2MAZA

Backbone 1h, 13c, and 15n chemical shift assignments for bovine apo calbindin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
75
structure length
75
Chain Sequence
b'KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGMSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-G
publication title Prot3DNMR: A Simple and Swift NMR Strategy for Three-Dimensional Structure Determination of Proteins
rcsb
source organism Bos taurus
molecule tags Metal binding protein
total genus 22
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2013-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2mazA00
1Y1AA 4JQ0D 1BR1B 4P2YB 5CSJA 2KNEA 3OB1B 1YTZC 1QX5B 1JBAA 3TS5C 4N1GA 1FI6A 1ALVA 2L0PA 2F33A 5DKQA 1A75A 3LK1A 4ZCVA 1TCFA 2OS8C 4CIDA 1LXFC 2L2EA 3CR5X 1KQVA 2OTGC 2M3WA 1SK6D 1CDLA 1QX2A 3I5GC 1C07A 3DD4A 3KEVA 1SPYA 1H4BA 3CR2A 3M0WA 1DF0A 1S3PA 1MXLC 5KTYA 1S36A 2KI4B 3JTDB 5K89A 1SYMA 2LHIA 4YGBB 1EG3A 2AUCA 2LUXA 3BUOB 2F2OA 2KDHA 3PALA 1FW4A 1Y1XA 1N65A 1BR4B 1Y6WA 1OQPA 3O78A 5DKRA 3OB2B 4DS7A 1W7JB 1IJ6A 1QIVA 1OSAA 2P6BB 4GNKB 1QVIY 1YUTA 2BBMA 2BKHB 5AEQA 2VRGA 4BY5A 1ZACA 4F0ZB 1EH2A 1SR6B 2JWWA 1SKTA 2CT9A 2LCPA 1MF8B 1RTP1 3OP0A 3ZWHA 1F4QA 5KU1A 2HPSA 3WXAA 1EXRA 2COLB 4FTGA 1R2UA 1VRKA 1DTLA 3EK8A 3WHUB 1LA3A 2LMTA 4C0JA 2QACA 1UWOA 1AUIB 1K9UA 2L51A 2M0RA 2JTZA 2LLSA 3NSLA 2TN4A 4L9MA 1SRAA 2MA2A 5FYXA 2BKIB 4ORCB 3SG2A 5AXIA 1DMOA 1KSMA 1YVHA 2FOTA 3BOWA 3TDUA 1L2OC 1RECA 1ODBA 1SY9A 3I5HB 1TN4A 1DJIA 1SNLA 2ZNEA 1CNPA 1MUXA 1LKJA 5HLOA 1CDPA 1CMGA 4JPZB 1A4PA 1GQMA 3D0YA 2BCAA 2BL0B 3NSOA 1UURA 4N5XA 2Y1MA 1KWOB 2KYFA 3VRNA 4JWQA 5DKNA 2K2FA 4CLNA 2LVJA 2MAZA 2G9BA 4GBAA 1NP8A 2M9GA 4QJ5B 2JTTA 1OMVA 1NPQA 1IG5A 1K9PA 2JC2A 1DJXA 2JNXA 3GK1A 5TNCA 4MBEA 4PDZA 1QX7A 5I2OA 1QASA 3GOFA 3EK4A 1DJYA 1A29A 1J55A 1IH0A 1WDCB 4AQIA 2M7NA 2ZNDA 4PHKA 2K7BA 2OTGB 3H4SE 1BLQA 3BUWB 1M31A 3I5GB 2JQ6A 2JT3A 2ISDA 3K21A 3FIAA 1K9KA 1X02A 1JF0A 1PULA 3BQ3A 3GK2A 3DVMA 2JNFA 3NXAA 3BOWB 1DGVA 4PHJA 1E8AA 1YR5A 2KAVA 4P5OE 2M97A 5CSNA 2PVBA 2LE9B 1KFUS 3AAKA 2E6WA 1NUBA 2IS9A 3TZ1A 1BF5A 1M46A 3VRRA 1F70A 1PK0D 1D1OA 1YRUB 1BMOA 1GJYA 1KFUL 3BUXB 4MZJA 4NQGA 1TNXA 4OCIA 1BG1A 3EKJA 3I5FC 3VRQA 1KQMB 2BCXA 1KK8B 3SIAA 1MQ1A 5BPJA 2LV7A 1EJ3A 1DVIA 2FCDA 4C0LA 2WCFA 3SIBA 1XK4A 2GGMA 4HRGA 2ZRTA 2K0JA 3FWBA 1RJVA 3RLZA 1UUSA 2MJWB 3A8RA 2F8PA 1UHHA 4A4CA 1JSAA 1CDNA 1KCYA 1KSOA 2NCOA 1SL9A 3PSRA 1PSRA 1SCMC 2MLFC 2ZFDA 4Q04A 4GAOA 2Y4QA 5KSZA 1CM1A 2SASA 1BT6A 2MLEC 1HT9A 2BE4A 2NLNA 4FQOA 5JOLA 1RFJA 4YGAA 2LVIA 1NCYA 2PMYA 2LNKA 3VRPA 1BOCA 2V53A 1YURA 4GGFA 5HKZA 1B7TY 2SCPA 1IRJA 4HSZA 1QS7A 1ALWA 1OMRA 2L98A 1KK7Z 1TNWA 4DRWA 2KOTA 2K61A 2MBXA 1SMGA 4OR9B 1FI5A 1S1EA 2R2IA 4MLWA 1CFCA 1SL8A 1S5GZ 2LVVA 4UPGA 1AJ5A 1B47A 3SG5A 2A4JA 1K96A 3VROA 2O5GA 1RROA 2ZN9A 3D10A 4MZLA 4I5NB 2I94A 4YRUA 5AFPA 3DF0B 4PCWA 1W7IB 5J3XA 3TDZA 2EC6C 1PVBA 1CLBA 4PE7A 1WRLA 1DJZA 4GPLB 4YGDB 2LLUA 2KAXA 1Y1UA 5D7FA 1XA5A 5HLVA 2PSRA 1OZSA 3KHEA 2PALA 3LLEA 5I8NA 4XJKB 2CNPA 2D8NA 2FJUB 3ICBA 1V1FA 2KFHA 5GQQC 3AKBA 3EKHA 1MXEA 2K8MB 2ZRSA 3FS7A 3ZNIA 1AK8A 1A2XA 1TTXA 1NCXA 1YRTB 2K2AA 2Y5IA 2O60A 3I5IB 2AMIA 3EVVA 1CTRA 4MSPA 3KF9A 3SG7A 2M29A 1J1DA 1LA0A 2G2BA 2K7DA 2KGBC 2KBIA 2WOSA 2CCMA 2LAPA 1S6CA 1XO5A 1JFKA 1F4OA 1TCOB 3BUNB 3JVTB 2K7CA 1UHKA 3I5FB 3BYAA 2BCBA 1QLKA 2BECA 1JF2A 2KAYA 1IKUA 2JPTA 3CS1A 4PHMA 3CR4X 2L5XB 2KHNA 3BUMB 2JXCA 1J7PA 3CTNA 1PRWA 4M2QA 4NDBA 2MHHA 4IL1A 3LL8B 1NCZA 1AVSA 1QVIZ 1SCVA 2LP3A 1J1EA 3TUYC 4NDDA 2F2PA 1EG4A 2I18A 1UP5A 2L4IA 3C1VA 2EGDA 3TS5B 1SCMB 1SL7A 2DOQA 1DJWA 1DGUA 2JOJA 3HCMA 3OHMB 4MVFA 2HQWA 2JRFA 4C0KA 2LVKA 1G8IA 4BY4A 2OS8B 1JUOA 1M39A 2BE6A 1JFJA 4MZKA 3NSKA 1OOJA 1K94A 1CLLA 2JULA 2Q91A 1PVAA 1AJ4A 4XYNA 1CFDA 4WRIA 2H2KA 4QJ4B 1OMDA 1IQ3A 2H61C 2F3YA 4R1EA 2I7AA 1TNPA 2F3ZA 1TOPA 2JU0A 5G08A 1Y0VH 1F71A 5HKWA 2OPOA 4HREE 4OVNF 1A03A 4PE4A 1JWDA 4YGCB 1IJ5A 2LHLA 1J7RA 4U8DA 5AERA 1NSHA 2HETA 1CDMA 4I5KA 1BODA 5HKYA 1NX1A 2LP2A 4D1EA 2JZIA 5CPVA 4DCKA 4I5JA 1YX8A 3DVKA 4MN0A 4WQ2A 1CB1A 4CPVA 4NDCA 5F6TA 1BJFA 3CWGA 3DF0A 1B1GA 1SW8A 1CMFA 2M49B 1AP4A 4AQJA 1KK7Y 3WHTB 3E3RA 2M8UA 3PM8A 5IBWA 1H8BA 1OZOA 1J7QA 4XJKA 2LMUA 1XFZO 3I5HC 1XFYO 1B8CA 4N1FA 1NX0A 1J7OA 1L2OB 1R6PA 2B1UA 2M1UA 3QRXA 4YI9A 3PN7C 2M7LA 1K2HA 4ORBB 2EHBA 1WRZA 1XFXO 1CM4A 1IWQA 1UHJA 3KPXA 1QIWA 4HRHA 2WCEA 4OV2A 1AHRA 3SJSA 1OE9B 1QV0A 4ICBA 1LVCD 1F8HA 1MR8A 3SG6A 4DUQA 3WNXB 3IQQA 4PE1A 3TUYB 4ETOA 1C7WA 1GGWA 3PLFB 3O2PA 4GFTA 1WDCC 3NSIA 4TNCA 2WCBA 1U5IB 5B8IB 2CXJA 1YUUA 1SBJA 5HYDA 1PSBA 1LINA 1K8UA 1DT7B 3IF7A 1FF1A 3CGAA 2KI6D 5ER5A 1IGVA 2MRDA 1ZOTB 2WORA 1YVLA 1TRFA 4USLA 1ZMZA 2KQ6A 2KYCA 4PHNA 1C7VA 3AKAA 1B9AA 3TDIA 5I2LA 2CTNA 3CLNA 1MHOA 2KQYA 2LUCA 1QXPA 1NIWA 3CZTX 2K7OA 2ZN8A 3KO0A 1B8RA 1WLZA 4ORAB 3DVJA 2BBNA 2HF5A 1FBVA 1RWYA 2KGRA 1XFWO 1S6JA 1QLSA 3BXKA 2JT0A 1QJTA 1Q80A 4ZCUA 1B7TZ 1KQMC 1TNQA 3FWCA 1KK8C 2AAOA 4MRXA 1WLMA 2RGIA 4WQ3A 1L7ZA 2L50A 4GUKA 1WY9A 4MEWA 1M45A 1UHIA 3SG3A 1S26D 2GGZA 2HQ8A 5CSFA 1A75B 2JT8A 1DJGA 1KFXS 1M63B 3SG4A 3O6BA 1BU3A 1WRKA 1NYAA 2M1KB 1V1GA 3EVRA 2LLTA 1K93D 2NCPA 3GK4X 1KFXL 1CLMA 4I5LB 3AAJA 3EVUA 4PALA 3RM1A 1DF0B 2LANA 3PN7B 3F45A 5CSIA 4GGNA 1B4CA 5D69A 1YX7A 5JJGA 4YGEB 1ZFSA 2WC8A 2NXQA 1B8LA 1G4YR 4M2OA 1K90D 2KI4C 2LMVA 3JTDC 1DJHA 1G33A 2NZ0A 1XYDA 2JXLA 3MSEB 3EK7A 1XFUO 1TIZA 2WNDA 3OX6A 3IQOA 5AANA 2LM5A 5PALA 1QV1A 1ZUZA 1SR6C 1IQ5A 4M2PA 4PE0A 2GV5A 4YI8A 1CKKA 1RK9A 1HQVA 2PRUA 1N2DA 3DVEA 1PALA 4MRYA 2EC6B 1XK4C 2Y1NA 3HX4A 4OKHA 2E30A 3PFVA 1U5IA 1MWNA 2CBLA 4AOMA 2KBMA 4YBHB 1NX2A 4CFQA 1XVJA 2I2RE 3VGOA 4CFRA 1GGZA 4QJ3B 1S6IA 2FCEA 2KFGA 3I5IC 5ER4X 1F54A 3A4UB 4DIRA 2KFFA 2KSPA 2PASA 2KI6C 2Q4UA 1S5GY 2H61A 2QPTA 3LK0A 3OX5A 3D0YB 4GGFC 1NX3A 1JC2A 3LCPC 1FPWA 1EL4A 3JVTC 1K95A 3O4YA 2LC5A 1N0YA 4A4BA 1F55A 1NWDA 2BL0C 1CFPA 4E68A 1UHNA 2L4HA 3PATA 1XFVO 1KWOC 5I2QA 2ZKMX 1QATA 1CFFA 1QTXA 1YUSA
chains in the Genus database with same CATH superfamily
1Y1AA 4JQ0D 1BR1B 4P2YB 5CSJA 2KNEA 3OB1B 1YTZC 1QX5B 3CZ0A 3TS5C 1JBAA 4N1GA 1FI6A 1ALVA 2L0PA 2F33A 5DKQA 1A75A 3LK1A 2QEVA 4ZCVA 1TCFA 2OS8C 4CIDA 1LXFC 3NHTA 2L2EA 2ERBA 3CR5X 1KQVA 2OTGC 2M3WA 1SK6D 2PYQA 1CDLA 1QX2A 3D74A 3I5GC 1C07A 3DD4A 3KEVA 1SPYA 1H4BA 3CR2A 3M0WA 1DF0A 1S3PA 1MXLC 5KTYA 1S36A 2KI4B 3B6XA 3JTDB 5K89A 1SYMA 2LHIA 1OOGA 4YGBB 1EG3A 2AUCA 2LUXA 3BUOB 2F2OA 2KDHA 3PALA 1FW4A 1Y1XA 1N65A 3BJHA 5FI6A 1BR4B 1Y6WA 1OQPA 3O78A 5DKRA 3OB2B 4DS7A 1W7JB 1IJ6A 1QIVA 1OSAA 1TWOA 2P6BB 1QVIY 1YUTA 2BBMA 2BKHB 4GNKB 1T14A 2VRGA 1ZACA 4BY5A 4F0ZB 1SR6B 2JWWA 1SKTA 3V2LA 2CT9A 2LCPA 1EH2A 3R1OA 1MF8B 1RTP1 3OP0A 3ZWHA 1F4QA 1GM0A 5KU1A 2HPSA 3WXAA 1ORGA 1EXRA 2COLB 2QDIA 4KYNA 4FTGA 1R2UA 1VRKA 1DTLA 3EK8A 3S0DA 3WHUB 1LA3A 2LMTA 4C0JA 2QACA 1UWOA 1AUIB 1K9UA 2L51A 2M0RA 2JTZA 2LLSA 3NSLA 2TN4A 4L9MA 1SRAA 2MA2A 5FYXA 2BKIB 4ORCB 3SG2A 5AXIA 1DMOA 1KSMA 1YVHA 2FOTA 2P70A 3BOWA 3S0EA 3TDUA 1L2OC 1RECA 1ODBA 1SY9A 3I5HB 1TN4A 1DJIA 1SNLA 2ZNEA 1CNPA 1MUXA 1LKJA 5HLOA 1CDPA 3S0BA 3DY9A 1CMGA 4JPZB 1A4PA 1GQMA 3D77A 3D0YA 2BCAA 2BL0B 3NSOA 3RZSA 1UURA 4N5XA 2WCJA 2WC6A 2Y1MA 1KWOB 2KYFA 3VRNA 4JWQA 5DKNA 2K2FA 4CLNA 2LVJA 2MAZA 2G9BA 4GBAA 1NP8A 2M9GA 4QJ5B 2JTTA 1OMVA 1NPQA 1IG5A 1K9PA 2JC2A 1DJXA 2JNXA 3D78A 3GK1A 5TNCA 4MBEA 4PDZA 1QX7A 5I2OA 1QASA 3SS4A 3GOFA 3O4XA 3EK4A 1DJYA 1A29A 1J55A 1IH0A 1WDCB 4AQIA 2M7NA 5FI2A 2ZNDA 4FQTA 4IJ7A 4PHKA 2K7BA 2OTGB 3H4SE 1BLQA 3BUWB 3B88A 1M31A 3I5GB 2JQ6A 2JT3A 2ISDA 2KPHA 3K21A 3FIAA 1K9KA 1X02A 1JF0A 1W9ZA 1PULA 3BQ3A 3GK2A 3DVMA 2JNFA 3NXAA 3BOWB 1DGVA 3CZ2A 4INXA 4PHJA 1E8AA 1YR5A 1TUZA 2KAVA 4P5OE 2M97A 5CSNA 3L4LA 2PVBA 2LE9B 1KFUS 3AAKA 2E6WA 1NUBA 2IS9A 3TZ1A 4INWA 1BF5A 1OOHA 1M46A 3K1EA 3VRRA 1F70A 1PK0D 1D1OA 1YRUB 1BMOA 1GJYA 1KFUL 3BUXB 4MZJA 4NQGA 1TNXA 4OCIA 1BG1A 3EKJA 3I5FC 3VRQA 1KQMB 2BCXA 2KLDA 1KK8B 3SIAA 1MQ1A 5BPJA 2LV7A 1EJ3A 2KLEA 1DVIA 2FCDA 4C0LA 2WCFA 3SIBA 1XK4A 2GGMA 4HRGA 2ZRTA 2K0JA 3FWBA 1RJVA 3RLZA 1UUSA 2MJWB 3A8RA 2F8PA 1UHHA 4A4CA 1JSAA 1CDNA 1KCYA 1KSOA 2NCOA 1SL9A 3PSRA 1PSRA 1SCMC 2MLFC 2ZFDA 4Q04A 4GAOA 2QEOA 2Y4QA 5KSZA 1CM1A 2SASA 1BT6A 2MLEC 1HT9A 2BE4A 2NLNA 4FQOA 5JOLA 1RFJA 4YGAA 2LVIA 1NCYA 1P28A 2LNKA 2PMYA 3VRPA 2V53A 1YURA 1BOCA 4GGFA 5HKZA 1B7TY 2SCPA 1IRJA 4HSZA 1QS7A 1ALWA 1OMRA 2L98A 1KK7Z 1TNWA 4DRWA 2KOTA 2K61A 2MBXA 1SMGA 4OR9B 1DELA 1FI5A 1S1EA 2R2IA 4MLWA 1CFCA 1SL8A 1S5GZ 2LVVA 4UPGA 1AJ5A 1B47A 3SG5A 2A4JA 1K96A 3VROA 1C3YA 2O5GA 1RROA 2ZN9A 3D10A 3CYZA 3BFHA 3R1PA 4I5NB 2I94A 4MZLA 3SS5A 2WCKA 4YRUA 5AFPA 3FE9A 3DF0B 4PCWA 1W7IB 5J3XA 3TDZA 2EC6C 3PM2A 3S0AA 1PVBA 1CLBA 4PE7A 1WRLA 1DJZA 4GPLB 4YGDB 2LLUA 2KAXA 1Y1UA 5D7FA 1XA5A 5HLVA 2PSRA 1OZSA 3KHEA 2PALA 3LLEA 5I8NA 4XJKB 2CNPA 2D8NA 2FJUB 3ICBA 1V1FA 3EG5B 2KFHA 5GQQC 3BFAA 3VB1A 2FJYA 3AKBA 3EKHA 1MXEA 2K8MB 2P71A 2ZRSA 3FS7A 3ZNIA 1AK8A 1A2XA 1TTXA 1NCXA 1YRTB 2K2AA 2Y5IA 2O60A 3CABA 2AMIA 3I5IB 3EVVA 1CTRA 4MSPA 3KF9A 3SG7A 2M29A 1J1DA 1LA0A 2G2BA 2K7DA 2KGBC 2KBIA 2WOSA 5DICA 2CCMA 2LAPA 1S6CA 1XO5A 1JFKA 1F4OA 1TCOB 3BUNB 3JVTB 2K7CA 1UHKA 3I5FB 3BYAA 3D75A 2BCBA 1QLKA 2BECA 1JF2A 2KAYA 5AEQA 1IKUA 2JPTA 3CS1A 4PHMA 3CR4X 2L5XB 2KHNA 3BUMB 2JXCA 1J7PA 3CTNA 1PRWA 4M2QA 4NDBA 2MHHA 2QEBA 3LL8B 2PQLA 4IL1A 3S0FA 1NCZA 5HL1A 1AVSA 1QVIZ 1SCVA 2LP3A 1J1EA 3TUYC 4NDDA 2F2PA 1EG4A 2I18A 1UP5A 2L4IA 3C1VA 2EGDA 3BFBA 3FE8A 1SCMB 1SL7A 3TS5B 2L2CA 2DOQA 1DJWA 3DYEA 3L4AA 1DGUA 2JOJA 3HCMA 3OHMB 4MVFA 2HQWA 2JRFA 4C0KA 2LVKA 1G8IA 3QMEA 4BY4A 2OS8B 1QWVA 1JUOA 1M39A 1SSEB 2BE6A 1JFJA 4MZKA 3NSKA 1OOJA 1K94A 1CLLA 2JULA 2Q91A 1PVAA 1AJ4A 4XYNA 1CFDA 4WRIA 2H2KA 4QJ4B 1OMDA 1TUJA 2H61C 2F3YA 4R1EA 2I7AA 1IQ3A 1TNPA 2F3ZA 1TOPA 2JU0A 5G08A 1Y0VH 1F71A 5HKWA 2OPOA 4HREE 4OVNF 4JD9A 1A03A 4PE4A 2GTEA 1JWDA 4YGCB 1IJ5A 1OW4A 2LHLA 1J7RA 4U8DA 5AERA 1NSHA 2HETA 1CDMA 4I5KA 1BODA 5HKYA 1NX1A 2LP2A 4D1EA 2JZIA 5CPVA 4DCKA 4I5JA 3DZTA 1YX8A 3DVKA 4MN0A 4WQ2A 1CB1A 4CPVA 4NDCA 5F6TA 2JPOA 1BJFA 3CWGA 3DF0A 1B1GA 1SW8A 1CMFA 2M49B 1AP4A 4AQJA 1KK7Y 3WHTB 5EL2A 3E3RA 2M8UA 2L5YA 3PM8A 5IBWA 1H8BA 1OZOA 1J7QA 4OZDA 4XJKA 3CZ1A 3D76A 2LMUA 1XFZO 3SS3A 1IIOA 3I5HC 1XFYO 1B8CA 4N1FA 1NX0A 1J7OA 1L2OB 1R6PA 5D3OA 2B1UA 2M1UA 3QRXA 4YI9A 3PN7C 2M7LA 1K2HA 4ORBB 2EHBA 1WRZA 1XFXO 1CM4A 4F7FA 1IWQA 1UHJA 3KPXA 1QIWA 4HRHA 2WCEA 4OV2A 3B86A 3OGNA 1AHRA 3SJSA 1OE9B 1QV0A 4ICBA 1LVCD 1F8HA 1MR8A 3SG6A 4DUQA 3WNXB 3IQQA 4PE1A 3TUYB 4ETOA 1C7WA 1GGWA 3PLFB 3UO9A 3O2PA 4GFTA 1WDCC 3NSIA 4TNCA 2QEHA 1U5IB 2WCBA 5B8IB 2CXJA 2WCHA 1YUUA 1SBJA 5HYDA 1PSBA 1LINA 1K8UA 1DT7B 3IF7A 1FF1A 2WCLA 3NHIA 3CGAA 2KI6D 3OBVA 5ER5A 1IGVA 2MRDA 1ZOTB 2WORA 1YVLA 1TRFA 4USLA 1ZMZA 2KQ6A 2KYCA 4PHNA 1C7VA 2K60A 3AKAA 1B9AA 3TDIA 5I2LA 2CTNA 1C3ZA 2WC5A 3CLNA 3N7HA 1XFRA 1MHOA 2KQYA 2LUCA 1QXPA 1NIWA 3CZTX 2K7OA 2ZN8A 3KO0A 1B8RA 1WLZA 4ORAB 3Q8IA 3DVJA 2BBNA 3L47A 2HF5A 3DXLA 1FBVA 1RWYA 2KGRA 1XFWO 1S6JA 1QLSA 3BXKA 2JT0A 1QJTA 1Q80A 4ZCUA 1B7TZ 1KQMC 1TNQA 2WCMA 1KK8C 2AAOA 3FWCA 1WLMA 2RGIA 4MRXA 4WQ3A 1L7ZA 2L50A 4GUKA 1WY9A 5I94A 4MEWA 1M45A 3R72A 1OOIX 1UHIA 3B7AA 3SG3A 3CDNA 1S26D 1LS8A 2GGZA 2HQ8A 5CSFA 1A75B 2JT8A 1DJGA 1KFXS 1M63B 3FE6A 3O6BA 1BU3A 3SG4A 1WRKA 1NYAA 3UNWA 2M1KB 1V1GA 3EVRA 2LLTA 3S0GA 1K93D 2NCPA 3GK4X 1KFXL 1CLMA 4I5LB 3AAJA 3EVUA 4PALA 3RM1A 1DF0B 2LANA 3PN7B 3F45A 5CSIA 2YGUA 1DQEA 3IVTA 4GGNA 1Z2CB 5D69A 1YX7A 5JJGA 1B4CA 4YGEB 1ZFSA 2WC8A 2NXQA 1B8LA 1G4YR 4M2OA 3B87A 1K90D 2KI4C 2LMVA 3JTDC 1DJHA 1G33A 2NZ0A 1XYDA 2JXLA 3MSEB 1DC1A 3EK7A 1XFUO 1TIZA 2WNDA 3OX6A 3IQOA 3D73A 5AANA 2LM5A 5PALA 1QV1A 1ZUZA 2H8VA 1SR6C 1IQ5A 4M2PA 1Z4HA 4PE0A 1DEKA 2GV5A 4YI8A 1CKKA 1RK9A 1HQVA 2PRUA 1N2DA 3DVEA 1PALA 4MRYA 2EC6B 1XK4C 2Y1NA 3HX4A 4OKHA 2E30A 3PFVA 1U5IA 1MWNA 2CBLA 4AOMA 2KBMA 4YBHB 3NGVA 1NX2A 4CFQA 1XVJA 2I2RE 3VGOA 4CFRA 1GGZA 4QJ3B 1S6IA 2FCEA 2KFGA 3I5IC 1OOFA 4PT1A 5ER4X 1F54A 2BNXA 3A4UB 3PJIA 4DIRA 2KFFA 2KSPA 2PASA 2KI6C 2Q4UA 1S5GY 2H61A 2QPTA 3LK0A 3OX5A 3D0YB 4GGFC 1NX3A 1JC2A 3LCPC 1FPWA 1EL4A 3JVTC 1K95A 3O4YA 2BAPA 2LC5A 1N0YA 4A4BA 4JKTA 1F55A 1NWDA 2BL0C 1CFPA 4E68A 1UHNA 2L4HA 3PATA 1XFVO 1KWOC 3R1VA 5FI7A 5I2QA 2ZKMX 1QATA 1CFFA 1QTXA 1YUSA
chains in the Genus database with same CATH topology
1Y1AA 4JQ0D 1BR1B 4P2YB 5CSJA 2KNEA 3OB1B 1YTZC 1QX5B 1JBAA 3TS5C 4N1GA 1FI6A 1ALVA 2L0PA 2F33A 5DKQA 1A75A 3LK1A 4ZCVA 1TCFA 2OS8C 4CIDA 1LXFC 2L2EA 3CR5X 1KQVA 2OTGC 2M3WA 1SK6D 1CDLA 1QX2A 3I5GC 1C07A 3DD4A 3KEVA 1SPYA 1H4BA 3CR2A 3M0WA 1DF0A 1S3PA 1MXLC 5KTYA 1S36A 2KI4B 3JTDB 5K89A 1SYMA 2LHIA 4YGBB 1EG3A 2AUCA 2LUXA 3BUOB 2F2OA 2KDHA 3PALA 1FW4A 1Y1XA 1N65A 1BR4B 1Y6WA 1OQPA 3O78A 5DKRA 3OB2B 4DS7A 1W7JB 1IJ6A 1QIVA 1OSAA 2P6BB 4GNKB 1QVIY 1YUTA 2BBMA 2BKHB 5AEQA 2VRGA 4BY5A 1ZACA 4F0ZB 1EH2A 1SR6B 2JWWA 1SKTA 2CT9A 2LCPA 1MF8B 1RTP1 3OP0A 3ZWHA 1F4QA 5KU1A 2HPSA 3WXAA 1EXRA 2COLB 4FTGA 1R2UA 1VRKA 1DTLA 3EK8A 3WHUB 1LA3A 2LMTA 4C0JA 2QACA 1UWOA 1AUIB 1K9UA 2L51A 2M0RA 2JTZA 2LLSA 3NSLA 2TN4A 4L9MA 1SRAA 2MA2A 5FYXA 2BKIB 4ORCB 3SG2A 5AXIA 1DMOA 1KSMA 1YVHA 2FOTA 3BOWA 3TDUA 1L2OC 1RECA 1ODBA 1SY9A 3I5HB 1TN4A 1DJIA 1SNLA 2ZNEA 1CNPA 1MUXA 1LKJA 5HLOA 1CDPA 1CMGA 4JPZB 1A4PA 1GQMA 3D0YA 2BCAA 2BL0B 3NSOA 1UURA 4N5XA 2Y1MA 1KWOB 2KYFA 3VRNA 4JWQA 5DKNA 2K2FA 4CLNA 2LVJA 2MAZA 2G9BA 4GBAA 1NP8A 2M9GA 4QJ5B 2JTTA 1OMVA 1NPQA 1IG5A 1K9PA 2JC2A 1DJXA 2JNXA 3GK1A 5TNCA 4MBEA 4PDZA 1QX7A 5I2OA 1QASA 3GOFA 3EK4A 1DJYA 1A29A 1J55A 1IH0A 1WDCB 4AQIA 2M7NA 2ZNDA 4PHKA 2K7BA 2OTGB 3H4SE 1BLQA 3BUWB 1M31A 3I5GB 2JQ6A 2JT3A 2ISDA 3K21A 3FIAA 1K9KA 1X02A 1JF0A 1PULA 3BQ3A 3GK2A 3DVMA 2JNFA 3NXAA 3BOWB 1DGVA 4PHJA 1E8AA 1YR5A 2KAVA 4P5OE 2M97A 5CSNA 2PVBA 2LE9B 1KFUS 3AAKA 2E6WA 1NUBA 2IS9A 3TZ1A 1BF5A 1M46A 3VRRA 1F70A 1PK0D 1D1OA 1YRUB 1BMOA 1GJYA 1KFUL 3BUXB 4MZJA 4NQGA 1TNXA 4OCIA 1BG1A 3EKJA 3I5FC 3VRQA 1KQMB 2BCXA 1KK8B 3SIAA 1MQ1A 5BPJA 2LV7A 1EJ3A 1DVIA 2FCDA 4C0LA 2WCFA 3SIBA 1XK4A 2GGMA 4HRGA 2ZRTA 2K0JA 3FWBA 1RJVA 3RLZA 1UUSA 2MJWB 3A8RA 2F8PA 1UHHA 4A4CA 1JSAA 1CDNA 1KCYA 1KSOA 2NCOA 1SL9A 3PSRA 1PSRA 1SCMC 2MLFC 2ZFDA 4Q04A 4GAOA 2Y4QA 5KSZA 1CM1A 2SASA 1BT6A 2MLEC 1HT9A 2BE4A 2NLNA 4FQOA 5JOLA 1RFJA 4YGAA 2LVIA 1NCYA 2PMYA 2LNKA 3VRPA 1BOCA 2V53A 1YURA 4GGFA 5HKZA 1B7TY 2SCPA 1IRJA 4HSZA 1QS7A 1ALWA 1OMRA 2L98A 1KK7Z 1TNWA 4DRWA 2KOTA 2K61A 2MBXA 1SMGA 4OR9B 1FI5A 1S1EA 2R2IA 4MLWA 1CFCA 1SL8A 1S5GZ 2LVVA 4UPGA 1AJ5A 1B47A 3SG5A 2A4JA 1K96A 3VROA 2O5GA 1RROA 2ZN9A 3D10A 4MZLA 4I5NB 2I94A 4YRUA 5AFPA 3DF0B 4PCWA 1W7IB 5J3XA 3TDZA 2EC6C 1PVBA 1CLBA 4PE7A 1WRLA 1DJZA 4GPLB 4YGDB 2LLUA 2KAXA 1Y1UA 5D7FA 1XA5A 5HLVA 2PSRA 1OZSA 3KHEA 2PALA 3LLEA 5I8NA 4XJKB 2CNPA 2D8NA 2FJUB 3ICBA 1V1FA 2KFHA 5GQQC 3AKBA 3EKHA 1MXEA 2K8MB 2ZRSA 3FS7A 3ZNIA 1AK8A 1A2XA 1TTXA 1NCXA 1YRTB 2K2AA 2Y5IA 2O60A 3I5IB 2AMIA 3EVVA 1CTRA 4MSPA 3KF9A 3SG7A 2M29A 1J1DA 1LA0A 2G2BA 2K7DA 2KGBC 2KBIA 2WOSA 2CCMA 2LAPA 1S6CA 1XO5A 1JFKA 1F4OA 1TCOB 3BUNB 3JVTB 2K7CA 1UHKA 3I5FB 3BYAA 2BCBA 1QLKA 2BECA 1JF2A 2KAYA 1IKUA 2JPTA 3CS1A 4PHMA 3CR4X 2L5XB 2KHNA 3BUMB 2JXCA 1J7PA 3CTNA 1PRWA 4M2QA 4NDBA 2MHHA 4IL1A 3LL8B 1NCZA 1AVSA 1QVIZ 1SCVA 2LP3A 1J1EA 3TUYC 4NDDA 2F2PA 1EG4A 2I18A 1UP5A 2L4IA 3C1VA 2EGDA 3TS5B 1SCMB 1SL7A 2DOQA 1DJWA 1DGUA 2JOJA 3HCMA 3OHMB 4MVFA 2HQWA 2JRFA 4C0KA 2LVKA 1G8IA 4BY4A 2OS8B 1JUOA 1M39A 2BE6A 1JFJA 4MZKA 3NSKA 1OOJA 1K94A 1CLLA 2JULA 2Q91A 1PVAA 1AJ4A 4XYNA 1CFDA 4WRIA 2H2KA 4QJ4B 1OMDA 1IQ3A 2H61C 2F3YA 4R1EA 2I7AA 1TNPA 2F3ZA 1TOPA 2JU0A 5G08A 1Y0VH 1F71A 5HKWA 2OPOA 4HREE 4OVNF 1A03A 4PE4A 1JWDA 4YGCB 1IJ5A 2LHLA 1J7RA 4U8DA 5AERA 1NSHA 2HETA 1CDMA 4I5KA 1BODA 5HKYA 1NX1A 2LP2A 4D1EA 2JZIA 5CPVA 4DCKA 4I5JA 1YX8A 3DVKA 4MN0A 4WQ2A 1CB1A 4CPVA 4NDCA 5F6TA 1BJFA 3CWGA 3DF0A 1B1GA 1SW8A 1CMFA 2M49B 1AP4A 4AQJA 1KK7Y 3WHTB 3E3RA 2M8UA 3PM8A 5IBWA 1H8BA 1OZOA 1J7QA 4XJKA 2LMUA 1XFZO 3I5HC 1XFYO 1B8CA 4N1FA 1NX0A 1J7OA 1L2OB 1R6PA 2B1UA 2M1UA 3QRXA 4YI9A 3PN7C 2M7LA 1K2HA 4ORBB 2EHBA 1WRZA 1XFXO 1CM4A 1IWQA 1UHJA 3KPXA 1QIWA 4HRHA 2WCEA 4OV2A 1AHRA 3SJSA 1OE9B 1QV0A 4ICBA 1LVCD 1F8HA 1MR8A 3SG6A 4DUQA 3WNXB 3IQQA 4PE1A 3TUYB 4ETOA 1C7WA 1GGWA 3PLFB 3O2PA 4GFTA 1WDCC 3NSIA 4TNCA 2WCBA 1U5IB 5B8IB 2CXJA 1YUUA 1SBJA 5HYDA 1PSBA 1LINA 1K8UA 1DT7B 3IF7A 1FF1A 3CGAA 2KI6D 5ER5A 1IGVA 2MRDA 1ZOTB 2WORA 1YVLA 1TRFA 4USLA 1ZMZA 2KQ6A 2KYCA 4PHNA 1C7VA 3AKAA 1B9AA 3TDIA 5I2LA 2CTNA 3CLNA 1MHOA 2KQYA 2LUCA 1QXPA 1NIWA 3CZTX 2K7OA 2ZN8A 3KO0A 1B8RA 1WLZA 4ORAB 3DVJA 2BBNA 2HF5A 1FBVA 1RWYA 2KGRA 1XFWO 1S6JA 1QLSA 3BXKA 2JT0A 1QJTA 1Q80A 4ZCUA 1B7TZ 1KQMC 1TNQA 3FWCA 1KK8C 2AAOA 4MRXA 1WLMA 2RGIA 4WQ3A 1L7ZA 2L50A 4GUKA 1WY9A 4MEWA 1M45A 1UHIA 3SG3A 1S26D 2GGZA 2HQ8A 5CSFA 1A75B 2JT8A 1DJGA 1KFXS 1M63B 3SG4A 3O6BA 1BU3A 1WRKA 1NYAA 2M1KB 1V1GA 3EVRA 2LLTA 1K93D 2NCPA 3GK4X 1KFXL 1CLMA 4I5LB 3AAJA 3EVUA 4PALA 3RM1A 1DF0B 2LANA 3PN7B 3F45A 5CSIA 4GGNA 1B4CA 5D69A 1YX7A 5JJGA 4YGEB 1ZFSA 2WC8A 2NXQA 1B8LA 1G4YR 4M2OA 1K90D 2KI4C 2LMVA 3JTDC 1DJHA 1G33A 2NZ0A 1XYDA 2JXLA 3MSEB 3EK7A 1XFUO 1TIZA 2WNDA 3OX6A 3IQOA 5AANA 2LM5A 5PALA 1QV1A 1ZUZA 1SR6C 1IQ5A 4M2PA 4PE0A 2GV5A 4YI8A 1CKKA 1RK9A 1HQVA 2PRUA 1N2DA 3DVEA 1PALA 4MRYA 2EC6B 1XK4C 2Y1NA 3HX4A 4OKHA 2E30A 3PFVA 1U5IA 1MWNA 2CBLA 4AOMA 2KBMA 4YBHB 1NX2A 4CFQA 1XVJA 2I2RE 3VGOA 4CFRA 1GGZA 4QJ3B 1S6IA 2FCEA 2KFGA 3I5IC 5ER4X 1F54A 3A4UB 4DIRA 2KFFA 2KSPA 2PASA 2KI6C 2Q4UA 1S5GY 2H61A 2QPTA 3LK0A 3OX5A 3D0YB 4GGFC 1NX3A 1JC2A 3LCPC 1FPWA 1EL4A 3JVTC 1K95A 3O4YA 2LC5A 1N0YA 4A4BA 1F55A 1NWDA 2BL0C 1CFPA 4E68A 1UHNA 2L4HA 3PATA 1XFVO 1KWOC 5I2QA 2ZKMX 1QATA 1CFFA 1QTXA 1YUSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y1A A;  4JQ0 D;  1BR1 B;  4P2Y B;  5CSJ A;  2KNE A;  3OB1 B;  1YTZ C;  1QX5 B;  1JBA A;  3TS5 C;  4N1G A;  1FI6 A;  1ALV A;  2L0P A;  2F33 A;  5DKQ A;  1A75 A;  3LK1 A;  4ZCV A;  1TCF A;  2OS8 C;  4CID A;  1LXF C;  2L2E A;  3CR5 X;  1KQV A;  2OTG C;  2M3W A;  1SK6 D;  1CDL A;  1QX2 A;  3I5G C;  1C07 A;  3DD4 A;  3KEV A;  1SPY A;  1H4B A;  3CR2 A;  3M0W A;  1DF0 A;  1S3P A;  1MXL C;  5KTY A;  1S36 A;  2KI4 B;  3JTD B;  5K89 A;  1SYM A;  2LHI A;  4YGB B;  1EG3 A;  2AUC A;  2LUX A;  3BUO B;  2F2O A;  2KDH A;  3PAL A;  1FW4 A;  1Y1X A;  1N65 A;  1BR4 B;  1Y6W A;  1OQP A;  3O78 A;  5DKR A;  3OB2 B;  4DS7 A;  1W7J B;  1IJ6 A;  1QIV A;  1OSA A;  2P6B B;  4GNK B;  1QVI Y;  1YUT A;  2BBM A;  2BKH B;  5AEQ A;  2VRG A;  4BY5 A;  1ZAC A;  4F0Z B;  1EH2 A;  1SR6 B;  2JWW A;  1SKT A;  2CT9 A;  2LCP A;  1MF8 B;  1RTP 1;  3OP0 A;  3ZWH A;  1F4Q A;  5KU1 A;  2HPS A;  3WXA A;  1EXR A;  2COL B;  4FTG A;  1R2U A;  1VRK A;  1DTL A;  3EK8 A;  3WHU B;  1LA3 A;  2LMT A;  4C0J A;  2QAC A;  1UWO A;  1AUI B;  1K9U A;  2L51 A;  2M0R A;  2JTZ A;  2LLS A;  3NSL A;  2TN4 A;  4L9M A;  1SRA A;  2MA2 A;  5FYX A;  2BKI B;  4ORC B;  3SG2 A;  5AXI A;  1DMO A;  1KSM A;  1YVH A;  2FOT A;  3BOW A;  3TDU A;  1L2O C;  1REC A;  1ODB A;  1SY9 A;  3I5H B;  1TN4 A;  1DJI A;  1SNL A;  2ZNE A;  1CNP A;  1MUX A;  1LKJ A;  5HLO A;  1CDP A;  1CMG A;  4JPZ B;  1A4P A;  1GQM A;  3D0Y A;  2BCA A;  2BL0 B;  3NSO A;  1UUR A;  4N5X A;  2Y1M A;  1KWO B;  2KYF A;  3VRN A;  4JWQ A;  5DKN A;  2K2F A;  4CLN A;  2LVJ A;  2MAZ A;  2G9B A;  4GBA A;  1NP8 A;  2M9G A;  4QJ5 B;  2JTT A;  1OMV A;  1NPQ A;  1IG5 A;  1K9P A;  2JC2 A;  1DJX A;  2JNX A;  3GK1 A;  5TNC A;  4MBE A;  4PDZ A;  1QX7 A;  5I2O A;  1QAS A;  3GOF A;  3EK4 A;  1DJY A;  1A29 A;  1J55 A;  1IH0 A;  1WDC B;  4AQI A;  2M7N A;  2ZND A;  4PHK A;  2K7B A;  2OTG B;  3H4S E;  1BLQ A;  3BUW B;  1M31 A;  3I5G B;  2JQ6 A;  2JT3 A;  2ISD A;  3K21 A;  3FIA A;  1K9K A;  1X02 A;  1JF0 A;  1PUL A;  3BQ3 A;  3GK2 A;  3DVM A;  2JNF A;  3NXA A;  3BOW B;  1DGV A;  4PHJ A;  1E8A A;  1YR5 A;  2KAV A;  4P5O E;  2M97 A;  5CSN A;  2PVB A;  2LE9 B;  1KFU S;  3AAK A;  2E6W A;  1NUB A;  2IS9 A;  3TZ1 A;  1BF5 A;  1M46 A;  3VRR A;  1F70 A;  1PK0 D;  1D1O A;  1YRU B;  1BMO A;  1GJY A;  1KFU L;  3BUX B;  4MZJ A;  4NQG A;  1TNX A;  4OCI A;  1BG1 A;  3EKJ A;  3I5F C;  3VRQ A;  1KQM B;  2BCX A;  1KK8 B;  3SIA A;  1MQ1 A;  5BPJ A;  2LV7 A;  1EJ3 A;  1DVI A;  2FCD A;  4C0L A;  2WCF A;  3SIB A;  1XK4 A;  2GGM A;  4HRG A;  2ZRT A;  2K0J A;  3FWB A;  1RJV A;  3RLZ A;  1UUS A;  2MJW B;  3A8R A;  2F8P A;  1UHH A;  4A4C A;  1JSA A;  1CDN A;  1KCY A;  1KSO A;  2NCO A;  1SL9 A;  3PSR A;  1PSR A;  1SCM C;  2MLF C;  2ZFD A;  4Q04 A;  4GAO A;  2Y4Q A;  5KSZ A;  1CM1 A;  2SAS A;  1BT6 A;  2MLE C;  1HT9 A;  2BE4 A;  2NLN A;  4FQO A;  5JOL A;  1RFJ A;  4YGA A;  2LVI A;  1NCY A;  2PMY A;  2LNK A;  3VRP A;  1BOC A;  2V53 A;  1YUR A;  4GGF A;  5HKZ A;  1B7T Y;  2SCP A;  1IRJ A;  4HSZ A;  1QS7 A;  1ALW A;  1OMR A;  2L98 A;  1KK7 Z;  1TNW A;  4DRW A;  2KOT A;  2K61 A;  2MBX A;  1SMG A;  4OR9 B;  1FI5 A;  1S1E A;  2R2I A;  4MLW A;  1CFC A;  1SL8 A;  1S5G Z;  2LVV A;  4UPG A;  1AJ5 A;  1B47 A;  3SG5 A;  2A4J A;  1K96 A;  3VRO A;  2O5G A;  1RRO A;  2ZN9 A;  3D10 A;  4MZL A;  4I5N B;  2I94 A;  4YRU A;  5AFP A;  3DF0 B;  4PCW A;  1W7I B;  5J3X A;  3TDZ A;  2EC6 C;  1PVB A;  1CLB A;  4PE7 A;  1WRL A;  1DJZ A;  4GPL B;  4YGD B;  2LLU A;  2KAX A;  1Y1U A;  5D7F A;  1XA5 A;  5HLV A;  2PSR A;  1OZS A;  3KHE A;  2PAL A;  3LLE A;  5I8N A;  4XJK B;  2CNP A;  2D8N A;  2FJU B;  3ICB A;  1V1F A;  2KFH A;  5GQQ C;  3AKB A;  3EKH A;  1MXE A;  2K8M B;  2ZRS A;  3FS7 A;  3ZNI A;  1AK8 A;  1A2X A;  1TTX A;  1NCX A;  1YRT B;  2K2A A;  2Y5I A;  2O60 A;  3I5I B;  2AMI A;  3EVV A;  1CTR A;  4MSP A;  3KF9 A;  3SG7 A;  2M29 A;  1J1D A;  1LA0 A;  2G2B A;  2K7D A;  2KGB C;  2KBI A;  2WOS A;  2CCM A;  2LAP A;  1S6C A;  1XO5 A;  1JFK A;  1F4O A;  1TCO B;  3BUN B;  3JVT B;  2K7C A;  1UHK A;  3I5F B;  3BYA A;  2BCB A;  1QLK A;  2BEC A;  1JF2 A;  2KAY A;  1IKU A;  2JPT A;  3CS1 A;  4PHM A;  3CR4 X;  2L5X B;  2KHN A;  3BUM B;  2JXC A;  1J7P A;  3CTN A;  1PRW A;  4M2Q A;  4NDB A;  2MHH A;  4IL1 A;  3LL8 B;  1NCZ A;  1AVS A;  1QVI Z;  1SCV A;  2LP3 A;  1J1E A;  3TUY C;  4NDD A;  2F2P A;  1EG4 A;  2I18 A;  1UP5 A;  2L4I A;  3C1V A;  2EGD A;  3TS5 B;  1SCM B;  1SL7 A;  2DOQ A;  1DJW A;  1DGU A;  2JOJ A;  3HCM A;  3OHM B;  4MVF A;  2HQW A;  2JRF A;  4C0K A;  2LVK A;  1G8I A;  4BY4 A;  2OS8 B;  1JUO A;  1M39 A;  2BE6 A;  1JFJ A;  4MZK A;  3NSK A;  1OOJ A;  1K94 A;  1CLL A;  2JUL A;  2Q91 A;  1PVA A;  1AJ4 A;  4XYN A;  1CFD A;  4WRI A;  2H2K A;  4QJ4 B;  1OMD A;  1IQ3 A;  2H61 C;  2F3Y A;  4R1E A;  2I7A A;  1TNP A;  2F3Z A;  1TOP A;  2JU0 A;  5G08 A;  1Y0V H;  1F71 A;  5HKW A;  2OPO A;  4HRE E;  4OVN F;  1A03 A;  4PE4 A;  1JWD A;  4YGC B;  1IJ5 A;  2LHL A;  1J7R A;  4U8D A;  5AER A;  1NSH A;  2HET A;  1CDM A;  4I5K A;  1BOD A;  5HKY A;  1NX1 A;  2LP2 A;  4D1E A;  2JZI A;  5CPV A;  4DCK A;  4I5J A;  1YX8 A;  3DVK A;  4MN0 A;  4WQ2 A;  1CB1 A;  4CPV A;  4NDC A;  5F6T A;  1BJF A;  3CWG A;  3DF0 A;  1B1G A;  1SW8 A;  1CMF A;  2M49 B;  1AP4 A;  4AQJ A;  1KK7 Y;  3WHT B;  3E3R A;  2M8U A;  3PM8 A;  5IBW A;  1H8B A;  1OZO A;  1J7Q A;  4XJK A;  2LMU A;  1XFZ O;  3I5H C;  1XFY O;  1B8C A;  4N1F A;  1NX0 A;  1J7O A;  1L2O B;  1R6P A;  2B1U A;  2M1U A;  3QRX A;  4YI9 A;  3PN7 C;  2M7L A;  1K2H A;  4ORB B;  2EHB A;  1WRZ A;  1XFX O;  1CM4 A;  1IWQ A;  1UHJ A;  3KPX A;  1QIW A;  4HRH A;  2WCE A;  4OV2 A;  1AHR A;  3SJS A;  1OE9 B;  1QV0 A;  4ICB A;  1LVC D;  1F8H A;  1MR8 A;  3SG6 A;  4DUQ A;  3WNX B;  3IQQ A;  4PE1 A;  3TUY B;  4ETO A;  1C7W A;  1GGW A;  3PLF B;  3O2P A;  4GFT A;  1WDC C;  3NSI A;  4TNC A;  2WCB A;  1U5I B;  5B8I B;  2CXJ A;  1YUU A;  1SBJ A;  5HYD A;  1PSB A;  1LIN A;  1K8U A;  1DT7 B;  3IF7 A;  1FF1 A;  3CGA A;  2KI6 D;  5ER5 A;  1IGV A;  2MRD A;  1ZOT B;  2WOR A;  1YVL A;  1TRF A;  4USL A;  1ZMZ A;  2KQ6 A;  2KYC A;  4PHN A;  1C7V A;  3AKA A;  1B9A A;  3TDI A;  5I2L A;  2CTN A;  3CLN A;  1MHO A;  2KQY A;  2LUC A;  1QXP A;  1NIW A;  3CZT X;  2K7O A;  2ZN8 A;  3KO0 A;  1B8R A;  1WLZ A;  4ORA B;  3DVJ A;  2BBN A;  2HF5 A;  1FBV A;  1RWY A;  2KGR A;  1XFW O;  1S6J A;  1QLS A;  3BXK A;  2JT0 A;  1QJT A;  1Q80 A;  4ZCU A;  1B7T Z;  1KQM C;  1TNQ A;  3FWC A;  1KK8 C;  2AAO A;  4MRX A;  1WLM A;  2RGI A;  4WQ3 A;  1L7Z A;  2L50 A;  4GUK A;  1WY9 A;  4MEW A;  1M45 A;  1UHI A;  3SG3 A;  1S26 D;  2GGZ A;  2HQ8 A;  5CSF A;  1A75 B;  2JT8 A;  1DJG A;  1KFX S;  1M63 B;  3SG4 A;  3O6B A;  1BU3 A;  1WRK A;  1NYA A;  2M1K B;  1V1G A;  3EVR A;  2LLT A;  1K93 D;  2NCP A;  3GK4 X;  1KFX L;  1CLM A;  4I5L B;  3AAJ A;  3EVU A;  4PAL A;  3RM1 A;  1DF0 B;  2LAN A;  3PN7 B;  3F45 A;  5CSI A;  4GGN A;  1B4C A;  5D69 A;  1YX7 A;  5JJG A;  4YGE B;  1ZFS A;  2WC8 A;  2NXQ A;  1B8L A;  1G4Y R;  4M2O A;  1K90 D;  2KI4 C;  2LMV A;  3JTD C;  1DJH A;  1G33 A;  2NZ0 A;  1XYD A;  2JXL A;  3MSE B;  3EK7 A;  1XFU O;  1TIZ A;  2WND A;  3OX6 A;  3IQO A;  5AAN A;  2LM5 A;  5PAL A;  1QV1 A;  1ZUZ A;  1SR6 C;  1IQ5 A;  4M2P A;  4PE0 A;  2GV5 A;  4YI8 A;  1CKK A;  1RK9 A;  1HQV A;  2PRU A;  1N2D A;  3DVE A;  1PAL A;  4MRY A;  2EC6 B;  1XK4 C;  2Y1N A;  3HX4 A;  4OKH A;  2E30 A;  3PFV A;  1U5I A;  1MWN A;  2CBL A;  4AOM A;  2KBM A;  4YBH B;  1NX2 A;  4CFQ A;  1XVJ A;  2I2R E;  3VGO A;  4CFR A;  1GGZ A;  4QJ3 B;  1S6I A;  2FCE A;  2KFG A;  3I5I C;  5ER4 X;  1F54 A;  3A4U B;  4DIR A;  2KFF A;  2KSP A;  2PAS A;  2KI6 C;  2Q4U A;  1S5G Y;  2H61 A;  2QPT A;  3LK0 A;  3OX5 A;  3D0Y B;  4GGF C;  1NX3 A;  1JC2 A;  3LCP C;  1FPW A;  1EL4 A;  3JVT C;  1K95 A;  3O4Y A;  2LC5 A;  1N0Y A;  4A4B A;  1F55 A;  1NWD A;  2BL0 C;  1CFP A;  4E68 A;  1UHN A;  2L4H A;  3PAT A;  1XFV O;  1KWO C;  5I2Q A;  2ZKM X;  1QAT A;  1CFF A;  1QTX A;  1YUS A; 
#chains in the Genus database with same CATH topology
 1Y1A A;  4JQ0 D;  1BR1 B;  4P2Y B;  5CSJ A;  2KNE A;  3OB1 B;  1YTZ C;  1QX5 B;  3CZ0 A;  3TS5 C;  1JBA A;  4N1G A;  1FI6 A;  1ALV A;  2L0P A;  2F33 A;  5DKQ A;  1A75 A;  3LK1 A;  2QEV A;  4ZCV A;  1TCF A;  2OS8 C;  4CID A;  1LXF C;  3NHT A;  2L2E A;  2ERB A;  3CR5 X;  1KQV A;  2OTG C;  2M3W A;  1SK6 D;  2PYQ A;  1CDL A;  1QX2 A;  3D74 A;  3I5G C;  1C07 A;  3DD4 A;  3KEV A;  1SPY A;  1H4B A;  3CR2 A;  3M0W A;  1DF0 A;  1S3P A;  1MXL C;  5KTY A;  1S36 A;  2KI4 B;  3B6X A;  3JTD B;  5K89 A;  1SYM A;  2LHI A;  1OOG A;  4YGB B;  1EG3 A;  2AUC A;  2LUX A;  3BUO B;  2F2O A;  2KDH A;  3PAL A;  1FW4 A;  1Y1X A;  1N65 A;  3BJH A;  5FI6 A;  1BR4 B;  1Y6W A;  1OQP A;  3O78 A;  5DKR A;  3OB2 B;  4DS7 A;  1W7J B;  1IJ6 A;  1QIV A;  1OSA A;  1TWO A;  2P6B B;  1QVI Y;  1YUT A;  2BBM A;  2BKH B;  4GNK B;  1T14 A;  2VRG A;  1ZAC A;  4BY5 A;  4F0Z B;  1SR6 B;  2JWW A;  1SKT A;  3V2L A;  2CT9 A;  2LCP A;  1EH2 A;  3R1O A;  1MF8 B;  1RTP 1;  3OP0 A;  3ZWH A;  1F4Q A;  1GM0 A;  5KU1 A;  2HPS A;  3WXA A;  1ORG A;  1EXR A;  2COL B;  2QDI A;  4KYN A;  4FTG A;  1R2U A;  1VRK A;  1DTL A;  3EK8 A;  3S0D A;  3WHU B;  1LA3 A;  2LMT A;  4C0J A;  2QAC A;  1UWO A;  1AUI B;  1K9U A;  2L51 A;  2M0R A;  2JTZ A;  2LLS A;  3NSL A;  2TN4 A;  4L9M A;  1SRA A;  2MA2 A;  5FYX A;  2BKI B;  4ORC B;  3SG2 A;  5AXI A;  1DMO A;  1KSM A;  1YVH A;  2FOT A;  2P70 A;  3BOW A;  3S0E A;  3TDU A;  1L2O C;  1REC A;  1ODB A;  1SY9 A;  3I5H B;  1TN4 A;  1DJI A;  1SNL A;  2ZNE A;  1CNP A;  1MUX A;  1LKJ A;  5HLO A;  1CDP A;  3S0B A;  3DY9 A;  1CMG A;  4JPZ B;  1A4P A;  1GQM A;  3D77 A;  3D0Y A;  2BCA A;  2BL0 B;  3NSO A;  3RZS A;  1UUR A;  4N5X A;  2WCJ A;  2WC6 A;  2Y1M A;  1KWO B;  2KYF A;  3VRN A;  4JWQ A;  5DKN A;  2K2F A;  4CLN A;  2LVJ A;  2MAZ A;  2G9B A;  4GBA A;  1NP8 A;  2M9G A;  4QJ5 B;  2JTT A;  1OMV A;  1NPQ A;  1IG5 A;  1K9P A;  2JC2 A;  1DJX A;  2JNX A;  3D78 A;  3GK1 A;  5TNC A;  4MBE A;  4PDZ A;  1QX7 A;  5I2O A;  1QAS A;  3SS4 A;  3GOF A;  3O4X A;  3EK4 A;  1DJY A;  1A29 A;  1J55 A;  1IH0 A;  1WDC B;  4AQI A;  2M7N A;  5FI2 A;  2ZND A;  4FQT A;  4IJ7 A;  4PHK A;  2K7B A;  2OTG B;  3H4S E;  1BLQ A;  3BUW B;  3B88 A;  1M31 A;  3I5G B;  2JQ6 A;  2JT3 A;  2ISD A;  2KPH A;  3K21 A;  3FIA A;  1K9K A;  1X02 A;  1JF0 A;  1W9Z A;  1PUL A;  3BQ3 A;  3GK2 A;  3DVM A;  2JNF A;  3NXA A;  3BOW B;  1DGV A;  3CZ2 A;  4INX A;  4PHJ A;  1E8A A;  1YR5 A;  1TUZ A;  2KAV A;  4P5O E;  2M97 A;  5CSN A;  3L4L A;  2PVB A;  2LE9 B;  1KFU S;  3AAK A;  2E6W A;  1NUB A;  2IS9 A;  3TZ1 A;  4INW A;  1BF5 A;  1OOH A;  1M46 A;  3K1E A;  3VRR A;  1F70 A;  1PK0 D;  1D1O A;  1YRU B;  1BMO A;  1GJY A;  1KFU L;  3BUX B;  4MZJ A;  4NQG A;  1TNX A;  4OCI A;  1BG1 A;  3EKJ A;  3I5F C;  3VRQ A;  1KQM B;  2BCX A;  2KLD A;  1KK8 B;  3SIA A;  1MQ1 A;  5BPJ A;  2LV7 A;  1EJ3 A;  2KLE A;  1DVI A;  2FCD A;  4C0L A;  2WCF A;  3SIB A;  1XK4 A;  2GGM A;  4HRG A;  2ZRT A;  2K0J A;  3FWB A;  1RJV A;  3RLZ A;  1UUS A;  2MJW B;  3A8R A;  2F8P A;  1UHH A;  4A4C A;  1JSA A;  1CDN A;  1KCY A;  1KSO A;  2NCO A;  1SL9 A;  3PSR A;  1PSR A;  1SCM C;  2MLF C;  2ZFD A;  4Q04 A;  4GAO A;  2QEO A;  2Y4Q A;  5KSZ A;  1CM1 A;  2SAS A;  1BT6 A;  2MLE C;  1HT9 A;  2BE4 A;  2NLN A;  4FQO A;  5JOL A;  1RFJ A;  4YGA A;  2LVI A;  1NCY A;  1P28 A;  2LNK A;  2PMY A;  3VRP A;  2V53 A;  1YUR A;  1BOC A;  4GGF A;  5HKZ A;  1B7T Y;  2SCP A;  1IRJ A;  4HSZ A;  1QS7 A;  1ALW A;  1OMR A;  2L98 A;  1KK7 Z;  1TNW A;  4DRW A;  2KOT A;  2K61 A;  2MBX A;  1SMG A;  4OR9 B;  1DEL A;  1FI5 A;  1S1E A;  2R2I A;  4MLW A;  1CFC A;  1SL8 A;  1S5G Z;  2LVV A;  4UPG A;  1AJ5 A;  1B47 A;  3SG5 A;  2A4J A;  1K96 A;  3VRO A;  1C3Y A;  2O5G A;  1RRO A;  2ZN9 A;  3D10 A;  3CYZ A;  3BFH A;  3R1P A;  4I5N B;  2I94 A;  4MZL A;  3SS5 A;  2WCK A;  4YRU A;  5AFP A;  3FE9 A;  3DF0 B;  4PCW A;  1W7I B;  5J3X A;  3TDZ A;  2EC6 C;  3PM2 A;  3S0A A;  1PVB A;  1CLB A;  4PE7 A;  1WRL A;  1DJZ A;  4GPL B;  4YGD B;  2LLU A;  2KAX A;  1Y1U A;  5D7F A;  1XA5 A;  5HLV A;  2PSR A;  1OZS A;  3KHE A;  2PAL A;  3LLE A;  5I8N A;  4XJK B;  2CNP A;  2D8N A;  2FJU B;  3ICB A;  1V1F A;  3EG5 B;  2KFH A;  5GQQ C;  3BFA A;  3VB1 A;  2FJY A;  3AKB A;  3EKH A;  1MXE A;  2K8M B;  2P71 A;  2ZRS A;  3FS7 A;  3ZNI A;  1AK8 A;  1A2X A;  1TTX A;  1NCX A;  1YRT B;  2K2A A;  2Y5I A;  2O60 A;  3CAB A;  2AMI A;  3I5I B;  3EVV A;  1CTR A;  4MSP A;  3KF9 A;  3SG7 A;  2M29 A;  1J1D A;  1LA0 A;  2G2B A;  2K7D A;  2KGB C;  2KBI A;  2WOS A;  5DIC A;  2CCM A;  2LAP A;  1S6C A;  1XO5 A;  1JFK A;  1F4O A;  1TCO B;  3BUN B;  3JVT B;  2K7C A;  1UHK A;  3I5F B;  3BYA A;  3D75 A;  2BCB A;  1QLK A;  2BEC A;  1JF2 A;  2KAY A;  5AEQ A;  1IKU A;  2JPT A;  3CS1 A;  4PHM A;  3CR4 X;  2L5X B;  2KHN A;  3BUM B;  2JXC A;  1J7P A;  3CTN A;  1PRW A;  4M2Q A;  4NDB A;  2MHH A;  2QEB A;  3LL8 B;  2PQL A;  4IL1 A;  3S0F A;  1NCZ A;  5HL1 A;  1AVS A;  1QVI Z;  1SCV A;  2LP3 A;  1J1E A;  3TUY C;  4NDD A;  2F2P A;  1EG4 A;  2I18 A;  1UP5 A;  2L4I A;  3C1V A;  2EGD A;  3BFB A;  3FE8 A;  1SCM B;  1SL7 A;  3TS5 B;  2L2C A;  2DOQ A;  1DJW A;  3DYE A;  3L4A A;  1DGU A;  2JOJ A;  3HCM A;  3OHM B;  4MVF A;  2HQW A;  2JRF A;  4C0K A;  2LVK A;  1G8I A;  3QME A;  4BY4 A;  2OS8 B;  1QWV A;  1JUO A;  1M39 A;  1SSE B;  2BE6 A;  1JFJ A;  4MZK A;  3NSK A;  1OOJ A;  1K94 A;  1CLL A;  2JUL A;  2Q91 A;  1PVA A;  1AJ4 A;  4XYN A;  1CFD A;  4WRI A;  2H2K A;  4QJ4 B;  1OMD A;  1TUJ A;  2H61 C;  2F3Y A;  4R1E A;  2I7A A;  1IQ3 A;  1TNP A;  2F3Z A;  1TOP A;  2JU0 A;  5G08 A;  1Y0V H;  1F71 A;  5HKW A;  2OPO A;  4HRE E;  4OVN F;  4JD9 A;  1A03 A;  4PE4 A;  2GTE A;  1JWD A;  4YGC B;  1IJ5 A;  1OW4 A;  2LHL A;  1J7R A;  4U8D A;  5AER A;  1NSH A;  2HET A;  1CDM A;  4I5K A;  1BOD A;  5HKY A;  1NX1 A;  2LP2 A;  4D1E A;  2JZI A;  5CPV A;  4DCK A;  4I5J A;  3DZT A;  1YX8 A;  3DVK A;  4MN0 A;  4WQ2 A;  1CB1 A;  4CPV A;  4NDC A;  5F6T A;  2JPO A;  1BJF A;  3CWG A;  3DF0 A;  1B1G A;  1SW8 A;  1CMF A;  2M49 B;  1AP4 A;  4AQJ A;  1KK7 Y;  3WHT B;  5EL2 A;  3E3R A;  2M8U A;  2L5Y A;  3PM8 A;  5IBW A;  1H8B A;  1OZO A;  1J7Q A;  4OZD A;  4XJK A;  3CZ1 A;  3D76 A;  2LMU A;  1XFZ O;  3SS3 A;  1IIO A;  3I5H C;  1XFY O;  1B8C A;  4N1F A;  1NX0 A;  1J7O A;  1L2O B;  1R6P A;  5D3O A;  2B1U A;  2M1U A;  3QRX A;  4YI9 A;  3PN7 C;  2M7L A;  1K2H A;  4ORB B;  2EHB A;  1WRZ A;  1XFX O;  1CM4 A;  4F7F A;  1IWQ A;  1UHJ A;  3KPX A;  1QIW A;  4HRH A;  2WCE A;  4OV2 A;  3B86 A;  3OGN A;  1AHR A;  3SJS A;  1OE9 B;  1QV0 A;  4ICB A;  1LVC D;  1F8H A;  1MR8 A;  3SG6 A;  4DUQ A;  3WNX B;  3IQQ A;  4PE1 A;  3TUY B;  4ETO A;  1C7W A;  1GGW A;  3PLF B;  3UO9 A;  3O2P A;  4GFT A;  1WDC C;  3NSI A;  4TNC A;  2QEH A;  1U5I B;  2WCB A;  5B8I B;  2CXJ A;  2WCH A;  1YUU A;  1SBJ A;  5HYD A;  1PSB A;  1LIN A;  1K8U A;  1DT7 B;  3IF7 A;  1FF1 A;  2WCL A;  3NHI A;  3CGA A;  2KI6 D;  3OBV A;  5ER5 A;  1IGV A;  2MRD A;  1ZOT B;  2WOR A;  1YVL A;  1TRF A;  4USL A;  1ZMZ A;  2KQ6 A;  2KYC A;  4PHN A;  1C7V A;  2K60 A;  3AKA A;  1B9A A;  3TDI A;  5I2L A;  2CTN A;  1C3Z A;  2WC5 A;  3CLN A;  3N7H A;  1XFR A;  1MHO A;  2KQY A;  2LUC A;  1QXP A;  1NIW A;  3CZT X;  2K7O A;  2ZN8 A;  3KO0 A;  1B8R A;  1WLZ A;  4ORA B;  3Q8I A;  3DVJ A;  2BBN A;  3L47 A;  2HF5 A;  3DXL A;  1FBV A;  1RWY A;  2KGR A;  1XFW O;  1S6J A;  1QLS A;  3BXK A;  2JT0 A;  1QJT A;  1Q80 A;  4ZCU A;  1B7T Z;  1KQM C;  1TNQ A;  2WCM A;  1KK8 C;  2AAO A;  3FWC A;  1WLM A;  2RGI A;  4MRX A;  4WQ3 A;  1L7Z A;  2L50 A;  4GUK A;  1WY9 A;  5I94 A;  4MEW A;  1M45 A;  3R72 A;  1OOI X;  1UHI A;  3B7A A;  3SG3 A;  3CDN A;  1S26 D;  1LS8 A;  2GGZ A;  2HQ8 A;  5CSF A;  1A75 B;  2JT8 A;  1DJG A;  1KFX S;  1M63 B;  3FE6 A;  3O6B A;  1BU3 A;  3SG4 A;  1WRK A;  1NYA A;  3UNW A;  2M1K B;  1V1G A;  3EVR A;  2LLT A;  3S0G A;  1K93 D;  2NCP A;  3GK4 X;  1KFX L;  1CLM A;  4I5L B;  3AAJ A;  3EVU A;  4PAL A;  3RM1 A;  1DF0 B;  2LAN A;  3PN7 B;  3F45 A;  5CSI A;  2YGU A;  1DQE A;  3IVT A;  4GGN A;  1Z2C B;  5D69 A;  1YX7 A;  5JJG A;  1B4C A;  4YGE B;  1ZFS A;  2WC8 A;  2NXQ A;  1B8L A;  1G4Y R;  4M2O A;  3B87 A;  1K90 D;  2KI4 C;  2LMV A;  3JTD C;  1DJH A;  1G33 A;  2NZ0 A;  1XYD A;  2JXL A;  3MSE B;  1DC1 A;  3EK7 A;  1XFU O;  1TIZ A;  2WND A;  3OX6 A;  3IQO A;  3D73 A;  5AAN A;  2LM5 A;  5PAL A;  1QV1 A;  1ZUZ A;  2H8V A;  1SR6 C;  1IQ5 A;  4M2P A;  1Z4H A;  4PE0 A;  1DEK A;  2GV5 A;  4YI8 A;  1CKK A;  1RK9 A;  1HQV A;  2PRU A;  1N2D A;  3DVE A;  1PAL A;  4MRY A;  2EC6 B;  1XK4 C;  2Y1N A;  3HX4 A;  4OKH A;  2E30 A;  3PFV A;  1U5I A;  1MWN A;  2CBL A;  4AOM A;  2KBM A;  4YBH B;  3NGV A;  1NX2 A;  4CFQ A;  1XVJ A;  2I2R E;  3VGO A;  4CFR A;  1GGZ A;  4QJ3 B;  1S6I A;  2FCE A;  2KFG A;  3I5I C;  1OOF A;  4PT1 A;  5ER4 X;  1F54 A;  2BNX A;  3A4U B;  3PJI A;  4DIR A;  2KFF A;  2KSP A;  2PAS A;  2KI6 C;  2Q4U A;  1S5G Y;  2H61 A;  2QPT A;  3LK0 A;  3OX5 A;  3D0Y B;  4GGF C;  1NX3 A;  1JC2 A;  3LCP C;  1FPW A;  1EL4 A;  3JVT C;  1K95 A;  3O4Y A;  2BAP A;  2LC5 A;  1N0Y A;  4A4B A;  4JKT A;  1F55 A;  1NWD A;  2BL0 C;  1CFP A;  4E68 A;  1UHN A;  2L4H A;  3PAT A;  1XFV O;  1KWO C;  3R1V A;  5FI7 A;  5I2Q A;  2ZKM X;  1QAT A;  1CFF A;  1QTX A;  1YUS A; 
#chains in the Genus database with same CATH homology
 1Y1A A;  4JQ0 D;  1BR1 B;  4P2Y B;  5CSJ A;  2KNE A;  3OB1 B;  1YTZ C;  1QX5 B;  1JBA A;  3TS5 C;  4N1G A;  1FI6 A;  1ALV A;  2L0P A;  2F33 A;  5DKQ A;  1A75 A;  3LK1 A;  4ZCV A;  1TCF A;  2OS8 C;  4CID A;  1LXF C;  2L2E A;  3CR5 X;  1KQV A;  2OTG C;  2M3W A;  1SK6 D;  1CDL A;  1QX2 A;  3I5G C;  1C07 A;  3DD4 A;  3KEV A;  1SPY A;  1H4B A;  3CR2 A;  3M0W A;  1DF0 A;  1S3P A;  1MXL C;  5KTY A;  1S36 A;  2KI4 B;  3JTD B;  5K89 A;  1SYM A;  2LHI A;  4YGB B;  1EG3 A;  2AUC A;  2LUX A;  3BUO B;  2F2O A;  2KDH A;  3PAL A;  1FW4 A;  1Y1X A;  1N65 A;  1BR4 B;  1Y6W A;  1OQP A;  3O78 A;  5DKR A;  3OB2 B;  4DS7 A;  1W7J B;  1IJ6 A;  1QIV A;  1OSA A;  2P6B B;  4GNK B;  1QVI Y;  1YUT A;  2BBM A;  2BKH B;  5AEQ A;  2VRG A;  4BY5 A;  1ZAC A;  4F0Z B;  1EH2 A;  1SR6 B;  2JWW A;  1SKT A;  2CT9 A;  2LCP A;  1MF8 B;  1RTP 1;  3OP0 A;  3ZWH A;  1F4Q A;  5KU1 A;  2HPS A;  3WXA A;  1EXR A;  2COL B;  4FTG A;  1R2U A;  1VRK A;  1DTL A;  3EK8 A;  3WHU B;  1LA3 A;  2LMT A;  4C0J A;  2QAC A;  1UWO A;  1AUI B;  1K9U A;  2L51 A;  2M0R A;  2JTZ A;  2LLS A;  3NSL A;  2TN4 A;  4L9M A;  1SRA A;  2MA2 A;  5FYX A;  2BKI B;  4ORC B;  3SG2 A;  5AXI A;  1DMO A;  1KSM A;  1YVH A;  2FOT A;  3BOW A;  3TDU A;  1L2O C;  1REC A;  1ODB A;  1SY9 A;  3I5H B;  1TN4 A;  1DJI A;  1SNL A;  2ZNE A;  1CNP A;  1MUX A;  1LKJ A;  5HLO A;  1CDP A;  1CMG A;  4JPZ B;  1A4P A;  1GQM A;  3D0Y A;  2BCA A;  2BL0 B;  3NSO A;  1UUR A;  4N5X A;  2Y1M A;  1KWO B;  2KYF A;  3VRN A;  4JWQ A;  5DKN A;  2K2F A;  4CLN A;  2LVJ A;  2MAZ A;  2G9B A;  4GBA A;  1NP8 A;  2M9G A;  4QJ5 B;  2JTT A;  1OMV A;  1NPQ A;  1IG5 A;  1K9P A;  2JC2 A;  1DJX A;  2JNX A;  3GK1 A;  5TNC A;  4MBE A;  4PDZ A;  1QX7 A;  5I2O A;  1QAS A;  3GOF A;  3EK4 A;  1DJY A;  1A29 A;  1J55 A;  1IH0 A;  1WDC B;  4AQI A;  2M7N A;  2ZND A;  4PHK A;  2K7B A;  2OTG B;  3H4S E;  1BLQ A;  3BUW B;  1M31 A;  3I5G B;  2JQ6 A;  2JT3 A;  2ISD A;  3K21 A;  3FIA A;  1K9K A;  1X02 A;  1JF0 A;  1PUL A;  3BQ3 A;  3GK2 A;  3DVM A;  2JNF A;  3NXA A;  3BOW B;  1DGV A;  4PHJ A;  1E8A A;  1YR5 A;  2KAV A;  4P5O E;  2M97 A;  5CSN A;  2PVB A;  2LE9 B;  1KFU S;  3AAK A;  2E6W A;  1NUB A;  2IS9 A;  3TZ1 A;  1BF5 A;  1M46 A;  3VRR A;  1F70 A;  1PK0 D;  1D1O A;  1YRU B;  1BMO A;  1GJY A;  1KFU L;  3BUX B;  4MZJ A;  4NQG A;  1TNX A;  4OCI A;  1BG1 A;  3EKJ A;  3I5F C;  3VRQ A;  1KQM B;  2BCX A;  1KK8 B;  3SIA A;  1MQ1 A;  5BPJ A;  2LV7 A;  1EJ3 A;  1DVI A;  2FCD A;  4C0L A;  2WCF A;  3SIB A;  1XK4 A;  2GGM A;  4HRG A;  2ZRT A;  2K0J A;  3FWB A;  1RJV A;  3RLZ A;  1UUS A;  2MJW B;  3A8R A;  2F8P A;  1UHH A;  4A4C A;  1JSA A;  1CDN A;  1KCY A;  1KSO A;  2NCO A;  1SL9 A;  3PSR A;  1PSR A;  1SCM C;  2MLF C;  2ZFD A;  4Q04 A;  4GAO A;  2Y4Q A;  5KSZ A;  1CM1 A;  2SAS A;  1BT6 A;  2MLE C;  1HT9 A;  2BE4 A;  2NLN A;  4FQO A;  5JOL A;  1RFJ A;  4YGA A;  2LVI A;  1NCY A;  2PMY A;  2LNK A;  3VRP A;  1BOC A;  2V53 A;  1YUR A;  4GGF A;  5HKZ A;  1B7T Y;  2SCP A;  1IRJ A;  4HSZ A;  1QS7 A;  1ALW A;  1OMR A;  2L98 A;  1KK7 Z;  1TNW A;  4DRW A;  2KOT A;  2K61 A;  2MBX A;  1SMG A;  4OR9 B;  1FI5 A;  1S1E A;  2R2I A;  4MLW A;  1CFC A;  1SL8 A;  1S5G Z;  2LVV A;  4UPG A;  1AJ5 A;  1B47 A;  3SG5 A;  2A4J A;  1K96 A;  3VRO A;  2O5G A;  1RRO A;  2ZN9 A;  3D10 A;  4MZL A;  4I5N B;  2I94 A;  4YRU A;  5AFP A;  3DF0 B;  4PCW A;  1W7I B;  5J3X A;  3TDZ A;  2EC6 C;  1PVB A;  1CLB A;  4PE7 A;  1WRL A;  1DJZ A;  4GPL B;  4YGD B;  2LLU A;  2KAX A;  1Y1U A;  5D7F A;  1XA5 A;  5HLV A;  2PSR A;  1OZS A;  3KHE A;  2PAL A;  3LLE A;  5I8N A;  4XJK B;  2CNP A;  2D8N A;  2FJU B;  3ICB A;  1V1F A;  2KFH A;  5GQQ C;  3AKB A;  3EKH A;  1MXE A;  2K8M B;  2ZRS A;  3FS7 A;  3ZNI A;  1AK8 A;  1A2X A;  1TTX A;  1NCX A;  1YRT B;  2K2A A;  2Y5I A;  2O60 A;  3I5I B;  2AMI A;  3EVV A;  1CTR A;  4MSP A;  3KF9 A;  3SG7 A;  2M29 A;  1J1D A;  1LA0 A;  2G2B A;  2K7D A;  2KGB C;  2KBI A;  2WOS A;  2CCM A;  2LAP A;  1S6C A;  1XO5 A;  1JFK A;  1F4O A;  1TCO B;  3BUN B;  3JVT B;  2K7C A;  1UHK A;  3I5F B;  3BYA A;  2BCB A;  1QLK A;  2BEC A;  1JF2 A;  2KAY A;  1IKU A;  2JPT A;  3CS1 A;  4PHM A;  3CR4 X;  2L5X B;  2KHN A;  3BUM B;  2JXC A;  1J7P A;  3CTN A;  1PRW A;  4M2Q A;  4NDB A;  2MHH A;  4IL1 A;  3LL8 B;  1NCZ A;  1AVS A;  1QVI Z;  1SCV A;  2LP3 A;  1J1E A;  3TUY C;  4NDD A;  2F2P A;  1EG4 A;  2I18 A;  1UP5 A;  2L4I A;  3C1V A;  2EGD A;  3TS5 B;  1SCM B;  1SL7 A;  2DOQ A;  1DJW A;  1DGU A;  2JOJ A;  3HCM A;  3OHM B;  4MVF A;  2HQW A;  2JRF A;  4C0K A;  2LVK A;  1G8I A;  4BY4 A;  2OS8 B;  1JUO A;  1M39 A;  2BE6 A;  1JFJ A;  4MZK A;  3NSK A;  1OOJ A;  1K94 A;  1CLL A;  2JUL A;  2Q91 A;  1PVA A;  1AJ4 A;  4XYN A;  1CFD A;  4WRI A;  2H2K A;  4QJ4 B;  1OMD A;  1IQ3 A;  2H61 C;  2F3Y A;  4R1E A;  2I7A A;  1TNP A;  2F3Z A;  1TOP A;  2JU0 A;  5G08 A;  1Y0V H;  1F71 A;  5HKW A;  2OPO A;  4HRE E;  4OVN F;  1A03 A;  4PE4 A;  1JWD A;  4YGC B;  1IJ5 A;  2LHL A;  1J7R A;  4U8D A;  5AER A;  1NSH A;  2HET A;  1CDM A;  4I5K A;  1BOD A;  5HKY A;  1NX1 A;  2LP2 A;  4D1E A;  2JZI A;  5CPV A;  4DCK A;  4I5J A;  1YX8 A;  3DVK A;  4MN0 A;  4WQ2 A;  1CB1 A;  4CPV A;  4NDC A;  5F6T A;  1BJF A;  3CWG A;  3DF0 A;  1B1G A;  1SW8 A;  1CMF A;  2M49 B;  1AP4 A;  4AQJ A;  1KK7 Y;  3WHT B;  3E3R A;  2M8U A;  3PM8 A;  5IBW A;  1H8B A;  1OZO A;  1J7Q A;  4XJK A;  2LMU A;  1XFZ O;  3I5H C;  1XFY O;  1B8C A;  4N1F A;  1NX0 A;  1J7O A;  1L2O B;  1R6P A;  2B1U A;  2M1U A;  3QRX A;  4YI9 A;  3PN7 C;  2M7L A;  1K2H A;  4ORB B;  2EHB A;  1WRZ A;  1XFX O;  1CM4 A;  1IWQ A;  1UHJ A;  3KPX A;  1QIW A;  4HRH A;  2WCE A;  4OV2 A;  1AHR A;  3SJS A;  1OE9 B;  1QV0 A;  4ICB A;  1LVC D;  1F8H A;  1MR8 A;  3SG6 A;  4DUQ A;  3WNX B;  3IQQ A;  4PE1 A;  3TUY B;  4ETO A;  1C7W A;  1GGW A;  3PLF B;  3O2P A;  4GFT A;  1WDC C;  3NSI A;  4TNC A;  2WCB A;  1U5I B;  5B8I B;  2CXJ A;  1YUU A;  1SBJ A;  5HYD A;  1PSB A;  1LIN A;  1K8U A;  1DT7 B;  3IF7 A;  1FF1 A;  3CGA A;  2KI6 D;  5ER5 A;  1IGV A;  2MRD A;  1ZOT B;  2WOR A;  1YVL A;  1TRF A;  4USL A;  1ZMZ A;  2KQ6 A;  2KYC A;  4PHN A;  1C7V A;  3AKA A;  1B9A A;  3TDI A;  5I2L A;  2CTN A;  3CLN A;  1MHO A;  2KQY A;  2LUC A;  1QXP A;  1NIW A;  3CZT X;  2K7O A;  2ZN8 A;  3KO0 A;  1B8R A;  1WLZ A;  4ORA B;  3DVJ A;  2BBN A;  2HF5 A;  1FBV A;  1RWY A;  2KGR A;  1XFW O;  1S6J A;  1QLS A;  3BXK A;  2JT0 A;  1QJT A;  1Q80 A;  4ZCU A;  1B7T Z;  1KQM C;  1TNQ A;  3FWC A;  1KK8 C;  2AAO A;  4MRX A;  1WLM A;  2RGI A;  4WQ3 A;  1L7Z A;  2L50 A;  4GUK A;  1WY9 A;  4MEW A;  1M45 A;  1UHI A;  3SG3 A;  1S26 D;  2GGZ A;  2HQ8 A;  5CSF A;  1A75 B;  2JT8 A;  1DJG A;  1KFX S;  1M63 B;  3SG4 A;  3O6B A;  1BU3 A;  1WRK A;  1NYA A;  2M1K B;  1V1G A;  3EVR A;  2LLT A;  1K93 D;  2NCP A;  3GK4 X;  1KFX L;  1CLM A;  4I5L B;  3AAJ A;  3EVU A;  4PAL A;  3RM1 A;  1DF0 B;  2LAN A;  3PN7 B;  3F45 A;  5CSI A;  4GGN A;  1B4C A;  5D69 A;  1YX7 A;  5JJG A;  4YGE B;  1ZFS A;  2WC8 A;  2NXQ A;  1B8L A;  1G4Y R;  4M2O A;  1K90 D;  2KI4 C;  2LMV A;  3JTD C;  1DJH A;  1G33 A;  2NZ0 A;  1XYD A;  2JXL A;  3MSE B;  3EK7 A;  1XFU O;  1TIZ A;  2WND A;  3OX6 A;  3IQO A;  5AAN A;  2LM5 A;  5PAL A;  1QV1 A;  1ZUZ A;  1SR6 C;  1IQ5 A;  4M2P A;  4PE0 A;  2GV5 A;  4YI8 A;  1CKK A;  1RK9 A;  1HQV A;  2PRU A;  1N2D A;  3DVE A;  1PAL A;  4MRY A;  2EC6 B;  1XK4 C;  2Y1N A;  3HX4 A;  4OKH A;  2E30 A;  3PFV A;  1U5I A;  1MWN A;  2CBL A;  4AOM A;  2KBM A;  4YBH B;  1NX2 A;  4CFQ A;  1XVJ A;  2I2R E;  3VGO A;  4CFR A;  1GGZ A;  4QJ3 B;  1S6I A;  2FCE A;  2KFG A;  3I5I C;  5ER4 X;  1F54 A;  3A4U B;  4DIR A;  2KFF A;  2KSP A;  2PAS A;  2KI6 C;  2Q4U A;  1S5G Y;  2H61 A;  2QPT A;  3LK0 A;  3OX5 A;  3D0Y B;  4GGF C;  1NX3 A;  1JC2 A;  3LCP C;  1FPW A;  1EL4 A;  3JVT C;  1K95 A;  3O4Y A;  2LC5 A;  1N0Y A;  4A4B A;  1F55 A;  1NWD A;  2BL0 C;  1CFP A;  4E68 A;  1UHN A;  2L4H A;  3PAT A;  1XFV O;  1KWO C;  5I2Q A;  2ZKM X;  1QAT A;  1CFF A;  1QTX A;  1YUS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...