA 4Q04A 1EXRA 4WRIA 4YI9A 2SCPA 1OOHA 4ORBB 3RZSA 1CM4A 1QTXA 1YRUB 3AKAA 2PMYA 4ORCB 4YGCB 1RJVA 2LCPA 3SG5A 2L98A 1SCMB 1UUSA 4KYNA 4P5OE 3RLZA 3EKHA 2WC5A 1NSHA 2FJYA 4PCWA 1K96A 1J1DA 4PE1A 2BCBA 1K93D 1SKTA 1Y1AA 2LM5A 2M97A 1KFXL 3CZTX 1LINA 4CFQA 1SR6C 1DTLA 3HCMA 2KI4C 4JD9A 2GGZA 4D1EA 1T14A 1QIWA 1FBVA 1VRKA 1CNPA 4HRGA 1GGZA 2HPSA 4MZJA 2LLSA 2BECA 3B88A 3CYZA 1K95A 2JOJA 2JU0A 3DYEA 4PE0A 1IIOA 1H8BA 3KHEA 3EG5B 1IWQA 2HQ8A 4GGFA 5IBWA 2JTTA 1LA0A 4MLWA 5CSIA 5ER5A 1FPWA 1JWDA 1BMOA 2IS9A 1YR5A 2M1KB 4OV2A 2EC6B 1OOIX 1TNWA 3B87A 1CDLA 1IQ3A 1UHIA 4QJ3B 3O2PA 1F70A 1CLBA 3S0GA 2NCOA 3A8RA 1MWNA 2VRGA 1M63B 2G9BA 2M7LA 3VRNA 5I2OA 4PE4A 1L7ZA 1OQPA 1JF0A 4PE7A 1F4OA 3JTDC 1ZOTB 4NQGA 1CKKA 4FQOA 4XYNA 5HL1A 3BXKA 3EK8A 3GOFA 1NP8A 2Y5IA 3WHTB 1YUSA 1K9PA 3ICBA 1MF8B 4AQJA 1CDNA 5BPJA 1F8HA 5F6TA 5HLOA 4CLNA 1SL9A 3I5IB 3EK7A 3NGVA 2WCEA 1XFWO 3TDUA 3OB2B 5AFPA 1TIZA 1DJYA 3NXAA 4DRWA 1K2HA 2JWWA 1XK4C 2L0PA 2MLEC 2WCFA 3I5FC 3OBVA 3VRQA 1AJ4A 2LP3A 1U5IB 1QASA 1DJIA 4DS7A 1WRLA 1S5GZ 4YGEB 1A75B 4YRUA 2QACA 5I8NA 5HKWA 1WRZA 1FI5A 1CMFA 4QJ4B 1S6JA 1UHKA 3GK1A 1DGVA 2KAYA 2AMIA 4JPZB 2L50A 2NXQA 4INWA 1TCFA 1DJZA 3KO0A 2Y1NA 3ZWHA 2H8VA 1TRFA 2KPHA 3ZNIA 1GGWA 2KDHA 1R6PA 2F33A 3BFBA 1D1OA 1CFDA 2K7OA 1YX7A 1S6IA 3BUNB 3EK4A 1SBJA 1GJYA 3K1EA 4I5JA 1XFUO 2ZRTA 1HT9A 1FF1A 3OP0A 1C07A 4U8DA 2FCEA 3CGAA 2LNKA 4OKHA 1WLMA 3IF7A 2F3ZA 5GQQC 3DY9A 1F54A 2WCMA 2FJUB 1Y1XA 1KQVA 1DMOA 1BLQA 1KK7Z 1MXLC 1FI6A 1J55A 1CFPA 5I94A 2LAPA 2MA2A 1DC1A 3CR4X 2BBNA 1TNXA 1CLMA 3NSKA 1NCXA 1OMVA 3PN7B 5ER4X 4WQ3A 4OCIA 3BUXB 2LE9B 3DF0B 2JT3A 4USLA 1MUXA 3IQOA 1KCYA 3PATA 2LVVA 4YGDB 1XFVO 3VROA 1U5IA 1TTXA 1TWOA 3CLNA 1PSBA 1MXEA 1UURA 2K7CA 2MRDA 1A75A 3D0YB 3IVTA 1JF2A 1J1EA 3I5FB 1DF0A 3A4UB 1IG5A 1P28A 1QLSA 2BE6A 4INXA 2KQ6A 1CMGA 1SL7A 1SSEB 2EC6C 5CPVA 2LMUA 4M2OA 2WCKA 2WCLA 4A4CA 1RK9A 2I94A 2LLTA 3PFVA 3F45A 4GBAA 4DUQA 3BUWB 1YTZC 4UPGA 1IKUA 1JSAA 1CDMA 5I2LA 2L5XB 2E6WA 1LKJA 2CCMA 3Q8IA 2P6BB 3D76A 2BL0B 1A03A 2KFGA 1C3ZA 1PSRA 2PSRA 1G4YR 5FI7A 2KFHA 2SASA 5DKQA 2JT8A 4IL1A 1BG1A 1XFXO 3R1OA 2CT9A 1OZSA 4FQTA 1NIWA 1ALWA 1UHJA 3E3RA 3BOWB 1QS7A 2K7BA 3D73A 3I5HB 4P2YB 3DVKA 3RM1A 1JBAA 3M0WA 4CPVA 2L4HA 4JWQA 4CFRA 1OW4A 5DICA 3I5IC 1SRAA 5AANA 2I7AA 2HF5A 1K94A 3NHIA 2Q4UA 3DF0A 2Q91A 4PHKA 1LA3A 2KI6C 2LLUA 1EG4A 2WORA 4C0KA 5FI2A 4DIRA 1EG3A 2F2PA 1CLLA 1L2OB 1XK4A 1M46A 2JPTA 1K90D 2F3YA 2K61A 3D77A 3D74A 4GFTA 4JQ0D 1QV1A 4YGAA 3TDIA 4ORAB 5FI6A 2PQLA 2H2KA 3BUOB 1DELA 1SL8A 1XO5A 1HQVA 4HRHA 4HSZA 3S0EA 4GPLB 1XA5A 1OOGA 2L4IA 1OMDA 1QIVA 2KLDA 2V53A 1DGUA 2K0JA 2JNFA 4FTGA 4MVFA 1NX1A 2OTGB 3V2LA 2P70A 4E68A 1V1GA 1ZACA 1DEKA 1GM0A 1J7QA 1W7IB 3D78A 2QEBA 2D8NA 1KFUS 2M1UA 2ZN8A 4GGNA 2PALA 1EJ3A 2LVJA 1ZMZA 3JVTC 2A4JA
chains in the Genus database with same CATH topology
3BOWA 1IQ5A 1CDPA 1N0YA 1J7PA 2KGBC 3FS7A 4HREE 2MHHA 1KWOB 2BCXA 3PSRA 2ZNEA 1J7RA 1K8UA 4N1GA 1C7WA 3WHUB 1B1GA 2LHIA 2KOTA 4I5KA 1SW8A 3PN7C 2JRFA 1BOCA 1XFYO 1E8AA 1BF5A 1RFJA 4A4BA 3PLFB 1QVIY 3OB1B 1KSOA 1YURA 1JFKA 5K89A 3EVRA 1EL4A 1ODBA 1TNPA 1Q80A 1NCZA 1UHNA 2JXLA 3LL8B 1B9AA 1SPYA 3SJSA 1Y6WA 1YX8A 1MQ1A 2K2AA 1QX2A 3C1VA 3CR2A 2JTZA 2DOQA 5KTYA 2FOTA 2KYFA 2KYCA 1GQMA 4L9MA 3EVVA 1CB1A 1FW4A 1KK7Y 2JC2A 2LVIA 5D7FA 3SG2A 2BCAA 4MRXA 2KNEA 5AEQA 1R2UA 1QJTA 1QLKA 2BL0C 1DJHA 1YUUA 5CSJA 2K7DA 4ICBA 1TOPA 2F8PA 1IJ5A 2KFFA 4NDBA 3WXAA 1NX0A 3OX6A 3I5HC 4N5XA 3HX4A 3JVTB 2F2OA 1B8CA 3QRXA 1BR4B 2RGIA 1CM1A 2WCBA 1S3PA 1IRJA 1ZFSA 5HKYA 2H61A 4GUKA 3VRPA 3DVMA 1XYDA 2KHNA 2L2EA 2O60A 1NX3A 1QX7A 4XJKB 1WLZA 5CSFA 1DJXA 4TNCA 1KFUL 1J7OA 1JC2A 5DKRA 1L2OC 3EVUA 4MZLA 2JZIA 1RROA 2TN4A 1WY9A 1OMRA 2K2FA 5J3XA 1XVJA 5FYXA 2LMTA 2ZRSA 1AUIB 2O5GA 1AK8A 1SK6D 2OS8C 3EKJA 2OTGC 3OHMB 3AAKA 1MR8A 3LCPC 2LP2A 3PM8A 1CFFA 1Y1UA 2CTNA 2JQ6A 2Y4QA 1B7TZ 1UHHA 3NSOA 2PASA 1CTRA 2JNXA 3K21A 4GNKB 4MEWA 4I5LB 1G8IA 1YRTB 2LANA 3FWBA 1OOJA 4MSPA 4QJ5B 1TNQA 1KWOC 2KAVA 3O6BA 1F71A 2Y1MA 5PALA 3BQ3A 4CIDA 5DKNA 1A2XA 3SG3A 2AAOA 2E30A 2KBIA 1A4PA 2MAZA 1C7VA 1N2DA 4PHMA 3SIBA 2H61C 1CFCA 1M39A 4XJKA 4N1FA 5I2QA 2GV5A 1DT7B 5B8IB 2JT0A 1NCYA 1M31A 2KGRA 1IH0A 2BKHB 1B4CA 2HETA 3SG6A 2ISDA 3H4SE 1IGVA 3D0YA 3FWCA 4BY5A 1PALA 1OE9B 2KSPA 4DCKA 2MJWB 1RWYA 3FIAA 2EHBA 3KPXA 4MBEA 2WC8A 1LXFC 1N65A 3TUYB 1JFJA 1UP5A 1NX2A 1SY9A 2CBLA 5JOLA 2B1UA 2OS8B 1AVSA 1RECA 4NDCA 1TN4A 2M9GA 4PALA 4ZCUA 1MHOA 2BBMA 3SG7A 2HQWA 1KK8B 2R2IA 2M7NA 3CTNA 1YUTA 1KQMB 3VRRA 2I2RE 1NPQA 1S26D 3MSEB 5TNCA 3NSLA 3GK2A 1YVLA 1BR1B 1DJGA 5HYDA 3GK4X 3I5GB 3TS5B 1S5GY 2M49B 2WOSA 1ZUZA 3PALA 3LLEA 5KSZA 2I18A 1Y0VH 4ZCVA 1K9UA 1NYAA 2LUCA 4YI8A 2KBMA 1TCOB 1JUOA 2LUXA 2ZNDA 2OPOA 4MRYA 2KQYA 2KAXA 1V1FA 3BYAA 5HLVA 1BODA 1BU3A 1PK0D 2LC5A 1QATA 1QXPA 2ZKMX 1B47A 1SNLA 5KU1A 1DVIA 4ETOA 2LV7A 4GAOA 5JJGA 2NZ0A 2M8UA 2BE4A 1BT6A 1SCVA 1XFZO 3CS1A 2ZN9A 1F55A 3SIAA 1G33A 1F4QA 2NCPA 1AP4A 2GGMA 4AOMA 1S6CA 1WDCC 1PRWA 3DVJA 3DD4A 1PVAA 1NWDA 1UWOA 1LVCD 2BKIB 2NLNA 3TZ1A 1SR6B 4M2QA 2M29A 2KI4B 2COLB 4I5NB 5D69A 1PVBA 1S36A 1W7JB 2MBXA 2G2BA 2PVBA 1DJWA 2JULA 3O78A 3KEVA 4YBHB 4GGFC 4PDZA 1KSMA 2PRUA 3DVEA 1DF0B 2CNPA 2FCDA 2L51A 2CXJA 2ZFDA 4OR9B 5G08A 1KFXS 1QV0A 5AXIA 1EH2A 5HKZA 2QPTA 1B7TY 1AHRA 1SCMC 2M0RA 2AUCA 1AJ5A 1X02A 3TDZA 3O4YA 1QVIZ 2LVKA 2EGDA 3CWGA 1B8RA 3AKBA 3KF9A 3OX5A 1OSAA 2WNDA 3TUYC 1PULA 1ALVA 1K9KA 3SG4A 3VGOA 3LK0A 3JTDB 3IQQA 1IJ6A 4OVNF 3AAJA 1YVHA 3LK1A 1WRKA 4PHJA 3CR5X 4MZKA 2LHLA 4C0JA 3BUMB 1QX5B 1B8LA 1OZOA 4M2PA 2MLFC 1WDCB 2M3WA 1KK8C 3NSIA 1S1EA 1SMGA 1KQMC 2KI6D 2LMVA 4R1EA 4WQ2A 2K8MB 1SYMA 1A29A 4YGBB 4NDDA 1RTP1 3D10A 5AERA 3I5GC 3TS5C 5CSNA 4PHNA 4F0ZB 2JXCA 1BJFA 4BY4A 1M45A 4MN0A 1H4BA 1NUBA 3WNXB 4AQIA 4Q04A 1EXRA 4WRIA 4YI9A 2SCPA 4ORBB 1CM4A 1QTXA 1YRUB 3AKAA 2PMYA 4ORCB 4YGCB 1RJVA 2LCPA 3SG5A 2L98A 1SCMB 1UUSA 4P5OE 3RLZA 3EKHA 1NSHA 4PCWA 1K96A 1J1DA 4PE1A 2BCBA 1K93D 1SKTA 1Y1AA 2LM5A 2M97A 1KFXL 3CZTX 1LINA 4CFQA 1SR6C 1DTLA 3HCMA 2KI4C 2GGZA 4D1EA 1QIWA 1FBVA 1VRKA 1CNPA 4HRGA 1GGZA 2HPSA 4MZJA 2LLSA 2BECA 1K95A 2JOJA 2JU0A 4PE0A 1H8BA 3KHEA 1IWQA 2HQ8A 4GGFA 5IBWA 2JTTA 1LA0A 4MLWA 5CSIA 5ER5A 1FPWA 1JWDA 1BMOA 2IS9A 1YR5A 2M1KB 4OV2A 2EC6B 1TNWA 1CDLA 1IQ3A 1UHIA 4QJ3B 3O2PA 1F70A 1CLBA 2NCOA 3A8RA 1MWNA 2VRGA 1M63B 2G9BA 2M7LA 3VRNA 5I2OA 4PE4A 1L7ZA 1OQPA 1JF0A 4PE7A 1F4OA 3JTDC 1ZOTB 4NQGA 1CKKA 4FQOA 4XYNA 3BXKA 3EK8A 3GOFA 1NP8A 2Y5IA 3WHTB 1YUSA 1K9PA 3ICBA 1MF8B 4AQJA 1CDNA 5BPJA 1F8HA 5F6TA 5HLOA 4CLNA 1SL9A 3I5IB 3EK7A 2WCEA 1XFWO 3TDUA 3OB2B 5AFPA 1TIZA 1DJYA 3NXAA 4DRWA 1K2HA 2JWWA 1XK4C 2L0PA 2MLEC 2WCFA 3I5FC 3VRQA 1AJ4A 2LP3A 1U5IB 1QASA 1DJIA 4DS7A 1WRLA 1S5GZ 4YGEB 1A75B 4YRUA 2QACA 5I8NA 5HKWA 1WRZA 1FI5A 1CMFA 4QJ4B 1S6JA 1UHKA 3GK1A 1DGVA 2KAYA 2AMIA 4JPZB 2L50A 2NXQA 1TCFA 1DJZA 3KO0A 2Y1NA 3ZWHA 1TRFA 3ZNIA 1GGWA 2KDHA 1R6PA 2F33A 1D1OA 1CFDA 2K7OA 1YX7A 1S6IA 3BUNB 3EK4A 1SBJA 1GJYA 4I5JA 1XFUO 2ZRTA 1HT9A 1FF1A 3OP0A 1C07A 4U8DA 2FCEA 3CGAA 2LNKA 4OKHA 1WLMA 3IF7A 2F3ZA 5GQQC 1F54A 2FJUB 1Y1XA 1KQVA 1DMOA 1BLQA 1KK7Z 1MXLC 1FI6A 1J55A 1CFPA 2LAPA 2MA2A 3CR4X 2BBNA 1TNXA 1CLMA 3NSKA 1NCXA 1OMVA 3PN7B 5ER4X 4WQ3A 4OCIA 3BUXB 2LE9B 3DF0B 2JT3A 4USLA 1MUXA 3IQOA 1KCYA 3PATA 2LVVA 4YGDB 1XFVO 3VROA 1U5IA 1TTXA 4C0LA 3CLNA 1PSBA 1MXEA 1UURA 2K7CA 2MRDA 1A75A 3D0YB 1JF2A 1J1EA 3I5FB 1DF0A 3A4UB 1IG5A 1QLSA 2BE6A 2KQ6A 1CMGA 1SL7A 2EC6C 5CPVA 2LMUA 4M2OA 4A4CA 1RK9A 2I94A 2LLTA 3PFVA 3F45A 4GBAA 4DUQA 3BUWB 1YTZC 4UPGA 1IKUA 1JSAA 1CDMA 5I2LA 2L5XB 2E6WA 1LKJA 2CCMA 2P6BB 2BL0B 1A03A 2KFGA 1PSRA 2PSRA 1G4YR 2KFHA 2SASA 5DKQA 2JT8A 4IL1A 1BG1A 1XFXO 2CT9A 1OZSA 1NIWA 1ALWA 1UHJA 3E3RA 3BOWB 1QS7A 2K7BA 4P2YB 3I5HB 3DVKA 3RM1A 1JBAA 3M0WA 4CPVA 2L4HA 4JWQA 4CFRA 3I5IC 1SRAA 5AANA 2I7AA 2HF5A 1K94A 2Q4UA 3DF0A 2Q91A 4PHKA 1LA3A 2KI6C 2LLUA 1EG4A 2WORA 4C0KA 4DIRA 1EG3A 2F2PA 1CLLA 1L2OB 1XK4A 1M46A 2JPTA 1K90D 2F3YA 2K61A 4JQ0D 4GFTA 3TDIA 1QV1A 4YGAA 4ORAB 2H2KA 3BUOB 1SL8A 1XO5A 4HRHA 1HQVA 4HSZA 4GPLB 1XA5A 2L4IA 1OMDA 1QIVA 2V53A 1DGUA 2K0JA 2JNFA 4FTGA 4MVFA 1NX1A 2OTGB 4E68A 1V1GA 1ZACA 1J7QA 1W7IB 2D8NA 1KFUS 2M1UA 2ZN8A 4GGNA 2PALA 1EJ3A 2LVJA 1ZMZA 3JVTC 2A4JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BOW A;  1IQ5 A;  1CDP A;  1N0Y A;  1J7P A;  2KGB C;  3FS7 A;  4HRE E;  2MHH A;  1KWO B;  2BCX A;  3PSR A;  2ZNE A;  1J7R A;  1K8U A;  4N1G A;  1C7W A;  3WHU B;  1B1G A;  2LHI A;  2KOT A;  4I5K A;  1SW8 A;  3PN7 C;  2JRF A;  1BOC A;  1XFY O;  1E8A A;  1BF5 A;  1RFJ A;  4A4B A;  3PLF B;  1QVI Y;  3OB1 B;  1KSO A;  1YUR A;  1JFK A;  5K89 A;  3EVR A;  1EL4 A;  1ODB A;  1TNP A;  1Q80 A;  1NCZ A;  1UHN A;  2JXL A;  3LL8 B;  1B9A A;  1SPY A;  3SJS A;  1Y6W A;  1YX8 A;  1MQ1 A;  2K2A A;  1QX2 A;  3C1V A;  3CR2 A;  2JTZ A;  2DOQ A;  5KTY A;  2FOT A;  2KYF A;  2KYC A;  1GQM A;  4L9M A;  3EVV A;  1CB1 A;  1FW4 A;  1KK7 Y;  2JC2 A;  2LVI A;  5D7F A;  3SG2 A;  2BCA A;  4MRX A;  2KNE A;  5AEQ A;  1R2U A;  1QJT A;  1QLK A;  2BL0 C;  1DJH A;  1YUU A;  5CSJ A;  2K7D A;  4ICB A;  1TOP A;  2F8P A;  1IJ5 A;  2KFF A;  4NDB A;  3WXA A;  1NX0 A;  3OX6 A;  3I5H C;  4N5X A;  3HX4 A;  3JVT B;  2F2O A;  1B8C A;  3QRX A;  1BR4 B;  2RGI A;  1CM1 A;  2WCB A;  1S3P A;  1IRJ A;  1ZFS A;  5HKY A;  2H61 A;  4GUK A;  3VRP A;  3DVM A;  1XYD A;  2KHN A;  2L2E A;  2O60 A;  1NX3 A;  1QX7 A;  4XJK B;  1WLZ A;  5CSF A;  1DJX A;  4TNC A;  1KFU L;  1J7O A;  1JC2 A;  5DKR A;  1L2O C;  3EVU A;  4MZL A;  2JZI A;  1RRO A;  2TN4 A;  1WY9 A;  1OMR A;  2K2F A;  5J3X A;  1XVJ A;  5FYX A;  2LMT A;  2ZRS A;  1AUI B;  2O5G A;  1AK8 A;  1SK6 D;  2OS8 C;  3EKJ A;  2OTG C;  3OHM B;  3AAK A;  1MR8 A;  3LCP C;  2LP2 A;  3PM8 A;  1CFF A;  1Y1U A;  2CTN A;  2JQ6 A;  2Y4Q A;  1B7T Z;  1UHH A;  3NSO A;  2PAS A;  1CTR A;  2JNX A;  3K21 A;  4GNK B;  4MEW A;  4I5L B;  1G8I A;  1YRT B;  2LAN A;  3FWB A;  1OOJ A;  4MSP A;  4QJ5 B;  1TNQ A;  1KWO C;  2KAV A;  3O6B A;  1F71 A;  2Y1M A;  5PAL A;  3BQ3 A;  4CID A;  5DKN A;  1A2X A;  3SG3 A;  2AAO A;  2E30 A;  2KBI A;  1A4P A;  2MAZ A;  1C7V A;  1N2D A;  4PHM A;  3SIB A;  2H61 C;  1CFC A;  1M39 A;  4XJK A;  4N1F A;  5I2Q A;  2GV5 A;  1DT7 B;  5B8I B;  2JT0 A;  1NCY A;  1M31 A;  2KGR A;  1IH0 A;  2BKH B;  1B4C A;  2HET A;  3SG6 A;  2ISD A;  3H4S E;  1IGV A;  3D0Y A;  3FWC A;  4BY5 A;  1PAL A;  1OE9 B;  2KSP A;  4DCK A;  2MJW B;  1RWY A;  3FIA A;  2EHB A;  3KPX A;  4MBE A;  2WC8 A;  1LXF C;  1N65 A;  3TUY B;  1JFJ A;  1UP5 A;  1NX2 A;  1SY9 A;  2CBL A;  5JOL A;  2B1U A;  2OS8 B;  1AVS A;  1REC A;  4NDC A;  1TN4 A;  2M9G A;  4PAL A;  4ZCU A;  1MHO A;  2BBM A;  3SG7 A;  2HQW A;  1KK8 B;  2R2I A;  2M7N A;  3CTN A;  1YUT A;  1KQM B;  3VRR A;  2I2R E;  1NPQ A;  1S26 D;  3MSE B;  5TNC A;  3NSL A;  3GK2 A;  1YVL A;  1BR1 B;  1DJG A;  5HYD A;  3GK4 X;  3I5G B;  3TS5 B;  1S5G Y;  2M49 B;  2WOS A;  1ZUZ A;  3PAL A;  3LLE A;  5KSZ A;  2I18 A;  1Y0V H;  4ZCV A;  1K9U A;  1NYA A;  2LUC A;  4YI8 A;  2KBM A;  1TCO B;  1JUO A;  2LUX A;  2ZND A;  2OPO A;  4MRY A;  2KQY A;  2KAX A;  1V1F A;  3BYA A;  5HLV A;  1BOD A;  1BU3 A;  1PK0 D;  2LC5 A;  1QAT A;  1QXP A;  2ZKM X;  1B47 A;  1SNL A;  5KU1 A;  1DVI A;  4ETO A;  2LV7 A;  4GAO A;  5JJG A;  2NZ0 A;  2M8U A;  2BE4 A;  1BT6 A;  1SCV A;  1XFZ O;  3CS1 A;  2ZN9 A;  1F55 A;  3SIA A;  1G33 A;  1F4Q A;  2NCP A;  1AP4 A;  2GGM A;  4AOM A;  1S6C A;  1WDC C;  1PRW A;  3DVJ A;  3DD4 A;  1PVA A;  1NWD A;  1UWO A;  1LVC D;  2BKI B;  2NLN A;  3TZ1 A;  1SR6 B;  4M2Q A;  2M29 A;  2KI4 B;  2COL B;  4I5N B;  5D69 A;  1PVB A;  1S36 A;  1W7J B;  2MBX A;  2G2B A;  2PVB A;  1DJW A;  2JUL A;  3O78 A;  3KEV A;  4YBH B;  4GGF C;  4PDZ A;  1KSM A;  2PRU A;  3DVE A;  1DF0 B;  2CNP A;  2FCD A;  2L51 A;  2CXJ A;  2ZFD A;  4OR9 B;  5G08 A;  1KFX S;  1QV0 A;  5AXI A;  1EH2 A;  5HKZ A;  2QPT A;  1B7T Y;  1AHR A;  1SCM C;  2M0R A;  2AUC A;  1AJ5 A;  1X02 A;  3TDZ A;  3O4Y A;  1QVI Z;  2LVK A;  2EGD A;  3CWG A;  1B8R A;  3AKB A;  3KF9 A;  3OX5 A;  1OSA A;  2WND A;  3TUY C;  1PUL A;  1ALV A;  1K9K A;  3SG4 A;  3VGO A;  3LK0 A;  3JTD B;  3IQQ A;  1IJ6 A;  4OVN F;  3AAJ A;  1YVH A;  3LK1 A;  1WRK A;  4PHJ A;  3CR5 X;  4MZK A;  2LHL A;  4C0J A;  3BUM B;  1QX5 B;  1B8L A;  1OZO A;  4M2P A;  2MLF C;  1WDC B;  2M3W A;  1KK8 C;  3NSI A;  1S1E A;  1SMG A;  1KQM C;  2KI6 D;  2LMV A;  4R1E A;  4WQ2 A;  2K8M B;  1SYM A;  1A29 A;  4YGB B;  4NDD A;  1RTP 1;  3D10 A;  5AER A;  3I5G C;  3TS5 C;  5CSN A;  4PHN A;  4F0Z B;  2JXC A;  1BJF A;  4BY4 A;  1M45 A;  4MN0 A;  1H4B A;  1NUB A;  3WNX B;  4AQI A;  4Q04 A;  1EXR A;  4WRI A;  4YI9 A;  2SCP A;  4ORB B;  1CM4 A;  1QTX A;  1YRU B;  3AKA A;  2PMY A;  4ORC B;  4YGC B;  1RJV A;  2LCP A;  3SG5 A;  2L98 A;  1SCM B;  1UUS A;  4P5O E;  3RLZ A;  3EKH A;  1NSH A;  4PCW A;  1K96 A;  1J1D A;  4PE1 A;  2BCB A;  1K93 D;  1SKT A;  1Y1A A;  2LM5 A;  2M97 A;  1KFX L;  3CZT X;  1LIN A;  4CFQ A;  1SR6 C;  1DTL A;  3HCM A;  2KI4 C;  2GGZ A;  4D1E A;  1QIW A;  1FBV A;  1VRK A;  1CNP A;  4HRG A;  1GGZ A;  2HPS A;  4MZJ A;  2LLS A;  2BEC A;  1K95 A;  2JOJ A;  2JU0 A;  4PE0 A;  1H8B A;  3KHE A;  1IWQ A;  2HQ8 A;  4GGF A;  5IBW A;  2JTT A;  1LA0 A;  4MLW A;  5CSI A;  5ER5 A;  1FPW A;  1JWD A;  1BMO A;  2IS9 A;  1YR5 A;  2M1K B;  4OV2 A;  2EC6 B;  1TNW A;  1CDL A;  1IQ3 A;  1UHI A;  4QJ3 B;  3O2P A;  1F70 A;  1CLB A;  2NCO A;  3A8R A;  1MWN A;  2VRG A;  1M63 B;  2G9B A;  2M7L A;  3VRN A;  5I2O A;  4PE4 A;  1L7Z A;  1OQP A;  1JF0 A;  4PE7 A;  1F4O A;  3JTD C;  1ZOT B;  4NQG A;  1CKK A;  4FQO A;  4XYN A;  3BXK A;  3EK8 A;  3GOF A;  1NP8 A;  2Y5I A;  3WHT B;  1YUS A;  1K9P A;  3ICB A;  1MF8 B;  4AQJ A;  1CDN A;  5BPJ A;  1F8H A;  5F6T A;  5HLO A;  4CLN A;  1SL9 A;  3I5I B;  3EK7 A;  2WCE A;  1XFW O;  3TDU A;  3OB2 B;  5AFP A;  1TIZ A;  1DJY A;  3NXA A;  4DRW A;  1K2H A;  2JWW A;  1XK4 C;  2L0P A;  2MLE C;  2WCF A;  3I5F C;  3VRQ A;  1AJ4 A;  2LP3 A;  1U5I B;  1QAS A;  1DJI A;  4DS7 A;  1WRL A;  1S5G Z;  4YGE B;  1A75 B;  4YRU A;  2QAC A;  5I8N A;  5HKW A;  1WRZ A;  1FI5 A;  1CMF A;  4QJ4 B;  1S6J A;  1UHK A;  3GK1 A;  1DGV A;  2KAY A;  2AMI A;  4JPZ B;  2L50 A;  2NXQ A;  1TCF A;  1DJZ A;  3KO0 A;  2Y1N A;  3ZWH A;  1TRF A;  3ZNI A;  1GGW A;  2KDH A;  1R6P A;  2F33 A;  1D1O A;  1CFD A;  2K7O A;  1YX7 A;  1S6I A;  3BUN B;  3EK4 A;  1SBJ A;  1GJY A;  4I5J A;  1XFU O;  2ZRT A;  1HT9 A;  1FF1 A;  3OP0 A;  1C07 A;  4U8D A;  2FCE A;  3CGA A;  2LNK A;  4OKH A;  1WLM A;  3IF7 A;  2F3Z A;  5GQQ C;  1F54 A;  2FJU B;  1Y1X A;  1KQV A;  1DMO A;  1BLQ A;  1KK7 Z;  1MXL C;  1FI6 A;  1J55 A;  1CFP A;  2LAP A;  2MA2 A;  3CR4 X;  2BBN A;  1TNX A;  1CLM A;  3NSK A;  1NCX A;  1OMV A;  3PN7 B;  5ER4 X;  4WQ3 A;  4OCI A;  3BUX B;  2LE9 B;  3DF0 B;  2JT3 A;  4USL A;  1MUX A;  3IQO A;  1KCY A;  3PAT A;  2LVV A;  4YGD B;  1XFV O;  3VRO A;  1U5I A;  1TTX A;  4C0L A;  3CLN A;  1PSB A;  1MXE A;  1UUR A;  2K7C A;  2MRD A;  1A75 A;  3D0Y B;  1JF2 A;  1J1E A;  3I5F B;  1DF0 A;  3A4U B;  1IG5 A;  1QLS A;  2BE6 A;  2KQ6 A;  1CMG A;  1SL7 A;  2EC6 C;  5CPV A;  2LMU A;  4M2O A;  4A4C A;  1RK9 A;  2I94 A;  2LLT A;  3PFV A;  3F45 A;  4GBA A;  4DUQ A;  3BUW B;  1YTZ C;  4UPG A;  1IKU A;  1JSA A;  1CDM A;  5I2L A;  2L5X B;  2E6W A;  1LKJ A;  2CCM A;  2P6B B;  2BL0 B;  1A03 A;  2KFG A;  1PSR A;  2PSR A;  1G4Y R;  2KFH A;  2SAS A;  5DKQ A;  2JT8 A;  4IL1 A;  1BG1 A;  1XFX O;  2CT9 A;  1OZS A;  1NIW A;  1ALW A;  1UHJ A;  3E3R A;  3BOW B;  1QS7 A;  2K7B A;  4P2Y B;  3I5H B;  3DVK A;  3RM1 A;  1JBA A;  3M0W A;  4CPV A;  2L4H A;  4JWQ A;  4CFR A;  3I5I C;  1SRA A;  5AAN A;  2I7A A;  2HF5 A;  1K94 A;  2Q4U A;  3DF0 A;  2Q91 A;  4PHK A;  1LA3 A;  2KI6 C;  2LLU A;  1EG4 A;  2WOR A;  4C0K A;  4DIR A;  1EG3 A;  2F2P A;  1CLL A;  1L2O B;  1XK4 A;  1M46 A;  2JPT A;  1K90 D;  2F3Y A;  2K61 A;  4JQ0 D;  4GFT A;  3TDI A;  1QV1 A;  4YGA A;  4ORA B;  2H2K A;  3BUO B;  1SL8 A;  1XO5 A;  4HRH A;  1HQV A;  4HSZ A;  4GPL B;  1XA5 A;  2L4I A;  1OMD A;  1QIV A;  2V53 A;  1DGU A;  2K0J A;  2JNF A;  4FTG A;  4MVF A;  1NX1 A;  2OTG B;  4E68 A;  1V1G A;  1ZAC A;  1J7Q A;  1W7I B;  2D8N A;  1KFU S;  2M1U A;  2ZN8 A;  4GGN A;  2PAL A;  1EJ3 A;  2LVJ A;  1ZMZ A;  3JVT C;  2A4J A; 
#chains in the Genus database with same CATH topology
 3BOW A;  1IQ5 A;  1CDP A;  1N0Y A;  1J7P A;  2KGB C;  3FS7 A;  4HRE E;  2MHH A;  1KWO B;  2BCX A;  3PSR A;  2ZNE A;  1J7R A;  1K8U A;  4N1G A;  1C7W A;  3WHU B;  1B1G A;  2LHI A;  2QEV A;  2KOT A;  4I5K A;  1SW8 A;  3PN7 C;  2JRF A;  1BOC A;  1XFY O;  1E8A A;  1BF5 A;  1RFJ A;  4A4B A;  3UO9 A;  3PLF B;  1QVI Y;  3OB1 B;  1KSO A;  1YUR A;  1JFK A;  5K89 A;  3CZ0 A;  3EVR A;  1EL4 A;  1ODB A;  1TNP A;  1Q80 A;  1NCZ A;  1UHN A;  2JXL A;  3LL8 B;  1B9A A;  2QEH A;  1SPY A;  3SJS A;  1Y6W A;  1YX8 A;  1MQ1 A;  2K2A A;  1QX2 A;  3C1V A;  3CR2 A;  2JTZ A;  2DOQ A;  5KTY A;  2FOT A;  2KYF A;  2KYC A;  1GQM A;  4L9M A;  3EVV A;  1CB1 A;  1FW4 A;  1KK7 Y;  2JC2 A;  2LVI A;  5D7F A;  3SG2 A;  1OOF A;  2BCA A;  2P71 A;  4MRX A;  2KNE A;  5AEQ A;  1R2U A;  1QJT A;  1QLK A;  2BL0 C;  1DJH A;  1YUU A;  5CSJ A;  2K7D A;  5EL2 A;  4ICB A;  1TOP A;  2F8P A;  1IJ5 A;  2KFF A;  4NDB A;  1W9Z A;  3WXA A;  1NX0 A;  3OX6 A;  3I5H C;  4N5X A;  2QEO A;  3HX4 A;  3JVT B;  1TUJ A;  2F2O A;  2JPO A;  1B8C A;  3QRX A;  1BR4 B;  2RGI A;  1CM1 A;  2WCB A;  1S3P A;  1IRJ A;  3DXL A;  1ZFS A;  1C3Y A;  5HKY A;  2H61 A;  4GUK A;  3VRP A;  3DVM A;  2QDI A;  1XYD A;  2KHN A;  2L2E A;  2O60 A;  1NX3 A;  1QX7 A;  4XJK B;  1WLZ A;  4IJ7 A;  5CSF A;  1DJX A;  3SS4 A;  4TNC A;  1KFU L;  1J7O A;  1JC2 A;  3L4A A;  5DKR A;  1L2O C;  3EVU A;  4MZL A;  2JZI A;  3CZ2 A;  1RRO A;  2TN4 A;  1WY9 A;  1OMR A;  2K2F A;  5J3X A;  1XVJ A;  5FYX A;  2LMT A;  2ZRS A;  1AUI B;  2O5G A;  1AK8 A;  1SK6 D;  2OS8 C;  3EKJ A;  2OTG C;  3OHM B;  3AAK A;  1MR8 A;  3LCP C;  2LP2 A;  3PM8 A;  1CFF A;  3L47 A;  1Y1U A;  2CTN A;  2JQ6 A;  1TUZ A;  2Y4Q A;  3D75 A;  3PJI A;  4PT1 A;  1B7T Z;  1UHH A;  3NSO A;  2PAS A;  1CTR A;  2JNX A;  3K21 A;  4GNK B;  4MEW A;  3S0A A;  4I5L B;  1G8I A;  1YRT B;  2LAN A;  2L5Y A;  3FWB A;  1OOJ A;  4MSP A;  3N7H A;  4QJ5 B;  1TNQ A;  1KWO C;  2KAV A;  3O6B A;  1F71 A;  2Y1M A;  5PAL A;  3BQ3 A;  4CID A;  5DKN A;  1A2X A;  3SG3 A;  2AAO A;  2E30 A;  3B86 A;  2KBI A;  1A4P A;  2MAZ A;  1C7V A;  1N2D A;  4PHM A;  3SIB A;  2H61 C;  1CFC A;  1Z2C B;  1M39 A;  4XJK A;  4N1F A;  5I2Q A;  2GV5 A;  3O4X A;  1DT7 B;  5B8I B;  2JT0 A;  1NCY A;  1M31 A;  2KGR A;  1IH0 A;  2BKH B;  3BJH A;  1B4C A;  2HET A;  3SG6 A;  2ISD A;  3H4S E;  1IGV A;  3D0Y A;  3FWC A;  5D3O A;  1LS8 A;  1PAL A;  4BY5 A;  1OE9 B;  2KSP A;  4DCK A;  2MJW B;  1RWY A;  3FIA A;  3FE8 A;  2EHB A;  3KPX A;  2PYQ A;  4MBE A;  2WC8 A;  3SS3 A;  3QME A;  1LXF C;  1N65 A;  3TUY B;  1JFJ A;  1UP5 A;  1NX2 A;  3CDN A;  1SY9 A;  2CBL A;  5JOL A;  3R1V A;  2B1U A;  2OS8 B;  1AVS A;  1REC A;  4NDC A;  1TN4 A;  2M9G A;  3DZT A;  4PAL A;  4OZD A;  4ZCU A;  1MHO A;  2BBM A;  3SG7 A;  2L2C A;  2HQW A;  1KK8 B;  2R2I A;  2M7N A;  3CTN A;  1YUT A;  1DQE A;  1KQM B;  2I2R E;  3VRR A;  1NPQ A;  1S26 D;  3MSE B;  5TNC A;  3BFH A;  3NSL A;  3GK2 A;  1YVL A;  1BR1 B;  1DJG A;  5HYD A;  3GK4 X;  3I5G B;  3TS5 B;  4C0L A;  1S5G Y;  2M49 B;  2WOS A;  1ZUZ A;  3PAL A;  3LLE A;  3UNW A;  5KSZ A;  2I18 A;  2K60 A;  1Y0V H;  3S0B A;  4ZCV A;  1K9U A;  1NYA A;  2LUC A;  4YI8 A;  2KBM A;  1TCO B;  1JUO A;  3FE6 A;  2LUX A;  2ZND A;  3SS5 A;  2GTE A;  2OPO A;  4MRY A;  2KQY A;  2KAX A;  1V1F A;  3BYA A;  5HLV A;  1BOD A;  1BU3 A;  1PK0 D;  2LC5 A;  2WC6 A;  1QAT A;  1QXP A;  2ZKM X;  3S0D A;  1B47 A;  1SNL A;  5KU1 A;  1DVI A;  4ETO A;  2LV7 A;  4GAO A;  5JJG A;  2NZ0 A;  3S0F A;  2M8U A;  3B7A A;  2BE4 A;  1BT6 A;  1SCV A;  1XFZ O;  3B6X A;  3CS1 A;  2ZN9 A;  1F55 A;  3SIA A;  1G33 A;  1F4Q A;  2NCP A;  1AP4 A;  2GGM A;  4AOM A;  2YGU A;  1S6C A;  1WDC C;  1PRW A;  3DVJ A;  3DD4 A;  1PVA A;  1NWD A;  1UWO A;  2ERB A;  1LVC D;  2BKI B;  2NLN A;  3TZ1 A;  1SR6 B;  4M2Q A;  2M29 A;  2KI4 B;  2COL B;  3NHT A;  2WCJ A;  4I5N B;  1PVB A;  5D69 A;  1S36 A;  1W7J B;  2KLE A;  3BFA A;  2MBX A;  2G2B A;  2PVB A;  3FE9 A;  1DJW A;  2JUL A;  3O78 A;  3KEV A;  4YBH B;  4GGF C;  4PDZ A;  1KSM A;  2PRU A;  3DVE A;  3L4L A;  1DF0 B;  2CNP A;  2FCD A;  2L51 A;  2CXJ A;  2ZFD A;  4OR9 B;  5G08 A;  1KFX S;  4F7F A;  3R1P A;  1QV0 A;  5AXI A;  1EH2 A;  1XFR A;  5HKZ A;  2QPT A;  1B7T Y;  1AHR A;  1SCM C;  2M0R A;  3PM2 A;  2AUC A;  1AJ5 A;  1X02 A;  3TDZ A;  3O4Y A;  1QVI Z;  2LVK A;  2EGD A;  3CWG A;  1B8R A;  3AKB A;  3KF9 A;  1ORG A;  3CZ1 A;  3OX5 A;  1OSA A;  2BAP A;  2WND A;  3TUY C;  1PUL A;  1ALV A;  1K9K A;  3SG4 A;  3VGO A;  3LK0 A;  3JTD B;  3IQQ A;  1IJ6 A;  4OVN F;  3AAJ A;  1YVH A;  2BNX A;  3LK1 A;  3CAB A;  1WRK A;  4PHJ A;  3CR5 X;  4MZK A;  2LHL A;  4C0J A;  3BUM B;  1QX5 B;  1B8L A;  1OZO A;  4M2P A;  2MLF C;  1WDC B;  4JKT A;  3OGN A;  2M3W A;  1KK8 C;  3NSI A;  2WCH A;  3VB1 A;  1S1E A;  1SMG A;  1KQM C;  2KI6 D;  2LMV A;  4R1E A;  4WQ2 A;  2K8M B;  3R72 A;  1SYM A;  1A29 A;  4YGB B;  4NDD A;  1RTP 1;  3D10 A;  5AER A;  1Z4H A;  3I5G C;  3TS5 C;  5CSN A;  4PHN A;  4F0Z B;  2JXC A;  1BJF A;  1QWV A;  4BY4 A;  1M45 A;  4MN0 A;  1H4B A;  1NUB A;  3WNX B;  4AQI A;  4Q04 A;  1EXR A;  4WRI A;  4YI9 A;  2SCP A;  1OOH A;  4ORB B;  3RZS A;  1CM4 A;  1QTX A;  1YRU B;  3AKA A;  2PMY A;  4ORC B;  4YGC B;  1RJV A;  2LCP A;  3SG5 A;  2L98 A;  1SCM B;  1UUS A;  4KYN A;  4P5O E;  3RLZ A;  3EKH A;  2WC5 A;  1NSH A;  2FJY A;  4PCW A;  1K96 A;  1J1D A;  4PE1 A;  2BCB A;  1K93 D;  1SKT A;  1Y1A A;  2LM5 A;  2M97 A;  1KFX L;  3CZT X;  1LIN A;  4CFQ A;  1SR6 C;  1DTL A;  3HCM A;  2KI4 C;  4JD9 A;  2GGZ A;  4D1E A;  1T14 A;  1QIW A;  1FBV A;  1VRK A;  1CNP A;  4HRG A;  1GGZ A;  2HPS A;  4MZJ A;  2LLS A;  2BEC A;  3B88 A;  3CYZ A;  1K95 A;  2JOJ A;  2JU0 A;  3DYE A;  4PE0 A;  1IIO A;  1H8B A;  3KHE A;  3EG5 B;  1IWQ A;  2HQ8 A;  4GGF A;  5IBW A;  2JTT A;  1LA0 A;  4MLW A;  5CSI A;  5ER5 A;  1FPW A;  1JWD A;  1BMO A;  2IS9 A;  1YR5 A;  2M1K B;  4OV2 A;  2EC6 B;  1OOI X;  1TNW A;  3B87 A;  1CDL A;  1IQ3 A;  1UHI A;  4QJ3 B;  3O2P A;  1F70 A;  1CLB A;  3S0G A;  2NCO A;  3A8R A;  1MWN A;  2VRG A;  1M63 B;  2G9B A;  2M7L A;  3VRN A;  5I2O A;  4PE4 A;  1L7Z A;  1OQP A;  1JF0 A;  4PE7 A;  1F4O A;  3JTD C;  1ZOT B;  4NQG A;  1CKK A;  4FQO A;  4XYN A;  5HL1 A;  3BXK A;  3EK8 A;  3GOF A;  1NP8 A;  2Y5I A;  3WHT B;  1YUS A;  1K9P A;  3ICB A;  1MF8 B;  4AQJ A;  1CDN A;  5BPJ A;  1F8H A;  5F6T A;  5HLO A;  4CLN A;  1SL9 A;  3I5I B;  3EK7 A;  3NGV A;  2WCE A;  1XFW O;  3TDU A;  3OB2 B;  5AFP A;  1TIZ A;  1DJY A;  3NXA A;  4DRW A;  1K2H A;  2JWW A;  1XK4 C;  2L0P A;  2MLE C;  2WCF A;  3I5F C;  3OBV A;  3VRQ A;  1AJ4 A;  2LP3 A;  1U5I B;  1QAS A;  1DJI A;  4DS7 A;  1WRL A;  1S5G Z;  4YGE B;  1A75 B;  4YRU A;  2QAC A;  5I8N A;  5HKW A;  1WRZ A;  1FI5 A;  1CMF A;  4QJ4 B;  1S6J A;  1UHK A;  3GK1 A;  1DGV A;  2KAY A;  2AMI A;  4JPZ B;  2L50 A;  2NXQ A;  4INW A;  1TCF A;  1DJZ A;  3KO0 A;  2Y1N A;  3ZWH A;  2H8V A;  1TRF A;  2KPH A;  3ZNI A;  1GGW A;  2KDH A;  1R6P A;  2F33 A;  3BFB A;  1D1O A;  1CFD A;  2K7O A;  1YX7 A;  1S6I A;  3BUN B;  3EK4 A;  1SBJ A;  1GJY A;  3K1E A;  4I5J A;  1XFU O;  2ZRT A;  1HT9 A;  1FF1 A;  3OP0 A;  1C07 A;  4U8D A;  2FCE A;  3CGA A;  2LNK A;  4OKH A;  1WLM A;  3IF7 A;  2F3Z A;  5GQQ C;  3DY9 A;  1F54 A;  2WCM A;  2FJU B;  1Y1X A;  1KQV A;  1DMO A;  1BLQ A;  1KK7 Z;  1MXL C;  1FI6 A;  1J55 A;  1CFP A;  5I94 A;  2LAP A;  2MA2 A;  1DC1 A;  3CR4 X;  2BBN A;  1TNX A;  1CLM A;  3NSK A;  1NCX A;  1OMV A;  3PN7 B;  5ER4 X;  4WQ3 A;  4OCI A;  3BUX B;  2LE9 B;  3DF0 B;  2JT3 A;  4USL A;  1MUX A;  3IQO A;  1KCY A;  3PAT A;  2LVV A;  4YGD B;  1XFV O;  3VRO A;  1U5I A;  1TTX A;  1TWO A;  3CLN A;  1PSB A;  1MXE A;  1UUR A;  2K7C A;  2MRD A;  1A75 A;  3D0Y B;  3IVT A;  1JF2 A;  1J1E A;  3I5F B;  1DF0 A;  3A4U B;  1IG5 A;  1P28 A;  1QLS A;  2BE6 A;  4INX A;  2KQ6 A;  1CMG A;  1SL7 A;  1SSE B;  2EC6 C;  5CPV A;  2LMU A;  4M2O A;  2WCK A;  2WCL A;  4A4C A;  1RK9 A;  2I94 A;  2LLT A;  3PFV A;  3F45 A;  4GBA A;  4DUQ A;  3BUW B;  1YTZ C;  4UPG A;  1IKU A;  1JSA A;  1CDM A;  5I2L A;  2L5X B;  2E6W A;  1LKJ A;  2CCM A;  3Q8I A;  2P6B B;  3D76 A;  2BL0 B;  1A03 A;  2KFG A;  1C3Z A;  1PSR A;  2PSR A;  1G4Y R;  5FI7 A;  2KFH A;  2SAS A;  5DKQ A;  2JT8 A;  4IL1 A;  1BG1 A;  1XFX O;  3R1O A;  2CT9 A;  1OZS A;  4FQT A;  1NIW A;  1ALW A;  1UHJ A;  3E3R A;  3BOW B;  1QS7 A;  2K7B A;  3D73 A;  3I5H B;  4P2Y B;  3DVK A;  3RM1 A;  1JBA A;  3M0W A;  4CPV A;  2L4H A;  4JWQ A;  4CFR A;  1OW4 A;  5DIC A;  3I5I C;  1SRA A;  5AAN A;  2I7A A;  2HF5 A;  1K94 A;  3NHI A;  2Q4U A;  3DF0 A;  2Q91 A;  4PHK A;  1LA3 A;  2KI6 C;  2LLU A;  1EG4 A;  2WOR A;  4C0K A;  5FI2 A;  4DIR A;  1EG3 A;  2F2P A;  1CLL A;  1L2O B;  1XK4 A;  1M46 A;  2JPT A;  1K90 D;  2F3Y A;  2K61 A;  3D77 A;  3D74 A;  4GFT A;  4JQ0 D;  1QV1 A;  4YGA A;  3TDI A;  4ORA B;  5FI6 A;  2PQL A;  2H2K A;  3BUO B;  1DEL A;  1SL8 A;  1XO5 A;  1HQV A;  4HRH A;  4HSZ A;  3S0E A;  4GPL B;  1XA5 A;  1OOG A;  2L4I A;  1OMD A;  1QIV A;  2KLD A;  2V53 A;  1DGU A;  2K0J A;  2JNF A;  4FTG A;  4MVF A;  1NX1 A;  2OTG B;  3V2L A;  2P70 A;  4E68 A;  1V1G A;  1ZAC A;  1DEK A;  1GM0 A;  1J7Q A;  1W7I B;  3D78 A;  2QEB A;  2D8N A;  1KFU S;  2M1U A;  2ZN8 A;  4GGN A;  2PAL A;  1EJ3 A;  2LVJ A;  1ZMZ A;  3JVT C;  2A4J A; 
#chains in the Genus database with same CATH homology
 3BOW A;  1IQ5 A;  1CDP A;  1N0Y A;  1J7P A;  2KGB C;  3FS7 A;  4HRE E;  2MHH A;  1KWO B;  2BCX A;  3PSR A;  2ZNE A;  1J7R A;  1K8U A;  4N1G A;  1C7W A;  3WHU B;  1B1G A;  2LHI A;  2KOT A;  4I5K A;  1SW8 A;  3PN7 C;  2JRF A;  1BOC A;  1XFY O;  1E8A A;  1BF5 A;  1RFJ A;  4A4B A;  3PLF B;  1QVI Y;  3OB1 B;  1KSO A;  1YUR A;  1JFK A;  5K89 A;  3EVR A;  1EL4 A;  1ODB A;  1TNP A;  1Q80 A;  1NCZ A;  1UHN A;  2JXL A;  3LL8 B;  1B9A A;  1SPY A;  3SJS A;  1Y6W A;  1YX8 A;  1MQ1 A;  2K2A A;  1QX2 A;  3C1V A;  3CR2 A;  2JTZ A;  2DOQ A;  5KTY A;  2FOT A;  2KYF A;  2KYC A;  1GQM A;  4L9M A;  3EVV A;  1CB1 A;  1FW4 A;  1KK7 Y;  2JC2 A;  2LVI A;  5D7F A;  3SG2 A;  2BCA A;  4MRX A;  2KNE A;  5AEQ A;  1R2U A;  1QJT A;  1QLK A;  2BL0 C;  1DJH A;  1YUU A;  5CSJ A;  2K7D A;  4ICB A;  1TOP A;  2F8P A;  1IJ5 A;  2KFF A;  4NDB A;  3WXA A;  1NX0 A;  3OX6 A;  3I5H C;  4N5X A;  3HX4 A;  3JVT B;  2F2O A;  1B8C A;  3QRX A;  1BR4 B;  2RGI A;  1CM1 A;  2WCB A;  1S3P A;  1IRJ A;  1ZFS A;  5HKY A;  2H61 A;  4GUK A;  3VRP A;  3DVM A;  1XYD A;  2KHN A;  2L2E A;  2O60 A;  1NX3 A;  1QX7 A;  4XJK B;  1WLZ A;  5CSF A;  1DJX A;  4TNC A;  1KFU L;  1J7O A;  1JC2 A;  5DKR A;  1L2O C;  3EVU A;  4MZL A;  2JZI A;  1RRO A;  2TN4 A;  1WY9 A;  1OMR A;  2K2F A;  5J3X A;  1XVJ A;  5FYX A;  2LMT A;  2ZRS A;  1AUI B;  2O5G A;  1AK8 A;  1SK6 D;  2OS8 C;  3EKJ A;  2OTG C;  3OHM B;  3AAK A;  1MR8 A;  3LCP C;  2LP2 A;  3PM8 A;  1CFF A;  1Y1U A;  2CTN A;  2JQ6 A;  2Y4Q A;  1B7T Z;  1UHH A;  3NSO A;  2PAS A;  1CTR A;  2JNX A;  3K21 A;  4GNK B;  4MEW A;  4I5L B;  1G8I A;  1YRT B;  2LAN A;  3FWB A;  1OOJ A;  4MSP A;  4QJ5 B;  1TNQ A;  1KWO C;  2KAV A;  3O6B A;  1F71 A;  2Y1M A;  5PAL A;  3BQ3 A;  4CID A;  5DKN A;  1A2X A;  3SG3 A;  2AAO A;  2E30 A;  2KBI A;  1A4P A;  2MAZ A;  1C7V A;  1N2D A;  4PHM A;  3SIB A;  2H61 C;  1CFC A;  1M39 A;  4XJK A;  4N1F A;  5I2Q A;  2GV5 A;  1DT7 B;  5B8I B;  2JT0 A;  1NCY A;  1M31 A;  2KGR A;  1IH0 A;  2BKH B;  1B4C A;  2HET A;  3SG6 A;  2ISD A;  3H4S E;  1IGV A;  3D0Y A;  3FWC A;  4BY5 A;  1PAL A;  1OE9 B;  2KSP A;  4DCK A;  2MJW B;  1RWY A;  3FIA A;  2EHB A;  3KPX A;  4MBE A;  2WC8 A;  1LXF C;  1N65 A;  3TUY B;  1JFJ A;  1UP5 A;  1NX2 A;  1SY9 A;  2CBL A;  5JOL A;  2B1U A;  2OS8 B;  1AVS A;  1REC A;  4NDC A;  1TN4 A;  2M9G A;  4PAL A;  4ZCU A;  1MHO A;  2BBM A;  3SG7 A;  2HQW A;  1KK8 B;  2R2I A;  2M7N A;  3CTN A;  1YUT A;  1KQM B;  3VRR A;  2I2R E;  1NPQ A;  1S26 D;  3MSE B;  5TNC A;  3NSL A;  3GK2 A;  1YVL A;  1BR1 B;  1DJG A;  5HYD A;  3GK4 X;  3I5G B;  3TS5 B;  1S5G Y;  2M49 B;  2WOS A;  1ZUZ A;  3PAL A;  3LLE A;  5KSZ A;  2I18 A;  1Y0V H;  4ZCV A;  1K9U A;  1NYA A;  2LUC A;  4YI8 A;  2KBM A;  1TCO B;  1JUO A;  2LUX A;  2ZND A;  2OPO A;  4MRY A;  2KQY A;  2KAX A;  1V1F A;  3BYA A;  5HLV A;  1BOD A;  1BU3 A;  1PK0 D;  2LC5 A;  1QAT A;  1QXP A;  2ZKM X;  1B47 A;  1SNL A;  5KU1 A;  1DVI A;  4ETO A;  2LV7 A;  4GAO A;  5JJG A;  2NZ0 A;  2M8U A;  2BE4 A;  1BT6 A;  1SCV A;  1XFZ O;  3CS1 A;  2ZN9 A;  1F55 A;  3SIA A;  1G33 A;  1F4Q A;  2NCP A;  1AP4 A;  2GGM A;  4AOM A;  1S6C A;  1WDC C;  1PRW A;  3DVJ A;  3DD4 A;  1PVA A;  1NWD A;  1UWO A;  1LVC D;  2BKI B;  2NLN A;  3TZ1 A;  1SR6 B;  4M2Q A;  2M29 A;  2KI4 B;  2COL B;  4I5N B;  5D69 A;  1PVB A;  1S36 A;  1W7J B;  2MBX A;  2G2B A;  2PVB A;  1DJW A;  2JUL A;  3O78 A;  3KEV A;  4YBH B;  4GGF C;  4PDZ A;  1KSM A;  2PRU A;  3DVE A;  1DF0 B;  2CNP A;  2FCD A;  2L51 A;  2CXJ A;  2ZFD A;  4OR9 B;  5G08 A;  1KFX S;  1QV0 A;  5AXI A;  1EH2 A;  5HKZ A;  2QPT A;  1B7T Y;  1AHR A;  1SCM C;  2M0R A;  2AUC A;  1AJ5 A;  1X02 A;  3TDZ A;  3O4Y A;  1QVI Z;  2LVK A;  2EGD A;  3CWG A;  1B8R A;  3AKB A;  3KF9 A;  3OX5 A;  1OSA A;  2WND A;  3TUY C;  1PUL A;  1ALV A;  1K9K A;  3SG4 A;  3VGO A;  3LK0 A;  3JTD B;  3IQQ A;  1IJ6 A;  4OVN F;  3AAJ A;  1YVH A;  3LK1 A;  1WRK A;  4PHJ A;  3CR5 X;  4MZK A;  2LHL A;  4C0J A;  3BUM B;  1QX5 B;  1B8L A;  1OZO A;  4M2P A;  2MLF C;  1WDC B;  2M3W A;  1KK8 C;  3NSI A;  1S1E A;  1SMG A;  1KQM C;  2KI6 D;  2LMV A;  4R1E A;  4WQ2 A;  2K8M B;  1SYM A;  1A29 A;  4YGB B;  4NDD A;  1RTP 1;  3D10 A;  5AER A;  3I5G C;  3TS5 C;  5CSN A;  4PHN A;  4F0Z B;  2JXC A;  1BJF A;  4BY4 A;  1M45 A;  4MN0 A;  1H4B A;  1NUB A;  3WNX B;  4AQI A;  4Q04 A;  1EXR A;  4WRI A;  4YI9 A;  2SCP A;  4ORB B;  1CM4 A;  1QTX A;  1YRU B;  3AKA A;  2PMY A;  4ORC B;  4YGC B;  1RJV A;  2LCP A;  3SG5 A;  2L98 A;  1SCM B;  1UUS A;  4P5O E;  3RLZ A;  3EKH A;  1NSH A;  4PCW A;  1K96 A;  1J1D A;  4PE1 A;  2BCB A;  1K93 D;  1SKT A;  1Y1A A;  2LM5 A;  2M97 A;  1KFX L;  3CZT X;  1LIN A;  4CFQ A;  1SR6 C;  1DTL A;  3HCM A;  2KI4 C;  2GGZ A;  4D1E A;  1QIW A;  1FBV A;  1VRK A;  1CNP A;  4HRG A;  1GGZ A;  2HPS A;  4MZJ A;  2LLS A;  2BEC A;  1K95 A;  2JOJ A;  2JU0 A;  4PE0 A;  1H8B A;  3KHE A;  1IWQ A;  2HQ8 A;  4GGF A;  5IBW A;  2JTT A;  1LA0 A;  4MLW A;  5CSI A;  5ER5 A;  1FPW A;  1JWD A;  1BMO A;  2IS9 A;  1YR5 A;  2M1K B;  4OV2 A;  2EC6 B;  1TNW A;  1CDL A;  1IQ3 A;  1UHI A;  4QJ3 B;  3O2P A;  1F70 A;  1CLB A;  2NCO A;  3A8R A;  1MWN A;  2VRG A;  1M63 B;  2G9B A;  2M7L A;  3VRN A;  5I2O A;  4PE4 A;  1L7Z A;  1OQP A;  1JF0 A;  4PE7 A;  1F4O A;  3JTD C;  1ZOT B;  4NQG A;  1CKK A;  4FQO A;  4XYN A;  3BXK A;  3EK8 A;  3GOF A;  1NP8 A;  2Y5I A;  3WHT B;  1YUS A;  1K9P A;  3ICB A;  1MF8 B;  4AQJ A;  1CDN A;  5BPJ A;  1F8H A;  5F6T A;  5HLO A;  4CLN A;  1SL9 A;  3I5I B;  3EK7 A;  2WCE A;  1XFW O;  3TDU A;  3OB2 B;  5AFP A;  1TIZ A;  1DJY A;  3NXA A;  4DRW A;  1K2H A;  2JWW A;  1XK4 C;  2L0P A;  2MLE C;  2WCF A;  3I5F C;  3VRQ A;  1AJ4 A;  2LP3 A;  1U5I B;  1QAS A;  1DJI A;  4DS7 A;  1WRL A;  1S5G Z;  4YGE B;  1A75 B;  4YRU A;  2QAC A;  5I8N A;  5HKW A;  1WRZ A;  1FI5 A;  1CMF A;  4QJ4 B;  1S6J A;  1UHK A;  3GK1 A;  1DGV A;  2KAY A;  2AMI A;  4JPZ B;  2L50 A;  2NXQ A;  1TCF A;  1DJZ A;  3KO0 A;  2Y1N A;  3ZWH A;  1TRF A;  3ZNI A;  1GGW A;  2KDH A;  1R6P A;  2F33 A;  1D1O A;  1CFD A;  2K7O A;  1YX7 A;  1S6I A;  3BUN B;  3EK4 A;  1SBJ A;  1GJY A;  4I5J A;  1XFU O;  2ZRT A;  1HT9 A;  1FF1 A;  3OP0 A;  1C07 A;  4U8D A;  2FCE A;  3CGA A;  2LNK A;  4OKH A;  1WLM A;  3IF7 A;  2F3Z A;  5GQQ C;  1F54 A;  2FJU B;  1Y1X A;  1KQV A;  1DMO A;  1BLQ A;  1KK7 Z;  1MXL C;  1FI6 A;  1J55 A;  1CFP A;  2LAP A;  2MA2 A;  3CR4 X;  2BBN A;  1TNX A;  1CLM A;  3NSK A;  1NCX A;  1OMV A;  3PN7 B;  5ER4 X;  4WQ3 A;  4OCI A;  3BUX B;  2LE9 B;  3DF0 B;  2JT3 A;  4USL A;  1MUX A;  3IQO A;  1KCY A;  3PAT A;  2LVV A;  4YGD B;  1XFV O;  3VRO A;  1U5I A;  1TTX A;  4C0L A;  3CLN A;  1PSB A;  1MXE A;  1UUR A;  2K7C A;  2MRD A;  1A75 A;  3D0Y B;  1JF2 A;  1J1E A;  3I5F B;  1DF0 A;  3A4U B;  1IG5 A;  1QLS A;  2BE6 A;  2KQ6 A;  1CMG A;  1SL7 A;  2EC6 C;  5CPV A;  2LMU A;  4M2O A;  4A4C A;  1RK9 A;  2I94 A;  2LLT A;  3PFV A;  3F45 A;  4GBA A;  4DUQ A;  3BUW B;  1YTZ C;  4UPG A;  1IKU A;  1JSA A;  1CDM A;  5I2L A;  2L5X B;  2E6W A;  1LKJ A;  2CCM A;  2P6B B;  2BL0 B;  1A03 A;  2KFG A;  1PSR A;  2PSR A;  1G4Y R;  2KFH A;  2SAS A;  5DKQ A;  2JT8 A;  4IL1 A;  1BG1 A;  1XFX O;  2CT9 A;  1OZS A;  1NIW A;  1ALW A;  1UHJ A;  3E3R A;  3BOW B;  1QS7 A;  2K7B A;  4P2Y B;  3I5H B;  3DVK A;  3RM1 A;  1JBA A;  3M0W A;  4CPV A;  2L4H A;  4JWQ A;  4CFR A;  3I5I C;  1SRA A;  5AAN A;  2I7A A;  2HF5 A;  1K94 A;  2Q4U A;  3DF0 A;  2Q91 A;  4PHK A;  1LA3 A;  2KI6 C;  2LLU A;  1EG4 A;  2WOR A;  4C0K A;  4DIR A;  1EG3 A;  2F2P A;  1CLL A;  1L2O B;  1XK4 A;  1M46 A;  2JPT A;  1K90 D;  2F3Y A;  2K61 A;  4JQ0 D;  4GFT A;  3TDI A;  1QV1 A;  4YGA A;  4ORA B;  2H2K A;  3BUO B;  1SL8 A;  1XO5 A;  4HRH A;  1HQV A;  4HSZ A;  4GPL B;  1XA5 A;  2L4I A;  1OMD A;  1QIV A;  2V53 A;  1DGU A;  2K0J A;  2JNF A;  4FTG A;  4MVF A;  1NX1 A;  2OTG B;  4E68 A;  1V1G A;  1ZAC A;  1J7Q A;  1W7I B;  2D8N A;  1KFU S;  2M1U A;  2ZN8 A;  4GGN A;  2PAL A;  1EJ3 A;  2LVJ A;  1ZMZ A;  3JVT C;  2A4J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...