1OMVA

Non-myristoylated bovine recoverin (e85q mutant) with calcium bound to ef-hand 3
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
191
structure length
188
Chain Sequence
GALSKEILEELQLNTKFTEEELSSWYQSFLKECPSGRITRQEFQTIYSKFFPEADPKAYAQHVFRSFDDGTLDFKQYVIALHMTSAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVTAIFKMISPEDTKHLPEDENTPEKRAEKIWGFFGKKDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords recoverin
publication title Impact of N-terminal myristoylation on the Ca2+-dependent conformational transition in recoverin
pubmed doi rcsb
source organism Bos taurus
total genus 74
structure length 188
sequence length 191
ec nomenclature
pdb deposition date 2003-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1omvA02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1omvA01
1FF1A 1YRUB 2L51A 1NWDA 2EC6C 2WCBA 1B9AA 3LK0A 4C0LA 3M0WA 1Y0VH 2MLEC 2O5GA 2B1UA 2HQWA 2ZNEA 3RM1A 1N2DA 4A4BA 5JJGA 2KI4B 2KQYA 3BUXB 5HLVA 2M3WA 3DVEA 4GGFC 2KI6C 4MLWA 1BODA 1H8BA 1SR6C 2GGZA 2RGIA 1MXEA 1SY9A 1TCFA 3CZTX 1MHOA 3AKBA 4IL1A 2L98A 3VGOA 1K94A 1DJHA 1Q80A 1SR6B 3WXAA 1EJ3A 1KFUS 2L4IA 2HQ8A 1ZMZA 2BL0C 4JPZB 4CPVA 2LAPA 5ER5A 1HQVA 2LMVA 1DMOA 1AJ5A 1BOCA 3SG4A 5DKRA 1LVCD 1YVHA 1UHIA 3BOWB 3LLEA 2OS8B 3EKJA 1RTP1 3TS5B 3KHEA 1F54A 2CT9A 1KQVA 4N1GA 4QJ5B 1NPQA 2M7NA 3GK2A 2R2IA 2QACA 1TNQA 4GUKA 1NCXA 5HKYA 2JXLA 2NCPA 1J1EA 2M8UA 2LMTA 1A4PA 1SNLA 5I2OA 2CXJA 1ALVA 1LINA 4FQOA 5KSZA 2TN4A 3I5GC 4DIRA 2JT3A 2G2BA 3FWBA 4OCIA 1U5IB 4NDCA 1WDCB 3IQQA 4ORCB 1QIWA 1YUSA 2KNEA 2VRGA 1V1GA 1SPYA 1L2OC 1NIWA 2K7CA 2LE9B 1CFDA 1J7PA 2AMIA 1ZFSA 3EVUA 3NSLA 1UHNA 1WY9A 1B1GA 1S1EA 3LCPC 1TNWA 2JWWA 3CR5X 1GGZA 1QX2A 2ISDA 2JC2A 1C7WA 4WRIA 4C0KA 1RJVA 1JC2A 1QV0A 3ZWHA 1CDPA 4HREE 2SASA 2LHIA 5CSFA 4ZCVA 4PHNA 2CTNA 2MRDA 1DJGA 1CMGA 3BUNB 4MRYA 4WQ3A 2LM5A 1NP8A 2HF5A 1YX8A 1M46A 2NZ0A 2ZKMX 4D1EA 4JQ0D 1NSHA 3BYAA 3KO0A 1FPWA 3ZNIA 2M49B 3LL8B 2HETA 4GGFA 2OTGC 1RROA 2K0JA 3NXAA 1YR5A 4ORBB 1E8AA 2JXCA 4DUQA 4YI9A 2KYFA 1YX7A 2O60A 4ZCUA 1SCVA 5CSJA 1SL9A 1PVBA 2MJWB 2OTGB 1FW4A 1XO5A 3O78A 1RWYA 1QV1A 5F6TA 4NQGA 2JQ6A 1KQMC 2AAOA 1B7TY 5BPJA 2Y5IA 2K8MB 4GFTA 1A75B 1IJ5A 1JSAA 2ZNDA 2QPTA 4YRUA 1AVSA 3I5HB 5KTYA 1LA0A 3WNXB 1XVJA 1SCMC 1J1DA 1K93D 4PDZA 1YUTA 3QRXA 1NUBA 2K61A 2CNPA 3TDUA 2MLFC 4AQIA 1TN4A 4C0JA 1WLMA 1F71A 3OX6A 4M2PA 1K8UA 3I5IC 4XYNA 2PRUA 4AOMA 2WNDA 1OOJA 2JT8A 1MF8B 3PN7B 2HPSA 5I8NA 2KBIA 1B8CA 2WOSA 2NXQA 1CTRA 2KSPA 2D8NA 4GGNA 3BUMB 3D10A 3D0YA 1ALWA 1CDLA 4PE0A 5KU1A 2LVIA 4XJKA 1GGWA 2KI4C 4CIDA 4I5LB 3FS7A 2BBMA 1RFJA 4UPGA 3JVTB 3VROA 1QS7A 1KK8B 2NLNA 1K9UA 1WRKA 4ICBA 1UWOA 1FBVA 4MZJA 2LC5A 3TZ1A 2ZRTA 3EVRA 3FIAA 3TUYB 1BMOA 1JBAA 2Y4QA 1W7IB 1PVAA 1IGVA 1DJXA 1EG3A 1KK7Y 2BBNA 1KFXS 1A03A 1IWQA 1A29A 1DGUA 2P6BB 4PHMA 2Q4UA 5D7FA 4CFQA 1S3PA 1F55A 2LUXA 4PHJA 3SIAA 1QIVA 1F8HA 4N1FA 5HKZA 4PHKA 2M0RA 1PK0D 2KFFA 2ZFDA 5TNCA 1FI5A 2OS8C 1M45A 3TS5C 3NSIA 1S5GY 1OQPA 1SKTA 3E3RA 4L9MA 4F0ZB 1IH0A 3VRRA 4R1EA 1AP4A 1TOPA 2KGRA 4YGAA 1B47A 1IKUA 2KYCA 2F2OA 2LLUA 3WHTB 1S36A 3A4UB 3AKAA 3KF9A 5I2LA 2KOTA 4ETOA 5D69A 1CM1A 4YGBB 3RLZA 1UUSA 4MEWA 2JOJA 1WDCC 3F45A 1QATA 3CS1A 4HRHA 1AJ4A 1XYDA 2KFHA 4YGCB 4A4CA 4YGDB 2KI6D 1J7OA 1C7VA 3I5FC 4MVFA 2FOTA 1ZACA 1B8RA 2KAVA 5AEQA 2BE4A 3I5FB 2OPOA 1C07A 5B8IB 3DF0B 4AQJA 2KHNA 1DJYA 1TRFA 3LK1A 2KFGA 1KWOB 2BCXA 2WCEA 1TTXA 3A8RA 2L5XB 4P2YB 1UP5A 2JU0A 1DJZA 1QJTA 1LXFC 4PALA 1CLMA 4P5OE 2WC8A 1NX3A 5IBWA 2I2RE 1IQ3A 4NDDA 1BR1B 2LV7A 1D1OA 1M63B 1DJIA 2JTTA 2NCOA 1OMVA 2BKHB 3BXKA 1DF0B 2LP2A 1OMRA 2MBXA 1CDNA 3PLFB 2M7LA 2KAYA 3DVJA 1SL8A 5JOLA 1J7QA 1WRLA 1LKJA 4MBEA 1SMGA 4DCKA 1BLQA 1RECA 2LVJA 1KFUL 5HYDA 4USLA 5FYXA 2JPTA 5PALA 2MHHA 4BY5A 3OB1B 1DT7B 1CFCA 3HCMA 2F33A 5AXIA 4MRXA 1QLSA 2K7DA 4CLNA 1JUOA 1OSAA 1W7JB 1XFZO 4PCWA 2COLB 2K2FA 3BOWA 2MA2A 3CLNA 4TNCA 1F4OA 3NSKA 3I5HC 4PE1A 3SJSA 1NYAA 1X02A 1RK9A 3DVKA 5AERA 2JNXA 1QXPA 1XK4C 2IS9A 2LLSA 2V53A 1DJWA 2EHBA 1Y1XA 2F2PA 2M9GA 1Y1AA 3PATA 1K90D 4MZLA 1KK7Z 3EKHA 1OMDA 4NDBA 1ZOTB 2WCFA 3PN7C 2I18A 1U5IA 1XFXO 1HT9A 2I94A 2PALA 3CR2A 1IG5A 2LHLA 4JWQA 1JF2A 2JULA 4QJ3B 3O2PA 2CCMA 1PULA 2CBLA 2AUCA 1OE9B 2BECA 5J3XA 3WHUB 4E68A 4HSZA 2LVKA 1JWDA 2KAXA 1S5GZ 1OZOA 2JRFA 1TIZA 3KEVA 3JVTC 1KK8C 1VRKA 1XA5A 3JTDB 4GAOA 2PVBA 4M2QA 1G4YR 1SL7A 1JFJA 2LANA 2SCPA 1KCYA 2ZN8A 3TUYC 2M29A 1SYMA 2PSRA 3OX5A 1BT6A 1UURA 1BU3A 5HKWA 1JF0A 1QLKA 2A4JA 4OVNF 4DS7A 2E6WA 1UHHA 5GQQC 1N65A 5CSIA 1J7RA 2E30A 1XFUO 3ICBA 1QVIY 1B8LA 1UHKA 2I7AA 1XFVO 3OP0A 3OHMB 1M31A 1PRWA 1AUIB 3C1VA 5CPVA 1S6IA 4ORAB 1MUXA 1F70A 4I5NB 4CFRA 1WRZA 2EC6B 1J55A 1NX1A 1AK8A 2L50A 2BKIB 2KBMA 2FJUB 1CFPA 2L2EA 4I5JA 1BF5A 5HLOA 3SG2A 3VRPA 1R2UA 1SW8A 1NX0A 1DVIA 2WORA 4I5KA 1A75A 1H4BA 5K89A 1MWNA 3KPXA 1XFWO 1AHRA 2M1KB 2H61C 1LA3A 4BY4A 2ZN9A 1ODBA 2BCBA 1XK4A 2JTZA 1CM4A 1MR8A 2PASA 3MSEB 2BL0B 2LP3A 2Y1NA 4HRGA 1DGVA 3GOFA 1KWOC 2KQ6A 4WQ2A 1NCYA 3AAKA 4M2OA 3AAJA 1S6CA 1BJFA 1M39A 2M97A 3SG7A 3PSRA 2DOQA 5DKNA 2KDHA 1WLZA 1CKKA 1GJYA 2ZRSA 3CWGA 1MQ1A 2LCPA 5G08A 2JNFA 5I2QA 3O4YA 3TDIA 5DKQA 2M1UA 1B7TZ 1R6PA 3SG5A 3SIBA 2LNKA 3VRQA 3K21A 3SG6A 3H4SE 3BQ3A 1QX7A 2K2AA 3VRNA 1ZUZA 1QASA 3I5GB 1CMFA 1BG1A 1EH2A 1KFXL 2FCDA 4OV2A 1PALA 1DTLA 3OB2B 5AANA 4OKHA 3D0YB 1CNPA 2JZIA 1L2OB 1NX2A 3IF7A 1F4QA 3HX4A 4XJKB 1SBJA 2K7OA 3CTNA 3TDZA 1SK6D 1UHJA 1KSMA 1SRAA 1GQMA 4GBAA 1G8IA 3GK4X 1EXRA 2GV5A 3BUOB 1YTZC 4GPLB 1IQ5A 2F3YA 2LVVA 1BR4B 1TNXA 2F8PA 1L7ZA 3IQOA 1G33A 4YBHB 3BUWB 2MAZA 1IJ6A 5AFPA 4YGEB 1CLLA 2Y1MA 2LMUA 2L0PA 1JFKA 1TCOB 1KSOA 2BCAA 1EL4A 1CLBA 4FTGA 3EK8A 1YVLA 1EG4A 3NSOA 1K95A 1PSBA 2G9BA 3EVVA 1K2HA 1YUUA 4PE4A 4Q04A 1QVIZ 2KGBC 4DRWA 2H61A 3DVMA 1A2XA 3CR4X 2EGDA 1CDMA 1Y6WA 3O6BA 1XFYO 1YURA 2PMYA 3JTDC 4MN0A 2K7BA 1B4CA 3DF0A 1KQMB 1CB1A 2GGMA 1NCZA 3DD4A 5CSNA 4QJ4B 1QTXA 2BE6A 3PM8A 1IRJA 1OZSA 1MXLC 1S6JA 4PE7A 1TNPA 1K9KA 1CFFA 3EK4A 2JT0A 1V1FA 2Q91A 1K9PA 3PFVA 3CGAA 3GK1A 1FI6A 2FCEA 1SCMB 2F3ZA 3FWCA 1S26D 4YI8A 1DF0A 2L4HA 1N0YA 1QX5B 3EK7A 4MZKA 4OR9B 4GNKB 2LLTA 3I5IB 2H2KA 4MSPA 1K96A 3SG3A 3PALA 2LUCA 4N5XA 1PSRA 1Y1UA 5ER4X 1YRTB 4U8DA
chains in the Genus database with same CATH superfamily
1FF1A 1YRUB 3IVTA 2L51A 1NWDA 2EC6C 3CZ0A 2WCBA 1B9AA 3LK0A 1OOFA 3B6XA 1Y0VH 2MLEC 2O5GA 3M0WA 4C0LA 2B1UA 2HQWA 2ZNEA 3RM1A 1N2DA 4A4BA 5JJGA 2KI4B 2L2CA 3OGNA 2KQYA 3BUXB 5HLVA 2M3WA 4IJ7A 3DVEA 4GGFC 2KI6C 4MLWA 3SS5A 1BODA 1SR6C 2GGZA 2RGIA 1XFRA 1H8BA 1MXEA 1SY9A 1TCFA 3CZTX 1MHOA 3R72A 1TUZA 3AKBA 4IL1A 2ERBA 2L98A 3VGOA 1K94A 1DJHA 1Q80A 1SR6B 3WXAA 1EJ3A 1KFUS 2L4IA 2HQ8A 1ZMZA 2BL0C 4JPZB 4CPVA 2LAPA 5ER5A 1HQVA 2LMVA 1DMOA 1AJ5A 1BOCA 3SG4A 5DKRA 1LVCD 1YVHA 1UHIA 3BOWB 3LLEA 2OS8B 3EKJA 1DELA 1RTP1 3TS5B 3KHEA 1F54A 2CT9A 1KQVA 4N1GA 4QJ5B 1NPQA 2M7NA 3GK2A 2R2IA 2QACA 1TNQA 4GUKA 1NCXA 5HKYA 2JXLA 2NCPA 1J1EA 2M8UA 2LMTA 5FI7A 1A4PA 1SNLA 3S0GA 5I2OA 2CXJA 1ALVA 1LINA 2QEOA 4FQOA 3UNWA 2TN4A 5KSZA 3I5GC 4DIRA 2JT3A 3QMEA 2G2BA 3FWBA 4OCIA 1U5IB 2H8VA 3Q8IA 1WDCB 4NDCA 3IQQA 4ORCB 1QIWA 1YUSA 2KNEA 2VRGA 1V1GA 3DXLA 4INWA 1SPYA 1L2OC 1NIWA 2K7CA 2LE9B 1CFDA 3CABA 4KYNA 1J7PA 2AMIA 1ZFSA 3EVUA 3NSLA 1UHNA 1WY9A 1B1GA 1S1EA 3LCPC 1TNWA 2JWWA 5HL1A 3CR5X 1GGZA 1QX2A 2ISDA 2JC2A 1C7WA 4WRIA 4C0KA 1RJVA 1JC2A 1QV0A 3B86A 3ZWHA 3S0AA 1CDPA 3V2LA 4HREE 2SASA 2LHIA 5CSFA 4ZCVA 4PHNA 2CTNA 2MRDA 4JD9A 1DJGA 4OZDA 1CMGA 4PT1A 3BUNB 3NHTA 4MRYA 4WQ3A 2LM5A 1NP8A 2HF5A 1YX8A 1M46A 4JKTA 2NZ0A 2ZKMX 4D1EA 4JQ0D 1NSHA 3BYAA 3KO0A 1FPWA 3ZNIA 3O4XA 2M49B 3LL8B 2HETA 4GGFA 2OTGC 1RROA 2K0JA 3NXAA 1YR5A 4ORBB 1E8AA 2JXCA 4DUQA 4YI9A 3S0DA 3BJHA 2KYFA 1DEKA 1YX7A 2O60A 4ZCUA 1SCVA 5CSJA 1SL9A 3VB1A 1PVBA 2MJWB 2OTGB 1FW4A 1XO5A 3O78A 1RWYA 1QV1A 1Z4HA 2PQLA 4NQGA 5F6TA 2JQ6A 1KQMC 1LS8A 2AAOA 5I94A 1B7TY 5BPJA 2Y5IA 2BAPA 5FI2A 2K8MB 4GFTA 1A75B 1IJ5A 1JSAA 2ZNDA 2QPTA 4YRUA 1AVSA 3I5HB 5KTYA 1LA0A 3WNXB 1XVJA 3BFHA 1SCMC 1J1DA 1K93D 2QEHA 3FE9A 4PDZA 1YUTA 3QRXA 1NUBA 2K61A 2CNPA 3TDUA 2MLFC 4AQIA 1TN4A 3BFAA 4C0JA 1WLMA 1F71A 3OX6A 4M2PA 1K8UA 3I5IC 4XYNA 2PRUA 4AOMA 2WNDA 1OOJA 2JT8A 1MF8B 3PN7B 2HPSA 5I8NA 2KPHA 2KBIA 1B8CA 2WOSA 2NXQA 1CTRA 2KSPA 2D8NA 3CDNA 4GGNA 3BUMB 3D10A 3D0YA 1ALWA 1CDLA 4PE0A 5KU1A 2LVIA 4XJKA 2QEBA 1GGWA 2KI4C 4CIDA 4I5LB 3FS7A 3D75A 2BBMA 1RFJA 3L4LA 4UPGA 3JVTB 3VROA 1QS7A 1KK8B 2NLNA 1QWVA 1K9UA 1WRKA 4ICBA 1UWOA 1FBVA 2QDIA 3DZTA 2LC5A 4INXA 4MZJA 3TZ1A 2ZRTA 3EVRA 3FIAA 5EL2A 1BMOA 3TUYB 1JBAA 2Y4QA 1W7IB 1PVAA 1IGVA 1DJXA 1EG3A 1KK7Y 2BBNA 1KFXS 1A03A 1IWQA 3FE6A 1A29A 1DGUA 2P6BB 4PHMA 2Q4UA 5D7FA 4CFQA 1S3PA 3D76A 1F55A 2LUXA 4PHJA 3SIAA 1QIVA 1F8HA 4N1FA 2WC5A 4PHKA 2M0RA 5HKZA 1PK0D 2KFFA 2ZFDA 5TNCA 1FI5A 2OS8C 1M45A 3CYZA 3TS5C 3NSIA 1S5GY 1OQPA 1SKTA 3E3RA 4L9MA 4F0ZB 1IH0A 3VRRA 4R1EA 1AP4A 1TOPA 2KGRA 2WC6A 4YGAA 2WCJA 1B47A 1IKUA 2KYCA 2F2OA 2LLUA 3WHTB 1S36A 3A4UB 3AKAA 3KF9A 5I2LA 2KOTA 4ETOA 5D69A 5FI6A 1CM1A 4YGBB 3RLZA 1UUSA 4MEWA 2JOJA 1WDCC 3F45A 1QATA 3CS1A 4HRHA 1XYDA 1AJ4A 2KFHA 1OOIX 4YGCB 4A4CA 4YGDB 2KI6D 1J7OA 2K60A 1C7VA 3I5FC 4MVFA 2FOTA 1ZACA 1B8RA 2KAVA 2WCKA 1DC1A 3R1PA 2BE4A 5AEQA 3D77A 3I5FB 2OPOA 1C07A 2WCHA 3DF0B 4AQJA 5B8IB 2KHNA 1DJYA 1TRFA 3LK1A 2KFGA 1DQEA 1KWOB 2BCXA 1TTXA 2WCEA 3A8RA 2L5XB 4P2YB 1UP5A 2JU0A 1DJZA 1QJTA 1LXFC 4PALA 1CLMA 4P5OE 2WC8A 1NX3A 5IBWA 2I2RE 1IQ3A 4NDDA 1BR1B 2LV7A 3S0EA 1D1OA 1M63B 1DJIA 2JTTA 2NCOA 1OMVA 2BKHB 3BXKA 3NGVA 1DF0B 2LP2A 1OMRA 2MBXA 1CDNA 3PLFB 2M7LA 2KAYA 3SS3A 3DVJA 3BFBA 1SL8A 5JOLA 1J7QA 1WRLA 1LKJA 4MBEA 1SMGA 4DCKA 1BLQA 1RECA 2LVJA 1KFUL 2GTEA 5HYDA 1GM0A 4USLA 5FYXA 2JPTA 5PALA 3EG5B 2MHHA 4BY5A 3OB1B 1DT7B 1CFCA 3HCMA 3D73A 2F33A 5AXIA 4MRXA 1QLSA 2P71A 2K7DA 3S0BA 4CLNA 1JUOA 1OSAA 1W7JB 1XFZO 4PCWA 2COLB 2K2FA 3BOWA 2MA2A 3CLNA 4TNCA 1F4OA 3NSKA 3I5HC 4PE1A 3CZ1A 3SJSA 2YGUA 1NYAA 1X02A 1RK9A 3DVKA 5AERA 2JNXA 1QXPA 1XK4C 2IS9A 2LLSA 2V53A 1DJWA 2EHBA 1Y1XA 2F2PA 2M9GA 1Y1AA 2FJYA 3PATA 1K90D 4MZLA 1C3ZA 1KK7Z 3EKHA 1OMDA 4NDBA 1ZOTB 2WCFA 3PN7C 2I18A 1XFXO 1U5IA 1OOHA 1HT9A 2I94A 2PALA 3CR2A 1IG5A 2LHLA 4JWQA 1JF2A 2JULA 2WCMA 4QJ3B 3O2PA 2CCMA 1PULA 2CBLA 2AUCA 1OE9B 2BECA 3DYEA 5J3XA 3WHUB 4E68A 4HSZA 2LVKA 1JWDA 2KAXA 4F7FA 1S5GZ 1OZOA 2JRFA 1TIZA 3KEVA 3JVTC 1C3YA 1KK8C 1VRKA 1XA5A 3JTDB 4GAOA 2PVBA 4M2QA 1G4YR 1SL7A 1JFJA 2LANA 2SCPA 1KCYA 2ZN8A 3TUYC 2M29A 1SYMA 2PSRA 3OX5A 1BT6A 1UURA 1BU3A 5HKWA 1JF0A 5D3OA 1QLKA 2A4JA 4OVNF 3D74A 4DS7A 2E6WA 1UHHA 5GQQC 1N65A 5CSIA 1J7RA 2E30A 1XFUO 3ICBA 1QVIY 1B8LA 1UHKA 2I7AA 1XFVO 3OP0A 3OHMB 1M31A 1PRWA 1AUIB 3DY9A 3C1VA 2QEVA 5CPVA 1S6IA 4ORAB 3CZ2A 3OBVA 1MUXA 1OOGA 1OW4A 4I5NB 1F70A 3R1VA 4CFRA 1WRZA 2EC6B 1J55A 3L47A 1NX1A 2L5YA 3D78A 1AK8A 2L50A 2BKIB 2KBMA 2FJUB 1CFPA 2L2EA 4I5JA 1BF5A 5HLOA 3SG2A 3VRPA 1R2UA 1SW8A 1NX0A 1DVIA 2WORA 4I5KA 1A75A 1H4BA 5K89A 1MWNA 3KPXA 1XFWO 1AHRA 2M1KB 2H61C 1LA3A 4BY4A 1IIOA 2ZN9A 1ODBA 3B87A 2BCBA 1SSEB 1XK4A 2JTZA 1CM4A 1MR8A 2PASA 3MSEB 2BL0B 2LP3A 2Y1NA 4HRGA 1DGVA 3GOFA 1KWOC 2KQ6A 3K1EA 3N7HA 4WQ2A 1NCYA 3AAKA 4M2OA 3AAJA 1S6CA 1BJFA 1M39A 2M97A 3SG7A 3PSRA 2DOQA 5DKNA 2KDHA 1WLZA 1CKKA 1GJYA 2ZRSA 3CWGA 1MQ1A 2LCPA 5G08A 2JNFA 5I2QA 2PYQA 3O4YA 3TDIA 5DKQA 2M1UA 1B7TZ 1R6PA 3SG5A 3SIBA 2LNKA 3VRQA 3K21A 3SG6A 1TWOA 3H4SE 1Z2CB 3BQ3A 1QX7A 2K2AA 3VRNA 1ZUZA 1QASA 3I5GB 3SS4A 1BG1A 1CMFA 1EH2A 1KFXL 2FCDA 1T14A 4OV2A 1PALA 1DTLA 2JPOA 2P70A 4FQTA 3OB2B 5AANA 4OKHA 3D0YB 1CNPA 2JZIA 1L2OB 1NX2A 3IF7A 1F4QA 3HX4A 4XJKB 1SBJA 2K7OA 3CTNA 3TDZA 1SK6D 1UHJA 1KSMA 1SRAA 1GQMA 4GBAA 1G8IA 3GK4X 1EXRA 2GV5A 3BUOB 1YTZC 4GPLB 1IQ5A 2F3YA 3R1OA 2LVVA 1BR4B 1TNXA 2F8PA 1L7ZA 3IQOA 1G33A 1TUJA 3B7AA 4YBHB 3BUWB 2MAZA 3PM2A 1IJ6A 5AFPA 4YGEB 1CLLA 2Y1MA 2LMUA 2L0PA 3L4AA 1JFKA 1TCOB 1KSOA 2BCAA 1EL4A 1CLBA 4FTGA 3EK8A 1YVLA 1EG4A 5DICA 3NSOA 1K95A 1PSBA 2G9BA 3UO9A 3EVVA 1K2HA 1YUUA 4PE4A 4Q04A 1QVIZ 2KGBC 4DRWA 2H61A 3DVMA 1A2XA 3CR4X 2EGDA 1CDMA 1Y6WA 3O6BA 1XFYO 1YURA 2PMYA 3JTDC 2KLDA 4MN0A 3RZSA 2K7BA 1B4CA 3DF0A 1KQMB 1CB1A 2GGMA 1NCZA 3DD4A 5CSNA 4QJ4B 1P28A 1QTXA 2BE6A 1IRJA 1OZSA 3PM8A 1MXLC 1S6JA 3PJIA 4PE7A 2KLEA 1TNPA 1K9KA 3NHIA 1CFFA 3B88A 3EK4A 2JT0A 3FE8A 1V1FA 2Q91A 1K9PA 3PFVA 3CGAA 3GK1A 1FI6A 2FCEA 1SCMB 2F3ZA 3FWCA 1S26D 4YI8A 1DF0A 2L4HA 1N0YA 2WCLA 1QX5B 3EK7A 4MZKA 4OR9B 4GNKB 2BNXA 3S0FA 2LLTA 3I5IB 2H2KA 4MSPA 1K96A 3SG3A 3PALA 2LUCA 4N5XA 1PSRA 1Y1UA 5ER4X 1YRTB 4U8DA 1ORGA 1W9ZA
chains in the Genus database with same CATH topology
1FF1A 1YRUB 2L51A 1NWDA 2EC6C 2WCBA 1B9AA 3LK0A 4C0LA 3M0WA 1Y0VH 2MLEC 2O5GA 2B1UA 2HQWA 2ZNEA 3RM1A 1N2DA 4A4BA 5JJGA 2KI4B 2KQYA 3BUXB 5HLVA 2M3WA 3DVEA 4GGFC 2KI6C 4MLWA 1BODA 1H8BA 1SR6C 2GGZA 2RGIA 1MXEA 1SY9A 1TCFA 3CZTX 1MHOA 3AKBA 4IL1A 2L98A 3VGOA 1K94A 1DJHA 1Q80A 1SR6B 3WXAA 1EJ3A 1KFUS 2L4IA 2HQ8A 1ZMZA 2BL0C 4JPZB 4CPVA 2LAPA 5ER5A 1HQVA 2LMVA 1DMOA 1AJ5A 1BOCA 3SG4A 5DKRA 1LVCD 1YVHA 1UHIA 3BOWB 3LLEA 2OS8B 3EKJA 1RTP1 3TS5B 3KHEA 1F54A 2CT9A 1KQVA 4N1GA 4QJ5B 1NPQA 2M7NA 3GK2A 2R2IA 2QACA 1TNQA 4GUKA 1NCXA 5HKYA 2JXLA 2NCPA 1J1EA 2M8UA 2LMTA 1A4PA 1SNLA 5I2OA 2CXJA 1ALVA 1LINA 4FQOA 5KSZA 2TN4A 3I5GC 4DIRA 2JT3A 2G2BA 3FWBA 4OCIA 1U5IB 4NDCA 1WDCB 3IQQA 4ORCB 1QIWA 1YUSA 2KNEA 2VRGA 1V1GA 1SPYA 1L2OC 1NIWA 2K7CA 2LE9B 1CFDA 1J7PA 2AMIA 1ZFSA 3EVUA 3NSLA 1UHNA 1WY9A 1B1GA 1S1EA 3LCPC 1TNWA 2JWWA 3CR5X 1GGZA 1QX2A 2ISDA 2JC2A 1C7WA 4WRIA 4C0KA 1RJVA 1JC2A 1QV0A 3ZWHA 1CDPA 4HREE 2SASA 2LHIA 5CSFA 4ZCVA 4PHNA 2CTNA 2MRDA 1DJGA 1CMGA 3BUNB 4MRYA 4WQ3A 2LM5A 1NP8A 2HF5A 1YX8A 1M46A 2NZ0A 2ZKMX 4D1EA 4JQ0D 1NSHA 3BYAA 3KO0A 1FPWA 3ZNIA 2M49B 3LL8B 2HETA 4GGFA 2OTGC 1RROA 2K0JA 3NXAA 1YR5A 4ORBB 1E8AA 2JXCA 4DUQA 4YI9A 2KYFA 1YX7A 2O60A 4ZCUA 1SCVA 5CSJA 1SL9A 1PVBA 2MJWB 2OTGB 1FW4A 1XO5A 3O78A 1RWYA 1QV1A 5F6TA 4NQGA 2JQ6A 1KQMC 2AAOA 1B7TY 5BPJA 2Y5IA 2K8MB 4GFTA 1A75B 1IJ5A 1JSAA 2ZNDA 2QPTA 4YRUA 1AVSA 3I5HB 5KTYA 1LA0A 3WNXB 1XVJA 1SCMC 1J1DA 1K93D 4PDZA 1YUTA 3QRXA 1NUBA 2K61A 2CNPA 3TDUA 2MLFC 4AQIA 1TN4A 4C0JA 1WLMA 1F71A 3OX6A 4M2PA 1K8UA 3I5IC 4XYNA 2PRUA 4AOMA 2WNDA 1OOJA 2JT8A 1MF8B 3PN7B 2HPSA 5I8NA 2KBIA 1B8CA 2WOSA 2NXQA 1CTRA 2KSPA 2D8NA 4GGNA 3BUMB 3D10A 3D0YA 1ALWA 1CDLA 4PE0A 5KU1A 2LVIA 4XJKA 1GGWA 2KI4C 4CIDA 4I5LB 3FS7A 2BBMA 1RFJA 4UPGA 3JVTB 3VROA 1QS7A 1KK8B 2NLNA 1K9UA 1WRKA 4ICBA 1UWOA 1FBVA 4MZJA 2LC5A 3TZ1A 2ZRTA 3EVRA 3FIAA 3TUYB 1BMOA 1JBAA 2Y4QA 1W7IB 1PVAA 1IGVA 1DJXA 1EG3A 1KK7Y 2BBNA 1KFXS 1A03A 1IWQA 1A29A 1DGUA 2P6BB 4PHMA 2Q4UA 5D7FA 4CFQA 1S3PA 1F55A 2LUXA 4PHJA 3SIAA 1QIVA 1F8HA 4N1FA 5HKZA 4PHKA 2M0RA 1PK0D 2KFFA 2ZFDA 5TNCA 1FI5A 2OS8C 1M45A 3TS5C 3NSIA 1S5GY 1OQPA 1SKTA 3E3RA 4L9MA 4F0ZB 1IH0A 3VRRA 4R1EA 1AP4A 1TOPA 2KGRA 4YGAA 1B47A 1IKUA 2KYCA 2F2OA 2LLUA 3WHTB 1S36A 3A4UB 3AKAA 3KF9A 5I2LA 2KOTA 4ETOA 5D69A 1CM1A 4YGBB 3RLZA 1UUSA 4MEWA 2JOJA 1WDCC 3F45A 1QATA 3CS1A 4HRHA 1AJ4A 1XYDA 2KFHA 4YGCB 4A4CA 4YGDB 2KI6D 1J7OA 1C7VA 3I5FC 4MVFA 2FOTA 1ZACA 1B8RA 2KAVA 5AEQA 2BE4A 3I5FB 2OPOA 1C07A 5B8IB 3DF0B 4AQJA 2KHNA 1DJYA 1TRFA 3LK1A 2KFGA 1KWOB 2BCXA 2WCEA 1TTXA 3A8RA 2L5XB 4P2YB 1UP5A 2JU0A 1DJZA 1QJTA 1LXFC 4PALA 1CLMA 4P5OE 2WC8A 1NX3A 5IBWA 2I2RE 1IQ3A 4NDDA 1BR1B 2LV7A 1D1OA 1M63B 1DJIA 2JTTA 2NCOA 1OMVA 2BKHB 3BXKA 1DF0B 2LP2A 1OMRA 2MBXA 1CDNA 3PLFB 2M7LA 2KAYA 3DVJA 1SL8A 5JOLA 1J7QA 1WRLA 1LKJA 4MBEA 1SMGA 4DCKA 1BLQA 1RECA 2LVJA 1KFUL 5HYDA 4USLA 5FYXA 2JPTA 5PALA 2MHHA 4BY5A 3OB1B 1DT7B 1CFCA 3HCMA 2F33A 5AXIA 4MRXA 1QLSA 2K7DA 4CLNA 1JUOA 1OSAA 1W7JB 1XFZO 4PCWA 2COLB 2K2FA 3BOWA 2MA2A 3CLNA 4TNCA 1F4OA 3NSKA 3I5HC 4PE1A 3SJSA 1NYAA 1X02A 1RK9A 3DVKA 5AERA 2JNXA 1QXPA 1XK4C 2IS9A 2LLSA 2V53A 1DJWA 2EHBA 1Y1XA 2F2PA 2M9GA 1Y1AA 3PATA 1K90D 4MZLA 1KK7Z 3EKHA 1OMDA 4NDBA 1ZOTB 2WCFA 3PN7C 2I18A 1U5IA 1XFXO 1HT9A 2I94A 2PALA 3CR2A 1IG5A 2LHLA 4JWQA 1JF2A 2JULA 4QJ3B 3O2PA 2CCMA 1PULA 2CBLA 2AUCA 1OE9B 2BECA 5J3XA 3WHUB 4E68A 4HSZA 2LVKA 1JWDA 2KAXA 1S5GZ 1OZOA 2JRFA 1TIZA 3KEVA 3JVTC 1KK8C 1VRKA 1XA5A 3JTDB 4GAOA 2PVBA 4M2QA 1G4YR 1SL7A 1JFJA 2LANA 2SCPA 1KCYA 2ZN8A 3TUYC 2M29A 1SYMA 2PSRA 3OX5A 1BT6A 1UURA 1BU3A 5HKWA 1JF0A 1QLKA 2A4JA 4OVNF 4DS7A 2E6WA 1UHHA 5GQQC 1N65A 5CSIA 1J7RA 2E30A 1XFUO 3ICBA 1QVIY 1B8LA 1UHKA 2I7AA 1XFVO 3OP0A 3OHMB 1M31A 1PRWA 1AUIB 3C1VA 5CPVA 1S6IA 4ORAB 1MUXA 1F70A 4I5NB 4CFRA 1WRZA 2EC6B 1J55A 1NX1A 1AK8A 2L50A 2BKIB 2KBMA 2FJUB 1CFPA 2L2EA 4I5JA 1BF5A 5HLOA 3SG2A 3VRPA 1R2UA 1SW8A 1NX0A 1DVIA 2WORA 4I5KA 1A75A 1H4BA 5K89A 1MWNA 3KPXA 1XFWO 1AHRA 2M1KB 2H61C 1LA3A 4BY4A 2ZN9A 1ODBA 2BCBA 1XK4A 2JTZA 1CM4A 1MR8A 2PASA 3MSEB 2BL0B 2LP3A 2Y1NA 4HRGA 1DGVA 3GOFA 1KWOC 2KQ6A 4WQ2A 1NCYA 3AAKA 4M2OA 3AAJA 1S6CA 1BJFA 1M39A 2M97A 3SG7A 3PSRA 2DOQA 5DKNA 2KDHA 1WLZA 1CKKA 1GJYA 2ZRSA 3CWGA 1MQ1A 2LCPA 5G08A 2JNFA 5I2QA 3O4YA 3TDIA 5DKQA 2M1UA 1B7TZ 1R6PA 3SG5A 3SIBA 2LNKA 3VRQA 3K21A 3SG6A 3H4SE 3BQ3A 1QX7A 2K2AA 3VRNA 1ZUZA 1QASA 3I5GB 1CMFA 1BG1A 1EH2A 1KFXL 2FCDA 4OV2A 1PALA 1DTLA 3OB2B 5AANA 4OKHA 3D0YB 1CNPA 2JZIA 1L2OB 1NX2A 3IF7A 1F4QA 3HX4A 4XJKB 1SBJA 2K7OA 3CTNA 3TDZA 1SK6D 1UHJA 1KSMA 1SRAA 1GQMA 4GBAA 1G8IA 3GK4X 1EXRA 2GV5A 3BUOB 1YTZC 4GPLB 1IQ5A 2F3YA 2LVVA 1BR4B 1TNXA 2F8PA 1L7ZA 3IQOA 1G33A 4YBHB 3BUWB 2MAZA 1IJ6A 5AFPA 4YGEB 1CLLA 2Y1MA 2LMUA 2L0PA 1JFKA 1TCOB 1KSOA 2BCAA 1EL4A 1CLBA 4FTGA 3EK8A 1YVLA 1EG4A 3NSOA 1K95A 1PSBA 2G9BA 3EVVA 1K2HA 1YUUA 4PE4A 4Q04A 1QVIZ 2KGBC 4DRWA 2H61A 3DVMA 1A2XA 3CR4X 2EGDA 1CDMA 1Y6WA 3O6BA 1XFYO 1YURA 2PMYA 3JTDC 4MN0A 2K7BA 1B4CA 3DF0A 1KQMB 1CB1A 2GGMA 1NCZA 3DD4A 5CSNA 4QJ4B 1QTXA 2BE6A 3PM8A 1IRJA 1OZSA 1MXLC 1S6JA 4PE7A 1TNPA 1K9KA 1CFFA 3EK4A 2JT0A 1V1FA 2Q91A 1K9PA 3PFVA 3CGAA 3GK1A 1FI6A 2FCEA 1SCMB 2F3ZA 3FWCA 1S26D 4YI8A 1DF0A 2L4HA 1N0YA 1QX5B 3EK7A 4MZKA 4OR9B 4GNKB 2LLTA 3I5IB 2H2KA 4MSPA 1K96A 3SG3A 3PALA 2LUCA 4N5XA 1PSRA 1Y1UA 5ER4X 1YRTB 4U8DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FF1 A;  1YRU B;  2L51 A;  1NWD A;  2EC6 C;  2WCB A;  1B9A A;  3LK0 A;  4C0L A;  3M0W A;  1Y0V H;  2MLE C;  2O5G A;  2B1U A;  2HQW A;  2ZNE A;  3RM1 A;  1N2D A;  4A4B A;  5JJG A;  2KI4 B;  2KQY A;  3BUX B;  5HLV A;  2M3W A;  3DVE A;  4GGF C;  2KI6 C;  4MLW A;  1BOD A;  1H8B A;  1SR6 C;  2GGZ A;  2RGI A;  1MXE A;  1SY9 A;  1TCF A;  3CZT X;  1MHO A;  3AKB A;  4IL1 A;  2L98 A;  3VGO A;  1K94 A;  1DJH A;  1Q80 A;  1SR6 B;  3WXA A;  1EJ3 A;  1KFU S;  2L4I A;  2HQ8 A;  1ZMZ A;  2BL0 C;  4JPZ B;  4CPV A;  2LAP A;  5ER5 A;  1HQV A;  2LMV A;  1DMO A;  1AJ5 A;  1BOC A;  3SG4 A;  5DKR A;  1LVC D;  1YVH A;  1UHI A;  3BOW B;  3LLE A;  2OS8 B;  3EKJ A;  1RTP 1;  3TS5 B;  3KHE A;  1F54 A;  2CT9 A;  1KQV A;  4N1G A;  4QJ5 B;  1NPQ A;  2M7N A;  3GK2 A;  2R2I A;  2QAC A;  1TNQ A;  4GUK A;  1NCX A;  5HKY A;  2JXL A;  2NCP A;  1J1E A;  2M8U A;  2LMT A;  1A4P A;  1SNL A;  5I2O A;  2CXJ A;  1ALV A;  1LIN A;  4FQO A;  5KSZ A;  2TN4 A;  3I5G C;  4DIR A;  2JT3 A;  2G2B A;  3FWB A;  4OCI A;  1U5I B;  4NDC A;  1WDC B;  3IQQ A;  4ORC B;  1QIW A;  1YUS A;  2KNE A;  2VRG A;  1V1G A;  1SPY A;  1L2O C;  1NIW A;  2K7C A;  2LE9 B;  1CFD A;  1J7P A;  2AMI A;  1ZFS A;  3EVU A;  3NSL A;  1UHN A;  1WY9 A;  1B1G A;  1S1E A;  3LCP C;  1TNW A;  2JWW A;  3CR5 X;  1GGZ A;  1QX2 A;  2ISD A;  2JC2 A;  1C7W A;  4WRI A;  4C0K A;  1RJV A;  1JC2 A;  1QV0 A;  3ZWH A;  1CDP A;  4HRE E;  2SAS A;  2LHI A;  5CSF A;  4ZCV A;  4PHN A;  2CTN A;  2MRD A;  1DJG A;  1CMG A;  3BUN B;  4MRY A;  4WQ3 A;  2LM5 A;  1NP8 A;  2HF5 A;  1YX8 A;  1M46 A;  2NZ0 A;  2ZKM X;  4D1E A;  4JQ0 D;  1NSH A;  3BYA A;  3KO0 A;  1FPW A;  3ZNI A;  2M49 B;  3LL8 B;  2HET A;  4GGF A;  2OTG C;  1RRO A;  2K0J A;  3NXA A;  1YR5 A;  4ORB B;  1E8A A;  2JXC A;  4DUQ A;  4YI9 A;  2KYF A;  1YX7 A;  2O60 A;  4ZCU A;  1SCV A;  5CSJ A;  1SL9 A;  1PVB A;  2MJW B;  2OTG B;  1FW4 A;  1XO5 A;  3O78 A;  1RWY A;  1QV1 A;  5F6T A;  4NQG A;  2JQ6 A;  1KQM C;  2AAO A;  1B7T Y;  5BPJ A;  2Y5I A;  2K8M B;  4GFT A;  1A75 B;  1IJ5 A;  1JSA A;  2ZND A;  2QPT A;  4YRU A;  1AVS A;  3I5H B;  5KTY A;  1LA0 A;  3WNX B;  1XVJ A;  1SCM C;  1J1D A;  1K93 D;  4PDZ A;  1YUT A;  3QRX A;  1NUB A;  2K61 A;  2CNP A;  3TDU A;  2MLF C;  4AQI A;  1TN4 A;  4C0J A;  1WLM A;  1F71 A;  3OX6 A;  4M2P A;  1K8U A;  3I5I C;  4XYN A;  2PRU A;  4AOM A;  2WND A;  1OOJ A;  2JT8 A;  1MF8 B;  3PN7 B;  2HPS A;  5I8N A;  2KBI A;  1B8C A;  2WOS A;  2NXQ A;  1CTR A;  2KSP A;  2D8N A;  4GGN A;  3BUM B;  3D10 A;  3D0Y A;  1ALW A;  1CDL A;  4PE0 A;  5KU1 A;  2LVI A;  4XJK A;  1GGW A;  2KI4 C;  4CID A;  4I5L B;  3FS7 A;  2BBM A;  1RFJ A;  4UPG A;  3JVT B;  3VRO A;  1QS7 A;  1KK8 B;  2NLN A;  1K9U A;  1WRK A;  4ICB A;  1UWO A;  1FBV A;  4MZJ A;  2LC5 A;  3TZ1 A;  2ZRT A;  3EVR A;  3FIA A;  3TUY B;  1BMO A;  1JBA A;  2Y4Q A;  1W7I B;  1PVA A;  1IGV A;  1DJX A;  1EG3 A;  1KK7 Y;  2BBN A;  1KFX S;  1A03 A;  1IWQ A;  1A29 A;  1DGU A;  2P6B B;  4PHM A;  2Q4U A;  5D7F A;  4CFQ A;  1S3P A;  1F55 A;  2LUX A;  4PHJ A;  3SIA A;  1QIV A;  1F8H A;  4N1F A;  5HKZ A;  4PHK A;  2M0R A;  1PK0 D;  2KFF A;  2ZFD A;  5TNC A;  1FI5 A;  2OS8 C;  1M45 A;  3TS5 C;  3NSI A;  1S5G Y;  1OQP A;  1SKT A;  3E3R A;  4L9M A;  4F0Z B;  1IH0 A;  3VRR A;  4R1E A;  1AP4 A;  1TOP A;  2KGR A;  4YGA A;  1B47 A;  1IKU A;  2KYC A;  2F2O A;  2LLU A;  3WHT B;  1S36 A;  3A4U B;  3AKA A;  3KF9 A;  5I2L A;  2KOT A;  4ETO A;  5D69 A;  1CM1 A;  4YGB B;  3RLZ A;  1UUS A;  4MEW A;  2JOJ A;  1WDC C;  3F45 A;  1QAT A;  3CS1 A;  4HRH A;  1AJ4 A;  1XYD A;  2KFH A;  4YGC B;  4A4C A;  4YGD B;  2KI6 D;  1J7O A;  1C7V A;  3I5F C;  4MVF A;  2FOT A;  1ZAC A;  1B8R A;  2KAV A;  5AEQ A;  2BE4 A;  3I5F B;  2OPO A;  1C07 A;  5B8I B;  3DF0 B;  4AQJ A;  2KHN A;  1DJY A;  1TRF A;  3LK1 A;  2KFG A;  1KWO B;  2BCX A;  2WCE A;  1TTX A;  3A8R A;  2L5X B;  4P2Y B;  1UP5 A;  2JU0 A;  1DJZ A;  1QJT A;  1LXF C;  4PAL A;  1CLM A;  4P5O E;  2WC8 A;  1NX3 A;  5IBW A;  2I2R E;  1IQ3 A;  4NDD A;  1BR1 B;  2LV7 A;  1D1O A;  1M63 B;  1DJI A;  2JTT A;  2NCO A;  1OMV A;  2BKH B;  3BXK A;  1DF0 B;  2LP2 A;  1OMR A;  2MBX A;  1CDN A;  3PLF B;  2M7L A;  2KAY A;  3DVJ A;  1SL8 A;  5JOL A;  1J7Q A;  1WRL A;  1LKJ A;  4MBE A;  1SMG A;  4DCK A;  1BLQ A;  1REC A;  2LVJ A;  1KFU L;  5HYD A;  4USL A;  5FYX A;  2JPT A;  5PAL A;  2MHH A;  4BY5 A;  3OB1 B;  1DT7 B;  1CFC A;  3HCM A;  2F33 A;  5AXI A;  4MRX A;  1QLS A;  2K7D A;  4CLN A;  1JUO A;  1OSA A;  1W7J B;  1XFZ O;  4PCW A;  2COL B;  2K2F A;  3BOW A;  2MA2 A;  3CLN A;  4TNC A;  1F4O A;  3NSK A;  3I5H C;  4PE1 A;  3SJS A;  1NYA A;  1X02 A;  1RK9 A;  3DVK A;  5AER A;  2JNX A;  1QXP A;  1XK4 C;  2IS9 A;  2LLS A;  2V53 A;  1DJW A;  2EHB A;  1Y1X A;  2F2P A;  2M9G A;  1Y1A A;  3PAT A;  1K90 D;  4MZL A;  1KK7 Z;  3EKH A;  1OMD A;  4NDB A;  1ZOT B;  2WCF A;  3PN7 C;  2I18 A;  1U5I A;  1XFX O;  1HT9 A;  2I94 A;  2PAL A;  3CR2 A;  1IG5 A;  2LHL A;  4JWQ A;  1JF2 A;  2JUL A;  4QJ3 B;  3O2P A;  2CCM A;  1PUL A;  2CBL A;  2AUC A;  1OE9 B;  2BEC A;  5J3X A;  3WHU B;  4E68 A;  4HSZ A;  2LVK A;  1JWD A;  2KAX A;  1S5G Z;  1OZO A;  2JRF A;  1TIZ A;  3KEV A;  3JVT C;  1KK8 C;  1VRK A;  1XA5 A;  3JTD B;  4GAO A;  2PVB A;  4M2Q A;  1G4Y R;  1SL7 A;  1JFJ A;  2LAN A;  2SCP A;  1KCY A;  2ZN8 A;  3TUY C;  2M29 A;  1SYM A;  2PSR A;  3OX5 A;  1BT6 A;  1UUR A;  1BU3 A;  5HKW A;  1JF0 A;  1QLK A;  2A4J A;  4OVN F;  4DS7 A;  2E6W A;  1UHH A;  5GQQ C;  1N65 A;  5CSI A;  1J7R A;  2E30 A;  1XFU O;  3ICB A;  1QVI Y;  1B8L A;  1UHK A;  2I7A A;  1XFV O;  3OP0 A;  3OHM B;  1M31 A;  1PRW A;  1AUI B;  3C1V A;  5CPV A;  1S6I A;  4ORA B;  1MUX A;  1F70 A;  4I5N B;  4CFR A;  1WRZ A;  2EC6 B;  1J55 A;  1NX1 A;  1AK8 A;  2L50 A;  2BKI B;  2KBM A;  2FJU B;  1CFP A;  2L2E A;  4I5J A;  1BF5 A;  5HLO A;  3SG2 A;  3VRP A;  1R2U A;  1SW8 A;  1NX0 A;  1DVI A;  2WOR A;  4I5K A;  1A75 A;  1H4B A;  5K89 A;  1MWN A;  3KPX A;  1XFW O;  1AHR A;  2M1K B;  2H61 C;  1LA3 A;  4BY4 A;  2ZN9 A;  1ODB A;  2BCB A;  1XK4 A;  2JTZ A;  1CM4 A;  1MR8 A;  2PAS A;  3MSE B;  2BL0 B;  2LP3 A;  2Y1N A;  4HRG A;  1DGV A;  3GOF A;  1KWO C;  2KQ6 A;  4WQ2 A;  1NCY A;  3AAK A;  4M2O A;  3AAJ A;  1S6C A;  1BJF A;  1M39 A;  2M97 A;  3SG7 A;  3PSR A;  2DOQ A;  5DKN A;  2KDH A;  1WLZ A;  1CKK A;  1GJY A;  2ZRS A;  3CWG A;  1MQ1 A;  2LCP A;  5G08 A;  2JNF A;  5I2Q A;  3O4Y A;  3TDI A;  5DKQ A;  2M1U A;  1B7T Z;  1R6P A;  3SG5 A;  3SIB A;  2LNK A;  3VRQ A;  3K21 A;  3SG6 A;  3H4S E;  3BQ3 A;  1QX7 A;  2K2A A;  3VRN A;  1ZUZ A;  1QAS A;  3I5G B;  1CMF A;  1BG1 A;  1EH2 A;  1KFX L;  2FCD A;  4OV2 A;  1PAL A;  1DTL A;  3OB2 B;  5AAN A;  4OKH A;  3D0Y B;  1CNP A;  2JZI A;  1L2O B;  1NX2 A;  3IF7 A;  1F4Q A;  3HX4 A;  4XJK B;  1SBJ A;  2K7O A;  3CTN A;  3TDZ A;  1SK6 D;  1UHJ A;  1KSM A;  1SRA A;  1GQM A;  4GBA A;  1G8I A;  3GK4 X;  1EXR A;  2GV5 A;  3BUO B;  1YTZ C;  4GPL B;  1IQ5 A;  2F3Y A;  2LVV A;  1BR4 B;  1TNX A;  2F8P A;  1L7Z A;  3IQO A;  1G33 A;  4YBH B;  3BUW B;  2MAZ A;  1IJ6 A;  5AFP A;  4YGE B;  1CLL A;  2Y1M A;  2LMU A;  2L0P A;  1JFK A;  1TCO B;  1KSO A;  2BCA A;  1EL4 A;  1CLB A;  4FTG A;  3EK8 A;  1YVL A;  1EG4 A;  3NSO A;  1K95 A;  1PSB A;  2G9B A;  3EVV A;  1K2H A;  1YUU A;  4PE4 A;  4Q04 A;  1QVI Z;  2KGB C;  4DRW A;  2H61 A;  3DVM A;  1A2X A;  3CR4 X;  2EGD A;  1CDM A;  1Y6W A;  3O6B A;  1XFY O;  1YUR A;  2PMY A;  3JTD C;  4MN0 A;  2K7B A;  1B4C A;  3DF0 A;  1KQM B;  1CB1 A;  2GGM A;  1NCZ A;  3DD4 A;  5CSN A;  4QJ4 B;  1QTX A;  2BE6 A;  3PM8 A;  1IRJ A;  1OZS A;  1MXL C;  1S6J A;  4PE7 A;  1TNP A;  1K9K A;  1CFF A;  3EK4 A;  2JT0 A;  1V1F A;  2Q91 A;  1K9P A;  3PFV A;  3CGA A;  3GK1 A;  1FI6 A;  2FCE A;  1SCM B;  2F3Z A;  3FWC A;  1S26 D;  4YI8 A;  1DF0 A;  2L4H A;  1N0Y A;  1QX5 B;  3EK7 A;  4MZK A;  4OR9 B;  4GNK B;  2LLT A;  3I5I B;  2H2K A;  4MSP A;  1K96 A;  3SG3 A;  3PAL A;  2LUC A;  4N5X A;  1PSR A;  1Y1U A;  5ER4 X;  1YRT B;  4U8D A; 
#chains in the Genus database with same CATH topology
 1FF1 A;  1YRU B;  3IVT A;  2L51 A;  1NWD A;  2EC6 C;  3CZ0 A;  2WCB A;  1B9A A;  3LK0 A;  1OOF A;  3B6X A;  1Y0V H;  2MLE C;  2O5G A;  3M0W A;  4C0L A;  2B1U A;  2HQW A;  2ZNE A;  3RM1 A;  1N2D A;  4A4B A;  5JJG A;  2KI4 B;  2L2C A;  3OGN A;  2KQY A;  3BUX B;  5HLV A;  2M3W A;  4IJ7 A;  3DVE A;  4GGF C;  2KI6 C;  4MLW A;  3SS5 A;  1BOD A;  1SR6 C;  2GGZ A;  2RGI A;  1XFR A;  1H8B A;  1MXE A;  1SY9 A;  1TCF A;  3CZT X;  1MHO A;  3R72 A;  1TUZ A;  3AKB A;  4IL1 A;  2ERB A;  2L98 A;  3VGO A;  1K94 A;  1DJH A;  1Q80 A;  1SR6 B;  3WXA A;  1EJ3 A;  1KFU S;  2L4I A;  2HQ8 A;  1ZMZ A;  2BL0 C;  4JPZ B;  4CPV A;  2LAP A;  5ER5 A;  1HQV A;  2LMV A;  1DMO A;  1AJ5 A;  1BOC A;  3SG4 A;  5DKR A;  1LVC D;  1YVH A;  1UHI A;  3BOW B;  3LLE A;  2OS8 B;  3EKJ A;  1DEL A;  1RTP 1;  3TS5 B;  3KHE A;  1F54 A;  2CT9 A;  1KQV A;  4N1G A;  4QJ5 B;  1NPQ A;  2M7N A;  3GK2 A;  2R2I A;  2QAC A;  1TNQ A;  4GUK A;  1NCX A;  5HKY A;  2JXL A;  2NCP A;  1J1E A;  2M8U A;  2LMT A;  5FI7 A;  1A4P A;  1SNL A;  3S0G A;  5I2O A;  2CXJ A;  1ALV A;  1LIN A;  2QEO A;  4FQO A;  3UNW A;  2TN4 A;  5KSZ A;  3I5G C;  4DIR A;  2JT3 A;  3QME A;  2G2B A;  3FWB A;  4OCI A;  1U5I B;  2H8V A;  3Q8I A;  1WDC B;  4NDC A;  3IQQ A;  4ORC B;  1QIW A;  1YUS A;  2KNE A;  2VRG A;  1V1G A;  3DXL A;  4INW A;  1SPY A;  1L2O C;  1NIW A;  2K7C A;  2LE9 B;  1CFD A;  3CAB A;  4KYN A;  1J7P A;  2AMI A;  1ZFS A;  3EVU A;  3NSL A;  1UHN A;  1WY9 A;  1B1G A;  1S1E A;  3LCP C;  1TNW A;  2JWW A;  5HL1 A;  3CR5 X;  1GGZ A;  1QX2 A;  2ISD A;  2JC2 A;  1C7W A;  4WRI A;  4C0K A;  1RJV A;  1JC2 A;  1QV0 A;  3B86 A;  3ZWH A;  3S0A A;  1CDP A;  3V2L A;  4HRE E;  2SAS A;  2LHI A;  5CSF A;  4ZCV A;  4PHN A;  2CTN A;  2MRD A;  4JD9 A;  1DJG A;  4OZD A;  1CMG A;  4PT1 A;  3BUN B;  3NHT A;  4MRY A;  4WQ3 A;  2LM5 A;  1NP8 A;  2HF5 A;  1YX8 A;  1M46 A;  4JKT A;  2NZ0 A;  2ZKM X;  4D1E A;  4JQ0 D;  1NSH A;  3BYA A;  3KO0 A;  1FPW A;  3ZNI A;  3O4X A;  2M49 B;  3LL8 B;  2HET A;  4GGF A;  2OTG C;  1RRO A;  2K0J A;  3NXA A;  1YR5 A;  4ORB B;  1E8A A;  2JXC A;  4DUQ A;  4YI9 A;  3S0D A;  3BJH A;  2KYF A;  1DEK A;  1YX7 A;  2O60 A;  4ZCU A;  1SCV A;  5CSJ A;  1SL9 A;  3VB1 A;  1PVB A;  2MJW B;  2OTG B;  1FW4 A;  1XO5 A;  3O78 A;  1RWY A;  1QV1 A;  1Z4H A;  2PQL A;  4NQG A;  5F6T A;  2JQ6 A;  1KQM C;  1LS8 A;  2AAO A;  5I94 A;  1B7T Y;  5BPJ A;  2Y5I A;  2BAP A;  5FI2 A;  2K8M B;  4GFT A;  1A75 B;  1IJ5 A;  1JSA A;  2ZND A;  2QPT A;  4YRU A;  1AVS A;  3I5H B;  5KTY A;  1LA0 A;  3WNX B;  1XVJ A;  3BFH A;  1SCM C;  1J1D A;  1K93 D;  2QEH A;  3FE9 A;  4PDZ A;  1YUT A;  3QRX A;  1NUB A;  2K61 A;  2CNP A;  3TDU A;  2MLF C;  4AQI A;  1TN4 A;  3BFA A;  4C0J A;  1WLM A;  1F71 A;  3OX6 A;  4M2P A;  1K8U A;  3I5I C;  4XYN A;  2PRU A;  4AOM A;  2WND A;  1OOJ A;  2JT8 A;  1MF8 B;  3PN7 B;  2HPS A;  5I8N A;  2KPH A;  2KBI A;  1B8C A;  2WOS A;  2NXQ A;  1CTR A;  2KSP A;  2D8N A;  3CDN A;  4GGN A;  3BUM B;  3D10 A;  3D0Y A;  1ALW A;  1CDL A;  4PE0 A;  5KU1 A;  2LVI A;  4XJK A;  2QEB A;  1GGW A;  2KI4 C;  4CID A;  4I5L B;  3FS7 A;  3D75 A;  2BBM A;  1RFJ A;  3L4L A;  4UPG A;  3JVT B;  3VRO A;  1QS7 A;  1KK8 B;  2NLN A;  1QWV A;  1K9U A;  1WRK A;  4ICB A;  1UWO A;  1FBV A;  2QDI A;  3DZT A;  2LC5 A;  4INX A;  4MZJ A;  3TZ1 A;  2ZRT A;  3EVR A;  3FIA A;  5EL2 A;  1BMO A;  3TUY B;  1JBA A;  2Y4Q A;  1W7I B;  1PVA A;  1IGV A;  1DJX A;  1EG3 A;  1KK7 Y;  2BBN A;  1KFX S;  1A03 A;  1IWQ A;  3FE6 A;  1A29 A;  1DGU A;  2P6B B;  4PHM A;  2Q4U A;  5D7F A;  4CFQ A;  1S3P A;  3D76 A;  1F55 A;  2LUX A;  4PHJ A;  3SIA A;  1QIV A;  1F8H A;  4N1F A;  2WC5 A;  4PHK A;  2M0R A;  5HKZ A;  1PK0 D;  2KFF A;  2ZFD A;  5TNC A;  1FI5 A;  2OS8 C;  1M45 A;  3CYZ A;  3TS5 C;  3NSI A;  1S5G Y;  1OQP A;  1SKT A;  3E3R A;  4L9M A;  4F0Z B;  1IH0 A;  3VRR A;  4R1E A;  1AP4 A;  1TOP A;  2KGR A;  2WC6 A;  4YGA A;  2WCJ A;  1B47 A;  1IKU A;  2KYC A;  2F2O A;  2LLU A;  3WHT B;  1S36 A;  3A4U B;  3AKA A;  3KF9 A;  5I2L A;  2KOT A;  4ETO A;  5D69 A;  5FI6 A;  1CM1 A;  4YGB B;  3RLZ A;  1UUS A;  4MEW A;  2JOJ A;  1WDC C;  3F45 A;  1QAT A;  3CS1 A;  4HRH A;  1XYD A;  1AJ4 A;  2KFH A;  1OOI X;  4YGC B;  4A4C A;  4YGD B;  2KI6 D;  1J7O A;  2K60 A;  1C7V A;  3I5F C;  4MVF A;  2FOT A;  1ZAC A;  1B8R A;  2KAV A;  2WCK A;  1DC1 A;  3R1P A;  2BE4 A;  5AEQ A;  3D77 A;  3I5F B;  2OPO A;  1C07 A;  2WCH A;  3DF0 B;  4AQJ A;  5B8I B;  2KHN A;  1DJY A;  1TRF A;  3LK1 A;  2KFG A;  1DQE A;  1KWO B;  2BCX A;  1TTX A;  2WCE A;  3A8R A;  2L5X B;  4P2Y B;  1UP5 A;  2JU0 A;  1DJZ A;  1QJT A;  1LXF C;  4PAL A;  1CLM A;  4P5O E;  2WC8 A;  1NX3 A;  5IBW A;  2I2R E;  1IQ3 A;  4NDD A;  1BR1 B;  2LV7 A;  3S0E A;  1D1O A;  1M63 B;  1DJI A;  2JTT A;  2NCO A;  1OMV A;  2BKH B;  3BXK A;  3NGV A;  1DF0 B;  2LP2 A;  1OMR A;  2MBX A;  1CDN A;  3PLF B;  2M7L A;  2KAY A;  3SS3 A;  3DVJ A;  3BFB A;  1SL8 A;  5JOL A;  1J7Q A;  1WRL A;  1LKJ A;  4MBE A;  1SMG A;  4DCK A;  1BLQ A;  1REC A;  2LVJ A;  1KFU L;  2GTE A;  5HYD A;  1GM0 A;  4USL A;  5FYX A;  2JPT A;  5PAL A;  3EG5 B;  2MHH A;  4BY5 A;  3OB1 B;  1DT7 B;  1CFC A;  3HCM A;  3D73 A;  2F33 A;  5AXI A;  4MRX A;  1QLS A;  2P71 A;  2K7D A;  3S0B A;  4CLN A;  1JUO A;  1OSA A;  1W7J B;  1XFZ O;  4PCW A;  2COL B;  2K2F A;  3BOW A;  2MA2 A;  3CLN A;  4TNC A;  1F4O A;  3NSK A;  3I5H C;  4PE1 A;  3CZ1 A;  3SJS A;  2YGU A;  1NYA A;  1X02 A;  1RK9 A;  3DVK A;  5AER A;  2JNX A;  1QXP A;  1XK4 C;  2IS9 A;  2LLS A;  2V53 A;  1DJW A;  2EHB A;  1Y1X A;  2F2P A;  2M9G A;  1Y1A A;  2FJY A;  3PAT A;  1K90 D;  4MZL A;  1C3Z A;  1KK7 Z;  3EKH A;  1OMD A;  4NDB A;  1ZOT B;  2WCF A;  3PN7 C;  2I18 A;  1XFX O;  1U5I A;  1OOH A;  1HT9 A;  2I94 A;  2PAL A;  3CR2 A;  1IG5 A;  2LHL A;  4JWQ A;  1JF2 A;  2JUL A;  2WCM A;  4QJ3 B;  3O2P A;  2CCM A;  1PUL A;  2CBL A;  2AUC A;  1OE9 B;  2BEC A;  3DYE A;  5J3X A;  3WHU B;  4E68 A;  4HSZ A;  2LVK A;  1JWD A;  2KAX A;  4F7F A;  1S5G Z;  1OZO A;  2JRF A;  1TIZ A;  3KEV A;  3JVT C;  1C3Y A;  1KK8 C;  1VRK A;  1XA5 A;  3JTD B;  4GAO A;  2PVB A;  4M2Q A;  1G4Y R;  1SL7 A;  1JFJ A;  2LAN A;  2SCP A;  1KCY A;  2ZN8 A;  3TUY C;  2M29 A;  1SYM A;  2PSR A;  3OX5 A;  1BT6 A;  1UUR A;  1BU3 A;  5HKW A;  1JF0 A;  5D3O A;  1QLK A;  2A4J A;  4OVN F;  3D74 A;  4DS7 A;  2E6W A;  1UHH A;  5GQQ C;  1N65 A;  5CSI A;  1J7R A;  2E30 A;  1XFU O;  3ICB A;  1QVI Y;  1B8L A;  1UHK A;  2I7A A;  1XFV O;  3OP0 A;  3OHM B;  1M31 A;  1PRW A;  1AUI B;  3DY9 A;  3C1V A;  2QEV A;  5CPV A;  1S6I A;  4ORA B;  3CZ2 A;  3OBV A;  1MUX A;  1OOG A;  1OW4 A;  4I5N B;  1F70 A;  3R1V A;  4CFR A;  1WRZ A;  2EC6 B;  1J55 A;  3L47 A;  1NX1 A;  2L5Y A;  3D78 A;  1AK8 A;  2L50 A;  2BKI B;  2KBM A;  2FJU B;  1CFP A;  2L2E A;  4I5J A;  1BF5 A;  5HLO A;  3SG2 A;  3VRP A;  1R2U A;  1SW8 A;  1NX0 A;  1DVI A;  2WOR A;  4I5K A;  1A75 A;  1H4B A;  5K89 A;  1MWN A;  3KPX A;  1XFW O;  1AHR A;  2M1K B;  2H61 C;  1LA3 A;  4BY4 A;  1IIO A;  2ZN9 A;  1ODB A;  3B87 A;  2BCB A;  1SSE B;  1XK4 A;  2JTZ A;  1CM4 A;  1MR8 A;  2PAS A;  3MSE B;  2BL0 B;  2LP3 A;  2Y1N A;  4HRG A;  1DGV A;  3GOF A;  1KWO C;  2KQ6 A;  3K1E A;  3N7H A;  4WQ2 A;  1NCY A;  3AAK A;  4M2O A;  3AAJ A;  1S6C A;  1BJF A;  1M39 A;  2M97 A;  3SG7 A;  3PSR A;  2DOQ A;  5DKN A;  2KDH A;  1WLZ A;  1CKK A;  1GJY A;  2ZRS A;  3CWG A;  1MQ1 A;  2LCP A;  5G08 A;  2JNF A;  5I2Q A;  2PYQ A;  3O4Y A;  3TDI A;  5DKQ A;  2M1U A;  1B7T Z;  1R6P A;  3SG5 A;  3SIB A;  2LNK A;  3VRQ A;  3K21 A;  3SG6 A;  1TWO A;  3H4S E;  1Z2C B;  3BQ3 A;  1QX7 A;  2K2A A;  3VRN A;  1ZUZ A;  1QAS A;  3I5G B;  3SS4 A;  1BG1 A;  1CMF A;  1EH2 A;  1KFX L;  2FCD A;  1T14 A;  4OV2 A;  1PAL A;  1DTL A;  2JPO A;  2P70 A;  4FQT A;  3OB2 B;  5AAN A;  4OKH A;  3D0Y B;  1CNP A;  2JZI A;  1L2O B;  1NX2 A;  3IF7 A;  1F4Q A;  3HX4 A;  4XJK B;  1SBJ A;  2K7O A;  3CTN A;  3TDZ A;  1SK6 D;  1UHJ A;  1KSM A;  1SRA A;  1GQM A;  4GBA A;  1G8I A;  3GK4 X;  1EXR A;  2GV5 A;  3BUO B;  1YTZ C;  4GPL B;  1IQ5 A;  2F3Y A;  3R1O A;  2LVV A;  1BR4 B;  1TNX A;  2F8P A;  1L7Z A;  3IQO A;  1G33 A;  1TUJ A;  3B7A A;  4YBH B;  3BUW B;  2MAZ A;  3PM2 A;  1IJ6 A;  5AFP A;  4YGE B;  1CLL A;  2Y1M A;  2LMU A;  2L0P A;  3L4A A;  1JFK A;  1TCO B;  1KSO A;  2BCA A;  1EL4 A;  1CLB A;  4FTG A;  3EK8 A;  1YVL A;  1EG4 A;  5DIC A;  3NSO A;  1K95 A;  1PSB A;  2G9B A;  3UO9 A;  3EVV A;  1K2H A;  1YUU A;  4PE4 A;  4Q04 A;  1QVI Z;  2KGB C;  4DRW A;  2H61 A;  3DVM A;  1A2X A;  3CR4 X;  2EGD A;  1CDM A;  1Y6W A;  3O6B A;  1XFY O;  1YUR A;  2PMY A;  3JTD C;  2KLD A;  4MN0 A;  3RZS A;  2K7B A;  1B4C A;  3DF0 A;  1KQM B;  1CB1 A;  2GGM A;  1NCZ A;  3DD4 A;  5CSN A;  4QJ4 B;  1P28 A;  1QTX A;  2BE6 A;  1IRJ A;  1OZS A;  3PM8 A;  1MXL C;  1S6J A;  3PJI A;  4PE7 A;  2KLE A;  1TNP A;  1K9K A;  3NHI A;  1CFF A;  3B88 A;  3EK4 A;  2JT0 A;  3FE8 A;  1V1F A;  2Q91 A;  1K9P A;  3PFV A;  3CGA A;  3GK1 A;  1FI6 A;  2FCE A;  1SCM B;  2F3Z A;  3FWC A;  1S26 D;  4YI8 A;  1DF0 A;  2L4H A;  1N0Y A;  2WCL A;  1QX5 B;  3EK7 A;  4MZK A;  4OR9 B;  4GNK B;  2BNX A;  3S0F A;  2LLT A;  3I5I B;  2H2K A;  4MSP A;  1K96 A;  3SG3 A;  3PAL A;  2LUC A;  4N5X A;  1PSR A;  1Y1U A;  5ER4 X;  1YRT B;  4U8D A;  1ORG A;  1W9Z A; 
#chains in the Genus database with same CATH homology
 1FF1 A;  1YRU B;  2L51 A;  1NWD A;  2EC6 C;  2WCB A;  1B9A A;  3LK0 A;  4C0L A;  3M0W A;  1Y0V H;  2MLE C;  2O5G A;  2B1U A;  2HQW A;  2ZNE A;  3RM1 A;  1N2D A;  4A4B A;  5JJG A;  2KI4 B;  2KQY A;  3BUX B;  5HLV A;  2M3W A;  3DVE A;  4GGF C;  2KI6 C;  4MLW A;  1BOD A;  1H8B A;  1SR6 C;  2GGZ A;  2RGI A;  1MXE A;  1SY9 A;  1TCF A;  3CZT X;  1MHO A;  3AKB A;  4IL1 A;  2L98 A;  3VGO A;  1K94 A;  1DJH A;  1Q80 A;  1SR6 B;  3WXA A;  1EJ3 A;  1KFU S;  2L4I A;  2HQ8 A;  1ZMZ A;  2BL0 C;  4JPZ B;  4CPV A;  2LAP A;  5ER5 A;  1HQV A;  2LMV A;  1DMO A;  1AJ5 A;  1BOC A;  3SG4 A;  5DKR A;  1LVC D;  1YVH A;  1UHI A;  3BOW B;  3LLE A;  2OS8 B;  3EKJ A;  1RTP 1;  3TS5 B;  3KHE A;  1F54 A;  2CT9 A;  1KQV A;  4N1G A;  4QJ5 B;  1NPQ A;  2M7N A;  3GK2 A;  2R2I A;  2QAC A;  1TNQ A;  4GUK A;  1NCX A;  5HKY A;  2JXL A;  2NCP A;  1J1E A;  2M8U A;  2LMT A;  1A4P A;  1SNL A;  5I2O A;  2CXJ A;  1ALV A;  1LIN A;  4FQO A;  5KSZ A;  2TN4 A;  3I5G C;  4DIR A;  2JT3 A;  2G2B A;  3FWB A;  4OCI A;  1U5I B;  4NDC A;  1WDC B;  3IQQ A;  4ORC B;  1QIW A;  1YUS A;  2KNE A;  2VRG A;  1V1G A;  1SPY A;  1L2O C;  1NIW A;  2K7C A;  2LE9 B;  1CFD A;  1J7P A;  2AMI A;  1ZFS A;  3EVU A;  3NSL A;  1UHN A;  1WY9 A;  1B1G A;  1S1E A;  3LCP C;  1TNW A;  2JWW A;  3CR5 X;  1GGZ A;  1QX2 A;  2ISD A;  2JC2 A;  1C7W A;  4WRI A;  4C0K A;  1RJV A;  1JC2 A;  1QV0 A;  3ZWH A;  1CDP A;  4HRE E;  2SAS A;  2LHI A;  5CSF A;  4ZCV A;  4PHN A;  2CTN A;  2MRD A;  1DJG A;  1CMG A;  3BUN B;  4MRY A;  4WQ3 A;  2LM5 A;  1NP8 A;  2HF5 A;  1YX8 A;  1M46 A;  2NZ0 A;  2ZKM X;  4D1E A;  4JQ0 D;  1NSH A;  3BYA A;  3KO0 A;  1FPW A;  3ZNI A;  2M49 B;  3LL8 B;  2HET A;  4GGF A;  2OTG C;  1RRO A;  2K0J A;  3NXA A;  1YR5 A;  4ORB B;  1E8A A;  2JXC A;  4DUQ A;  4YI9 A;  2KYF A;  1YX7 A;  2O60 A;  4ZCU A;  1SCV A;  5CSJ A;  1SL9 A;  1PVB A;  2MJW B;  2OTG B;  1FW4 A;  1XO5 A;  3O78 A;  1RWY A;  1QV1 A;  5F6T A;  4NQG A;  2JQ6 A;  1KQM C;  2AAO A;  1B7T Y;  5BPJ A;  2Y5I A;  2K8M B;  4GFT A;  1A75 B;  1IJ5 A;  1JSA A;  2ZND A;  2QPT A;  4YRU A;  1AVS A;  3I5H B;  5KTY A;  1LA0 A;  3WNX B;  1XVJ A;  1SCM C;  1J1D A;  1K93 D;  4PDZ A;  1YUT A;  3QRX A;  1NUB A;  2K61 A;  2CNP A;  3TDU A;  2MLF C;  4AQI A;  1TN4 A;  4C0J A;  1WLM A;  1F71 A;  3OX6 A;  4M2P A;  1K8U A;  3I5I C;  4XYN A;  2PRU A;  4AOM A;  2WND A;  1OOJ A;  2JT8 A;  1MF8 B;  3PN7 B;  2HPS A;  5I8N A;  2KBI A;  1B8C A;  2WOS A;  2NXQ A;  1CTR A;  2KSP A;  2D8N A;  4GGN A;  3BUM B;  3D10 A;  3D0Y A;  1ALW A;  1CDL A;  4PE0 A;  5KU1 A;  2LVI A;  4XJK A;  1GGW A;  2KI4 C;  4CID A;  4I5L B;  3FS7 A;  2BBM A;  1RFJ A;  4UPG A;  3JVT B;  3VRO A;  1QS7 A;  1KK8 B;  2NLN A;  1K9U A;  1WRK A;  4ICB A;  1UWO A;  1FBV A;  4MZJ A;  2LC5 A;  3TZ1 A;  2ZRT A;  3EVR A;  3FIA A;  3TUY B;  1BMO A;  1JBA A;  2Y4Q A;  1W7I B;  1PVA A;  1IGV A;  1DJX A;  1EG3 A;  1KK7 Y;  2BBN A;  1KFX S;  1A03 A;  1IWQ A;  1A29 A;  1DGU A;  2P6B B;  4PHM A;  2Q4U A;  5D7F A;  4CFQ A;  1S3P A;  1F55 A;  2LUX A;  4PHJ A;  3SIA A;  1QIV A;  1F8H A;  4N1F A;  5HKZ A;  4PHK A;  2M0R A;  1PK0 D;  2KFF A;  2ZFD A;  5TNC A;  1FI5 A;  2OS8 C;  1M45 A;  3TS5 C;  3NSI A;  1S5G Y;  1OQP A;  1SKT A;  3E3R A;  4L9M A;  4F0Z B;  1IH0 A;  3VRR A;  4R1E A;  1AP4 A;  1TOP A;  2KGR A;  4YGA A;  1B47 A;  1IKU A;  2KYC A;  2F2O A;  2LLU A;  3WHT B;  1S36 A;  3A4U B;  3AKA A;  3KF9 A;  5I2L A;  2KOT A;  4ETO A;  5D69 A;  1CM1 A;  4YGB B;  3RLZ A;  1UUS A;  4MEW A;  2JOJ A;  1WDC C;  3F45 A;  1QAT A;  3CS1 A;  4HRH A;  1AJ4 A;  1XYD A;  2KFH A;  4YGC B;  4A4C A;  4YGD B;  2KI6 D;  1J7O A;  1C7V A;  3I5F C;  4MVF A;  2FOT A;  1ZAC A;  1B8R A;  2KAV A;  5AEQ A;  2BE4 A;  3I5F B;  2OPO A;  1C07 A;  5B8I B;  3DF0 B;  4AQJ A;  2KHN A;  1DJY A;  1TRF A;  3LK1 A;  2KFG A;  1KWO B;  2BCX A;  2WCE A;  1TTX A;  3A8R A;  2L5X B;  4P2Y B;  1UP5 A;  2JU0 A;  1DJZ A;  1QJT A;  1LXF C;  4PAL A;  1CLM A;  4P5O E;  2WC8 A;  1NX3 A;  5IBW A;  2I2R E;  1IQ3 A;  4NDD A;  1BR1 B;  2LV7 A;  1D1O A;  1M63 B;  1DJI A;  2JTT A;  2NCO A;  1OMV A;  2BKH B;  3BXK A;  1DF0 B;  2LP2 A;  1OMR A;  2MBX A;  1CDN A;  3PLF B;  2M7L A;  2KAY A;  3DVJ A;  1SL8 A;  5JOL A;  1J7Q A;  1WRL A;  1LKJ A;  4MBE A;  1SMG A;  4DCK A;  1BLQ A;  1REC A;  2LVJ A;  1KFU L;  5HYD A;  4USL A;  5FYX A;  2JPT A;  5PAL A;  2MHH A;  4BY5 A;  3OB1 B;  1DT7 B;  1CFC A;  3HCM A;  2F33 A;  5AXI A;  4MRX A;  1QLS A;  2K7D A;  4CLN A;  1JUO A;  1OSA A;  1W7J B;  1XFZ O;  4PCW A;  2COL B;  2K2F A;  3BOW A;  2MA2 A;  3CLN A;  4TNC A;  1F4O A;  3NSK A;  3I5H C;  4PE1 A;  3SJS A;  1NYA A;  1X02 A;  1RK9 A;  3DVK A;  5AER A;  2JNX A;  1QXP A;  1XK4 C;  2IS9 A;  2LLS A;  2V53 A;  1DJW A;  2EHB A;  1Y1X A;  2F2P A;  2M9G A;  1Y1A A;  3PAT A;  1K90 D;  4MZL A;  1KK7 Z;  3EKH A;  1OMD A;  4NDB A;  1ZOT B;  2WCF A;  3PN7 C;  2I18 A;  1U5I A;  1XFX O;  1HT9 A;  2I94 A;  2PAL A;  3CR2 A;  1IG5 A;  2LHL A;  4JWQ A;  1JF2 A;  2JUL A;  4QJ3 B;  3O2P A;  2CCM A;  1PUL A;  2CBL A;  2AUC A;  1OE9 B;  2BEC A;  5J3X A;  3WHU B;  4E68 A;  4HSZ A;  2LVK A;  1JWD A;  2KAX A;  1S5G Z;  1OZO A;  2JRF A;  1TIZ A;  3KEV A;  3JVT C;  1KK8 C;  1VRK A;  1XA5 A;  3JTD B;  4GAO A;  2PVB A;  4M2Q A;  1G4Y R;  1SL7 A;  1JFJ A;  2LAN A;  2SCP A;  1KCY A;  2ZN8 A;  3TUY C;  2M29 A;  1SYM A;  2PSR A;  3OX5 A;  1BT6 A;  1UUR A;  1BU3 A;  5HKW A;  1JF0 A;  1QLK A;  2A4J A;  4OVN F;  4DS7 A;  2E6W A;  1UHH A;  5GQQ C;  1N65 A;  5CSI A;  1J7R A;  2E30 A;  1XFU O;  3ICB A;  1QVI Y;  1B8L A;  1UHK A;  2I7A A;  1XFV O;  3OP0 A;  3OHM B;  1M31 A;  1PRW A;  1AUI B;  3C1V A;  5CPV A;  1S6I A;  4ORA B;  1MUX A;  1F70 A;  4I5N B;  4CFR A;  1WRZ A;  2EC6 B;  1J55 A;  1NX1 A;  1AK8 A;  2L50 A;  2BKI B;  2KBM A;  2FJU B;  1CFP A;  2L2E A;  4I5J A;  1BF5 A;  5HLO A;  3SG2 A;  3VRP A;  1R2U A;  1SW8 A;  1NX0 A;  1DVI A;  2WOR A;  4I5K A;  1A75 A;  1H4B A;  5K89 A;  1MWN A;  3KPX A;  1XFW O;  1AHR A;  2M1K B;  2H61 C;  1LA3 A;  4BY4 A;  2ZN9 A;  1ODB A;  2BCB A;  1XK4 A;  2JTZ A;  1CM4 A;  1MR8 A;  2PAS A;  3MSE B;  2BL0 B;  2LP3 A;  2Y1N A;  4HRG A;  1DGV A;  3GOF A;  1KWO C;  2KQ6 A;  4WQ2 A;  1NCY A;  3AAK A;  4M2O A;  3AAJ A;  1S6C A;  1BJF A;  1M39 A;  2M97 A;  3SG7 A;  3PSR A;  2DOQ A;  5DKN A;  2KDH A;  1WLZ A;  1CKK A;  1GJY A;  2ZRS A;  3CWG A;  1MQ1 A;  2LCP A;  5G08 A;  2JNF A;  5I2Q A;  3O4Y A;  3TDI A;  5DKQ A;  2M1U A;  1B7T Z;  1R6P A;  3SG5 A;  3SIB A;  2LNK A;  3VRQ A;  3K21 A;  3SG6 A;  3H4S E;  3BQ3 A;  1QX7 A;  2K2A A;  3VRN A;  1ZUZ A;  1QAS A;  3I5G B;  1CMF A;  1BG1 A;  1EH2 A;  1KFX L;  2FCD A;  4OV2 A;  1PAL A;  1DTL A;  3OB2 B;  5AAN A;  4OKH A;  3D0Y B;  1CNP A;  2JZI A;  1L2O B;  1NX2 A;  3IF7 A;  1F4Q A;  3HX4 A;  4XJK B;  1SBJ A;  2K7O A;  3CTN A;  3TDZ A;  1SK6 D;  1UHJ A;  1KSM A;  1SRA A;  1GQM A;  4GBA A;  1G8I A;  3GK4 X;  1EXR A;  2GV5 A;  3BUO B;  1YTZ C;  4GPL B;  1IQ5 A;  2F3Y A;  2LVV A;  1BR4 B;  1TNX A;  2F8P A;  1L7Z A;  3IQO A;  1G33 A;  4YBH B;  3BUW B;  2MAZ A;  1IJ6 A;  5AFP A;  4YGE B;  1CLL A;  2Y1M A;  2LMU A;  2L0P A;  1JFK A;  1TCO B;  1KSO A;  2BCA A;  1EL4 A;  1CLB A;  4FTG A;  3EK8 A;  1YVL A;  1EG4 A;  3NSO A;  1K95 A;  1PSB A;  2G9B A;  3EVV A;  1K2H A;  1YUU A;  4PE4 A;  4Q04 A;  1QVI Z;  2KGB C;  4DRW A;  2H61 A;  3DVM A;  1A2X A;  3CR4 X;  2EGD A;  1CDM A;  1Y6W A;  3O6B A;  1XFY O;  1YUR A;  2PMY A;  3JTD C;  4MN0 A;  2K7B A;  1B4C A;  3DF0 A;  1KQM B;  1CB1 A;  2GGM A;  1NCZ A;  3DD4 A;  5CSN A;  4QJ4 B;  1QTX A;  2BE6 A;  3PM8 A;  1IRJ A;  1OZS A;  1MXL C;  1S6J A;  4PE7 A;  1TNP A;  1K9K A;  1CFF A;  3EK4 A;  2JT0 A;  1V1F A;  2Q91 A;  1K9P A;  3PFV A;  3CGA A;  3GK1 A;  1FI6 A;  2FCE A;  1SCM B;  2F3Z A;  3FWC A;  1S26 D;  4YI8 A;  1DF0 A;  2L4H A;  1N0Y A;  1QX5 B;  3EK7 A;  4MZK A;  4OR9 B;  4GNK B;  2LLT A;  3I5I B;  2H2K A;  4MSP A;  1K96 A;  3SG3 A;  3PAL A;  2LUC A;  4N5X A;  1PSR A;  1Y1U A;  5ER4 X;  1YRT B;  4U8D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...