1PRWA

Crystal structure of bovine brain ca++ calmodulin in a compact form
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
148
structure length
147
Chain Sequence
ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGELTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calmodulin
publication title A closed compact structure of native ca(2+)-calmodulin.
pubmed doi rcsb
molecule tags Metal binding protein
total genus 57
structure length 147
sequence length 148
ec nomenclature
pdb deposition date 2003-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1prwA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1prwA02
1UHNA 1XFUO 3BOWA 2LMUA 2JXCA 3NSIA 1MQ1A 5ER5A 1GQMA 1FI5A 3TS5B 2EGDA 3I5FB 1K90D 1XFWO 4DRWA 1QVIZ 3CR2A 5CSIA 5JJGA 3ICBA 2M8UA 5DKRA 1DJHA 3TS5C 3I5FC 1DT7B 1DJWA 2I18A 2L51A 1N65A 2V53A 1RECA 2K7DA 2L4IA 1SPYA 1IH0A 2NLNA 1QLSA 4MZKA 1KK7Y 1MXEA 3AAJA 1K8UA 4CIDA 1DGUA 5I2OA 1WLMA 4CFQA 2BCXA 2HQWA 1EG3A 1ZUZA 2M1UA 1K95A 2ZFDA 3NSKA 4PHNA 3SG7A 5CSJA 3TDZA 2ZN8A 3M0WA 4PE1A 2KI6D 5CSNA 2KOTA 2K7BA 4PHJA 2QPTA 2GGZA 2COLB 3CTNA 2LANA 2BL0B 4FTGA 4WQ2A 3MSEB 5IBWA 5AFPA 2JOJA 4ETOA 1K9PA 2GV5A 2M0RA 2BL0C 3E3RA 1PK0D 4YI8A 1BR1B 1CKKA 1Y1XA 2K2AA 3JVTB 1A75B 3SG2A 2LMVA 3O78A 1OE9B 2M7LA 2BBNA 2CNPA 1ZACA 4JQ0D 3EK7A 1U5IA 1SCMB 2JTTA 3JVTC 1TNQA 1EJ3A 1EL4A 2L5XB 1Y0VH 4BY4A 3NSOA 4P2YB 1S6JA 1SL7A 4PDZA 1SCMC 4PHKA 4PHMA 3KPXA 1V1GA 2LAPA 3A4UB 2F33A 1SR6B 1Y6WA 4MRXA 2Y4QA 4OV2A 1OZSA 1CLBA 3IF7A 1SR6C 4CLNA 4AQIA 1KFXL 5KU1A 3LCPC 1XK4C 2PRUA 4AQJA 1CFFA 1WRZA 1UWOA 3WNXB 2PASA 1LA3A 1XFXO 2LVJA 3LL8B 1OZOA 1A75A 2LVVA 2NXQA 2LHIA 3RLZA 1EXRA 1G8IA 3A8RA 4DIRA 2LVIA 3KEVA 2JT3A 1YR5A 1BU3A 1OSAA 1J1EA 1QASA 3BUWB 1CB1A 2F2OA 1UHKA 3FS7A 1YX8A 2K0JA 3HX4A 2G9BA 3JTDC 2BE4A 3NSLA 4NDBA 1AJ4A 1BMOA 4UPGA 2WNDA 3SJSA 4XJKA 1F55A 1B8RA 2F3ZA 4C0JA 1JFKA 1KFUL 1NX3A 2BE6A 1B7TZ 4MZLA 1SYMA 1QIWA 2MLEC 3GOFA 5I2LA 1MWNA 5B8IB 3PATA 1SKTA 2LCPA 3BUMB 1JF2A 3I5IB 1NX2A 4OKHA 1DF0B 2KFHA 3CS1A 3BUNB 1WLZA 1DJIA 3O6BA 2LUXA 4M2PA 5CSFA 2PALA 5HLOA 3I5IC 2JTZA 4E68A 1NCYA 4OR9B 2M49B 1RTP1 1CM1A 5PALA 4GGFC 1KK8B 3EK4A 2KGBC 1CM4A 1SRAA 4I5NB 5BPJA 1IQ5A 1SL8A 2CCMA 1K9UA 2LP2A 1KK8C 1QVIY 1QX5B 1PSRA 1H8BA 1IWQA 2M9GA 3PLFB 4PE0A 1K96A 4MRYA 2K7CA 1TCFA 1SL9A 1YVLA 1B1GA 1F8HA 1FW4A 2LP3A 3QRXA 3OB2B 2MJWB 2KAVA 1DJGA 1TTXA 1DTLA 3C1VA 3ZWHA 1IJ5A 1AHRA 1S36A 2JULA 5HLVA 4U8DA 2BBMA 1J55A 1RROA 4GPLB 5DKNA 3VRPA 1DF0A 2OTGB 3GK1A 1EG4A 1CDPA 1PVAA 4YGAA 4GGFA 1CTRA 3O4YA 2OTGC 4DS7A 3CLNA 1BT6A 3GK4X 1U5IB 2CT9A 2CTNA 1YRTB 4MSPA 5HKWA 1LKJA 4IL1A 2SASA 4MZJA 1M46A 2WCBA 3DF0B 3GK2A 4ORAB 1IKUA 5KSZA 3LLEA 3DD4A 2SCPA 1X02A 3VRRA 2FJUB 3SIBA 1N0YA 1R6PA 1R2UA 2KAXA 3OP0A 4MBEA 3SG5A 3CGAA 3AKAA 4MEWA 2JNXA 1S5GZ 4CFRA 2LE9B 4PCWA 1KSMA 3OB1B 4HRHA 1PULA 1QV0A 1ZMZA 1YVHA 5DKQA 2NCPA 1CNPA 2M29A 2LC5A 5J3XA 2CXJA 3TZ1A 1FF1A 3BYAA 3AAKA 5TNCA 1OOJA 4MVFA 1K94A 1NWDA 3AKBA 3DF0A 3FIAA 3HCMA 1RK9A 1SW8A 5AANA 1A03A 1L7ZA 2OS8B 1FBVA 4XJKB 2F8PA 2IS9A 1CLLA 2H61C 4GNKB 2JXLA 1UHJA 3EKHA 1TNPA 4GFTA 5JOLA 1NP8A 2OS8C 1YRUB 2PSRA 1XFZO 1SNLA 2HPSA 1DGVA 4I5LB 4ORBB 1J1DA 2AUCA 2ZNEA 2I94A 2ZKMX 3H4SE 4GGNA 1F70A 4I5KA 4QJ3B 2K61A 1NYAA 4P5OE 1F54A 4PALA 1XYDA 3D0YB 1NIWA 2KQYA 1B9AA 1B7TY 1OMDA 2O60A 1TNWA 1IQ3A 1TOPA 2Q4UA 2WCFA 1M39A 2KSPA 2MBXA 1XA5A 2H2KA 4NQGA 3OHMB 1WRKA 1RJVA 1ZFSA 3LK1A 2H61A 3EVVA 4C0KA 1LXFC 2LM5A 1J7OA 2FCEA 1BF5A 1Y1UA 1K93D 1KSOA 1M31A 2ZN9A 2MRDA 1OMRA 1JFJA 3BXKA 3KF9A 2OPOA 3K21A 1QTXA 1CLMA 2F2PA 3OX5A 2JT8A 1C7VA 2MHHA 1YTZC 1SK6D 4TNCA 2KNEA 2PMYA 5D69A 1TN4A 1IGVA 1MF8B 2BKIB 1E8AA 2R2IA 1HT9A 4YGBB 3EK8A 5AEQA 2I7AA 2EHBA 3CR5X 2WCEA 3D0YA 1DMOA 1Q80A 2LHLA 1YURA 3DVMA 1QX2A 4XYNA 5D7FA 3VRQA 2KAYA 2LLUA 2L98A 1JUOA 2BCBA 2Y5IA 1W7JB 1J7PA 1IJ6A 1LVCD 2JZIA 2L4HA 5F6TA 4YGEB 1A29A 1V1FA 2ZRSA 2LLTA 2M7NA 5AXIA 4CPVA 1QJTA 3NXAA 1C7WA 4YRUA 1PSBA 1DJYA 2MA2A 4N1FA 1AP4A 4PE7A 4YI9A 1KFXS 1M45A 2KGRA 2MAZA 1KWOB 1MXLC 1BG1A 1JBAA 3PFVA 2WORA 3BUXB 1S6IA 3EVUA 1H4BA 3SG3A 1ZOTB 3VROA 2KI6C 5HKYA 2ZRTA 1KWOC 1PRWA 4AOMA 2K2FA 1FI6A 3WXAA 1BODA 1XVJA 3PN7B 4NDCA 2HF5A 3KHEA 1BJFA 2Y1NA 1MUXA 1S26D 1SMGA 1UP5A 2O5GA 1KQMB 2PVBA 2FOTA 1SY9A 3PN7C 4OCIA 4WRIA 5AERA 2F3YA 1XO5A 4D1EA 2M3WA 1AUIB 2D8NA 1AK8A 2KQ6A 1AJ5A 1M63B 1KQMC 2M97A 3PM8A 4ICBA 5CPVA 1NSHA 1IG5A 1S5GY 1MR8A 1UHHA 1XFVO 4FQOA 2HQ8A 1KFUS 2KDHA 1K2HA 1KCYA 4DCKA 3CZTX 4HSZA 4N1GA 1CDNA 1CFPA 1DJXA 2KYFA 2I2RE 1VRKA 3I5HB 3DVEA 1UURA 3KO0A 3IQOA 2HETA 1UUSA 2JT0A 3I5HC 3F45A 2JQ6A 2KFFA 4YGDB 4MN0A 2Y1MA 3CWGA 3EKJA 1S3PA 1MHOA 1RFJA 1EH2A 3FWBA 3WHTB 2L2EA 2G2BA 1A2XA 3PALA 1UHIA 2LUCA 2NZ0A 3I5GB 5I8NA 1D1OA 1YX7A 1B4CA 3SG4A 1KK7Z 3IQQA 4PE4A 2BCAA 1LINA 1ODBA 2DOQA 5HYDA 2KBIA 1FPWA 3TUYB 1CFCA 3I5GC 1JF0A 1BLQA 1TIZA 3VRNA 1W7IB 2LMTA 4ZCUA 1JWDA 2GGMA 1F71A 1SBJA 3TUYC 1CDMA 5G08A 1WRLA 4A4BA 1J7QA 1SCVA 1AVSA 2LV7A 2P6BB 4HREE 4Q04A 1BOCA 1OMVA 2JRFA 2LNKA 2ZNDA 1QXPA 2EC6B 5HKZA 2K7OA 2K8MB 1WDCB 1QS7A 4L9MA 1CFDA 3BQ3A 4ORCB 1B8LA 4N5XA 4USLA 2EC6C 4WQ3A 2VRGA 1NCXA 1WDCC 5ER4X 3CR4X 1ALWA 1QX7A 3DVJA 4BY5A 1JC2A 1J7RA 1GJYA 2BKHB 2WC8A 4GBAA 1NCZA 3WHUB 5GQQC 1NPQA 3BUOB 3PSRA 2KI4B 3DVKA 4JPZB 1TRFA 5FYXA 2MLFC 1A4PA 4NDDA 1PVBA 2L0PA 1CDLA 1NUBA 2AAOA 2KI4C 3D10A 1QATA 4ZCVA 5I2QA 1CMGA 4I5JA 2JU0A 1G33A 4JWQA 1TCOB 1G4YR 1DVIA 3RM1A 3JTDB 1PALA 4GAOA 1ALVA 3OX6A 1K9KA 1IRJA 2A4JA 1GGWA 4DUQA 1TNXA 1B47A 4OVNF 1CMFA 1LA0A 1C07A 1XFYO 2B1UA 2L50A 4M2QA 4QJ4B 2QACA 4M2OA 3VGOA 3SIAA 1QV1A 1Y1AA 2ISDA 1NX1A 1NX0A 3TDUA 1BR4B 1XK4A 3BOWB 2KBMA 3TDIA 4C0LA 4MLWA 5KTYA 2FCDA 2KYCA 2WOSA 1GGZA 1N2DA 4R1EA 1KQVA 4HRGA 3ZNIA 1HQVA 2JNFA 2KHNA 3LK0A 2NCOA 3EVRA 1F4OA 1QIVA 1RWYA 1YUSA 2TN4A 2E30A 1YUTA 1QLKA 4YGCB 2M1KB 4YBHB 1OQPA 5K89A 1S6CA 3FWCA 4A4CA 1YUUA 4F0ZB 1WY9A 2E6WA 3O2PA 2BECA 1F4QA 4GUKA 2RGIA 1B8CA 1DJZA 2JC2A 2JWWA 1L2OB 2AMIA 3SG6A 2LLSA 2JPTA 1S1EA 2KFGA 2Q91A 2LVKA 2CBLA 1L2OC 1JSAA 4QJ5B
chains in the Genus database with same CATH superfamily
1UHNA 1XFUO 3BOWA 3B7AA 2LMUA 3UO9A 2JXCA 3NSIA 1MQ1A 5ER5A 1GQMA 1FI5A 2K60A 3TS5B 2EGDA 3I5FB 1K90D 1XFWO 4DRWA 1QVIZ 3CR2A 5CSIA 2WCMA 3ICBA 2M8UA 5DKRA 1DJHA 3TS5C 3I5FC 5JJGA 1DT7B 1DJWA 2I18A 2L51A 1N65A 2V53A 1RECA 2K7DA 2L4IA 1SPYA 2FJYA 1IH0A 1DELA 1QLSA 2NLNA 1KK7Y 1MXEA 4MZKA 3AAJA 1K8UA 4CIDA 1DGUA 5I2OA 1Z2CB 1WLMA 4CFQA 2BCXA 2HQWA 2KLEA 1EG3A 1ZUZA 2M1UA 1K95A 2ZFDA 3NSKA 4PHNA 3SG7A 5CSJA 3TDZA 2ZN8A 3M0WA 3FE8A 4PE1A 2WC6A 2KI6D 5CSNA 2KOTA 2K7BA 3R1OA 2QPTA 2GGZA 4PHJA 2COLB 3CTNA 2LANA 2BL0B 4FTGA 4WQ2A 3MSEB 2BNXA 2L5YA 5IBWA 3D76A 5AFPA 2JOJA 4ETOA 1K9PA 1ORGA 2GV5A 2M0RA 2BL0C 3E3RA 1PK0D 4YI8A 1BR1B 1CKKA 1Y1XA 2K2AA 4PT1A 3JVTB 1A75B 3SG2A 2LMVA 3O78A 1OE9B 2M7LA 2BBNA 2CNPA 1ZACA 4JQ0D 3EK7A 1U5IA 1SCMB 2JTTA 3JVTC 1TNQA 1EJ3A 1EL4A 2L5XB 1Y0VH 3UNWA 4BY4A 1DC1A 3NSOA 4P2YB 1S6JA 1SL7A 4PDZA 3QMEA 1SCMC 4PHKA 4PHMA 3KPXA 1V1GA 2LAPA 3A4UB 1C3YA 2F33A 1SR6B 1Y6WA 3FE6A 1C3ZA 3SS5A 4MRXA 2Y4QA 4OV2A 1OZSA 1CLBA 3IF7A 1SR6C 4CLNA 3V2LA 1KFXL 4AQIA 5KU1A 3LCPC 1XK4C 2PRUA 4AQJA 1CFFA 1WRZA 1UWOA 3WNXB 2PASA 1LA3A 1XFXO 2LVJA 3L4LA 1OZOA 1A75A 2LVVA 3LL8B 2NXQA 2LHIA 3RLZA 1EXRA 1G8IA 3A8RA 4DIRA 2LVIA 3KEVA 2JT3A 1YR5A 1BU3A 1OSAA 1J1EA 1QASA 3BUWB 1CB1A 2F2OA 1UHKA 3FS7A 1YX8A 2K0JA 3HX4A 3N7HA 2G9BA 3JTDC 2BE4A 3NSLA 4NDBA 1AJ4A 1BMOA 1OW4A 4UPGA 2WNDA 3B86A 3SJSA 3R1PA 4XJKA 1B8RA 2F3ZA 4C0JA 1F55A 1JFKA 1KFUL 1NX3A 2BE6A 3CABA 1B7TZ 3CZ0A 4MZLA 1SYMA 1QIWA 2MLEC 3GOFA 5I2LA 1MWNA 5B8IB 3PATA 2PYQA 1SKTA 2LCPA 3BUMB 3PM2A 1JF2A 3I5IB 1NX2A 4OKHA 1DF0B 2KFHA 3CS1A 3BUNB 1WLZA 1DJIA 3O6BA 2LUXA 4M2PA 5CSFA 2PALA 5HLOA 3I5IC 2JTZA 4E68A 1NCYA 4OR9B 3OGNA 2M49B 1RTP1 1CM1A 5PALA 4GGFC 1KK8B 3EK4A 2QEHA 2KGBC 1CM4A 1SRAA 4I5NB 5BPJA 1IQ5A 1SL8A 2CCMA 1K9UA 2LP2A 1KK8C 4IJ7A 1QVIY 1QX5B 1DQEA 1PSRA 1H8BA 1IWQA 2M9GA 3PLFB 4PE0A 1K96A 4MRYA 2K7CA 1TCFA 1SL9A 1YVLA 1B1GA 1F8HA 1FW4A 2LP3A 3D75A 3OB2B 3QRXA 2MJWB 2KAVA 1DJGA 1TTXA 3DYEA 1DTLA 2PQLA 3C1VA 5FI6A 3ZWHA 1IJ5A 1AHRA 1S36A 1SSEB 2JULA 4U8DA 5HLVA 2BBMA 1J55A 1RROA 1W9ZA 4GPLB 5DKNA 3VRPA 1DF0A 2OTGB 1OOGA 3GK1A 1EG4A 1CDPA 1PVAA 4YGAA 4GGFA 1CTRA 2H8VA 3O4YA 2OTGC 2QEBA 4DS7A 3CLNA 1BT6A 3GK4X 1U5IB 2CT9A 2CTNA 4JD9A 4OZDA 1YRTB 4MSPA 5HKWA 1LKJA 2JPOA 4IL1A 3DZTA 2SASA 4MZJA 1M46A 2WCBA 3DF0B 3K1EA 3GK2A 3CYZA 2WC5A 4INWA 4ORAB 2L2CA 1IKUA 5KSZA 3LLEA 2WCJA 3DD4A 2SCPA 1X02A 3VRRA 3O4XA 2FJUB 3SIBA 1N0YA 1R6PA 1R2UA 2KAXA 3OP0A 4MBEA 3SG5A 3CGAA 3AKAA 4MEWA 2JNXA 1S5GZ 4CFRA 2LE9B 4PCWA 1KSMA 3OB1B 4HRHA 1PULA 1QV0A 1ZMZA 1YVHA 5DKQA 2NCPA 1CNPA 2M29A 2LC5A 5J3XA 2CXJA 3TZ1A 1FF1A 3BYAA 3AAKA 5TNCA 1OOJA 4MVFA 1K94A 1NWDA 3AKBA 2GTEA 3DF0A 3FIAA 3HCMA 1RK9A 1SW8A 1XFRA 5AANA 1L7ZA 3SS3A 1A03A 3B88A 2OS8B 1FBVA 4XJKB 2F8PA 2IS9A 1CLLA 2H61C 2KPHA 2WCHA 4GNKB 2JXLA 1UHJA 3EKHA 1TNPA 4GFTA 5JOLA 1NP8A 2OS8C 1YRUB 5HL1A 2PSRA 1XFZO 1SNLA 2HPSA 1DGVA 1Z4HA 2KLDA 3NHIA 4I5LB 4ORBB 1J1DA 2AUCA 2ZNEA 2I94A 2ZKMX 3H4SE 4GGNA 1F70A 4I5KA 4QJ3B 2K61A 1NYAA 4P5OE 1F54A 3S0FA 4PALA 3S0AA 2QEOA 1XYDA 3BFBA 3NGVA 3D0YB 3S0BA 1NIWA 2KQYA 1B9AA 1B7TY 1OMDA 2O60A 3SS4A 1TNWA 1IQ3A 1TOPA 2Q4UA 2WCFA 1M39A 2KSPA 2MBXA 1XA5A 2H2KA 4NQGA 2QDIA 5EL2A 3OHMB 1WRKA 1RJVA 1ZFSA 3CZ1A 3LK1A 3BFAA 2H61A 3EVVA 4JKTA 1LXFC 4C0KA 2LM5A 1J7OA 2FCEA 1BF5A 1Y1UA 1K93D 1KSOA 1M31A 2ZN9A 2MRDA 1OMRA 1JFJA 3BXKA 3KF9A 2OPOA 3K21A 1QTXA 1CLMA 2F2PA 3OX5A 2JT8A 3D78A 1C7VA 2MHHA 1YTZC 1SK6D 4TNCA 2KNEA 2PMYA 5D69A 1TN4A 1IGVA 1MF8B 3BJHA 2BKIB 1E8AA 2R2IA 1HT9A 4YGBB 3EK8A 5AEQA 2I7AA 2EHBA 3CR5X 2WCEA 3D0YA 1DMOA 1Q80A 2LHLA 1YURA 3DVMA 1QX2A 4XYNA 5D7FA 3VRQA 2KAYA 3R1VA 3B6XA 2LLUA 2L98A 1JUOA 2BCBA 2Y5IA 1W7JB 1J7PA 1IJ6A 1LVCD 2JZIA 2L4HA 5F6TA 4YGEB 1A29A 1V1FA 2ZRSA 2LLTA 2M7NA 5AXIA 4CPVA 1QJTA 3NXAA 1C7WA 3S0DA 3L47A 1PSBA 1DJYA 2MA2A 4N1FA 1AP4A 4PE7A 4YI9A 1KFXS 1M45A 2KGRA 2MAZA 1KWOB 1MXLC 2YGUA 1BG1A 1JBAA 3PFVA 2WORA 3BUXB 1S6IA 3D74A 3EVUA 1H4BA 3SG3A 1ZOTB 3VROA 2KI6C 5HKYA 2ZRTA 1KWOC 1PRWA 4AOMA 2K2FA 1FI6A 3WXAA 3FE9A 1XVJA 3PN7B 1BODA 4NDCA 2HF5A 3KHEA 1BJFA 2Y1NA 1MUXA 1S26D 1OOFA 1SMGA 1UP5A 2O5GA 1KQMB 2PVBA 2P71A 2FOTA 1SY9A 3PN7C 4OCIA 1TUJA 4WRIA 2F3YA 3VB1A 1XO5A 5AERA 4D1EA 2M3WA 1AUIB 3B87A 1T14A 2D8NA 1OOHA 1AK8A 5FI2A 2KQ6A 1AJ5A 1M63B 1KQMC 2M97A 3PM8A 4ICBA 5CPVA 1QWVA 1NSHA 1IG5A 1S5GY 1MR8A 1UHHA 1XFVO 3S0EA 4FQOA 2HQ8A 1KFUS 1OOIX 2KDHA 1K2HA 1KCYA 4DCKA 3CZTX 4HSZA 4N1GA 1CDNA 1CFPA 1DJXA 1GM0A 5I94A 2KYFA 2I2RE 1VRKA 3I5HB 3DVEA 3S0GA 1UURA 3PJIA 3KO0A 3IQOA 2HETA 4YRUA 3CZ2A 1UUSA 2JT0A 3I5HC 2ERBA 3EG5B 3D77A 3F45A 2JQ6A 3IVTA 2KFFA 4YGDB 3R72A 4MN0A 2Y1MA 3CWGA 3EKJA 1S3PA 1MHOA 1RFJA 1EH2A 3FWBA 3BFHA 2L2EA 3WHTB 2G2BA 1A2XA 5DICA 3PALA 1UHIA 2LUCA 2NZ0A 4F7FA 3I5GB 5I8NA 1D1OA 1YX7A 1B4CA 3SG4A 1KK7Z 3IQQA 4PE4A 2BCAA 1LINA 1ODBA 2DOQA 5HYDA 2KBIA 1FPWA 3TUYB 1CFCA 2WCKA 1JF0A 3I5GC 1BLQA 1TIZA 3VRNA 1W7IB 2LMTA 4ZCUA 1JWDA 2GGMA 1F71A 1SBJA 3TUYC 1CDMA 5G08A 1WRLA 4A4BA 1J7QA 1SCVA 1AVSA 2LV7A 2P6BB 4HREE 4Q04A 1BOCA 1OMVA 2JRFA 3L4AA 4KYNA 2LNKA 2ZNDA 1QXPA 2EC6B 5HKZA 2K7OA 3OBVA 2K8MB 1WDCB 1QS7A 4L9MA 1CFDA 3BQ3A 4ORCB 1B8LA 4N5XA 4USLA 2EC6C 4WQ3A 2VRGA 1NCXA 1WDCC 5ER4X 3CR4X 1ALWA 1LS8A 1QX7A 3DVJA 4BY5A 1JC2A 1J7RA 1GJYA 2BKHB 2WC8A 5FI7A 4GBAA 1NCZA 3WHUB 5GQQC 1NPQA 3BUOB 3PSRA 2KI4B 3DVKA 4JPZB 1TRFA 5FYXA 2MLFC 1A4PA 4NDDA 1PVBA 2L0PA 1CDLA 1NUBA 2AAOA 2KI4C 3D10A 1QATA 2BAPA 4ZCVA 5I2QA 1CMGA 4I5JA 2JU0A 1G33A 4JWQA 1TCOB 1G4YR 1DVIA 3RM1A 3JTDB 1PALA 4GAOA 1IIOA 1ALVA 3OX6A 1K9KA 1IRJA 2A4JA 1GGWA 4DUQA 1TNXA 1B47A 4OVNF 1CMFA 1LA0A 1C07A 3DXLA 1XFYO 2B1UA 2L50A 4M2QA 4QJ4B 3RZSA 2QACA 1TWOA 4M2OA 3VGOA 3SIAA 1QV1A 1Y1AA 2ISDA 1NX1A 1NX0A 3TDUA 1BR4B 1XK4A 3BOWB 2KBMA 3TDIA 4C0LA 4MLWA 3D73A 5KTYA 2FCDA 2KYCA 2WOSA 1GGZA 1N2DA 3NHTA 4R1EA 1KQVA 4HRGA 3ZNIA 1HQVA 2WCLA 2JNFA 2KHNA 3LK0A 2NCOA 3EVRA 1F4OA 1QIVA 1RWYA 1YUSA 2TN4A 2E30A 1YUTA 1QLKA 4YGCB 2M1KB 3CDNA 4YBHB 1OQPA 1P28A 5K89A 2P70A 1S6CA 3FWCA 4A4CA 1YUUA 4F0ZB 1WY9A 2E6WA 3O2PA 2BECA 4FQTA 1F4QA 4GUKA 2RGIA 5D3OA 1B8CA 1DJZA 2JC2A 2JWWA 1TUZA 1L2OB 2AMIA 3DY9A 3SG6A 2LLSA 3Q8IA 4INXA 2QEVA 2JPTA 1S1EA 2KFGA 2Q91A 2LVKA 1DEKA 2CBLA 1L2OC 1JSAA 4QJ5B
chains in the Genus database with same CATH topology
1UHNA 1XFUO 3BOWA 2LMUA 2JXCA 3NSIA 1MQ1A 5ER5A 1GQMA 1FI5A 3TS5B 2EGDA 3I5FB 1K90D 1XFWO 4DRWA 1QVIZ 3CR2A 5CSIA 5JJGA 3ICBA 2M8UA 5DKRA 1DJHA 3TS5C 3I5FC 1DT7B 1DJWA 2I18A 2L51A 1N65A 2V53A 1RECA 2K7DA 2L4IA 1SPYA 1IH0A 2NLNA 1QLSA 4MZKA 1KK7Y 1MXEA 3AAJA 1K8UA 4CIDA 1DGUA 5I2OA 1WLMA 4CFQA 2BCXA 2HQWA 1EG3A 1ZUZA 2M1UA 1K95A 2ZFDA 3NSKA 4PHNA 3SG7A 5CSJA 3TDZA 2ZN8A 3M0WA 4PE1A 2KI6D 5CSNA 2KOTA 2K7BA 4PHJA 2QPTA 2GGZA 2COLB 3CTNA 2LANA 2BL0B 4FTGA 4WQ2A 3MSEB 5IBWA 5AFPA 2JOJA 4ETOA 1K9PA 2GV5A 2M0RA 2BL0C 3E3RA 1PK0D 4YI8A 1BR1B 1CKKA 1Y1XA 2K2AA 3JVTB 1A75B 3SG2A 2LMVA 3O78A 1OE9B 2M7LA 2BBNA 2CNPA 1ZACA 4JQ0D 3EK7A 1U5IA 1SCMB 2JTTA 3JVTC 1TNQA 1EJ3A 1EL4A 2L5XB 1Y0VH 4BY4A 3NSOA 4P2YB 1S6JA 1SL7A 4PDZA 1SCMC 4PHKA 4PHMA 3KPXA 1V1GA 2LAPA 3A4UB 2F33A 1SR6B 1Y6WA 4MRXA 2Y4QA 4OV2A 1OZSA 1CLBA 3IF7A 1SR6C 4CLNA 4AQIA 1KFXL 5KU1A 3LCPC 1XK4C 2PRUA 4AQJA 1CFFA 1WRZA 1UWOA 3WNXB 2PASA 1LA3A 1XFXO 2LVJA 3LL8B 1OZOA 1A75A 2LVVA 2NXQA 2LHIA 3RLZA 1EXRA 1G8IA 3A8RA 4DIRA 2LVIA 3KEVA 2JT3A 1YR5A 1BU3A 1OSAA 1J1EA 1QASA 3BUWB 1CB1A 2F2OA 1UHKA 3FS7A 1YX8A 2K0JA 3HX4A 2G9BA 3JTDC 2BE4A 3NSLA 4NDBA 1AJ4A 1BMOA 4UPGA 2WNDA 3SJSA 4XJKA 1F55A 1B8RA 2F3ZA 4C0JA 1JFKA 1KFUL 1NX3A 2BE6A 1B7TZ 4MZLA 1SYMA 1QIWA 2MLEC 3GOFA 5I2LA 1MWNA 5B8IB 3PATA 1SKTA 2LCPA 3BUMB 1JF2A 3I5IB 1NX2A 4OKHA 1DF0B 2KFHA 3CS1A 3BUNB 1WLZA 1DJIA 3O6BA 2LUXA 4M2PA 5CSFA 2PALA 5HLOA 3I5IC 2JTZA 4E68A 1NCYA 4OR9B 2M49B 1RTP1 1CM1A 5PALA 4GGFC 1KK8B 3EK4A 2KGBC 1CM4A 1SRAA 4I5NB 5BPJA 1IQ5A 1SL8A 2CCMA 1K9UA 2LP2A 1KK8C 1QVIY 1QX5B 1PSRA 1H8BA 1IWQA 2M9GA 3PLFB 4PE0A 1K96A 4MRYA 2K7CA 1TCFA 1SL9A 1YVLA 1B1GA 1F8HA 1FW4A 2LP3A 3QRXA 3OB2B 2MJWB 2KAVA 1DJGA 1TTXA 1DTLA 3C1VA 3ZWHA 1IJ5A 1AHRA 1S36A 2JULA 5HLVA 4U8DA 2BBMA 1J55A 1RROA 4GPLB 5DKNA 3VRPA 1DF0A 2OTGB 3GK1A 1EG4A 1CDPA 1PVAA 4YGAA 4GGFA 1CTRA 3O4YA 2OTGC 4DS7A 3CLNA 1BT6A 3GK4X 1U5IB 2CT9A 2CTNA 1YRTB 4MSPA 5HKWA 1LKJA 4IL1A 2SASA 4MZJA 1M46A 2WCBA 3DF0B 3GK2A 4ORAB 1IKUA 5KSZA 3LLEA 3DD4A 2SCPA 1X02A 3VRRA 2FJUB 3SIBA 1N0YA 1R6PA 1R2UA 2KAXA 3OP0A 4MBEA 3SG5A 3CGAA 3AKAA 4MEWA 2JNXA 1S5GZ 4CFRA 2LE9B 4PCWA 1KSMA 3OB1B 4HRHA 1PULA 1QV0A 1ZMZA 1YVHA 5DKQA 2NCPA 1CNPA 2M29A 2LC5A 5J3XA 2CXJA 3TZ1A 1FF1A 3BYAA 3AAKA 5TNCA 1OOJA 4MVFA 1K94A 1NWDA 3AKBA 3DF0A 3FIAA 3HCMA 1RK9A 1SW8A 5AANA 1A03A 1L7ZA 2OS8B 1FBVA 4XJKB 2F8PA 2IS9A 1CLLA 2H61C 4GNKB 2JXLA 1UHJA 3EKHA 1TNPA 4GFTA 5JOLA 1NP8A 2OS8C 1YRUB 2PSRA 1XFZO 1SNLA 2HPSA 1DGVA 4I5LB 4ORBB 1J1DA 2AUCA 2ZNEA 2I94A 2ZKMX 3H4SE 4GGNA 1F70A 4I5KA 4QJ3B 2K61A 1NYAA 4P5OE 1F54A 4PALA 1XYDA 3D0YB 1NIWA 2KQYA 1B9AA 1B7TY 1OMDA 2O60A 1TNWA 1IQ3A 1TOPA 2Q4UA 2WCFA 1M39A 2KSPA 2MBXA 1XA5A 2H2KA 4NQGA 3OHMB 1WRKA 1RJVA 1ZFSA 3LK1A 2H61A 3EVVA 4C0KA 1LXFC 2LM5A 1J7OA 2FCEA 1BF5A 1Y1UA 1K93D 1KSOA 1M31A 2ZN9A 2MRDA 1OMRA 1JFJA 3BXKA 3KF9A 2OPOA 3K21A 1QTXA 1CLMA 2F2PA 3OX5A 2JT8A 1C7VA 2MHHA 1YTZC 1SK6D 4TNCA 2KNEA 2PMYA 5D69A 1TN4A 1IGVA 1MF8B 2BKIB 1E8AA 2R2IA 1HT9A 4YGBB 3EK8A 5AEQA 2I7AA 2EHBA 3CR5X 2WCEA 3D0YA 1DMOA 1Q80A 2LHLA 1YURA 3DVMA 1QX2A 4XYNA 5D7FA 3VRQA 2KAYA 2LLUA 2L98A 1JUOA 2BCBA 2Y5IA 1W7JB 1J7PA 1IJ6A 1LVCD 2JZIA 2L4HA 5F6TA 4YGEB 1A29A 1V1FA 2ZRSA 2LLTA 2M7NA 5AXIA 4CPVA 1QJTA 3NXAA 1C7WA 4YRUA 1PSBA 1DJYA 2MA2A 4N1FA 1AP4A 4PE7A 4YI9A 1KFXS 1M45A 2KGRA 2MAZA 1KWOB 1MXLC 1BG1A 1JBAA 3PFVA 2WORA 3BUXB 1S6IA 3EVUA 1H4BA 3SG3A 1ZOTB 3VROA 2KI6C 5HKYA 2ZRTA 1KWOC 1PRWA 4AOMA 2K2FA 1FI6A 3WXAA 1BODA 1XVJA 3PN7B 4NDCA 2HF5A 3KHEA 1BJFA 2Y1NA 1MUXA 1S26D 1SMGA 1UP5A 2O5GA 1KQMB 2PVBA 2FOTA 1SY9A 3PN7C 4OCIA 4WRIA 5AERA 2F3YA 1XO5A 4D1EA 2M3WA 1AUIB 2D8NA 1AK8A 2KQ6A 1AJ5A 1M63B 1KQMC 2M97A 3PM8A 4ICBA 5CPVA 1NSHA 1IG5A 1S5GY 1MR8A 1UHHA 1XFVO 4FQOA 2HQ8A 1KFUS 2KDHA 1K2HA 1KCYA 4DCKA 3CZTX 4HSZA 4N1GA 1CDNA 1CFPA 1DJXA 2KYFA 2I2RE 1VRKA 3I5HB 3DVEA 1UURA 3KO0A 3IQOA 2HETA 1UUSA 2JT0A 3I5HC 3F45A 2JQ6A 2KFFA 4YGDB 4MN0A 2Y1MA 3CWGA 3EKJA 1S3PA 1MHOA 1RFJA 1EH2A 3FWBA 3WHTB 2L2EA 2G2BA 1A2XA 3PALA 1UHIA 2LUCA 2NZ0A 3I5GB 5I8NA 1D1OA 1YX7A 1B4CA 3SG4A 1KK7Z 3IQQA 4PE4A 2BCAA 1LINA 1ODBA 2DOQA 5HYDA 2KBIA 1FPWA 3TUYB 1CFCA 3I5GC 1JF0A 1BLQA 1TIZA 3VRNA 1W7IB 2LMTA 4ZCUA 1JWDA 2GGMA 1F71A 1SBJA 3TUYC 1CDMA 5G08A 1WRLA 4A4BA 1J7QA 1SCVA 1AVSA 2LV7A 2P6BB 4HREE 4Q04A 1BOCA 1OMVA 2JRFA 2LNKA 2ZNDA 1QXPA 2EC6B 5HKZA 2K7OA 2K8MB 1WDCB 1QS7A 4L9MA 1CFDA 3BQ3A 4ORCB 1B8LA 4N5XA 4USLA 2EC6C 4WQ3A 2VRGA 1NCXA 1WDCC 5ER4X 3CR4X 1ALWA 1QX7A 3DVJA 4BY5A 1JC2A 1J7RA 1GJYA 2BKHB 2WC8A 4GBAA 1NCZA 3WHUB 5GQQC 1NPQA 3BUOB 3PSRA 2KI4B 3DVKA 4JPZB 1TRFA 5FYXA 2MLFC 1A4PA 4NDDA 1PVBA 2L0PA 1CDLA 1NUBA 2AAOA 2KI4C 3D10A 1QATA 4ZCVA 5I2QA 1CMGA 4I5JA 2JU0A 1G33A 4JWQA 1TCOB 1G4YR 1DVIA 3RM1A 3JTDB 1PALA 4GAOA 1ALVA 3OX6A 1K9KA 1IRJA 2A4JA 1GGWA 4DUQA 1TNXA 1B47A 4OVNF 1CMFA 1LA0A 1C07A 1XFYO 2B1UA 2L50A 4M2QA 4QJ4B 2QACA 4M2OA 3VGOA 3SIAA 1QV1A 1Y1AA 2ISDA 1NX1A 1NX0A 3TDUA 1BR4B 1XK4A 3BOWB 2KBMA 3TDIA 4C0LA 4MLWA 5KTYA 2FCDA 2KYCA 2WOSA 1GGZA 1N2DA 4R1EA 1KQVA 4HRGA 3ZNIA 1HQVA 2JNFA 2KHNA 3LK0A 2NCOA 3EVRA 1F4OA 1QIVA 1RWYA 1YUSA 2TN4A 2E30A 1YUTA 1QLKA 4YGCB 2M1KB 4YBHB 1OQPA 5K89A 1S6CA 3FWCA 4A4CA 1YUUA 4F0ZB 1WY9A 2E6WA 3O2PA 2BECA 1F4QA 4GUKA 2RGIA 1B8CA 1DJZA 2JC2A 2JWWA 1L2OB 2AMIA 3SG6A 2LLSA 2JPTA 1S1EA 2KFGA 2Q91A 2LVKA 2CBLA 1L2OC 1JSAA 4QJ5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UHN A;  1XFU O;  3BOW A;  2LMU A;  2JXC A;  3NSI A;  1MQ1 A;  5ER5 A;  1GQM A;  1FI5 A;  3TS5 B;  2EGD A;  3I5F B;  1K90 D;  1XFW O;  4DRW A;  1QVI Z;  3CR2 A;  5CSI A;  5JJG A;  3ICB A;  2M8U A;  5DKR A;  1DJH A;  3TS5 C;  3I5F C;  1DT7 B;  1DJW A;  2I18 A;  2L51 A;  1N65 A;  2V53 A;  1REC A;  2K7D A;  2L4I A;  1SPY A;  1IH0 A;  2NLN A;  1QLS A;  4MZK A;  1KK7 Y;  1MXE A;  3AAJ A;  1K8U A;  4CID A;  1DGU A;  5I2O A;  1WLM A;  4CFQ A;  2BCX A;  2HQW A;  1EG3 A;  1ZUZ A;  2M1U A;  1K95 A;  2ZFD A;  3NSK A;  4PHN A;  3SG7 A;  5CSJ A;  3TDZ A;  2ZN8 A;  3M0W A;  4PE1 A;  2KI6 D;  5CSN A;  2KOT A;  2K7B A;  4PHJ A;  2QPT A;  2GGZ A;  2COL B;  3CTN A;  2LAN A;  2BL0 B;  4FTG A;  4WQ2 A;  3MSE B;  5IBW A;  5AFP A;  2JOJ A;  4ETO A;  1K9P A;  2GV5 A;  2M0R A;  2BL0 C;  3E3R A;  1PK0 D;  4YI8 A;  1BR1 B;  1CKK A;  1Y1X A;  2K2A A;  3JVT B;  1A75 B;  3SG2 A;  2LMV A;  3O78 A;  1OE9 B;  2M7L A;  2BBN A;  2CNP A;  1ZAC A;  4JQ0 D;  3EK7 A;  1U5I A;  1SCM B;  2JTT A;  3JVT C;  1TNQ A;  1EJ3 A;  1EL4 A;  2L5X B;  1Y0V H;  4BY4 A;  3NSO A;  4P2Y B;  1S6J A;  1SL7 A;  4PDZ A;  1SCM C;  4PHK A;  4PHM A;  3KPX A;  1V1G A;  2LAP A;  3A4U B;  2F33 A;  1SR6 B;  1Y6W A;  4MRX A;  2Y4Q A;  4OV2 A;  1OZS A;  1CLB A;  3IF7 A;  1SR6 C;  4CLN A;  4AQI A;  1KFX L;  5KU1 A;  3LCP C;  1XK4 C;  2PRU A;  4AQJ A;  1CFF A;  1WRZ A;  1UWO A;  3WNX B;  2PAS A;  1LA3 A;  1XFX O;  2LVJ A;  3LL8 B;  1OZO A;  1A75 A;  2LVV A;  2NXQ A;  2LHI A;  3RLZ A;  1EXR A;  1G8I A;  3A8R A;  4DIR A;  2LVI A;  3KEV A;  2JT3 A;  1YR5 A;  1BU3 A;  1OSA A;  1J1E A;  1QAS A;  3BUW B;  1CB1 A;  2F2O A;  1UHK A;  3FS7 A;  1YX8 A;  2K0J A;  3HX4 A;  2G9B A;  3JTD C;  2BE4 A;  3NSL A;  4NDB A;  1AJ4 A;  1BMO A;  4UPG A;  2WND A;  3SJS A;  4XJK A;  1F55 A;  1B8R A;  2F3Z A;  4C0J A;  1JFK A;  1KFU L;  1NX3 A;  2BE6 A;  1B7T Z;  4MZL A;  1SYM A;  1QIW A;  2MLE C;  3GOF A;  5I2L A;  1MWN A;  5B8I B;  3PAT A;  1SKT A;  2LCP A;  3BUM B;  1JF2 A;  3I5I B;  1NX2 A;  4OKH A;  1DF0 B;  2KFH A;  3CS1 A;  3BUN B;  1WLZ A;  1DJI A;  3O6B A;  2LUX A;  4M2P A;  5CSF A;  2PAL A;  5HLO A;  3I5I C;  2JTZ A;  4E68 A;  1NCY A;  4OR9 B;  2M49 B;  1RTP 1;  1CM1 A;  5PAL A;  4GGF C;  1KK8 B;  3EK4 A;  2KGB C;  1CM4 A;  1SRA A;  4I5N B;  5BPJ A;  1IQ5 A;  1SL8 A;  2CCM A;  1K9U A;  2LP2 A;  1KK8 C;  1QVI Y;  1QX5 B;  1PSR A;  1H8B A;  1IWQ A;  2M9G A;  3PLF B;  4PE0 A;  1K96 A;  4MRY A;  2K7C A;  1TCF A;  1SL9 A;  1YVL A;  1B1G A;  1F8H A;  1FW4 A;  2LP3 A;  3QRX A;  3OB2 B;  2MJW B;  2KAV A;  1DJG A;  1TTX A;  1DTL A;  3C1V A;  3ZWH A;  1IJ5 A;  1AHR A;  1S36 A;  2JUL A;  5HLV A;  4U8D A;  2BBM A;  1J55 A;  1RRO A;  4GPL B;  5DKN A;  3VRP A;  1DF0 A;  2OTG B;  3GK1 A;  1EG4 A;  1CDP A;  1PVA A;  4YGA A;  4GGF A;  1CTR A;  3O4Y A;  2OTG C;  4DS7 A;  3CLN A;  1BT6 A;  3GK4 X;  1U5I B;  2CT9 A;  2CTN A;  1YRT B;  4MSP A;  5HKW A;  1LKJ A;  4IL1 A;  2SAS A;  4MZJ A;  1M46 A;  2WCB A;  3DF0 B;  3GK2 A;  4ORA B;  1IKU A;  5KSZ A;  3LLE A;  3DD4 A;  2SCP A;  1X02 A;  3VRR A;  2FJU B;  3SIB A;  1N0Y A;  1R6P A;  1R2U A;  2KAX A;  3OP0 A;  4MBE A;  3SG5 A;  3CGA A;  3AKA A;  4MEW A;  2JNX A;  1S5G Z;  4CFR A;  2LE9 B;  4PCW A;  1KSM A;  3OB1 B;  4HRH A;  1PUL A;  1QV0 A;  1ZMZ A;  1YVH A;  5DKQ A;  2NCP A;  1CNP A;  2M29 A;  2LC5 A;  5J3X A;  2CXJ A;  3TZ1 A;  1FF1 A;  3BYA A;  3AAK A;  5TNC A;  1OOJ A;  4MVF A;  1K94 A;  1NWD A;  3AKB A;  3DF0 A;  3FIA A;  3HCM A;  1RK9 A;  1SW8 A;  5AAN A;  1A03 A;  1L7Z A;  2OS8 B;  1FBV A;  4XJK B;  2F8P A;  2IS9 A;  1CLL A;  2H61 C;  4GNK B;  2JXL A;  1UHJ A;  3EKH A;  1TNP A;  4GFT A;  5JOL A;  1NP8 A;  2OS8 C;  1YRU B;  2PSR A;  1XFZ O;  1SNL A;  2HPS A;  1DGV A;  4I5L B;  4ORB B;  1J1D A;  2AUC A;  2ZNE A;  2I94 A;  2ZKM X;  3H4S E;  4GGN A;  1F70 A;  4I5K A;  4QJ3 B;  2K61 A;  1NYA A;  4P5O E;  1F54 A;  4PAL A;  1XYD A;  3D0Y B;  1NIW A;  2KQY A;  1B9A A;  1B7T Y;  1OMD A;  2O60 A;  1TNW A;  1IQ3 A;  1TOP A;  2Q4U A;  2WCF A;  1M39 A;  2KSP A;  2MBX A;  1XA5 A;  2H2K A;  4NQG A;  3OHM B;  1WRK A;  1RJV A;  1ZFS A;  3LK1 A;  2H61 A;  3EVV A;  4C0K A;  1LXF C;  2LM5 A;  1J7O A;  2FCE A;  1BF5 A;  1Y1U A;  1K93 D;  1KSO A;  1M31 A;  2ZN9 A;  2MRD A;  1OMR A;  1JFJ A;  3BXK A;  3KF9 A;  2OPO A;  3K21 A;  1QTX A;  1CLM A;  2F2P A;  3OX5 A;  2JT8 A;  1C7V A;  2MHH A;  1YTZ C;  1SK6 D;  4TNC A;  2KNE A;  2PMY A;  5D69 A;  1TN4 A;  1IGV A;  1MF8 B;  2BKI B;  1E8A A;  2R2I A;  1HT9 A;  4YGB B;  3EK8 A;  5AEQ A;  2I7A A;  2EHB A;  3CR5 X;  2WCE A;  3D0Y A;  1DMO A;  1Q80 A;  2LHL A;  1YUR A;  3DVM A;  1QX2 A;  4XYN A;  5D7F A;  3VRQ A;  2KAY A;  2LLU A;  2L98 A;  1JUO A;  2BCB A;  2Y5I A;  1W7J B;  1J7P A;  1IJ6 A;  1LVC D;  2JZI A;  2L4H A;  5F6T A;  4YGE B;  1A29 A;  1V1F A;  2ZRS A;  2LLT A;  2M7N A;  5AXI A;  4CPV A;  1QJT A;  3NXA A;  1C7W A;  4YRU A;  1PSB A;  1DJY A;  2MA2 A;  4N1F A;  1AP4 A;  4PE7 A;  4YI9 A;  1KFX S;  1M45 A;  2KGR A;  2MAZ A;  1KWO B;  1MXL C;  1BG1 A;  1JBA A;  3PFV A;  2WOR A;  3BUX B;  1S6I A;  3EVU A;  1H4B A;  3SG3 A;  1ZOT B;  3VRO A;  2KI6 C;  5HKY A;  2ZRT A;  1KWO C;  1PRW A;  4AOM A;  2K2F A;  1FI6 A;  3WXA A;  1BOD A;  1XVJ A;  3PN7 B;  4NDC A;  2HF5 A;  3KHE A;  1BJF A;  2Y1N A;  1MUX A;  1S26 D;  1SMG A;  1UP5 A;  2O5G A;  1KQM B;  2PVB A;  2FOT A;  1SY9 A;  3PN7 C;  4OCI A;  4WRI A;  5AER A;  2F3Y A;  1XO5 A;  4D1E A;  2M3W A;  1AUI B;  2D8N A;  1AK8 A;  2KQ6 A;  1AJ5 A;  1M63 B;  1KQM C;  2M97 A;  3PM8 A;  4ICB A;  5CPV A;  1NSH A;  1IG5 A;  1S5G Y;  1MR8 A;  1UHH A;  1XFV O;  4FQO A;  2HQ8 A;  1KFU S;  2KDH A;  1K2H A;  1KCY A;  4DCK A;  3CZT X;  4HSZ A;  4N1G A;  1CDN A;  1CFP A;  1DJX A;  2KYF A;  2I2R E;  1VRK A;  3I5H B;  3DVE A;  1UUR A;  3KO0 A;  3IQO A;  2HET A;  1UUS A;  2JT0 A;  3I5H C;  3F45 A;  2JQ6 A;  2KFF A;  4YGD B;  4MN0 A;  2Y1M A;  3CWG A;  3EKJ A;  1S3P A;  1MHO A;  1RFJ A;  1EH2 A;  3FWB A;  3WHT B;  2L2E A;  2G2B A;  1A2X A;  3PAL A;  1UHI A;  2LUC A;  2NZ0 A;  3I5G B;  5I8N A;  1D1O A;  1YX7 A;  1B4C A;  3SG4 A;  1KK7 Z;  3IQQ A;  4PE4 A;  2BCA A;  1LIN A;  1ODB A;  2DOQ A;  5HYD A;  2KBI A;  1FPW A;  3TUY B;  1CFC A;  3I5G C;  1JF0 A;  1BLQ A;  1TIZ A;  3VRN A;  1W7I B;  2LMT A;  4ZCU A;  1JWD A;  2GGM A;  1F71 A;  1SBJ A;  3TUY C;  1CDM A;  5G08 A;  1WRL A;  4A4B A;  1J7Q A;  1SCV A;  1AVS A;  2LV7 A;  2P6B B;  4HRE E;  4Q04 A;  1BOC A;  1OMV A;  2JRF A;  2LNK A;  2ZND A;  1QXP A;  2EC6 B;  5HKZ A;  2K7O A;  2K8M B;  1WDC B;  1QS7 A;  4L9M A;  1CFD A;  3BQ3 A;  4ORC B;  1B8L A;  4N5X A;  4USL A;  2EC6 C;  4WQ3 A;  2VRG A;  1NCX A;  1WDC C;  5ER4 X;  3CR4 X;  1ALW A;  1QX7 A;  3DVJ A;  4BY5 A;  1JC2 A;  1J7R A;  1GJY A;  2BKH B;  2WC8 A;  4GBA A;  1NCZ A;  3WHU B;  5GQQ C;  1NPQ A;  3BUO B;  3PSR A;  2KI4 B;  3DVK A;  4JPZ B;  1TRF A;  5FYX A;  2MLF C;  1A4P A;  4NDD A;  1PVB A;  2L0P A;  1CDL A;  1NUB A;  2AAO A;  2KI4 C;  3D10 A;  1QAT A;  4ZCV A;  5I2Q A;  1CMG A;  4I5J A;  2JU0 A;  1G33 A;  4JWQ A;  1TCO B;  1G4Y R;  1DVI A;  3RM1 A;  3JTD B;  1PAL A;  4GAO A;  1ALV A;  3OX6 A;  1K9K A;  1IRJ A;  2A4J A;  1GGW A;  4DUQ A;  1TNX A;  1B47 A;  4OVN F;  1CMF A;  1LA0 A;  1C07 A;  1XFY O;  2B1U A;  2L50 A;  4M2Q A;  4QJ4 B;  2QAC A;  4M2O A;  3VGO A;  3SIA A;  1QV1 A;  1Y1A A;  2ISD A;  1NX1 A;  1NX0 A;  3TDU A;  1BR4 B;  1XK4 A;  3BOW B;  2KBM A;  3TDI A;  4C0L A;  4MLW A;  5KTY A;  2FCD A;  2KYC A;  2WOS A;  1GGZ A;  1N2D A;  4R1E A;  1KQV A;  4HRG A;  3ZNI A;  1HQV A;  2JNF A;  2KHN A;  3LK0 A;  2NCO A;  3EVR A;  1F4O A;  1QIV A;  1RWY A;  1YUS A;  2TN4 A;  2E30 A;  1YUT A;  1QLK A;  4YGC B;  2M1K B;  4YBH B;  1OQP A;  5K89 A;  1S6C A;  3FWC A;  4A4C A;  1YUU A;  4F0Z B;  1WY9 A;  2E6W A;  3O2P A;  2BEC A;  1F4Q A;  4GUK A;  2RGI A;  1B8C A;  1DJZ A;  2JC2 A;  2JWW A;  1L2O B;  2AMI A;  3SG6 A;  2LLS A;  2JPT A;  1S1E A;  2KFG A;  2Q91 A;  2LVK A;  2CBL A;  1L2O C;  1JSA A;  4QJ5 B; 
#chains in the Genus database with same CATH topology
 1UHN A;  1XFU O;  3BOW A;  3B7A A;  2LMU A;  3UO9 A;  2JXC A;  3NSI A;  1MQ1 A;  5ER5 A;  1GQM A;  1FI5 A;  2K60 A;  3TS5 B;  2EGD A;  3I5F B;  1K90 D;  1XFW O;  4DRW A;  1QVI Z;  3CR2 A;  5CSI A;  2WCM A;  3ICB A;  2M8U A;  5DKR A;  1DJH A;  3TS5 C;  3I5F C;  5JJG A;  1DT7 B;  1DJW A;  2I18 A;  2L51 A;  1N65 A;  2V53 A;  1REC A;  2K7D A;  2L4I A;  1SPY A;  2FJY A;  1IH0 A;  1DEL A;  1QLS A;  2NLN A;  1KK7 Y;  1MXE A;  4MZK A;  3AAJ A;  1K8U A;  4CID A;  1DGU A;  5I2O A;  1Z2C B;  1WLM A;  4CFQ A;  2BCX A;  2HQW A;  2KLE A;  1EG3 A;  1ZUZ A;  2M1U A;  1K95 A;  2ZFD A;  3NSK A;  4PHN A;  3SG7 A;  5CSJ A;  3TDZ A;  2ZN8 A;  3M0W A;  3FE8 A;  4PE1 A;  2WC6 A;  2KI6 D;  5CSN A;  2KOT A;  2K7B A;  3R1O A;  2QPT A;  2GGZ A;  4PHJ A;  2COL B;  3CTN A;  2LAN A;  2BL0 B;  4FTG A;  4WQ2 A;  3MSE B;  2BNX A;  2L5Y A;  5IBW A;  3D76 A;  5AFP A;  2JOJ A;  4ETO A;  1K9P A;  1ORG A;  2GV5 A;  2M0R A;  2BL0 C;  3E3R A;  1PK0 D;  4YI8 A;  1BR1 B;  1CKK A;  1Y1X A;  2K2A A;  4PT1 A;  3JVT B;  1A75 B;  3SG2 A;  2LMV A;  3O78 A;  1OE9 B;  2M7L A;  2BBN A;  2CNP A;  1ZAC A;  4JQ0 D;  3EK7 A;  1U5I A;  1SCM B;  2JTT A;  3JVT C;  1TNQ A;  1EJ3 A;  1EL4 A;  2L5X B;  1Y0V H;  3UNW A;  4BY4 A;  1DC1 A;  3NSO A;  4P2Y B;  1S6J A;  1SL7 A;  4PDZ A;  3QME A;  1SCM C;  4PHK A;  4PHM A;  3KPX A;  1V1G A;  2LAP A;  3A4U B;  1C3Y A;  2F33 A;  1SR6 B;  1Y6W A;  3FE6 A;  1C3Z A;  3SS5 A;  4MRX A;  2Y4Q A;  4OV2 A;  1OZS A;  1CLB A;  3IF7 A;  1SR6 C;  4CLN A;  3V2L A;  1KFX L;  4AQI A;  5KU1 A;  3LCP C;  1XK4 C;  2PRU A;  4AQJ A;  1CFF A;  1WRZ A;  1UWO A;  3WNX B;  2PAS A;  1LA3 A;  1XFX O;  2LVJ A;  3L4L A;  1OZO A;  1A75 A;  2LVV A;  3LL8 B;  2NXQ A;  2LHI A;  3RLZ A;  1EXR A;  1G8I A;  3A8R A;  4DIR A;  2LVI A;  3KEV A;  2JT3 A;  1YR5 A;  1BU3 A;  1OSA A;  1J1E A;  1QAS A;  3BUW B;  1CB1 A;  2F2O A;  1UHK A;  3FS7 A;  1YX8 A;  2K0J A;  3HX4 A;  3N7H A;  2G9B A;  3JTD C;  2BE4 A;  3NSL A;  4NDB A;  1AJ4 A;  1BMO A;  1OW4 A;  4UPG A;  2WND A;  3B86 A;  3SJS A;  3R1P A;  4XJK A;  1B8R A;  2F3Z A;  4C0J A;  1F55 A;  1JFK A;  1KFU L;  1NX3 A;  2BE6 A;  3CAB A;  1B7T Z;  3CZ0 A;  4MZL A;  1SYM A;  1QIW A;  2MLE C;  3GOF A;  5I2L A;  1MWN A;  5B8I B;  3PAT A;  2PYQ A;  1SKT A;  2LCP A;  3BUM B;  3PM2 A;  1JF2 A;  3I5I B;  1NX2 A;  4OKH A;  1DF0 B;  2KFH A;  3CS1 A;  3BUN B;  1WLZ A;  1DJI A;  3O6B A;  2LUX A;  4M2P A;  5CSF A;  2PAL A;  5HLO A;  3I5I C;  2JTZ A;  4E68 A;  1NCY A;  4OR9 B;  3OGN A;  2M49 B;  1RTP 1;  1CM1 A;  5PAL A;  4GGF C;  1KK8 B;  3EK4 A;  2QEH A;  2KGB C;  1CM4 A;  1SRA A;  4I5N B;  5BPJ A;  1IQ5 A;  1SL8 A;  2CCM A;  1K9U A;  2LP2 A;  1KK8 C;  4IJ7 A;  1QVI Y;  1QX5 B;  1DQE A;  1PSR A;  1H8B A;  1IWQ A;  2M9G A;  3PLF B;  4PE0 A;  1K96 A;  4MRY A;  2K7C A;  1TCF A;  1SL9 A;  1YVL A;  1B1G A;  1F8H A;  1FW4 A;  2LP3 A;  3D75 A;  3OB2 B;  3QRX A;  2MJW B;  2KAV A;  1DJG A;  1TTX A;  3DYE A;  1DTL A;  2PQL A;  3C1V A;  5FI6 A;  3ZWH A;  1IJ5 A;  1AHR A;  1S36 A;  1SSE B;  2JUL A;  4U8D A;  5HLV A;  2BBM A;  1J55 A;  1RRO A;  1W9Z A;  4GPL B;  5DKN A;  3VRP A;  1DF0 A;  2OTG B;  1OOG A;  3GK1 A;  1EG4 A;  1CDP A;  1PVA A;  4YGA A;  4GGF A;  1CTR A;  2H8V A;  3O4Y A;  2OTG C;  2QEB A;  4DS7 A;  3CLN A;  1BT6 A;  3GK4 X;  1U5I B;  2CT9 A;  2CTN A;  4JD9 A;  4OZD A;  1YRT B;  4MSP A;  5HKW A;  1LKJ A;  2JPO A;  4IL1 A;  3DZT A;  2SAS A;  4MZJ A;  1M46 A;  2WCB A;  3DF0 B;  3K1E A;  3GK2 A;  3CYZ A;  2WC5 A;  4INW A;  4ORA B;  2L2C A;  1IKU A;  5KSZ A;  3LLE A;  2WCJ A;  3DD4 A;  2SCP A;  1X02 A;  3VRR A;  3O4X A;  2FJU B;  3SIB A;  1N0Y A;  1R6P A;  1R2U A;  2KAX A;  3OP0 A;  4MBE A;  3SG5 A;  3CGA A;  3AKA A;  4MEW A;  2JNX A;  1S5G Z;  4CFR A;  2LE9 B;  4PCW A;  1KSM A;  3OB1 B;  4HRH A;  1PUL A;  1QV0 A;  1ZMZ A;  1YVH A;  5DKQ A;  2NCP A;  1CNP A;  2M29 A;  2LC5 A;  5J3X A;  2CXJ A;  3TZ1 A;  1FF1 A;  3BYA A;  3AAK A;  5TNC A;  1OOJ A;  4MVF A;  1K94 A;  1NWD A;  3AKB A;  2GTE A;  3DF0 A;  3FIA A;  3HCM A;  1RK9 A;  1SW8 A;  1XFR A;  5AAN A;  1L7Z A;  3SS3 A;  1A03 A;  3B88 A;  2OS8 B;  1FBV A;  4XJK B;  2F8P A;  2IS9 A;  1CLL A;  2H61 C;  2KPH A;  2WCH A;  4GNK B;  2JXL A;  1UHJ A;  3EKH A;  1TNP A;  4GFT A;  5JOL A;  1NP8 A;  2OS8 C;  1YRU B;  5HL1 A;  2PSR A;  1XFZ O;  1SNL A;  2HPS A;  1DGV A;  1Z4H A;  2KLD A;  3NHI A;  4I5L B;  4ORB B;  1J1D A;  2AUC A;  2ZNE A;  2I94 A;  2ZKM X;  3H4S E;  4GGN A;  1F70 A;  4I5K A;  4QJ3 B;  2K61 A;  1NYA A;  4P5O E;  1F54 A;  3S0F A;  4PAL A;  3S0A A;  2QEO A;  1XYD A;  3BFB A;  3NGV A;  3D0Y B;  3S0B A;  1NIW A;  2KQY A;  1B9A A;  1B7T Y;  1OMD A;  2O60 A;  3SS4 A;  1TNW A;  1IQ3 A;  1TOP A;  2Q4U A;  2WCF A;  1M39 A;  2KSP A;  2MBX A;  1XA5 A;  2H2K A;  4NQG A;  2QDI A;  5EL2 A;  3OHM B;  1WRK A;  1RJV A;  1ZFS A;  3CZ1 A;  3LK1 A;  3BFA A;  2H61 A;  3EVV A;  4JKT A;  1LXF C;  4C0K A;  2LM5 A;  1J7O A;  2FCE A;  1BF5 A;  1Y1U A;  1K93 D;  1KSO A;  1M31 A;  2ZN9 A;  2MRD A;  1OMR A;  1JFJ A;  3BXK A;  3KF9 A;  2OPO A;  3K21 A;  1QTX A;  1CLM A;  2F2P A;  3OX5 A;  2JT8 A;  3D78 A;  1C7V A;  2MHH A;  1YTZ C;  1SK6 D;  4TNC A;  2KNE A;  2PMY A;  5D69 A;  1TN4 A;  1IGV A;  1MF8 B;  3BJH A;  2BKI B;  1E8A A;  2R2I A;  1HT9 A;  4YGB B;  3EK8 A;  5AEQ A;  2I7A A;  2EHB A;  3CR5 X;  2WCE A;  3D0Y A;  1DMO A;  1Q80 A;  2LHL A;  1YUR A;  3DVM A;  1QX2 A;  4XYN A;  5D7F A;  3VRQ A;  2KAY A;  3R1V A;  3B6X A;  2LLU A;  2L98 A;  1JUO A;  2BCB A;  2Y5I A;  1W7J B;  1J7P A;  1IJ6 A;  1LVC D;  2JZI A;  2L4H A;  5F6T A;  4YGE B;  1A29 A;  1V1F A;  2ZRS A;  2LLT A;  2M7N A;  5AXI A;  4CPV A;  1QJT A;  3NXA A;  1C7W A;  3S0D A;  3L47 A;  1PSB A;  1DJY A;  2MA2 A;  4N1F A;  1AP4 A;  4PE7 A;  4YI9 A;  1KFX S;  1M45 A;  2KGR A;  2MAZ A;  1KWO B;  1MXL C;  2YGU A;  1BG1 A;  1JBA A;  3PFV A;  2WOR A;  3BUX B;  1S6I A;  3D74 A;  3EVU A;  1H4B A;  3SG3 A;  1ZOT B;  3VRO A;  2KI6 C;  5HKY A;  2ZRT A;  1KWO C;  1PRW A;  4AOM A;  2K2F A;  1FI6 A;  3WXA A;  3FE9 A;  1XVJ A;  3PN7 B;  1BOD A;  4NDC A;  2HF5 A;  3KHE A;  1BJF A;  2Y1N A;  1MUX A;  1S26 D;  1OOF A;  1SMG A;  1UP5 A;  2O5G A;  1KQM B;  2PVB A;  2P71 A;  2FOT A;  1SY9 A;  3PN7 C;  4OCI A;  1TUJ A;  4WRI A;  2F3Y A;  3VB1 A;  1XO5 A;  5AER A;  4D1E A;  2M3W A;  1AUI B;  3B87 A;  1T14 A;  2D8N A;  1OOH A;  1AK8 A;  5FI2 A;  2KQ6 A;  1AJ5 A;  1M63 B;  1KQM C;  2M97 A;  3PM8 A;  4ICB A;  5CPV A;  1QWV A;  1NSH A;  1IG5 A;  1S5G Y;  1MR8 A;  1UHH A;  1XFV O;  3S0E A;  4FQO A;  2HQ8 A;  1KFU S;  1OOI X;  2KDH A;  1K2H A;  1KCY A;  4DCK A;  3CZT X;  4HSZ A;  4N1G A;  1CDN A;  1CFP A;  1DJX A;  1GM0 A;  5I94 A;  2KYF A;  2I2R E;  1VRK A;  3I5H B;  3DVE A;  3S0G A;  1UUR A;  3PJI A;  3KO0 A;  3IQO A;  2HET A;  4YRU A;  3CZ2 A;  1UUS A;  2JT0 A;  3I5H C;  2ERB A;  3EG5 B;  3D77 A;  3F45 A;  2JQ6 A;  3IVT A;  2KFF A;  4YGD B;  3R72 A;  4MN0 A;  2Y1M A;  3CWG A;  3EKJ A;  1S3P A;  1MHO A;  1RFJ A;  1EH2 A;  3FWB A;  3BFH A;  2L2E A;  3WHT B;  2G2B A;  1A2X A;  5DIC A;  3PAL A;  1UHI A;  2LUC A;  2NZ0 A;  4F7F A;  3I5G B;  5I8N A;  1D1O A;  1YX7 A;  1B4C A;  3SG4 A;  1KK7 Z;  3IQQ A;  4PE4 A;  2BCA A;  1LIN A;  1ODB A;  2DOQ A;  5HYD A;  2KBI A;  1FPW A;  3TUY B;  1CFC A;  2WCK A;  1JF0 A;  3I5G C;  1BLQ A;  1TIZ A;  3VRN A;  1W7I B;  2LMT A;  4ZCU A;  1JWD A;  2GGM A;  1F71 A;  1SBJ A;  3TUY C;  1CDM A;  5G08 A;  1WRL A;  4A4B A;  1J7Q A;  1SCV A;  1AVS A;  2LV7 A;  2P6B B;  4HRE E;  4Q04 A;  1BOC A;  1OMV A;  2JRF A;  3L4A A;  4KYN A;  2LNK A;  2ZND A;  1QXP A;  2EC6 B;  5HKZ A;  2K7O A;  3OBV A;  2K8M B;  1WDC B;  1QS7 A;  4L9M A;  1CFD A;  3BQ3 A;  4ORC B;  1B8L A;  4N5X A;  4USL A;  2EC6 C;  4WQ3 A;  2VRG A;  1NCX A;  1WDC C;  5ER4 X;  3CR4 X;  1ALW A;  1LS8 A;  1QX7 A;  3DVJ A;  4BY5 A;  1JC2 A;  1J7R A;  1GJY A;  2BKH B;  2WC8 A;  5FI7 A;  4GBA A;  1NCZ A;  3WHU B;  5GQQ C;  1NPQ A;  3BUO B;  3PSR A;  2KI4 B;  3DVK A;  4JPZ B;  1TRF A;  5FYX A;  2MLF C;  1A4P A;  4NDD A;  1PVB A;  2L0P A;  1CDL A;  1NUB A;  2AAO A;  2KI4 C;  3D10 A;  1QAT A;  2BAP A;  4ZCV A;  5I2Q A;  1CMG A;  4I5J A;  2JU0 A;  1G33 A;  4JWQ A;  1TCO B;  1G4Y R;  1DVI A;  3RM1 A;  3JTD B;  1PAL A;  4GAO A;  1IIO A;  1ALV A;  3OX6 A;  1K9K A;  1IRJ A;  2A4J A;  1GGW A;  4DUQ A;  1TNX A;  1B47 A;  4OVN F;  1CMF A;  1LA0 A;  1C07 A;  3DXL A;  1XFY O;  2B1U A;  2L50 A;  4M2Q A;  4QJ4 B;  3RZS A;  2QAC A;  1TWO A;  4M2O A;  3VGO A;  3SIA A;  1QV1 A;  1Y1A A;  2ISD A;  1NX1 A;  1NX0 A;  3TDU A;  1BR4 B;  1XK4 A;  3BOW B;  2KBM A;  3TDI A;  4C0L A;  4MLW A;  3D73 A;  5KTY A;  2FCD A;  2KYC A;  2WOS A;  1GGZ A;  1N2D A;  3NHT A;  4R1E A;  1KQV A;  4HRG A;  3ZNI A;  1HQV A;  2WCL A;  2JNF A;  2KHN A;  3LK0 A;  2NCO A;  3EVR A;  1F4O A;  1QIV A;  1RWY A;  1YUS A;  2TN4 A;  2E30 A;  1YUT A;  1QLK A;  4YGC B;  2M1K B;  3CDN A;  4YBH B;  1OQP A;  1P28 A;  5K89 A;  2P70 A;  1S6C A;  3FWC A;  4A4C A;  1YUU A;  4F0Z B;  1WY9 A;  2E6W A;  3O2P A;  2BEC A;  4FQT A;  1F4Q A;  4GUK A;  2RGI A;  5D3O A;  1B8C A;  1DJZ A;  2JC2 A;  2JWW A;  1TUZ A;  1L2O B;  2AMI A;  3DY9 A;  3SG6 A;  2LLS A;  3Q8I A;  4INX A;  2QEV A;  2JPT A;  1S1E A;  2KFG A;  2Q91 A;  2LVK A;  1DEK A;  2CBL A;  1L2O C;  1JSA A;  4QJ5 B; 
#chains in the Genus database with same CATH homology
 1UHN A;  1XFU O;  3BOW A;  2LMU A;  2JXC A;  3NSI A;  1MQ1 A;  5ER5 A;  1GQM A;  1FI5 A;  3TS5 B;  2EGD A;  3I5F B;  1K90 D;  1XFW O;  4DRW A;  1QVI Z;  3CR2 A;  5CSI A;  5JJG A;  3ICB A;  2M8U A;  5DKR A;  1DJH A;  3TS5 C;  3I5F C;  1DT7 B;  1DJW A;  2I18 A;  2L51 A;  1N65 A;  2V53 A;  1REC A;  2K7D A;  2L4I A;  1SPY A;  1IH0 A;  2NLN A;  1QLS A;  4MZK A;  1KK7 Y;  1MXE A;  3AAJ A;  1K8U A;  4CID A;  1DGU A;  5I2O A;  1WLM A;  4CFQ A;  2BCX A;  2HQW A;  1EG3 A;  1ZUZ A;  2M1U A;  1K95 A;  2ZFD A;  3NSK A;  4PHN A;  3SG7 A;  5CSJ A;  3TDZ A;  2ZN8 A;  3M0W A;  4PE1 A;  2KI6 D;  5CSN A;  2KOT A;  2K7B A;  4PHJ A;  2QPT A;  2GGZ A;  2COL B;  3CTN A;  2LAN A;  2BL0 B;  4FTG A;  4WQ2 A;  3MSE B;  5IBW A;  5AFP A;  2JOJ A;  4ETO A;  1K9P A;  2GV5 A;  2M0R A;  2BL0 C;  3E3R A;  1PK0 D;  4YI8 A;  1BR1 B;  1CKK A;  1Y1X A;  2K2A A;  3JVT B;  1A75 B;  3SG2 A;  2LMV A;  3O78 A;  1OE9 B;  2M7L A;  2BBN A;  2CNP A;  1ZAC A;  4JQ0 D;  3EK7 A;  1U5I A;  1SCM B;  2JTT A;  3JVT C;  1TNQ A;  1EJ3 A;  1EL4 A;  2L5X B;  1Y0V H;  4BY4 A;  3NSO A;  4P2Y B;  1S6J A;  1SL7 A;  4PDZ A;  1SCM C;  4PHK A;  4PHM A;  3KPX A;  1V1G A;  2LAP A;  3A4U B;  2F33 A;  1SR6 B;  1Y6W A;  4MRX A;  2Y4Q A;  4OV2 A;  1OZS A;  1CLB A;  3IF7 A;  1SR6 C;  4CLN A;  4AQI A;  1KFX L;  5KU1 A;  3LCP C;  1XK4 C;  2PRU A;  4AQJ A;  1CFF A;  1WRZ A;  1UWO A;  3WNX B;  2PAS A;  1LA3 A;  1XFX O;  2LVJ A;  3LL8 B;  1OZO A;  1A75 A;  2LVV A;  2NXQ A;  2LHI A;  3RLZ A;  1EXR A;  1G8I A;  3A8R A;  4DIR A;  2LVI A;  3KEV A;  2JT3 A;  1YR5 A;  1BU3 A;  1OSA A;  1J1E A;  1QAS A;  3BUW B;  1CB1 A;  2F2O A;  1UHK A;  3FS7 A;  1YX8 A;  2K0J A;  3HX4 A;  2G9B A;  3JTD C;  2BE4 A;  3NSL A;  4NDB A;  1AJ4 A;  1BMO A;  4UPG A;  2WND A;  3SJS A;  4XJK A;  1F55 A;  1B8R A;  2F3Z A;  4C0J A;  1JFK A;  1KFU L;  1NX3 A;  2BE6 A;  1B7T Z;  4MZL A;  1SYM A;  1QIW A;  2MLE C;  3GOF A;  5I2L A;  1MWN A;  5B8I B;  3PAT A;  1SKT A;  2LCP A;  3BUM B;  1JF2 A;  3I5I B;  1NX2 A;  4OKH A;  1DF0 B;  2KFH A;  3CS1 A;  3BUN B;  1WLZ A;  1DJI A;  3O6B A;  2LUX A;  4M2P A;  5CSF A;  2PAL A;  5HLO A;  3I5I C;  2JTZ A;  4E68 A;  1NCY A;  4OR9 B;  2M49 B;  1RTP 1;  1CM1 A;  5PAL A;  4GGF C;  1KK8 B;  3EK4 A;  2KGB C;  1CM4 A;  1SRA A;  4I5N B;  5BPJ A;  1IQ5 A;  1SL8 A;  2CCM A;  1K9U A;  2LP2 A;  1KK8 C;  1QVI Y;  1QX5 B;  1PSR A;  1H8B A;  1IWQ A;  2M9G A;  3PLF B;  4PE0 A;  1K96 A;  4MRY A;  2K7C A;  1TCF A;  1SL9 A;  1YVL A;  1B1G A;  1F8H A;  1FW4 A;  2LP3 A;  3QRX A;  3OB2 B;  2MJW B;  2KAV A;  1DJG A;  1TTX A;  1DTL A;  3C1V A;  3ZWH A;  1IJ5 A;  1AHR A;  1S36 A;  2JUL A;  5HLV A;  4U8D A;  2BBM A;  1J55 A;  1RRO A;  4GPL B;  5DKN A;  3VRP A;  1DF0 A;  2OTG B;  3GK1 A;  1EG4 A;  1CDP A;  1PVA A;  4YGA A;  4GGF A;  1CTR A;  3O4Y A;  2OTG C;  4DS7 A;  3CLN A;  1BT6 A;  3GK4 X;  1U5I B;  2CT9 A;  2CTN A;  1YRT B;  4MSP A;  5HKW A;  1LKJ A;  4IL1 A;  2SAS A;  4MZJ A;  1M46 A;  2WCB A;  3DF0 B;  3GK2 A;  4ORA B;  1IKU A;  5KSZ A;  3LLE A;  3DD4 A;  2SCP A;  1X02 A;  3VRR A;  2FJU B;  3SIB A;  1N0Y A;  1R6P A;  1R2U A;  2KAX A;  3OP0 A;  4MBE A;  3SG5 A;  3CGA A;  3AKA A;  4MEW A;  2JNX A;  1S5G Z;  4CFR A;  2LE9 B;  4PCW A;  1KSM A;  3OB1 B;  4HRH A;  1PUL A;  1QV0 A;  1ZMZ A;  1YVH A;  5DKQ A;  2NCP A;  1CNP A;  2M29 A;  2LC5 A;  5J3X A;  2CXJ A;  3TZ1 A;  1FF1 A;  3BYA A;  3AAK A;  5TNC A;  1OOJ A;  4MVF A;  1K94 A;  1NWD A;  3AKB A;  3DF0 A;  3FIA A;  3HCM A;  1RK9 A;  1SW8 A;  5AAN A;  1A03 A;  1L7Z A;  2OS8 B;  1FBV A;  4XJK B;  2F8P A;  2IS9 A;  1CLL A;  2H61 C;  4GNK B;  2JXL A;  1UHJ A;  3EKH A;  1TNP A;  4GFT A;  5JOL A;  1NP8 A;  2OS8 C;  1YRU B;  2PSR A;  1XFZ O;  1SNL A;  2HPS A;  1DGV A;  4I5L B;  4ORB B;  1J1D A;  2AUC A;  2ZNE A;  2I94 A;  2ZKM X;  3H4S E;  4GGN A;  1F70 A;  4I5K A;  4QJ3 B;  2K61 A;  1NYA A;  4P5O E;  1F54 A;  4PAL A;  1XYD A;  3D0Y B;  1NIW A;  2KQY A;  1B9A A;  1B7T Y;  1OMD A;  2O60 A;  1TNW A;  1IQ3 A;  1TOP A;  2Q4U A;  2WCF A;  1M39 A;  2KSP A;  2MBX A;  1XA5 A;  2H2K A;  4NQG A;  3OHM B;  1WRK A;  1RJV A;  1ZFS A;  3LK1 A;  2H61 A;  3EVV A;  4C0K A;  1LXF C;  2LM5 A;  1J7O A;  2FCE A;  1BF5 A;  1Y1U A;  1K93 D;  1KSO A;  1M31 A;  2ZN9 A;  2MRD A;  1OMR A;  1JFJ A;  3BXK A;  3KF9 A;  2OPO A;  3K21 A;  1QTX A;  1CLM A;  2F2P A;  3OX5 A;  2JT8 A;  1C7V A;  2MHH A;  1YTZ C;  1SK6 D;  4TNC A;  2KNE A;  2PMY A;  5D69 A;  1TN4 A;  1IGV A;  1MF8 B;  2BKI B;  1E8A A;  2R2I A;  1HT9 A;  4YGB B;  3EK8 A;  5AEQ A;  2I7A A;  2EHB A;  3CR5 X;  2WCE A;  3D0Y A;  1DMO A;  1Q80 A;  2LHL A;  1YUR A;  3DVM A;  1QX2 A;  4XYN A;  5D7F A;  3VRQ A;  2KAY A;  2LLU A;  2L98 A;  1JUO A;  2BCB A;  2Y5I A;  1W7J B;  1J7P A;  1IJ6 A;  1LVC D;  2JZI A;  2L4H A;  5F6T A;  4YGE B;  1A29 A;  1V1F A;  2ZRS A;  2LLT A;  2M7N A;  5AXI A;  4CPV A;  1QJT A;  3NXA A;  1C7W A;  4YRU A;  1PSB A;  1DJY A;  2MA2 A;  4N1F A;  1AP4 A;  4PE7 A;  4YI9 A;  1KFX S;  1M45 A;  2KGR A;  2MAZ A;  1KWO B;  1MXL C;  1BG1 A;  1JBA A;  3PFV A;  2WOR A;  3BUX B;  1S6I A;  3EVU A;  1H4B A;  3SG3 A;  1ZOT B;  3VRO A;  2KI6 C;  5HKY A;  2ZRT A;  1KWO C;  1PRW A;  4AOM A;  2K2F A;  1FI6 A;  3WXA A;  1BOD A;  1XVJ A;  3PN7 B;  4NDC A;  2HF5 A;  3KHE A;  1BJF A;  2Y1N A;  1MUX A;  1S26 D;  1SMG A;  1UP5 A;  2O5G A;  1KQM B;  2PVB A;  2FOT A;  1SY9 A;  3PN7 C;  4OCI A;  4WRI A;  5AER A;  2F3Y A;  1XO5 A;  4D1E A;  2M3W A;  1AUI B;  2D8N A;  1AK8 A;  2KQ6 A;  1AJ5 A;  1M63 B;  1KQM C;  2M97 A;  3PM8 A;  4ICB A;  5CPV A;  1NSH A;  1IG5 A;  1S5G Y;  1MR8 A;  1UHH A;  1XFV O;  4FQO A;  2HQ8 A;  1KFU S;  2KDH A;  1K2H A;  1KCY A;  4DCK A;  3CZT X;  4HSZ A;  4N1G A;  1CDN A;  1CFP A;  1DJX A;  2KYF A;  2I2R E;  1VRK A;  3I5H B;  3DVE A;  1UUR A;  3KO0 A;  3IQO A;  2HET A;  1UUS A;  2JT0 A;  3I5H C;  3F45 A;  2JQ6 A;  2KFF A;  4YGD B;  4MN0 A;  2Y1M A;  3CWG A;  3EKJ A;  1S3P A;  1MHO A;  1RFJ A;  1EH2 A;  3FWB A;  3WHT B;  2L2E A;  2G2B A;  1A2X A;  3PAL A;  1UHI A;  2LUC A;  2NZ0 A;  3I5G B;  5I8N A;  1D1O A;  1YX7 A;  1B4C A;  3SG4 A;  1KK7 Z;  3IQQ A;  4PE4 A;  2BCA A;  1LIN A;  1ODB A;  2DOQ A;  5HYD A;  2KBI A;  1FPW A;  3TUY B;  1CFC A;  3I5G C;  1JF0 A;  1BLQ A;  1TIZ A;  3VRN A;  1W7I B;  2LMT A;  4ZCU A;  1JWD A;  2GGM A;  1F71 A;  1SBJ A;  3TUY C;  1CDM A;  5G08 A;  1WRL A;  4A4B A;  1J7Q A;  1SCV A;  1AVS A;  2LV7 A;  2P6B B;  4HRE E;  4Q04 A;  1BOC A;  1OMV A;  2JRF A;  2LNK A;  2ZND A;  1QXP A;  2EC6 B;  5HKZ A;  2K7O A;  2K8M B;  1WDC B;  1QS7 A;  4L9M A;  1CFD A;  3BQ3 A;  4ORC B;  1B8L A;  4N5X A;  4USL A;  2EC6 C;  4WQ3 A;  2VRG A;  1NCX A;  1WDC C;  5ER4 X;  3CR4 X;  1ALW A;  1QX7 A;  3DVJ A;  4BY5 A;  1JC2 A;  1J7R A;  1GJY A;  2BKH B;  2WC8 A;  4GBA A;  1NCZ A;  3WHU B;  5GQQ C;  1NPQ A;  3BUO B;  3PSR A;  2KI4 B;  3DVK A;  4JPZ B;  1TRF A;  5FYX A;  2MLF C;  1A4P A;  4NDD A;  1PVB A;  2L0P A;  1CDL A;  1NUB A;  2AAO A;  2KI4 C;  3D10 A;  1QAT A;  4ZCV A;  5I2Q A;  1CMG A;  4I5J A;  2JU0 A;  1G33 A;  4JWQ A;  1TCO B;  1G4Y R;  1DVI A;  3RM1 A;  3JTD B;  1PAL A;  4GAO A;  1ALV A;  3OX6 A;  1K9K A;  1IRJ A;  2A4J A;  1GGW A;  4DUQ A;  1TNX A;  1B47 A;  4OVN F;  1CMF A;  1LA0 A;  1C07 A;  1XFY O;  2B1U A;  2L50 A;  4M2Q A;  4QJ4 B;  2QAC A;  4M2O A;  3VGO A;  3SIA A;  1QV1 A;  1Y1A A;  2ISD A;  1NX1 A;  1NX0 A;  3TDU A;  1BR4 B;  1XK4 A;  3BOW B;  2KBM A;  3TDI A;  4C0L A;  4MLW A;  5KTY A;  2FCD A;  2KYC A;  2WOS A;  1GGZ A;  1N2D A;  4R1E A;  1KQV A;  4HRG A;  3ZNI A;  1HQV A;  2JNF A;  2KHN A;  3LK0 A;  2NCO A;  3EVR A;  1F4O A;  1QIV A;  1RWY A;  1YUS A;  2TN4 A;  2E30 A;  1YUT A;  1QLK A;  4YGC B;  2M1K B;  4YBH B;  1OQP A;  5K89 A;  1S6C A;  3FWC A;  4A4C A;  1YUU A;  4F0Z B;  1WY9 A;  2E6W A;  3O2P A;  2BEC A;  1F4Q A;  4GUK A;  2RGI A;  1B8C A;  1DJZ A;  2JC2 A;  2JWW A;  1L2O B;  2AMI A;  3SG6 A;  2LLS A;  2JPT A;  1S1E A;  2KFG A;  2Q91 A;  2LVK A;  2CBL A;  1L2O C;  1JSA A;  4QJ5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...