1OMVA

Non-myristoylated bovine recoverin (e85q mutant) with calcium bound to ef-hand 3
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
191
structure length
188
Chain Sequence
GALSKEILEELQLNTKFTEEELSSWYQSFLKECPSGRITRQEFQTIYSKFFPEADPKAYAQHVFRSFDDGTLDFKQYVIALHMTSAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVTAIFKMISPEDTKHLPEDENTPEKRAEKIWGFFGKKDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords recoverin
publication title Impact of N-terminal myristoylation on the Ca2+-dependent conformational transition in recoverin
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein
total genus 74
structure length 188
sequence length 191
ec nomenclature
pdb deposition date 2003-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1omvA02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1omvA01
1QIWA 1HQVA 4TNCA 3ZNIA 1H8BA 1IH0A 4CLNA 2P6BB 2LUCA 1S5GZ 2BL0B 2LNKA 4M2OA 2M7LA 1NCYA 2KSPA 1QTXA 1NCXA 2JOJA 2LHLA 4PE4A 3NSOA 2ZKMX 2D8NA 3KHEA 3JVTB 4PHJA 1N65A 4ZCUA 3OP0A 3TDZA 1B7TY 1AJ5A 2BCAA 2WCBA 1KWOB 1C07A 3EKHA 1AK8A 3I5FC 1EL4A 1MXLC 1NWDA 1XVJA 2AAOA 2LVIA 4IL1A 4D1EA 3FWBA 1WLZA 1DF0A 1SW8A 2HQWA 2QACA 3SG2A 2JZIA 2KGBC 2L5XB 2OS8C 4N1FA 3EKJA 3DVEA 1XYDA 1C7VA 1F71A 5I8NA 1WRZA 4QJ4B 1WDCC 3DVJA 3I5HC 4YI9A 4GGNA 1H4BA 1NX2A 1L2OC 1OMDA 4PE1A 3O78A 2O60A 4NQGA 1YRUB 2LV7A 3KEVA 1LVCD 3TS5B 1CDNA 3GOFA 1NX0A 3A8RA 2M8UA 1S6IA 3SG4A 2LC5A 4GFTA 2QPTA 3D10A 3LLEA 2F33A 1XFUO 2G2BA 1TCFA 5HLVA 1Y0VH 1KFXL 1WRKA 2KBIA 1CFDA 1XFYO 1B7TZ 5DKNA 3RM1A 1KSOA 5CSIA 4FQOA 3LCPC 1DJXA 4N1GA 4YGBB 2BECA 3I5GB 2LMUA 2E30A 2M29A 4I5NB 5AERA 4NDCA 4P2YB 1B8RA 3E3RA 1S1EA 4OV2A 5GQQC 1SR6B 1FI6A 3PLFB 3QRXA 4PE7A 1NP8A 4ZCVA 1IQ3A 3EK4A 2ZNEA 2FCEA 3PALA 3DVMA 4GPLB 4E68A 3BOWB 3NXAA 4MSPA 1NCZA 1DJWA 5CSFA 1TNXA 3MSEB 3CR4X 2M49B 2AMIA 3BXKA 2FJUB 3VRRA 3CZTX 4C0JA 1SY9A 1RROA 2JQ6A 3I5IB 1KFXS 3AAJA 1S3PA 2H2KA 3OX5A 1MHOA 3PN7B 1TN4A 4QJ3B 1S5GY 1DMOA 3BUXB 2PRUA 1KK7Z 1FPWA 1CLMA 1F8HA 1MWNA 1RECA 3SG5A 4GNKB 4YBHB 1LA0A 1DJHA 1NYAA 3RLZA 5FYXA 4QJ5B 1RJVA 2PVBA 1F70A 3LL8B 1OE9B 2NZ0A 4N5XA 3VRNA 5CSNA 4GGFC 5HKYA 5CSJA 1R2UA 2PSRA 1QJTA 4GUKA 1U5IB 1EJ3A 1UHKA 3JTDC 4I5JA 3PATA 1B8LA 4C0LA 1UHIA 1WRLA 2K7CA 4C0KA 1TNWA 3EVRA 1SBJA 2LP3A 1YR5A 4USLA 5HKZA 1BF5A 1Y1XA 1SL8A 1K8UA 1ZACA 2O5GA 3I5FB 3WNXB 2K7DA 1G8IA 5I2QA 1QVIZ 1BR4B 1GQMA 2GGZA 1UHHA 2SASA 1JF2A 2V53A 1DGVA 1UUSA 1DJIA 1K94A 2L4HA 2I94A 3BYAA 1SCMC 1QX2A 1OOJA 2JTZA 2OS8B 1Y1AA 4PDZA 5B8IB 2OPOA 3F45A 1QIVA 3VGOA 1CKKA 1WDCB 1BU3A 1QLKA 3I5HB 2Y1NA 2H61A 4CFRA 2JTTA 2KYFA 2BCBA 2KI4B 1NUBA 2HF5A 1ZMZA 1IRJA 1KFUL 5F6TA 1KK8B 1XK4C 2E6WA 4JWQA 2LANA 3BUMB 3TZ1A 2L51A 1XA5A 2KAXA 4P5OE 2A4JA 1MF8B 4HSZA 1B9AA 3O6BA 4GAOA 1OZSA 1JFJA 1XFWO 3EVVA 3FWCA 1N0YA 2JRFA 1C7WA 2B1UA 3DVKA 2ZRSA 1PRWA 4ICBA 2KDHA 2HETA 2LLSA 1D1OA 1J7RA 1SNLA 2JPTA 3CGAA 1MXEA 5JJGA 1EG4A 4AQJA 1KSMA 4YRUA 2MBXA 5HYDA 3KPXA 1NX3A 2LVKA 1PK0D 4L9MA 2I2RE 1GJYA 1QATA 3AKAA 2NCOA 3C1VA 1RWYA 4DIRA 1KK7Y 1JC2A 1KFUS 4ORBB 1BLQA 2GGMA 1CB1A 3BOWA 1QX5B 2EHBA 1M31A 1CFPA 2KNEA 2M3WA 1IGVA 4ORCB 1CTRA 3VRPA 4YGDB 3CR5X 5G08A 2F3ZA 2MRDA 1KQMC 4NDBA 5AEQA 5KSZA 1TNQA 1J7PA 4DUQA 2KOTA 1DJZA 2HQ8A 5HLOA 4HRHA 1DTLA 5K89A 1J1EA 1XFZO 2PALA 2PMYA 5IBWA 1CMFA 5AFPA 1EH2A 3IQOA 1B4CA 4MZLA 5KU1A 2KAYA 2Y4QA 3GK1A 1JSAA 2KFHA 2WCEA 1ODBA 1K90D 1S26D 4FTGA 4OKHA 2CXJA 4PE0A 1IKUA 3OB1B 3FS7A 3TUYC 4MEWA 4WQ2A 3WXAA 2TN4A 1M46A 3NSKA 4YI8A 3OX6A 1QVIY 1V1FA 2LVVA 2ZRTA 1U5IA 2CT9A 3KO0A 1QS7A 3IF7A 5CPVA 1IQ5A 2KGRA 4UPGA 4I5LB 1W7JB 3JTDB 2LLTA 4PCWA 2M1KB 5DKRA 4CPVA 1UURA 2CTNA 1SKTA 1QLSA 2LLUA 2IS9A 1BODA 2ZNDA 1AHRA 2MLFC 1BT6A 1BR1B 3HCMA 1RFJA 2LUXA 5ER4X 1QV1A 1CDPA 3OHMB 1J1DA 2GV5A 1F4OA 2EC6C 2KQYA 1NSHA 3I5GC 2KYCA 1A75A 4BY5A 1TNPA 2F2OA 3PM8A 2WOSA 2K61A 4BY4A 3SIBA 2BE4A 1SL7A 2L2EA 1SR6C 4I5KA 1DGUA 1SCMB 2OTGC 2Y5IA 4XYNA 2K7BA 5HKWA 1BG1A 1OMVA 1DJGA 1DT7B 1IWQA 1F4QA 1TOPA 1HT9A 1YTZC 4MBEA 1FF1A 2PASA 1QASA 2SCPA 4CFQA 3ZWHA 1J7QA 1AJ4A 1SCVA 4ETOA 2CBLA 2K2FA 1A75B 2JT3A 1OSAA 3D0YB 2LCPA 3OB2B 1OMRA 1YRTB 1NX1A 2K7OA 2L98A 3VRQA 1WLMA 1RK9A 1ZOTB 2CNPA 4U8DA 1S36A 2LM5A 1IG5A 1CNPA 2MLEC 2KFGA 1K93D 1X02A 4OR9B 2ZFDA 2KBMA 3NSIA 1LINA 3CTNA 5I2LA 2JT0A 1EXRA 2WCFA 4HRGA 1YX7A 1DVIA 2F8PA 1M39A 1SL9A 1S6CA 2KI6D 4JQ0D 1L2OB 2KAVA 3AKBA 4MZKA 4R1EA 1RTP1 2K0JA 3NSLA 2M1UA 3VROA 1TTXA 3SIAA 1UP5A 2JWWA 1UHNA 2M0RA 1CMGA 3DF0A 1ALVA 1YURA 1W7IB 1B47A 4M2PA 1A2XA 1JFKA 2F2PA 1ALWA 2BBMA 4Q04A 4WQ3A 2L50A 1KQMB 4HREE 1XO5A 4YGAA 1GGWA 1SMGA 5D69A 4WRIA 1AP4A 1BOCA 4PHMA 1SYMA 2F3YA 2M9GA 2L4IA 5DKQA 2KFFA 1ZFSA 2KI6C 1BMOA 1CLLA 3SG7A 2JULA 2BL0C 2FCDA 2JC2A 2JNXA 1YVLA 1KQVA 1TRFA 1NIWA 1PSBA 3WHTB 1KCYA 1LKJA 4PHKA 4PHNA 5AANA 2ZN9A 3JVTC 3DF0B 4ORAB 4MLWA 1XFXO 1E8AA 1N2DA 2K8MB 2LE9B 1UHJA 1KWOC 3ICBA 2KHNA 3CS1A 1CM4A 4GGFA 2MHHA 3TUYB 4DCKA 5KTYA 1MR8A 2JT8A 2WC8A 2WNDA 1PVBA 2KI4C 4GBAA 3M0WA 1UWOA 1K9KA 2VRGA 2NCPA 2BE6A 1K96A 3CWGA 3PFVA 1JBAA 3BUWB 1ZUZA 5JOLA 1KK8C 1OZOA 1AUIB 4MRYA 2BKIB 1B1GA 3O4YA 4AQIA 2BKHB 2FOTA 1XFVO 1YX8A 2I18A 2G9BA 1DF0B 1YVHA 4OVNF 3LK0A 1QXPA 3TDUA 5I2OA 1V1GA 1R6PA 1IJ5A 4MZJA 2Q91A 2LHIA 3GK2A 1F54A 5J3XA 3DD4A 2Q4UA 1Y1UA 3GK4X 2LVJA 1G33A 1K95A 2NLNA 4F0ZB 4JPZB 2EC6B 2H61C 1YUTA 2COLB 1A29A 1Y6WA 1LA3A 1FI5A 1K9PA 1MQ1A 1F55A 1IJ6A 1JF0A 3EK8A 3TS5C 3EK7A 1S6JA 1WY9A 2EGDA 5AXIA 2ISDA 1YUUA 2DOQA 4A4BA 2MAZA 1FW4A 2LMTA 3SG3A 1A4PA 2ZN8A 2OTGB 3A4UB 3BQ3A 4XJKA 1CFCA 1Q80A 4M2QA 2JNFA 1LXFC 1J7OA 5BPJA 3CLNA 1SPYA 2K2AA 1B8CA 2LMVA 1CLBA 3H4SE 3FIAA 1M63B 5D7FA 1XK4A 3D0YA 1G4YR 1PALA 3CR2A 4A4CA 1PVAA 4OCIA 3SG6A 1A03A 1TCOB 2CCMA 3BUNB 4YGCB 2BCXA 2MJWB 4MN0A 1AVSA 3PSRA 1BJFA 2AUCA 1QV0A 2WORA 3TDIA 2M97A 1VRKA 3SJSA 2HPSA 1JUOA 3AAKA 2I7AA 4MRXA 1GGZA 1SK6D 4XJKB 4NDDA 5ER5A 3I5IC 1CM1A 1QX7A 2LAPA 1CDMA 3O2PA 4CIDA 1YUSA 4YGEB 1CDLA 1OQPA 3PN7C 1SRAA 2NXQA 3IQQA 1PULA 1K2HA 1DJYA 2LP2A 1MUXA 1PSRA 1TIZA 2R2IA 2JU0A 1NPQA 4DRWA 2JXLA 4MVFA 5TNCA 3KF9A 1JWDA 3K21A 3WHUB 3HX4A 1CFFA 2KQ6A 2JXCA 2L0PA 3EVUA 1L7ZA 1FBVA 1J55A 1EG3A 1M45A 3LK1A 5PALA 4AOMA 4PALA 2MA2A 4DS7A 2Y1MA 1K9UA 3BUOB 2BBNA 2RGIA 2M7NA
chains in the Genus database with same CATH superfamily
1QIWA 1HQVA 4TNCA 3ZNIA 1H8BA 1IH0A 1P28A 4CLNA 2P6BB 2LUCA 1S5GZ 2BL0B 2LNKA 4M2OA 2WCKA 2M7LA 1NCYA 2KSPA 1QTXA 1NCXA 2JOJA 2LHLA 4PE4A 3NSOA 2ZKMX 3D75A 2D8NA 3KHEA 3JVTB 4PHJA 1N65A 4ZCUA 3OP0A 3TDZA 1B7TY 1AJ5A 2BCAA 2WCBA 1KWOB 1C07A 3EKHA 1AK8A 2PYQA 3I5FC 1EL4A 1MXLC 1NWDA 1XVJA 2AAOA 2LVIA 4IL1A 4D1EA 4F7FA 3FWBA 1WLZA 1DF0A 1SW8A 2HQWA 2QACA 3SG2A 2JZIA 2KGBC 2L5XB 2OS8C 4N1FA 3EKJA 3DVEA 1XYDA 1C7VA 1F71A 2KLDA 2QEOA 5D3OA 5I8NA 1WRZA 4QJ4B 1WDCC 3DVJA 3I5HC 4YI9A 4GGNA 1C3YA 3CZ1A 1H4BA 1NX2A 1L2OC 1OMDA 4PE1A 3O78A 2O60A 2ERBA 1TWOA 4NQGA 1YRUB 2LV7A 3KEVA 1LVCD 3TS5B 1CDNA 3GOFA 1NX0A 3A8RA 2M8UA 3NGVA 1S6IA 3SG4A 2LC5A 4GFTA 2QPTA 3D10A 3LLEA 2F33A 3D74A 1XFUO 2G2BA 3B6XA 1TCFA 5HLVA 1Y0VH 3DXLA 1KFXL 1WRKA 2KBIA 1CFDA 1XFYO 1B7TZ 2KPHA 5DKNA 3RM1A 1KSOA 5CSIA 4FQOA 3LCPC 1DJXA 4N1GA 4YGBB 2BECA 3S0FA 3I5GB 2LMUA 3K1EA 2E30A 2WCJA 2M29A 4I5NB 5AERA 4NDCA 4P2YB 1SSEB 1B8RA 4INWA 3E3RA 1S1EA 4OV2A 1TUZA 1SR6B 2WC6A 5GQQC 1FI6A 3PLFB 3QRXA 4PE7A 1NP8A 3CABA 3D77A 4ZCVA 1IQ3A 3EK4A 2ZNEA 2FCEA 3PALA 3DVMA 4GPLB 4E68A 3BOWB 3NXAA 4MSPA 1NCZA 1DJWA 5CSFA 1TNXA 3MSEB 3CR4X 2M49B 2AMIA 3BXKA 2FJUB 3VRRA 3CZTX 4C0JA 1SY9A 1RROA 2JQ6A 3I5IB 1KFXS 3AAJA 2WCMA 1S3PA 2K60A 2H2KA 3OX5A 1MHOA 3PN7B 1TN4A 4QJ3B 1S5GY 3DZTA 1DMOA 3BUXB 2PRUA 3BFBA 1KK7Z 1Z4HA 1FPWA 1CLMA 1F8HA 1MWNA 1RECA 3SG5A 4GNKB 4YBHB 1LA0A 3R1PA 1DJHA 1NYAA 3RLZA 5FYXA 1XFRA 3D76A 4QJ5B 1RJVA 2PVBA 4JKTA 1F70A 3LL8B 1OE9B 2NZ0A 4N5XA 3VRNA 5CSNA 4GGFC 5HKYA 5CSJA 1R2UA 2PSRA 1QJTA 4GUKA 1U5IB 1EJ3A 1UHKA 3JTDC 4I5JA 3PATA 1B8LA 4C0LA 1UHIA 1T14A 3CZ0A 1WRLA 2K7CA 3DYEA 4C0KA 1TNWA 3EVRA 3S0GA 1SBJA 2LP3A 1YR5A 4USLA 5HKZA 1BF5A 1Y1XA 1SL8A 1ZACA 1K8UA 2O5GA 2QEVA 3I5FB 3WNXB 2K7DA 1G8IA 5I2QA 1QVIZ 3B86A 1BR4B 1DQEA 1GQMA 2GGZA 1UHHA 2QEHA 2SASA 1JF2A 1LS8A 1DGVA 1UUSA 1DJIA 1K94A 2V53A 3R72A 2L4HA 2I94A 3BYAA 1SCMC 1QX2A 1OOJA 2JTZA 2OS8B 1Y1AA 4PDZA 5B8IB 2OPOA 3F45A 2GTEA 1QIVA 3L47A 3VGOA 1CKKA 1WDCB 3OGNA 1BU3A 1QLKA 3I5HB 2JPOA 2H61A 2Y1NA 4CFRA 2JTTA 2KYFA 2BCBA 2KI4B 1NUBA 2HF5A 1ZMZA 1IRJA 1KFUL 5F6TA 1KK8B 1XK4C 2E6WA 4JWQA 2LANA 3BUMB 3TZ1A 2L51A 3S0BA 1XA5A 2KAXA 4P5OE 2A4JA 1MF8B 4HSZA 1B9AA 3O6BA 4GAOA 1OZSA 1JFJA 1XFWO 3EVVA 3FWCA 1N0YA 2JRFA 1C7WA 2B1UA 3DVKA 2ZRSA 1PRWA 1OOGA 4ICBA 2KDHA 2HETA 2LLSA 3D73A 1D1OA 1J7RA 1SNLA 2JPTA 3S0EA 3CGAA 1MXEA 5JJGA 1EG4A 4AQJA 1KSMA 4YRUA 2MBXA 5HYDA 3KPXA 1NX3A 2LVKA 5HL1A 1PK0D 4L9MA 3DY9A 2I2RE 1GJYA 1QATA 3AKAA 3R1VA 2NCOA 3C1VA 1RWYA 2YGUA 4DIRA 1KK7Y 1JC2A 2P70A 1KFUS 4ORBB 1BLQA 2GGMA 1CB1A 3BOWA 1QX5B 2EHBA 1M31A 3FE9A 2KNEA 5DICA 1CFPA 2M3WA 1IGVA 2WCLA 4ORCB 1CTRA 3VRPA 4YGDB 3CR5X 5G08A 2F3ZA 2MRDA 1KQMC 4NDBA 5AEQA 5KSZA 1TNQA 1J7PA 4DUQA 2KOTA 1DJZA 2HQ8A 5HLOA 4HRHA 1DTLA 5K89A 1J1EA 1XFZO 3R1OA 2PALA 2PMYA 5IBWA 2WC5A 3CZ2A 1CMFA 5AFPA 1OW4A 1EH2A 4KYNA 3IQOA 1B4CA 2BAPA 4MZLA 5KU1A 2KAYA 2Y4QA 3GK1A 1JSAA 2KFHA 3NHIA 2WCEA 1ODBA 1K90D 1DC1A 1S26D 4FTGA 3BJHA 4OKHA 2CXJA 3CYZA 4PE0A 1IKUA 3OB1B 3FS7A 1GM0A 3TUYC 3S0DA 4MEWA 4WQ2A 3WXAA 2TN4A 2QDIA 1M46A 3NSKA 4YI8A 3OX6A 1QVIY 1V1FA 2LVVA 2ZRTA 1U5IA 5FI7A 2CT9A 3KO0A 4INXA 1QS7A 3IF7A 5CPVA 1IQ5A 2KGRA 3BFHA 4UPGA 3RZSA 4I5LB 1W7JB 5FI2A 3JTDB 2LLTA 4PCWA 2M1KB 5DKRA 4CPVA 1UURA 2CTNA 1SKTA 1QLSA 2L5YA 2LLUA 2IS9A 1BODA 2ZNDA 1AHRA 2MLFC 1BT6A 1BR1B 1Z2CB 3HCMA 1RFJA 2LUXA 5ER4X 1QV1A 1CDPA 3OHMB 1J1DA 2GV5A 1F4OA 2EC6C 2KQYA 1NSHA 3I5GC 2KYCA 3QMEA 3UNWA 1A75A 4BY5A 1TNPA 2F2OA 3PM8A 2WOSA 1DELA 2K61A 4BY4A 2WCHA 3SIBA 2BE4A 1SL7A 2L2EA 1SR6C 3B7AA 4I5KA 1DGUA 1SCMB 5EL2A 2OTGC 2Y5IA 3L4LA 4XYNA 2K7BA 5HKWA 1BG1A 1OMVA 1DJGA 1DT7B 3Q8IA 1IWQA 1F4QA 1TOPA 1HT9A 1YTZC 4MBEA 1FF1A 2PASA 1QASA 2SCPA 3B87A 3SS5A 4CFQA 3ZWHA 1J7QA 1AJ4A 1SCVA 1QWVA 2CBLA 2K2FA 1A75B 4ETOA 1OOIX 2JT3A 1OSAA 3D0YB 2LCPA 3CDNA 1OMRA 1YRTB 3OB2B 1NX1A 2K7OA 2L98A 3VRQA 1WLMA 1RK9A 1ZOTB 2CNPA 4U8DA 1S36A 2LM5A 1IG5A 3SS4A 2MLEC 1CNPA 2KFGA 1K93D 1X02A 3EG5B 4OR9B 2ZFDA 2KBMA 3NSIA 1LINA 3CTNA 4OZDA 5I2LA 3L4AA 2JT0A 1EXRA 2L2CA 2WCFA 4HRGA 1YX7A 1DVIA 2F8PA 1M39A 1SL9A 1S6CA 2KI6D 4JQ0D 1L2OB 2KAVA 3AKBA 3O4XA 4MZKA 4R1EA 1RTP1 2K0JA 3NSLA 2M1UA 3V2LA 3VROA 1TTXA 3SIAA 1UP5A 2JWWA 1UHNA 2M0RA 1CMGA 3DF0A 1ALVA 1YURA 1W7IB 1B47A 4M2PA 1A2XA 1JFKA 2F2PA 1ALWA 2BBMA 4Q04A 4WQ3A 2L50A 1KQMB 4HREE 1XO5A 4YGAA 1GGWA 1SMGA 5D69A 4WRIA 1AP4A 3OBVA 1BOCA 4PHMA 1SYMA 2F3YA 2M9GA 2L4IA 5DKQA 3PM2A 2KFFA 1OOHA 1ZFSA 2KI6C 1BMOA 1CLLA 3SG7A 3VB1A 3IVTA 2JULA 2BL0C 2FCDA 2JC2A 2JNXA 1YVLA 1KQVA 1ORGA 1TRFA 5I94A 1NIWA 1PSBA 3WHTB 1KCYA 1LKJA 4PHKA 4PHNA 5AANA 2ZN9A 3JVTC 3DF0B 4ORAB 4MLWA 1XFXO 1E8AA 1N2DA 2K8MB 2LE9B 1UHJA 1KWOC 3ICBA 4IJ7A 2KHNA 3CS1A 1CM4A 4GGFA 2FJYA 2MHHA 3TUYB 4DCKA 5KTYA 3D78A 1MR8A 2JT8A 2WC8A 2WNDA 1PVBA 2KI4C 4GBAA 3M0WA 1UWOA 1K9KA 2VRGA 2NCPA 2KLEA 2BE6A 1K96A 3CWGA 3PFVA 1JBAA 3BUWB 1ZUZA 1IIOA 5JOLA 1KK8C 1OZOA 1AUIB 4MRYA 2BKIB 1B1GA 3O4YA 4AQIA 2BKHB 2FOTA 1XFVO 1YX8A 2I18A 2G9BA 1DF0B 1YVHA 4OVNF 4PT1A 3LK0A 1QXPA 3TDUA 5I2OA 1V1GA 1R6PA 1IJ5A 1DEKA 1OOFA 2Q91A 2LHIA 4MZJA 3GK2A 1F54A 3NHTA 5J3XA 3DD4A 2Q4UA 1Y1UA 3GK4X 1W9ZA 2LVJA 1G33A 1K95A 2NLNA 4F0ZB 4JPZB 2EC6B 2H61C 1YUTA 2COLB 1A29A 2BNXA 1Y6WA 1LA3A 3FE8A 1K9PA 1FI5A 1MQ1A 1TUJA 1F55A 1IJ6A 1JF0A 3EK8A 3TS5C 3EK7A 1S6JA 1WY9A 2EGDA 3BFAA 5AXIA 5FI6A 1YUUA 2ISDA 3UO9A 2DOQA 4A4BA 2PQLA 2MAZA 1FW4A 2LMTA 3SG3A 1A4PA 2ZN8A 2OTGB 3A4UB 3BQ3A 4XJKA 3S0AA 1CFCA 1Q80A 4M2QA 2JNFA 1LXFC 1J7OA 5BPJA 3CLNA 1SPYA 2K2AA 1B8CA 2LMVA 1CLBA 3H4SE 3FIAA 1M63B 5D7FA 3FE6A 1C3ZA 1XK4A 3D0YA 1G4YR 1PALA 3CR2A 4A4CA 2H8VA 4FQTA 1PVAA 4OCIA 3SG6A 1A03A 1TCOB 2CCMA 3BUNB 4YGCB 2BCXA 2MJWB 4MN0A 1AVSA 3PSRA 1BJFA 2AUCA 1QV0A 2WORA 3SS3A 3TDIA 2M97A 1VRKA 3SJSA 2HPSA 1JUOA 2P71A 3AAKA 2I7AA 4MRXA 1GGZA 1SK6D 4XJKB 4NDDA 5ER5A 3I5IC 1CM1A 1QX7A 2LAPA 1CDMA 3O2PA 4CIDA 1YUSA 4YGEB 1CDLA 1OQPA 3PN7C 3N7HA 1SRAA 3PJIA 2NXQA 3IQQA 1PULA 1K2HA 1DJYA 2LP2A 3B88A 1MUXA 1PSRA 1TIZA 2QEBA 2R2IA 2JU0A 1NPQA 4DRWA 2JXLA 4MVFA 5TNCA 3KF9A 1JWDA 3K21A 3WHUB 3HX4A 1CFFA 2KQ6A 2JXCA 2L0PA 3EVUA 4JD9A 1L7ZA 1FBVA 1J55A 1EG3A 1M45A 3LK1A 5PALA 4AOMA 4PALA 2MA2A 4DS7A 2Y1MA 1K9UA 3BUOB 2BBNA 2RGIA 2M7NA
chains in the Genus database with same CATH topology
1QIWA 1HQVA 4TNCA 3ZNIA 1H8BA 1IH0A 4CLNA 2P6BB 2LUCA 1S5GZ 2BL0B 2LNKA 4M2OA 2M7LA 1NCYA 2KSPA 1QTXA 1NCXA 2JOJA 2LHLA 4PE4A 3NSOA 2ZKMX 2D8NA 3KHEA 3JVTB 4PHJA 1N65A 4ZCUA 3OP0A 3TDZA 1B7TY 1AJ5A 2BCAA 2WCBA 1KWOB 1C07A 3EKHA 1AK8A 3I5FC 1EL4A 1MXLC 1NWDA 1XVJA 2AAOA 2LVIA 4IL1A 4D1EA 3FWBA 1WLZA 1DF0A 1SW8A 2HQWA 2QACA 3SG2A 2JZIA 2KGBC 2L5XB 2OS8C 4N1FA 3EKJA 3DVEA 1XYDA 1C7VA 1F71A 5I8NA 1WRZA 4QJ4B 1WDCC 3DVJA 3I5HC 4YI9A 4GGNA 1H4BA 1NX2A 1L2OC 1OMDA 4PE1A 3O78A 2O60A 4NQGA 1YRUB 2LV7A 3KEVA 1LVCD 3TS5B 1CDNA 3GOFA 1NX0A 3A8RA 2M8UA 1S6IA 3SG4A 2LC5A 4GFTA 2QPTA 3D10A 3LLEA 2F33A 1XFUO 2G2BA 1TCFA 5HLVA 1Y0VH 1KFXL 1WRKA 2KBIA 1CFDA 1XFYO 1B7TZ 5DKNA 3RM1A 1KSOA 5CSIA 4FQOA 3LCPC 1DJXA 4N1GA 4YGBB 2BECA 3I5GB 2LMUA 2E30A 2M29A 4I5NB 5AERA 4NDCA 4P2YB 1B8RA 3E3RA 1S1EA 4OV2A 5GQQC 1SR6B 1FI6A 3PLFB 3QRXA 4PE7A 1NP8A 4ZCVA 1IQ3A 3EK4A 2ZNEA 2FCEA 3PALA 3DVMA 4GPLB 4E68A 3BOWB 3NXAA 4MSPA 1NCZA 1DJWA 5CSFA 1TNXA 3MSEB 3CR4X 2M49B 2AMIA 3BXKA 2FJUB 3VRRA 3CZTX 4C0JA 1SY9A 1RROA 2JQ6A 3I5IB 1KFXS 3AAJA 1S3PA 2H2KA 3OX5A 1MHOA 3PN7B 1TN4A 4QJ3B 1S5GY 1DMOA 3BUXB 2PRUA 1KK7Z 1FPWA 1CLMA 1F8HA 1MWNA 1RECA 3SG5A 4GNKB 4YBHB 1LA0A 1DJHA 1NYAA 3RLZA 5FYXA 4QJ5B 1RJVA 2PVBA 1F70A 3LL8B 1OE9B 2NZ0A 4N5XA 3VRNA 5CSNA 4GGFC 5HKYA 5CSJA 1R2UA 2PSRA 1QJTA 4GUKA 1U5IB 1EJ3A 1UHKA 3JTDC 4I5JA 3PATA 1B8LA 4C0LA 1UHIA 1WRLA 2K7CA 4C0KA 1TNWA 3EVRA 1SBJA 2LP3A 1YR5A 4USLA 5HKZA 1BF5A 1Y1XA 1SL8A 1K8UA 1ZACA 2O5GA 3I5FB 3WNXB 2K7DA 1G8IA 5I2QA 1QVIZ 1BR4B 1GQMA 2GGZA 1UHHA 2SASA 1JF2A 2V53A 1DGVA 1UUSA 1DJIA 1K94A 2L4HA 2I94A 3BYAA 1SCMC 1QX2A 1OOJA 2JTZA 2OS8B 1Y1AA 4PDZA 5B8IB 2OPOA 3F45A 1QIVA 3VGOA 1CKKA 1WDCB 1BU3A 1QLKA 3I5HB 2Y1NA 2H61A 4CFRA 2JTTA 2KYFA 2BCBA 2KI4B 1NUBA 2HF5A 1ZMZA 1IRJA 1KFUL 5F6TA 1KK8B 1XK4C 2E6WA 4JWQA 2LANA 3BUMB 3TZ1A 2L51A 1XA5A 2KAXA 4P5OE 2A4JA 1MF8B 4HSZA 1B9AA 3O6BA 4GAOA 1OZSA 1JFJA 1XFWO 3EVVA 3FWCA 1N0YA 2JRFA 1C7WA 2B1UA 3DVKA 2ZRSA 1PRWA 4ICBA 2KDHA 2HETA 2LLSA 1D1OA 1J7RA 1SNLA 2JPTA 3CGAA 1MXEA 5JJGA 1EG4A 4AQJA 1KSMA 4YRUA 2MBXA 5HYDA 3KPXA 1NX3A 2LVKA 1PK0D 4L9MA 2I2RE 1GJYA 1QATA 3AKAA 2NCOA 3C1VA 1RWYA 4DIRA 1KK7Y 1JC2A 1KFUS 4ORBB 1BLQA 2GGMA 1CB1A 3BOWA 1QX5B 2EHBA 1M31A 1CFPA 2KNEA 2M3WA 1IGVA 4ORCB 1CTRA 3VRPA 4YGDB 3CR5X 5G08A 2F3ZA 2MRDA 1KQMC 4NDBA 5AEQA 5KSZA 1TNQA 1J7PA 4DUQA 2KOTA 1DJZA 2HQ8A 5HLOA 4HRHA 1DTLA 5K89A 1J1EA 1XFZO 2PALA 2PMYA 5IBWA 1CMFA 5AFPA 1EH2A 3IQOA 1B4CA 4MZLA 5KU1A 2KAYA 2Y4QA 3GK1A 1JSAA 2KFHA 2WCEA 1ODBA 1K90D 1S26D 4FTGA 4OKHA 2CXJA 4PE0A 1IKUA 3OB1B 3FS7A 3TUYC 4MEWA 4WQ2A 3WXAA 2TN4A 1M46A 3NSKA 4YI8A 3OX6A 1QVIY 1V1FA 2LVVA 2ZRTA 1U5IA 2CT9A 3KO0A 1QS7A 3IF7A 5CPVA 1IQ5A 2KGRA 4UPGA 4I5LB 1W7JB 3JTDB 2LLTA 4PCWA 2M1KB 5DKRA 4CPVA 1UURA 2CTNA 1SKTA 1QLSA 2LLUA 2IS9A 1BODA 2ZNDA 1AHRA 2MLFC 1BT6A 1BR1B 3HCMA 1RFJA 2LUXA 5ER4X 1QV1A 1CDPA 3OHMB 1J1DA 2GV5A 1F4OA 2EC6C 2KQYA 1NSHA 3I5GC 2KYCA 1A75A 4BY5A 1TNPA 2F2OA 3PM8A 2WOSA 2K61A 4BY4A 3SIBA 2BE4A 1SL7A 2L2EA 1SR6C 4I5KA 1DGUA 1SCMB 2OTGC 2Y5IA 4XYNA 2K7BA 5HKWA 1BG1A 1OMVA 1DJGA 1DT7B 1IWQA 1F4QA 1TOPA 1HT9A 1YTZC 4MBEA 1FF1A 2PASA 1QASA 2SCPA 4CFQA 3ZWHA 1J7QA 1AJ4A 1SCVA 4ETOA 2CBLA 2K2FA 1A75B 2JT3A 1OSAA 3D0YB 2LCPA 3OB2B 1OMRA 1YRTB 1NX1A 2K7OA 2L98A 3VRQA 1WLMA 1RK9A 1ZOTB 2CNPA 4U8DA 1S36A 2LM5A 1IG5A 1CNPA 2MLEC 2KFGA 1K93D 1X02A 4OR9B 2ZFDA 2KBMA 3NSIA 1LINA 3CTNA 5I2LA 2JT0A 1EXRA 2WCFA 4HRGA 1YX7A 1DVIA 2F8PA 1M39A 1SL9A 1S6CA 2KI6D 4JQ0D 1L2OB 2KAVA 3AKBA 4MZKA 4R1EA 1RTP1 2K0JA 3NSLA 2M1UA 3VROA 1TTXA 3SIAA 1UP5A 2JWWA 1UHNA 2M0RA 1CMGA 3DF0A 1ALVA 1YURA 1W7IB 1B47A 4M2PA 1A2XA 1JFKA 2F2PA 1ALWA 2BBMA 4Q04A 4WQ3A 2L50A 1KQMB 4HREE 1XO5A 4YGAA 1GGWA 1SMGA 5D69A 4WRIA 1AP4A 1BOCA 4PHMA 1SYMA 2F3YA 2M9GA 2L4IA 5DKQA 2KFFA 1ZFSA 2KI6C 1BMOA 1CLLA 3SG7A 2JULA 2BL0C 2FCDA 2JC2A 2JNXA 1YVLA 1KQVA 1TRFA 1NIWA 1PSBA 3WHTB 1KCYA 1LKJA 4PHKA 4PHNA 5AANA 2ZN9A 3JVTC 3DF0B 4ORAB 4MLWA 1XFXO 1E8AA 1N2DA 2K8MB 2LE9B 1UHJA 1KWOC 3ICBA 2KHNA 3CS1A 1CM4A 4GGFA 2MHHA 3TUYB 4DCKA 5KTYA 1MR8A 2JT8A 2WC8A 2WNDA 1PVBA 2KI4C 4GBAA 3M0WA 1UWOA 1K9KA 2VRGA 2NCPA 2BE6A 1K96A 3CWGA 3PFVA 1JBAA 3BUWB 1ZUZA 5JOLA 1KK8C 1OZOA 1AUIB 4MRYA 2BKIB 1B1GA 3O4YA 4AQIA 2BKHB 2FOTA 1XFVO 1YX8A 2I18A 2G9BA 1DF0B 1YVHA 4OVNF 3LK0A 1QXPA 3TDUA 5I2OA 1V1GA 1R6PA 1IJ5A 4MZJA 2Q91A 2LHIA 3GK2A 1F54A 5J3XA 3DD4A 2Q4UA 1Y1UA 3GK4X 2LVJA 1G33A 1K95A 2NLNA 4F0ZB 4JPZB 2EC6B 2H61C 1YUTA 2COLB 1A29A 1Y6WA 1LA3A 1FI5A 1K9PA 1MQ1A 1F55A 1IJ6A 1JF0A 3EK8A 3TS5C 3EK7A 1S6JA 1WY9A 2EGDA 5AXIA 2ISDA 1YUUA 2DOQA 4A4BA 2MAZA 1FW4A 2LMTA 3SG3A 1A4PA 2ZN8A 2OTGB 3A4UB 3BQ3A 4XJKA 1CFCA 1Q80A 4M2QA 2JNFA 1LXFC 1J7OA 5BPJA 3CLNA 1SPYA 2K2AA 1B8CA 2LMVA 1CLBA 3H4SE 3FIAA 1M63B 5D7FA 1XK4A 3D0YA 1G4YR 1PALA 3CR2A 4A4CA 1PVAA 4OCIA 3SG6A 1A03A 1TCOB 2CCMA 3BUNB 4YGCB 2BCXA 2MJWB 4MN0A 1AVSA 3PSRA 1BJFA 2AUCA 1QV0A 2WORA 3TDIA 2M97A 1VRKA 3SJSA 2HPSA 1JUOA 3AAKA 2I7AA 4MRXA 1GGZA 1SK6D 4XJKB 4NDDA 5ER5A 3I5IC 1CM1A 1QX7A 2LAPA 1CDMA 3O2PA 4CIDA 1YUSA 4YGEB 1CDLA 1OQPA 3PN7C 1SRAA 2NXQA 3IQQA 1PULA 1K2HA 1DJYA 2LP2A 1MUXA 1PSRA 1TIZA 2R2IA 2JU0A 1NPQA 4DRWA 2JXLA 4MVFA 5TNCA 3KF9A 1JWDA 3K21A 3WHUB 3HX4A 1CFFA 2KQ6A 2JXCA 2L0PA 3EVUA 1L7ZA 1FBVA 1J55A 1EG3A 1M45A 3LK1A 5PALA 4AOMA 4PALA 2MA2A 4DS7A 2Y1MA 1K9UA 3BUOB 2BBNA 2RGIA 2M7NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QIW A;  1HQV A;  4TNC A;  3ZNI A;  1H8B A;  1IH0 A;  4CLN A;  2P6B B;  2LUC A;  1S5G Z;  2BL0 B;  2LNK A;  4M2O A;  2M7L A;  1NCY A;  2KSP A;  1QTX A;  1NCX A;  2JOJ A;  2LHL A;  4PE4 A;  3NSO A;  2ZKM X;  2D8N A;  3KHE A;  3JVT B;  4PHJ A;  1N65 A;  4ZCU A;  3OP0 A;  3TDZ A;  1B7T Y;  1AJ5 A;  2BCA A;  2WCB A;  1KWO B;  1C07 A;  3EKH A;  1AK8 A;  3I5F C;  1EL4 A;  1MXL C;  1NWD A;  1XVJ A;  2AAO A;  2LVI A;  4IL1 A;  4D1E A;  3FWB A;  1WLZ A;  1DF0 A;  1SW8 A;  2HQW A;  2QAC A;  3SG2 A;  2JZI A;  2KGB C;  2L5X B;  2OS8 C;  4N1F A;  3EKJ A;  3DVE A;  1XYD A;  1C7V A;  1F71 A;  5I8N A;  1WRZ A;  4QJ4 B;  1WDC C;  3DVJ A;  3I5H C;  4YI9 A;  4GGN A;  1H4B A;  1NX2 A;  1L2O C;  1OMD A;  4PE1 A;  3O78 A;  2O60 A;  4NQG A;  1YRU B;  2LV7 A;  3KEV A;  1LVC D;  3TS5 B;  1CDN A;  3GOF A;  1NX0 A;  3A8R A;  2M8U A;  1S6I A;  3SG4 A;  2LC5 A;  4GFT A;  2QPT A;  3D10 A;  3LLE A;  2F33 A;  1XFU O;  2G2B A;  1TCF A;  5HLV A;  1Y0V H;  1KFX L;  1WRK A;  2KBI A;  1CFD A;  1XFY O;  1B7T Z;  5DKN A;  3RM1 A;  1KSO A;  5CSI A;  4FQO A;  3LCP C;  1DJX A;  4N1G A;  4YGB B;  2BEC A;  3I5G B;  2LMU A;  2E30 A;  2M29 A;  4I5N B;  5AER A;  4NDC A;  4P2Y B;  1B8R A;  3E3R A;  1S1E A;  4OV2 A;  5GQQ C;  1SR6 B;  1FI6 A;  3PLF B;  3QRX A;  4PE7 A;  1NP8 A;  4ZCV A;  1IQ3 A;  3EK4 A;  2ZNE A;  2FCE A;  3PAL A;  3DVM A;  4GPL B;  4E68 A;  3BOW B;  3NXA A;  4MSP A;  1NCZ A;  1DJW A;  5CSF A;  1TNX A;  3MSE B;  3CR4 X;  2M49 B;  2AMI A;  3BXK A;  2FJU B;  3VRR A;  3CZT X;  4C0J A;  1SY9 A;  1RRO A;  2JQ6 A;  3I5I B;  1KFX S;  3AAJ A;  1S3P A;  2H2K A;  3OX5 A;  1MHO A;  3PN7 B;  1TN4 A;  4QJ3 B;  1S5G Y;  1DMO A;  3BUX B;  2PRU A;  1KK7 Z;  1FPW A;  1CLM A;  1F8H A;  1MWN A;  1REC A;  3SG5 A;  4GNK B;  4YBH B;  1LA0 A;  1DJH A;  1NYA A;  3RLZ A;  5FYX A;  4QJ5 B;  1RJV A;  2PVB A;  1F70 A;  3LL8 B;  1OE9 B;  2NZ0 A;  4N5X A;  3VRN A;  5CSN A;  4GGF C;  5HKY A;  5CSJ A;  1R2U A;  2PSR A;  1QJT A;  4GUK A;  1U5I B;  1EJ3 A;  1UHK A;  3JTD C;  4I5J A;  3PAT A;  1B8L A;  4C0L A;  1UHI A;  1WRL A;  2K7C A;  4C0K A;  1TNW A;  3EVR A;  1SBJ A;  2LP3 A;  1YR5 A;  4USL A;  5HKZ A;  1BF5 A;  1Y1X A;  1SL8 A;  1K8U A;  1ZAC A;  2O5G A;  3I5F B;  3WNX B;  2K7D A;  1G8I A;  5I2Q A;  1QVI Z;  1BR4 B;  1GQM A;  2GGZ A;  1UHH A;  2SAS A;  1JF2 A;  2V53 A;  1DGV A;  1UUS A;  1DJI A;  1K94 A;  2L4H A;  2I94 A;  3BYA A;  1SCM C;  1QX2 A;  1OOJ A;  2JTZ A;  2OS8 B;  1Y1A A;  4PDZ A;  5B8I B;  2OPO A;  3F45 A;  1QIV A;  3VGO A;  1CKK A;  1WDC B;  1BU3 A;  1QLK A;  3I5H B;  2Y1N A;  2H61 A;  4CFR A;  2JTT A;  2KYF A;  2BCB A;  2KI4 B;  1NUB A;  2HF5 A;  1ZMZ A;  1IRJ A;  1KFU L;  5F6T A;  1KK8 B;  1XK4 C;  2E6W A;  4JWQ A;  2LAN A;  3BUM B;  3TZ1 A;  2L51 A;  1XA5 A;  2KAX A;  4P5O E;  2A4J A;  1MF8 B;  4HSZ A;  1B9A A;  3O6B A;  4GAO A;  1OZS A;  1JFJ A;  1XFW O;  3EVV A;  3FWC A;  1N0Y A;  2JRF A;  1C7W A;  2B1U A;  3DVK A;  2ZRS A;  1PRW A;  4ICB A;  2KDH A;  2HET A;  2LLS A;  1D1O A;  1J7R A;  1SNL A;  2JPT A;  3CGA A;  1MXE A;  5JJG A;  1EG4 A;  4AQJ A;  1KSM A;  4YRU A;  2MBX A;  5HYD A;  3KPX A;  1NX3 A;  2LVK A;  1PK0 D;  4L9M A;  2I2R E;  1GJY A;  1QAT A;  3AKA A;  2NCO A;  3C1V A;  1RWY A;  4DIR A;  1KK7 Y;  1JC2 A;  1KFU S;  4ORB B;  1BLQ A;  2GGM A;  1CB1 A;  3BOW A;  1QX5 B;  2EHB A;  1M31 A;  1CFP A;  2KNE A;  2M3W A;  1IGV A;  4ORC B;  1CTR A;  3VRP A;  4YGD B;  3CR5 X;  5G08 A;  2F3Z A;  2MRD A;  1KQM C;  4NDB A;  5AEQ A;  5KSZ A;  1TNQ A;  1J7P A;  4DUQ A;  2KOT A;  1DJZ A;  2HQ8 A;  5HLO A;  4HRH A;  1DTL A;  5K89 A;  1J1E A;  1XFZ O;  2PAL A;  2PMY A;  5IBW A;  1CMF A;  5AFP A;  1EH2 A;  3IQO A;  1B4C A;  4MZL A;  5KU1 A;  2KAY A;  2Y4Q A;  3GK1 A;  1JSA A;  2KFH A;  2WCE A;  1ODB A;  1K90 D;  1S26 D;  4FTG A;  4OKH A;  2CXJ A;  4PE0 A;  1IKU A;  3OB1 B;  3FS7 A;  3TUY C;  4MEW A;  4WQ2 A;  3WXA A;  2TN4 A;  1M46 A;  3NSK A;  4YI8 A;  3OX6 A;  1QVI Y;  1V1F A;  2LVV A;  2ZRT A;  1U5I A;  2CT9 A;  3KO0 A;  1QS7 A;  3IF7 A;  5CPV A;  1IQ5 A;  2KGR A;  4UPG A;  4I5L B;  1W7J B;  3JTD B;  2LLT A;  4PCW A;  2M1K B;  5DKR A;  4CPV A;  1UUR A;  2CTN A;  1SKT A;  1QLS A;  2LLU A;  2IS9 A;  1BOD A;  2ZND A;  1AHR A;  2MLF C;  1BT6 A;  1BR1 B;  3HCM A;  1RFJ A;  2LUX A;  5ER4 X;  1QV1 A;  1CDP A;  3OHM B;  1J1D A;  2GV5 A;  1F4O A;  2EC6 C;  2KQY A;  1NSH A;  3I5G C;  2KYC A;  1A75 A;  4BY5 A;  1TNP A;  2F2O A;  3PM8 A;  2WOS A;  2K61 A;  4BY4 A;  3SIB A;  2BE4 A;  1SL7 A;  2L2E A;  1SR6 C;  4I5K A;  1DGU A;  1SCM B;  2OTG C;  2Y5I A;  4XYN A;  2K7B A;  5HKW A;  1BG1 A;  1OMV A;  1DJG A;  1DT7 B;  1IWQ A;  1F4Q A;  1TOP A;  1HT9 A;  1YTZ C;  4MBE A;  1FF1 A;  2PAS A;  1QAS A;  2SCP A;  4CFQ A;  3ZWH A;  1J7Q A;  1AJ4 A;  1SCV A;  4ETO A;  2CBL A;  2K2F A;  1A75 B;  2JT3 A;  1OSA A;  3D0Y B;  2LCP A;  3OB2 B;  1OMR A;  1YRT B;  1NX1 A;  2K7O A;  2L98 A;  3VRQ A;  1WLM A;  1RK9 A;  1ZOT B;  2CNP A;  4U8D A;  1S36 A;  2LM5 A;  1IG5 A;  1CNP A;  2MLE C;  2KFG A;  1K93 D;  1X02 A;  4OR9 B;  2ZFD A;  2KBM A;  3NSI A;  1LIN A;  3CTN A;  5I2L A;  2JT0 A;  1EXR A;  2WCF A;  4HRG A;  1YX7 A;  1DVI A;  2F8P A;  1M39 A;  1SL9 A;  1S6C A;  2KI6 D;  4JQ0 D;  1L2O B;  2KAV A;  3AKB A;  4MZK A;  4R1E A;  1RTP 1;  2K0J A;  3NSL A;  2M1U A;  3VRO A;  1TTX A;  3SIA A;  1UP5 A;  2JWW A;  1UHN A;  2M0R A;  1CMG A;  3DF0 A;  1ALV A;  1YUR A;  1W7I B;  1B47 A;  4M2P A;  1A2X A;  1JFK A;  2F2P A;  1ALW A;  2BBM A;  4Q04 A;  4WQ3 A;  2L50 A;  1KQM B;  4HRE E;  1XO5 A;  4YGA A;  1GGW A;  1SMG A;  5D69 A;  4WRI A;  1AP4 A;  1BOC A;  4PHM A;  1SYM A;  2F3Y A;  2M9G A;  2L4I A;  5DKQ A;  2KFF A;  1ZFS A;  2KI6 C;  1BMO A;  1CLL A;  3SG7 A;  2JUL A;  2BL0 C;  2FCD A;  2JC2 A;  2JNX A;  1YVL A;  1KQV A;  1TRF A;  1NIW A;  1PSB A;  3WHT B;  1KCY A;  1LKJ A;  4PHK A;  4PHN A;  5AAN A;  2ZN9 A;  3JVT C;  3DF0 B;  4ORA B;  4MLW A;  1XFX O;  1E8A A;  1N2D A;  2K8M B;  2LE9 B;  1UHJ A;  1KWO C;  3ICB A;  2KHN A;  3CS1 A;  1CM4 A;  4GGF A;  2MHH A;  3TUY B;  4DCK A;  5KTY A;  1MR8 A;  2JT8 A;  2WC8 A;  2WND A;  1PVB A;  2KI4 C;  4GBA A;  3M0W A;  1UWO A;  1K9K A;  2VRG A;  2NCP A;  2BE6 A;  1K96 A;  3CWG A;  3PFV A;  1JBA A;  3BUW B;  1ZUZ A;  5JOL A;  1KK8 C;  1OZO A;  1AUI B;  4MRY A;  2BKI B;  1B1G A;  3O4Y A;  4AQI A;  2BKH B;  2FOT A;  1XFV O;  1YX8 A;  2I18 A;  2G9B A;  1DF0 B;  1YVH A;  4OVN F;  3LK0 A;  1QXP A;  3TDU A;  5I2O A;  1V1G A;  1R6P A;  1IJ5 A;  4MZJ A;  2Q91 A;  2LHI A;  3GK2 A;  1F54 A;  5J3X A;  3DD4 A;  2Q4U A;  1Y1U A;  3GK4 X;  2LVJ A;  1G33 A;  1K95 A;  2NLN A;  4F0Z B;  4JPZ B;  2EC6 B;  2H61 C;  1YUT A;  2COL B;  1A29 A;  1Y6W A;  1LA3 A;  1FI5 A;  1K9P A;  1MQ1 A;  1F55 A;  1IJ6 A;  1JF0 A;  3EK8 A;  3TS5 C;  3EK7 A;  1S6J A;  1WY9 A;  2EGD A;  5AXI A;  2ISD A;  1YUU A;  2DOQ A;  4A4B A;  2MAZ A;  1FW4 A;  2LMT A;  3SG3 A;  1A4P A;  2ZN8 A;  2OTG B;  3A4U B;  3BQ3 A;  4XJK A;  1CFC A;  1Q80 A;  4M2Q A;  2JNF A;  1LXF C;  1J7O A;  5BPJ A;  3CLN A;  1SPY A;  2K2A A;  1B8C A;  2LMV A;  1CLB A;  3H4S E;  3FIA A;  1M63 B;  5D7F A;  1XK4 A;  3D0Y A;  1G4Y R;  1PAL A;  3CR2 A;  4A4C A;  1PVA A;  4OCI A;  3SG6 A;  1A03 A;  1TCO B;  2CCM A;  3BUN B;  4YGC B;  2BCX A;  2MJW B;  4MN0 A;  1AVS A;  3PSR A;  1BJF A;  2AUC A;  1QV0 A;  2WOR A;  3TDI A;  2M97 A;  1VRK A;  3SJS A;  2HPS A;  1JUO A;  3AAK A;  2I7A A;  4MRX A;  1GGZ A;  1SK6 D;  4XJK B;  4NDD A;  5ER5 A;  3I5I C;  1CM1 A;  1QX7 A;  2LAP A;  1CDM A;  3O2P A;  4CID A;  1YUS A;  4YGE B;  1CDL A;  1OQP A;  3PN7 C;  1SRA A;  2NXQ A;  3IQQ A;  1PUL A;  1K2H A;  1DJY A;  2LP2 A;  1MUX A;  1PSR A;  1TIZ A;  2R2I A;  2JU0 A;  1NPQ A;  4DRW A;  2JXL A;  4MVF A;  5TNC A;  3KF9 A;  1JWD A;  3K21 A;  3WHU B;  3HX4 A;  1CFF A;  2KQ6 A;  2JXC A;  2L0P A;  3EVU A;  1L7Z A;  1FBV A;  1J55 A;  1EG3 A;  1M45 A;  3LK1 A;  5PAL A;  4AOM A;  4PAL A;  2MA2 A;  4DS7 A;  2Y1M A;  1K9U A;  3BUO B;  2BBN A;  2RGI A;  2M7N A; 
#chains in the Genus database with same CATH topology
 1QIW A;  1HQV A;  4TNC A;  3ZNI A;  1H8B A;  1IH0 A;  1P28 A;  4CLN A;  2P6B B;  2LUC A;  1S5G Z;  2BL0 B;  2LNK A;  4M2O A;  2WCK A;  2M7L A;  1NCY A;  2KSP A;  1QTX A;  1NCX A;  2JOJ A;  2LHL A;  4PE4 A;  3NSO A;  2ZKM X;  3D75 A;  2D8N A;  3KHE A;  3JVT B;  4PHJ A;  1N65 A;  4ZCU A;  3OP0 A;  3TDZ A;  1B7T Y;  1AJ5 A;  2BCA A;  2WCB A;  1KWO B;  1C07 A;  3EKH A;  1AK8 A;  2PYQ A;  3I5F C;  1EL4 A;  1MXL C;  1NWD A;  1XVJ A;  2AAO A;  2LVI A;  4IL1 A;  4D1E A;  4F7F A;  3FWB A;  1WLZ A;  1DF0 A;  1SW8 A;  2HQW A;  2QAC A;  3SG2 A;  2JZI A;  2KGB C;  2L5X B;  2OS8 C;  4N1F A;  3EKJ A;  3DVE A;  1XYD A;  1C7V A;  1F71 A;  2KLD A;  2QEO A;  5D3O A;  5I8N A;  1WRZ A;  4QJ4 B;  1WDC C;  3DVJ A;  3I5H C;  4YI9 A;  4GGN A;  1C3Y A;  3CZ1 A;  1H4B A;  1NX2 A;  1L2O C;  1OMD A;  4PE1 A;  3O78 A;  2O60 A;  2ERB A;  1TWO A;  4NQG A;  1YRU B;  2LV7 A;  3KEV A;  1LVC D;  3TS5 B;  1CDN A;  3GOF A;  1NX0 A;  3A8R A;  2M8U A;  3NGV A;  1S6I A;  3SG4 A;  2LC5 A;  4GFT A;  2QPT A;  3D10 A;  3LLE A;  2F33 A;  3D74 A;  1XFU O;  2G2B A;  3B6X A;  1TCF A;  5HLV A;  1Y0V H;  3DXL A;  1KFX L;  1WRK A;  2KBI A;  1CFD A;  1XFY O;  1B7T Z;  2KPH A;  5DKN A;  3RM1 A;  1KSO A;  5CSI A;  4FQO A;  3LCP C;  1DJX A;  4N1G A;  4YGB B;  2BEC A;  3S0F A;  3I5G B;  2LMU A;  3K1E A;  2E30 A;  2WCJ A;  2M29 A;  4I5N B;  5AER A;  4NDC A;  4P2Y B;  1SSE B;  1B8R A;  4INW A;  3E3R A;  1S1E A;  4OV2 A;  1TUZ A;  1SR6 B;  2WC6 A;  5GQQ C;  1FI6 A;  3PLF B;  3QRX A;  4PE7 A;  1NP8 A;  3CAB A;  3D77 A;  4ZCV A;  1IQ3 A;  3EK4 A;  2ZNE A;  2FCE A;  3PAL A;  3DVM A;  4GPL B;  4E68 A;  3BOW B;  3NXA A;  4MSP A;  1NCZ A;  1DJW A;  5CSF A;  1TNX A;  3MSE B;  3CR4 X;  2M49 B;  2AMI A;  3BXK A;  2FJU B;  3VRR A;  3CZT X;  4C0J A;  1SY9 A;  1RRO A;  2JQ6 A;  3I5I B;  1KFX S;  3AAJ A;  2WCM A;  1S3P A;  2K60 A;  2H2K A;  3OX5 A;  1MHO A;  3PN7 B;  1TN4 A;  4QJ3 B;  1S5G Y;  3DZT A;  1DMO A;  3BUX B;  2PRU A;  3BFB A;  1KK7 Z;  1Z4H A;  1FPW A;  1CLM A;  1F8H A;  1MWN A;  1REC A;  3SG5 A;  4GNK B;  4YBH B;  1LA0 A;  3R1P A;  1DJH A;  1NYA A;  3RLZ A;  5FYX A;  1XFR A;  3D76 A;  4QJ5 B;  1RJV A;  2PVB A;  4JKT A;  1F70 A;  3LL8 B;  1OE9 B;  2NZ0 A;  4N5X A;  3VRN A;  5CSN A;  4GGF C;  5HKY A;  5CSJ A;  1R2U A;  2PSR A;  1QJT A;  4GUK A;  1U5I B;  1EJ3 A;  1UHK A;  3JTD C;  4I5J A;  3PAT A;  1B8L A;  4C0L A;  1UHI A;  1T14 A;  3CZ0 A;  1WRL A;  2K7C A;  3DYE A;  4C0K A;  1TNW A;  3EVR A;  3S0G A;  1SBJ A;  2LP3 A;  1YR5 A;  4USL A;  5HKZ A;  1BF5 A;  1Y1X A;  1SL8 A;  1ZAC A;  1K8U A;  2O5G A;  2QEV A;  3I5F B;  3WNX B;  2K7D A;  1G8I A;  5I2Q A;  1QVI Z;  3B86 A;  1BR4 B;  1DQE A;  1GQM A;  2GGZ A;  1UHH A;  2QEH A;  2SAS A;  1JF2 A;  1LS8 A;  1DGV A;  1UUS A;  1DJI A;  1K94 A;  2V53 A;  3R72 A;  2L4H A;  2I94 A;  3BYA A;  1SCM C;  1QX2 A;  1OOJ A;  2JTZ A;  2OS8 B;  1Y1A A;  4PDZ A;  5B8I B;  2OPO A;  3F45 A;  2GTE A;  1QIV A;  3L47 A;  3VGO A;  1CKK A;  1WDC B;  3OGN A;  1BU3 A;  1QLK A;  3I5H B;  2JPO A;  2H61 A;  2Y1N A;  4CFR A;  2JTT A;  2KYF A;  2BCB A;  2KI4 B;  1NUB A;  2HF5 A;  1ZMZ A;  1IRJ A;  1KFU L;  5F6T A;  1KK8 B;  1XK4 C;  2E6W A;  4JWQ A;  2LAN A;  3BUM B;  3TZ1 A;  2L51 A;  3S0B A;  1XA5 A;  2KAX A;  4P5O E;  2A4J A;  1MF8 B;  4HSZ A;  1B9A A;  3O6B A;  4GAO A;  1OZS A;  1JFJ A;  1XFW O;  3EVV A;  3FWC A;  1N0Y A;  2JRF A;  1C7W A;  2B1U A;  3DVK A;  2ZRS A;  1PRW A;  1OOG A;  4ICB A;  2KDH A;  2HET A;  2LLS A;  3D73 A;  1D1O A;  1J7R A;  1SNL A;  2JPT A;  3S0E A;  3CGA A;  1MXE A;  5JJG A;  1EG4 A;  4AQJ A;  1KSM A;  4YRU A;  2MBX A;  5HYD A;  3KPX A;  1NX3 A;  2LVK A;  5HL1 A;  1PK0 D;  4L9M A;  3DY9 A;  2I2R E;  1GJY A;  1QAT A;  3AKA A;  3R1V A;  2NCO A;  3C1V A;  1RWY A;  2YGU A;  4DIR A;  1KK7 Y;  1JC2 A;  2P70 A;  1KFU S;  4ORB B;  1BLQ A;  2GGM A;  1CB1 A;  3BOW A;  1QX5 B;  2EHB A;  1M31 A;  3FE9 A;  2KNE A;  5DIC A;  1CFP A;  2M3W A;  1IGV A;  2WCL A;  4ORC B;  1CTR A;  3VRP A;  4YGD B;  3CR5 X;  5G08 A;  2F3Z A;  2MRD A;  1KQM C;  4NDB A;  5AEQ A;  5KSZ A;  1TNQ A;  1J7P A;  4DUQ A;  2KOT A;  1DJZ A;  2HQ8 A;  5HLO A;  4HRH A;  1DTL A;  5K89 A;  1J1E A;  1XFZ O;  3R1O A;  2PAL A;  2PMY A;  5IBW A;  2WC5 A;  3CZ2 A;  1CMF A;  5AFP A;  1OW4 A;  1EH2 A;  4KYN A;  3IQO A;  1B4C A;  2BAP A;  4MZL A;  5KU1 A;  2KAY A;  2Y4Q A;  3GK1 A;  1JSA A;  2KFH A;  3NHI A;  2WCE A;  1ODB A;  1K90 D;  1DC1 A;  1S26 D;  4FTG A;  3BJH A;  4OKH A;  2CXJ A;  3CYZ A;  4PE0 A;  1IKU A;  3OB1 B;  3FS7 A;  1GM0 A;  3TUY C;  3S0D A;  4MEW A;  4WQ2 A;  3WXA A;  2TN4 A;  2QDI A;  1M46 A;  3NSK A;  4YI8 A;  3OX6 A;  1QVI Y;  1V1F A;  2LVV A;  2ZRT A;  1U5I A;  5FI7 A;  2CT9 A;  3KO0 A;  4INX A;  1QS7 A;  3IF7 A;  5CPV A;  1IQ5 A;  2KGR A;  3BFH A;  4UPG A;  3RZS A;  4I5L B;  1W7J B;  5FI2 A;  3JTD B;  2LLT A;  4PCW A;  2M1K B;  5DKR A;  4CPV A;  1UUR A;  2CTN A;  1SKT A;  1QLS A;  2L5Y A;  2LLU A;  2IS9 A;  1BOD A;  2ZND A;  1AHR A;  2MLF C;  1BT6 A;  1BR1 B;  1Z2C B;  3HCM A;  1RFJ A;  2LUX A;  5ER4 X;  1QV1 A;  1CDP A;  3OHM B;  1J1D A;  2GV5 A;  1F4O A;  2EC6 C;  2KQY A;  1NSH A;  3I5G C;  2KYC A;  3QME A;  3UNW A;  1A75 A;  4BY5 A;  1TNP A;  2F2O A;  3PM8 A;  2WOS A;  1DEL A;  2K61 A;  4BY4 A;  2WCH A;  3SIB A;  2BE4 A;  1SL7 A;  2L2E A;  1SR6 C;  3B7A A;  4I5K A;  1DGU A;  1SCM B;  5EL2 A;  2OTG C;  2Y5I A;  3L4L A;  4XYN A;  2K7B A;  5HKW A;  1BG1 A;  1OMV A;  1DJG A;  1DT7 B;  3Q8I A;  1IWQ A;  1F4Q A;  1TOP A;  1HT9 A;  1YTZ C;  4MBE A;  1FF1 A;  2PAS A;  1QAS A;  2SCP A;  3B87 A;  3SS5 A;  4CFQ A;  3ZWH A;  1J7Q A;  1AJ4 A;  1SCV A;  1QWV A;  2CBL A;  2K2F A;  1A75 B;  4ETO A;  1OOI X;  2JT3 A;  1OSA A;  3D0Y B;  2LCP A;  3CDN A;  1OMR A;  1YRT B;  3OB2 B;  1NX1 A;  2K7O A;  2L98 A;  3VRQ A;  1WLM A;  1RK9 A;  1ZOT B;  2CNP A;  4U8D A;  1S36 A;  2LM5 A;  1IG5 A;  3SS4 A;  2MLE C;  1CNP A;  2KFG A;  1K93 D;  1X02 A;  3EG5 B;  4OR9 B;  2ZFD A;  2KBM A;  3NSI A;  1LIN A;  3CTN A;  4OZD A;  5I2L A;  3L4A A;  2JT0 A;  1EXR A;  2L2C A;  2WCF A;  4HRG A;  1YX7 A;  1DVI A;  2F8P A;  1M39 A;  1SL9 A;  1S6C A;  2KI6 D;  4JQ0 D;  1L2O B;  2KAV A;  3AKB A;  3O4X A;  4MZK A;  4R1E A;  1RTP 1;  2K0J A;  3NSL A;  2M1U A;  3V2L A;  3VRO A;  1TTX A;  3SIA A;  1UP5 A;  2JWW A;  1UHN A;  2M0R A;  1CMG A;  3DF0 A;  1ALV A;  1YUR A;  1W7I B;  1B47 A;  4M2P A;  1A2X A;  1JFK A;  2F2P A;  1ALW A;  2BBM A;  4Q04 A;  4WQ3 A;  2L50 A;  1KQM B;  4HRE E;  1XO5 A;  4YGA A;  1GGW A;  1SMG A;  5D69 A;  4WRI A;  1AP4 A;  3OBV A;  1BOC A;  4PHM A;  1SYM A;  2F3Y A;  2M9G A;  2L4I A;  5DKQ A;  3PM2 A;  2KFF A;  1OOH A;  1ZFS A;  2KI6 C;  1BMO A;  1CLL A;  3SG7 A;  3VB1 A;  3IVT A;  2JUL A;  2BL0 C;  2FCD A;  2JC2 A;  2JNX A;  1YVL A;  1KQV A;  1ORG A;  1TRF A;  5I94 A;  1NIW A;  1PSB A;  3WHT B;  1KCY A;  1LKJ A;  4PHK A;  4PHN A;  5AAN A;  2ZN9 A;  3JVT C;  3DF0 B;  4ORA B;  4MLW A;  1XFX O;  1E8A A;  1N2D A;  2K8M B;  2LE9 B;  1UHJ A;  1KWO C;  3ICB A;  4IJ7 A;  2KHN A;  3CS1 A;  1CM4 A;  4GGF A;  2FJY A;  2MHH A;  3TUY B;  4DCK A;  5KTY A;  3D78 A;  1MR8 A;  2JT8 A;  2WC8 A;  2WND A;  1PVB A;  2KI4 C;  4GBA A;  3M0W A;  1UWO A;  1K9K A;  2VRG A;  2NCP A;  2KLE A;  2BE6 A;  1K96 A;  3CWG A;  3PFV A;  1JBA A;  3BUW B;  1ZUZ A;  1IIO A;  5JOL A;  1KK8 C;  1OZO A;  1AUI B;  4MRY A;  2BKI B;  1B1G A;  3O4Y A;  4AQI A;  2BKH B;  2FOT A;  1XFV O;  1YX8 A;  2I18 A;  2G9B A;  1DF0 B;  1YVH A;  4OVN F;  4PT1 A;  3LK0 A;  1QXP A;  3TDU A;  5I2O A;  1V1G A;  1R6P A;  1IJ5 A;  1DEK A;  1OOF A;  2Q91 A;  2LHI A;  4MZJ A;  3GK2 A;  1F54 A;  3NHT A;  5J3X A;  3DD4 A;  2Q4U A;  1Y1U A;  3GK4 X;  1W9Z A;  2LVJ A;  1G33 A;  1K95 A;  2NLN A;  4F0Z B;  4JPZ B;  2EC6 B;  2H61 C;  1YUT A;  2COL B;  1A29 A;  2BNX A;  1Y6W A;  1LA3 A;  3FE8 A;  1K9P A;  1FI5 A;  1MQ1 A;  1TUJ A;  1F55 A;  1IJ6 A;  1JF0 A;  3EK8 A;  3TS5 C;  3EK7 A;  1S6J A;  1WY9 A;  2EGD A;  3BFA A;  5AXI A;  5FI6 A;  1YUU A;  2ISD A;  3UO9 A;  2DOQ A;  4A4B A;  2PQL A;  2MAZ A;  1FW4 A;  2LMT A;  3SG3 A;  1A4P A;  2ZN8 A;  2OTG B;  3A4U B;  3BQ3 A;  4XJK A;  3S0A A;  1CFC A;  1Q80 A;  4M2Q A;  2JNF A;  1LXF C;  1J7O A;  5BPJ A;  3CLN A;  1SPY A;  2K2A A;  1B8C A;  2LMV A;  1CLB A;  3H4S E;  3FIA A;  1M63 B;  5D7F A;  3FE6 A;  1C3Z A;  1XK4 A;  3D0Y A;  1G4Y R;  1PAL A;  3CR2 A;  4A4C A;  2H8V A;  4FQT A;  1PVA A;  4OCI A;  3SG6 A;  1A03 A;  1TCO B;  2CCM A;  3BUN B;  4YGC B;  2BCX A;  2MJW B;  4MN0 A;  1AVS A;  3PSR A;  1BJF A;  2AUC A;  1QV0 A;  2WOR A;  3SS3 A;  3TDI A;  2M97 A;  1VRK A;  3SJS A;  2HPS A;  1JUO A;  2P71 A;  3AAK A;  2I7A A;  4MRX A;  1GGZ A;  1SK6 D;  4XJK B;  4NDD A;  5ER5 A;  3I5I C;  1CM1 A;  1QX7 A;  2LAP A;  1CDM A;  3O2P A;  4CID A;  1YUS A;  4YGE B;  1CDL A;  1OQP A;  3PN7 C;  3N7H A;  1SRA A;  3PJI A;  2NXQ A;  3IQQ A;  1PUL A;  1K2H A;  1DJY A;  2LP2 A;  3B88 A;  1MUX A;  1PSR A;  1TIZ A;  2QEB A;  2R2I A;  2JU0 A;  1NPQ A;  4DRW A;  2JXL A;  4MVF A;  5TNC A;  3KF9 A;  1JWD A;  3K21 A;  3WHU B;  3HX4 A;  1CFF A;  2KQ6 A;  2JXC A;  2L0P A;  3EVU A;  4JD9 A;  1L7Z A;  1FBV A;  1J55 A;  1EG3 A;  1M45 A;  3LK1 A;  5PAL A;  4AOM A;  4PAL A;  2MA2 A;  4DS7 A;  2Y1M A;  1K9U A;  3BUO B;  2BBN A;  2RGI A;  2M7N A; 
#chains in the Genus database with same CATH homology
 1QIW A;  1HQV A;  4TNC A;  3ZNI A;  1H8B A;  1IH0 A;  4CLN A;  2P6B B;  2LUC A;  1S5G Z;  2BL0 B;  2LNK A;  4M2O A;  2M7L A;  1NCY A;  2KSP A;  1QTX A;  1NCX A;  2JOJ A;  2LHL A;  4PE4 A;  3NSO A;  2ZKM X;  2D8N A;  3KHE A;  3JVT B;  4PHJ A;  1N65 A;  4ZCU A;  3OP0 A;  3TDZ A;  1B7T Y;  1AJ5 A;  2BCA A;  2WCB A;  1KWO B;  1C07 A;  3EKH A;  1AK8 A;  3I5F C;  1EL4 A;  1MXL C;  1NWD A;  1XVJ A;  2AAO A;  2LVI A;  4IL1 A;  4D1E A;  3FWB A;  1WLZ A;  1DF0 A;  1SW8 A;  2HQW A;  2QAC A;  3SG2 A;  2JZI A;  2KGB C;  2L5X B;  2OS8 C;  4N1F A;  3EKJ A;  3DVE A;  1XYD A;  1C7V A;  1F71 A;  5I8N A;  1WRZ A;  4QJ4 B;  1WDC C;  3DVJ A;  3I5H C;  4YI9 A;  4GGN A;  1H4B A;  1NX2 A;  1L2O C;  1OMD A;  4PE1 A;  3O78 A;  2O60 A;  4NQG A;  1YRU B;  2LV7 A;  3KEV A;  1LVC D;  3TS5 B;  1CDN A;  3GOF A;  1NX0 A;  3A8R A;  2M8U A;  1S6I A;  3SG4 A;  2LC5 A;  4GFT A;  2QPT A;  3D10 A;  3LLE A;  2F33 A;  1XFU O;  2G2B A;  1TCF A;  5HLV A;  1Y0V H;  1KFX L;  1WRK A;  2KBI A;  1CFD A;  1XFY O;  1B7T Z;  5DKN A;  3RM1 A;  1KSO A;  5CSI A;  4FQO A;  3LCP C;  1DJX A;  4N1G A;  4YGB B;  2BEC A;  3I5G B;  2LMU A;  2E30 A;  2M29 A;  4I5N B;  5AER A;  4NDC A;  4P2Y B;  1B8R A;  3E3R A;  1S1E A;  4OV2 A;  5GQQ C;  1SR6 B;  1FI6 A;  3PLF B;  3QRX A;  4PE7 A;  1NP8 A;  4ZCV A;  1IQ3 A;  3EK4 A;  2ZNE A;  2FCE A;  3PAL A;  3DVM A;  4GPL B;  4E68 A;  3BOW B;  3NXA A;  4MSP A;  1NCZ A;  1DJW A;  5CSF A;  1TNX A;  3MSE B;  3CR4 X;  2M49 B;  2AMI A;  3BXK A;  2FJU B;  3VRR A;  3CZT X;  4C0J A;  1SY9 A;  1RRO A;  2JQ6 A;  3I5I B;  1KFX S;  3AAJ A;  1S3P A;  2H2K A;  3OX5 A;  1MHO A;  3PN7 B;  1TN4 A;  4QJ3 B;  1S5G Y;  1DMO A;  3BUX B;  2PRU A;  1KK7 Z;  1FPW A;  1CLM A;  1F8H A;  1MWN A;  1REC A;  3SG5 A;  4GNK B;  4YBH B;  1LA0 A;  1DJH A;  1NYA A;  3RLZ A;  5FYX A;  4QJ5 B;  1RJV A;  2PVB A;  1F70 A;  3LL8 B;  1OE9 B;  2NZ0 A;  4N5X A;  3VRN A;  5CSN A;  4GGF C;  5HKY A;  5CSJ A;  1R2U A;  2PSR A;  1QJT A;  4GUK A;  1U5I B;  1EJ3 A;  1UHK A;  3JTD C;  4I5J A;  3PAT A;  1B8L A;  4C0L A;  1UHI A;  1WRL A;  2K7C A;  4C0K A;  1TNW A;  3EVR A;  1SBJ A;  2LP3 A;  1YR5 A;  4USL A;  5HKZ A;  1BF5 A;  1Y1X A;  1SL8 A;  1K8U A;  1ZAC A;  2O5G A;  3I5F B;  3WNX B;  2K7D A;  1G8I A;  5I2Q A;  1QVI Z;  1BR4 B;  1GQM A;  2GGZ A;  1UHH A;  2SAS A;  1JF2 A;  2V53 A;  1DGV A;  1UUS A;  1DJI A;  1K94 A;  2L4H A;  2I94 A;  3BYA A;  1SCM C;  1QX2 A;  1OOJ A;  2JTZ A;  2OS8 B;  1Y1A A;  4PDZ A;  5B8I B;  2OPO A;  3F45 A;  1QIV A;  3VGO A;  1CKK A;  1WDC B;  1BU3 A;  1QLK A;  3I5H B;  2Y1N A;  2H61 A;  4CFR A;  2JTT A;  2KYF A;  2BCB A;  2KI4 B;  1NUB A;  2HF5 A;  1ZMZ A;  1IRJ A;  1KFU L;  5F6T A;  1KK8 B;  1XK4 C;  2E6W A;  4JWQ A;  2LAN A;  3BUM B;  3TZ1 A;  2L51 A;  1XA5 A;  2KAX A;  4P5O E;  2A4J A;  1MF8 B;  4HSZ A;  1B9A A;  3O6B A;  4GAO A;  1OZS A;  1JFJ A;  1XFW O;  3EVV A;  3FWC A;  1N0Y A;  2JRF A;  1C7W A;  2B1U A;  3DVK A;  2ZRS A;  1PRW A;  4ICB A;  2KDH A;  2HET A;  2LLS A;  1D1O A;  1J7R A;  1SNL A;  2JPT A;  3CGA A;  1MXE A;  5JJG A;  1EG4 A;  4AQJ A;  1KSM A;  4YRU A;  2MBX A;  5HYD A;  3KPX A;  1NX3 A;  2LVK A;  1PK0 D;  4L9M A;  2I2R E;  1GJY A;  1QAT A;  3AKA A;  2NCO A;  3C1V A;  1RWY A;  4DIR A;  1KK7 Y;  1JC2 A;  1KFU S;  4ORB B;  1BLQ A;  2GGM A;  1CB1 A;  3BOW A;  1QX5 B;  2EHB A;  1M31 A;  1CFP A;  2KNE A;  2M3W A;  1IGV A;  4ORC B;  1CTR A;  3VRP A;  4YGD B;  3CR5 X;  5G08 A;  2F3Z A;  2MRD A;  1KQM C;  4NDB A;  5AEQ A;  5KSZ A;  1TNQ A;  1J7P A;  4DUQ A;  2KOT A;  1DJZ A;  2HQ8 A;  5HLO A;  4HRH A;  1DTL A;  5K89 A;  1J1E A;  1XFZ O;  2PAL A;  2PMY A;  5IBW A;  1CMF A;  5AFP A;  1EH2 A;  3IQO A;  1B4C A;  4MZL A;  5KU1 A;  2KAY A;  2Y4Q A;  3GK1 A;  1JSA A;  2KFH A;  2WCE A;  1ODB A;  1K90 D;  1S26 D;  4FTG A;  4OKH A;  2CXJ A;  4PE0 A;  1IKU A;  3OB1 B;  3FS7 A;  3TUY C;  4MEW A;  4WQ2 A;  3WXA A;  2TN4 A;  1M46 A;  3NSK A;  4YI8 A;  3OX6 A;  1QVI Y;  1V1F A;  2LVV A;  2ZRT A;  1U5I A;  2CT9 A;  3KO0 A;  1QS7 A;  3IF7 A;  5CPV A;  1IQ5 A;  2KGR A;  4UPG A;  4I5L B;  1W7J B;  3JTD B;  2LLT A;  4PCW A;  2M1K B;  5DKR A;  4CPV A;  1UUR A;  2CTN A;  1SKT A;  1QLS A;  2LLU A;  2IS9 A;  1BOD A;  2ZND A;  1AHR A;  2MLF C;  1BT6 A;  1BR1 B;  3HCM A;  1RFJ A;  2LUX A;  5ER4 X;  1QV1 A;  1CDP A;  3OHM B;  1J1D A;  2GV5 A;  1F4O A;  2EC6 C;  2KQY A;  1NSH A;  3I5G C;  2KYC A;  1A75 A;  4BY5 A;  1TNP A;  2F2O A;  3PM8 A;  2WOS A;  2K61 A;  4BY4 A;  3SIB A;  2BE4 A;  1SL7 A;  2L2E A;  1SR6 C;  4I5K A;  1DGU A;  1SCM B;  2OTG C;  2Y5I A;  4XYN A;  2K7B A;  5HKW A;  1BG1 A;  1OMV A;  1DJG A;  1DT7 B;  1IWQ A;  1F4Q A;  1TOP A;  1HT9 A;  1YTZ C;  4MBE A;  1FF1 A;  2PAS A;  1QAS A;  2SCP A;  4CFQ A;  3ZWH A;  1J7Q A;  1AJ4 A;  1SCV A;  4ETO A;  2CBL A;  2K2F A;  1A75 B;  2JT3 A;  1OSA A;  3D0Y B;  2LCP A;  3OB2 B;  1OMR A;  1YRT B;  1NX1 A;  2K7O A;  2L98 A;  3VRQ A;  1WLM A;  1RK9 A;  1ZOT B;  2CNP A;  4U8D A;  1S36 A;  2LM5 A;  1IG5 A;  1CNP A;  2MLE C;  2KFG A;  1K93 D;  1X02 A;  4OR9 B;  2ZFD A;  2KBM A;  3NSI A;  1LIN A;  3CTN A;  5I2L A;  2JT0 A;  1EXR A;  2WCF A;  4HRG A;  1YX7 A;  1DVI A;  2F8P A;  1M39 A;  1SL9 A;  1S6C A;  2KI6 D;  4JQ0 D;  1L2O B;  2KAV A;  3AKB A;  4MZK A;  4R1E A;  1RTP 1;  2K0J A;  3NSL A;  2M1U A;  3VRO A;  1TTX A;  3SIA A;  1UP5 A;  2JWW A;  1UHN A;  2M0R A;  1CMG A;  3DF0 A;  1ALV A;  1YUR A;  1W7I B;  1B47 A;  4M2P A;  1A2X A;  1JFK A;  2F2P A;  1ALW A;  2BBM A;  4Q04 A;  4WQ3 A;  2L50 A;  1KQM B;  4HRE E;  1XO5 A;  4YGA A;  1GGW A;  1SMG A;  5D69 A;  4WRI A;  1AP4 A;  1BOC A;  4PHM A;  1SYM A;  2F3Y A;  2M9G A;  2L4I A;  5DKQ A;  2KFF A;  1ZFS A;  2KI6 C;  1BMO A;  1CLL A;  3SG7 A;  2JUL A;  2BL0 C;  2FCD A;  2JC2 A;  2JNX A;  1YVL A;  1KQV A;  1TRF A;  1NIW A;  1PSB A;  3WHT B;  1KCY A;  1LKJ A;  4PHK A;  4PHN A;  5AAN A;  2ZN9 A;  3JVT C;  3DF0 B;  4ORA B;  4MLW A;  1XFX O;  1E8A A;  1N2D A;  2K8M B;  2LE9 B;  1UHJ A;  1KWO C;  3ICB A;  2KHN A;  3CS1 A;  1CM4 A;  4GGF A;  2MHH A;  3TUY B;  4DCK A;  5KTY A;  1MR8 A;  2JT8 A;  2WC8 A;  2WND A;  1PVB A;  2KI4 C;  4GBA A;  3M0W A;  1UWO A;  1K9K A;  2VRG A;  2NCP A;  2BE6 A;  1K96 A;  3CWG A;  3PFV A;  1JBA A;  3BUW B;  1ZUZ A;  5JOL A;  1KK8 C;  1OZO A;  1AUI B;  4MRY A;  2BKI B;  1B1G A;  3O4Y A;  4AQI A;  2BKH B;  2FOT A;  1XFV O;  1YX8 A;  2I18 A;  2G9B A;  1DF0 B;  1YVH A;  4OVN F;  3LK0 A;  1QXP A;  3TDU A;  5I2O A;  1V1G A;  1R6P A;  1IJ5 A;  4MZJ A;  2Q91 A;  2LHI A;  3GK2 A;  1F54 A;  5J3X A;  3DD4 A;  2Q4U A;  1Y1U A;  3GK4 X;  2LVJ A;  1G33 A;  1K95 A;  2NLN A;  4F0Z B;  4JPZ B;  2EC6 B;  2H61 C;  1YUT A;  2COL B;  1A29 A;  1Y6W A;  1LA3 A;  1FI5 A;  1K9P A;  1MQ1 A;  1F55 A;  1IJ6 A;  1JF0 A;  3EK8 A;  3TS5 C;  3EK7 A;  1S6J A;  1WY9 A;  2EGD A;  5AXI A;  2ISD A;  1YUU A;  2DOQ A;  4A4B A;  2MAZ A;  1FW4 A;  2LMT A;  3SG3 A;  1A4P A;  2ZN8 A;  2OTG B;  3A4U B;  3BQ3 A;  4XJK A;  1CFC A;  1Q80 A;  4M2Q A;  2JNF A;  1LXF C;  1J7O A;  5BPJ A;  3CLN A;  1SPY A;  2K2A A;  1B8C A;  2LMV A;  1CLB A;  3H4S E;  3FIA A;  1M63 B;  5D7F A;  1XK4 A;  3D0Y A;  1G4Y R;  1PAL A;  3CR2 A;  4A4C A;  1PVA A;  4OCI A;  3SG6 A;  1A03 A;  1TCO B;  2CCM A;  3BUN B;  4YGC B;  2BCX A;  2MJW B;  4MN0 A;  1AVS A;  3PSR A;  1BJF A;  2AUC A;  1QV0 A;  2WOR A;  3TDI A;  2M97 A;  1VRK A;  3SJS A;  2HPS A;  1JUO A;  3AAK A;  2I7A A;  4MRX A;  1GGZ A;  1SK6 D;  4XJK B;  4NDD A;  5ER5 A;  3I5I C;  1CM1 A;  1QX7 A;  2LAP A;  1CDM A;  3O2P A;  4CID A;  1YUS A;  4YGE B;  1CDL A;  1OQP A;  3PN7 C;  1SRA A;  2NXQ A;  3IQQ A;  1PUL A;  1K2H A;  1DJY A;  2LP2 A;  1MUX A;  1PSR A;  1TIZ A;  2R2I A;  2JU0 A;  1NPQ A;  4DRW A;  2JXL A;  4MVF A;  5TNC A;  3KF9 A;  1JWD A;  3K21 A;  3WHU B;  3HX4 A;  1CFF A;  2KQ6 A;  2JXC A;  2L0P A;  3EVU A;  1L7Z A;  1FBV A;  1J55 A;  1EG3 A;  1M45 A;  3LK1 A;  5PAL A;  4AOM A;  4PAL A;  2MA2 A;  4DS7 A;  2Y1M A;  1K9U A;  3BUO B;  2BBN A;  2RGI A;  2M7N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...