2MAZA

Backbone 1h, 13c, and 15n chemical shift assignments for bovine apo calbindin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
75
structure length
75
Chain Sequence
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGMSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Prot3DNMR: A Simple and Swift NMR Strategy for Three-Dimensional Structure Determination of Proteins
rcsb
source organism Bos taurus
molecule tags Metal binding protein
molecule keywords Protein S100-G
total genus 22
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2013-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2mazA00
1XFVO 3DF0A 2O60A 1K2HA 4DS7A 3GK1A 2KGBC 1V1FA 1F4QA 2MHHA 1Y1UA 2G2BA 3EK8A 2KAYA 4M2OA 1YVLA 1ZACA 1QV0A 2BBMA 1FI5A 1EG4A 1QLSA 1KK7Z 1KSMA 4YGDB 3BOWB 1WLMA 2Y5IA 2AAOA 5BPJA 1A2XA 1K95A 1RFJA 1CFPA 3BUXB 3EVUA 1B8RA 1KK8B 4E68A 1JWDA 1HT9A 2L51A 1YRUB 4A4BA 1LKJA 2I94A 1M45A 1R2UA 1DF0A 2BBNA 1DJXA 2I2RE 1YX8A 1J7PA 2FCEA 1RTP1 4MEWA 1B47A 2LM5A 1BR4B 2JZIA 3CLNA 3FIAA 3SG7A 2M29A 1OMDA 3GK2A 2H61A 2R2IA 1XFUO 3LK1A 3TS5B 2JRFA 1SCMC 3CR2A 4ORBB 1NWDA 2NCOA 3KPXA 1E8AA 1CM4A 1SBJA 5AANA 3SG4A 1KK8C 3NSOA 4MN0A 2NCPA 3I5FC 4U8DA 2OS8C 1UHNA 2ZNEA 3PALA 4AQJA 1SMGA 5D69A 2M0RA 3JVTB 2K7BA 2L2EA 1L2OB 4MZLA 1S36A 1K9PA 1K9KA 2K2FA 5KTYA 3IF7A 4ICBA 1XO5A 1OQPA 3C1VA 1F55A 1QS7A 1QX7A 3K21A 4P2YB 1EJ3A 2OTGB 1Q80A 2NXQA 2COLB 3OB2B 1SKTA 1K93D 1UP5A 4P5OE 4QJ3B 1JFKA 3OP0A 4ETOA 5CPVA 4OVNF 2F2PA 1F4OA 1OOJA 4OCIA 3PN7C 1GGWA 3I5HB 1M46A 1PSBA 1D1OA 4YBHB 2FJUB 1VRKA 2LE9B 4OR9B 4AQIA 1SYMA 4GFTA 1BOCA 1H4BA 4PHKA 1ZFSA 1TCFA 4MZKA 1DMOA 2JNXA 4PE0A 1KK7Y 2D8NA 2KFHA 4DIRA 2PMYA 1OMRA 2Q4UA 1IGVA 5I8NA 1IJ5A 1B9AA 1ALWA 1DVIA 2LV7A 3AKBA 2OS8B 4PE7A 5DKRA 2KAXA 2F3ZA 1B8LA 4CPVA 3CS1A 2BE6A 3I5IC 1WDCB 1NX1A 1DJZA 1KFXS 1S5GZ 1TN4A 2KGRA 4QJ4B 2PASA 1JF2A 1TCOB 3KO0A 1SCMB 3EKHA 5HLVA 2F33A 1NCZA 2KYFA 1G8IA 4NDCA 1H8BA 2E6WA 4PE1A 4DCKA 1XFXO 1QATA 1B4CA 2KFFA 2KI6D 2ZRTA 2QPTA 5CSIA 2KNEA 1F71A 2KI4C 5TNCA 1IG5A 5AXIA 1U5IA 2PRUA 4CFQA 1CDLA 1NX2A 1S6CA 2CNPA 1YR5A 2F2OA 2NLNA 3SIAA 2WNDA 1CKKA 1CLLA 2LHLA 4PDZA 1C7WA 2K8MB 4HSZA 1WRKA 4PHMA 3AAJA 2KQ6A 3O6BA 1HQVA 2K61A 2JT8A 3TDIA 2Y4QA 4MSPA 4MRXA 4HRHA 4N1FA 1AUIB 3F45A 2M7LA 3PATA 4C0JA 4C0LA 1IH0A 3BUNB 3LL8B 2TN4A 1KWOB 4JWQA 1IRJA 2FOTA 2LLTA 5IBWA 3PFVA 1SK6D 2P6BB 3ZWHA 3H4SE 1LXFC 1CMGA 3VRRA 2Q91A 1ZUZA 5ER4X 3RLZA 1ZOTB 1CDMA 5HKWA 1AP4A 1OZSA 2H2KA 2BKIB 1K8UA 5AEQA 3LCPC 1DJYA 1UWOA 1TNXA 1JFJA 2Y1MA 4I5NB 2M8UA 1U5IB 2LP2A 2LMUA 1QJTA 2BL0B 2LANA 1AVSA 1KFXL 1WRZA 1DGUA 1YUTA 1MQ1A 2KYCA 2AMIA 2KOTA 2VRGA 2E30A 5J3XA 1AK8A 3TS5C 1BLQA 1Y6WA 1B7TZ 2CXJA 4F0ZB 5DKQA 4PALA 1YX7A 4I5KA 1PVBA 1XA5A 3OB1B 4MVFA 1FF1A 3ZNIA 1YUSA 4XJKB 2JT0A 1AJ5A 3BQ3A 4CLNA 1WY9A 2EC6C 3O4YA 1SL9A 1YTZC 2FCDA 4N5XA 2L0PA 1CB1A 1A75A 3IQOA 3CWGA 3CR5X 3A4UB 3M0WA 1K96A 3LLEA 3E3RA 4HREE 1QVIY 3FS7A 4D1EA 1GJYA 2MJWB 1QVIZ 3SG5A 1CTRA 2HPSA 1YUUA 2LMTA 1RROA 5B8IB 2L4IA 2HF5A 1QXPA 1YVHA 4YGCB 4QJ5B 1C07A 1S1EA 3GOFA 1UHKA 5JOLA 1FI6A 3NXAA 1DJGA 1QX2A 2JC2A 4GUKA 1DF0B 4MLWA 1B8CA 1SR6C 3PSRA 1KCYA 4I5JA 1RECA 2CCMA 2BE4A 5AFPA 2KFGA 1Y1XA 3WHTB 1UURA 3SG2A 2JQ6A 1FPWA 1F8HA 4HRGA 1KFUL 2LUCA 2LAPA 2V53A 2L5XB 2JNFA 3BXKA 4JQ0D 3FWCA 2KDHA 2F8PA 4AOMA 4OV2A 3VRNA 4R1EA 3VROA 3TZ1A 2B1UA 3MSEB 4M2QA 1DJHA 2CBLA 2K7DA 1BF5A 2JU0A 4GGFA 1JUOA 1KQMC 3LK0A 4DUQA 3DVEA 3EK4A 1TTXA 1IKUA 1RWYA 1WLZA 1A4PA 1S6JA 4FTGA 4JPZB 4L9MA 1K94A 1IQ5A 2JULA 1BU3A 1CM1A 1XK4C 4XJKA 3D0YA 1SR6B 1TNQA 4GNKB 4UPGA 4BY4A 1LINA 4Q04A 1DT7B 3CGAA 1WDCC 2M97A 1X02A 2DOQA 1NSHA 2MBXA 1KSOA 5JJGA 2BKHB 4USLA 2JOJA 3SG6A 1L2OC 4YRUA 3OX6A 1G33A 2K0JA 2LC5A 1MHOA 2SASA 1OSAA 3EK7A 1B1GA 3JTDC 1B7TY 1Y1AA 1NIWA 2WC8A 2MLEC 1PSRA 1UUSA 1PK0D 3TDZA 1BJFA 1SL8A 3IQQA 2JWWA 3PLFB 5F6TA 1JC2A 1EH2A 1SCVA 2WOSA 1XVJA 1XFYO 1IWQA 1IJ6A 2WCFA 3DD4A 1J55A 3ICBA 2EC6B 1YRTB 1N0YA 2ZN9A 2GV5A 1GQMA 2LUXA 3VGOA 2LLSA 5I2QA 4GBAA 2NZ0A 2WORA 1CDPA 2BCBA 1M39A 2K7CA 3OHMB 1CLBA 5I2OA 3D0YB 1OE9B 3NSLA 3SJSA 1LA0A 1NX3A 2BL0C 3I5IB 2M1KB 3D10A 3I5FB 1EG3A 1SL7A 2SCPA 4CFRA 3PM8A 5KSZA 1CFCA 1CMFA 3BUMB 1S3PA 1TNPA 1UHJA 1J7QA 3O78A 1AJ4A 1RK9A 1BG1A 1W7JB 4CIDA 4PHJA 4NDDA 2EHBA 2OTGC 2MRDA 1AHRA 5HLOA 1FW4A 4WRIA 1BMOA 1UHHA 5GQQC 1QIWA 3SIBA 3HX4A 4ZCUA 1K90D 5D7FA 1OMVA 1SY9A 2BCXA 3DVJA 1SRAA 4OKHA 1ODBA 3TDUA 1OZOA 1ALVA 1KWOC 3BYAA 1J1DA 3EKJA 2CTNA 2A4JA 2L4HA 4YGBB 5CSJA 1XYDA 1MUXA 3I5GC 3CR4X 1TRFA 3CTNA 5HYDA 1S6IA 2WCEA 1J7RA 3AKAA 1QV1A 1BR1B 2G9BA 3FWBA 4XYNA 2MLFC 3BUWB 1N65A 2KI4B 1S26D 2HQ8A 1S5GY 3DF0B 5PALA 1MF8B 1TOPA 4C0KA 1SW8A 2LVVA 2OPOA 2WCBA 1CFDA 2LLUA 2AUCA 1DJIA 1UHIA 4PE4A 4M2PA 1PALA 3KHEA 2L98A 2O5GA 1JF0A 4ZCVA 3CZTX 1L7ZA 4MZJA 3I5GB 1A75B 1A29A 1LVCD 1TNWA 1FBVA 2JT3A 4PCWA 2K7OA 2ZFDA 3TUYB 2EGDA 1J1EA 1V1GA 1C7VA 2MAZA 3NSKA 3VRPA 3GK4X 2PVBA 3HCMA 2ZKMX 2GGZA 3O2PA 2I18A 1Y0VH 1SNLA 1NP8A 3OX5A 3JTDB 1NX0A 1XFZO 2JPTA 4GPLB 2L50A 3WXAA 2LP3A 4PHNA 2M7NA 5K89A 3DVKA 4YI9A 2I7AA 4WQ3A 5DKNA 1RJVA 4GGFC 4NDBA 4MBEA 3VRQA 3KF9A 3JVTC 1BODA 2PSRA 5AERA 2LVKA 1NCXA 1NPQA 2MA2A 2F3YA 4NQGA 4BY5A 2ZRSA 1QTXA 1K9UA 2KI6C 2PALA 1LA3A 4FQOA 2HETA 2LHIA 2JTZA 1PULA 1J7OA 2JXLA 1DTLA 1NYAA 4TNCA 2KBIA 3EVVA 2KSPA 1F54A 1SPYA 1EL4A 3SG3A 1M31A 1CDNA 3TUYC 1TIZA 5FYXA 1MXEA 1BT6A 4IL1A 1W7IB 3KEVA 2ZNDA 1CLMA 1PRWA 2KAVA 2ZN8A 2K2AA 1PVAA 4YI8A 5G08A 2HQWA 4MRYA 2QACA 3QRXA 3WNXB 1QASA 2ISDA 4I5LB 2LNKA 3RM1A 1QLKA 2M1UA 1IQ3A 5HKZA 2LCPA 1F70A 1G4YR 1JBAA 1CNPA 5CSFA 1XK4A 1EXRA 1YURA 1R6PA 2IS9A 1MWNA 4ORCB 1M63B 2M49B 1CFFA 2M9GA 5HKYA 1WRLA 2LMVA 1ZMZA 1N2DA 1DJWA 5I2LA 2BECA 4WQ2A 3EVRA 4GAOA 1XFWO 2H61C 4DRWA 1MXLC 2BCAA 1KQMB 2RGIA 2CT9A 2GGMA 2LVIA 1JSAA 1A03A 2KQYA 5CSNA 1QX5B 3AAKA 1GGZA 2M3WA 1DGVA 2Y1NA 3A8RA 4YGAA 5ER5A 4ORAB 1NCYA 2KHNA 2JXCA 2JTTA 4N1GA 3WHUB 1KQVA 1NUBA 3BOWA 1QIVA 3DVMA 3I5HC 3PN7B 4GGNA 2LVJA 1KFUS 2KBMA 3NSIA 4A4CA 1MR8A 3BUOB 5KU1A 4YGEB
chains in the Genus database with same CATH superfamily
1XFVO 3DF0A 2O60A 1K2HA 4DS7A 3L4AA 3GK1A 2KGBC 1V1FA 3S0GA 1F4QA 2MHHA 1Y1UA 2G2BA 3EK8A 2KAYA 4M2OA 1YVLA 1ZACA 1QV0A 2BBMA 1FI5A 1EG4A 2WCMA 2QEOA 1QLSA 1KK7Z 1KSMA 4YGDB 3BOWB 1WLMA 2Y5IA 2AAOA 5BPJA 3R1VA 1A2XA 1K95A 1RFJA 3DYEA 1CFPA 3BUXB 3EVUA 1B8RA 1C3ZA 1KK8B 3BJHA 4E68A 1JWDA 1HT9A 2L51A 1YRUB 4A4BA 1LKJA 2I94A 1M45A 1R2UA 1DF0A 2BBNA 1DJXA 3L4LA 2I2RE 1YX8A 1J7PA 2FCEA 1RTP1 3K1EA 4MEWA 2KLDA 1B47A 2LM5A 5D3OA 1BR4B 2JZIA 3CLNA 3FIAA 3SG7A 2M29A 1OMDA 3GK2A 2H61A 2R2IA 1XFUO 3LK1A 3TS5B 2JRFA 1SCMC 3CR2A 4ORBB 1NWDA 2NCOA 3KPXA 1E8AA 1CM4A 2PQLA 1SBJA 5AANA 3SG4A 3BFHA 1KK8C 3NSOA 4MN0A 3CDNA 1XFRA 2NCPA 3CZ2A 3I5FC 4U8DA 2OS8C 1UHNA 2ZNEA 3PALA 3R1PA 4AQJA 1SMGA 5D69A 2M0RA 3JVTB 2K7BA 2L2EA 1L2OB 3D76A 4MZLA 1S36A 1K9PA 1K9KA 2K2FA 5KTYA 3IF7A 4ICBA 1XO5A 1OQPA 3FE6A 3C1VA 3B7AA 1F55A 1QS7A 1QX7A 2QDIA 3K21A 4P2YB 1EJ3A 2OTGB 1Q80A 1TWOA 2COLB 2NXQA 3OB2B 1SKTA 1K93D 1UP5A 4P5OE 4QJ3B 1JFKA 3OP0A 4ETOA 5CPVA 4OVNF 2F2PA 1F4OA 1OOJA 4OCIA 3PN7C 1GGWA 3I5HB 1M46A 1PSBA 5FI7A 4YBHB 2FJUB 1D1OA 1VRKA 2LE9B 4OR9B 4AQIA 1SYMA 2BNXA 4GFTA 1BOCA 1H4BA 4PHKA 1ZFSA 1TCFA 3BFAA 4MZKA 1DMOA 2JNXA 1P28A 4PE0A 5I94A 1KK7Y 2D8NA 2KFHA 1ORGA 2PMYA 4DIRA 1OMRA 2Q4UA 1IGVA 5I8NA 1IJ5A 1B9AA 1ALWA 1DVIA 2LV7A 3AKBA 2OS8B 4PE7A 5DKRA 2KAXA 2F3ZA 1B8LA 4CPVA 3CS1A 2BE6A 3I5IC 1WDCB 1NX1A 3SS5A 1DJZA 1KFXS 1S5GZ 1TN4A 2KGRA 4QJ4B 2PASA 1JF2A 1TCOB 3KO0A 1Z2CB 1SCMB 3NGVA 3EKHA 5HLVA 2F33A 1NCZA 2KYFA 1Z4HA 1G8IA 4NDCA 1H8BA 2E6WA 2JPOA 4PE1A 2P71A 4DCKA 3D75A 1XFXO 1QATA 1B4CA 2KFFA 2KI6D 2ZRTA 3FE8A 2QPTA 5CSIA 4F7FA 2KNEA 2P70A 1F71A 2KI4C 5TNCA 1IG5A 4INXA 5AXIA 2WCHA 1U5IA 2PRUA 4CFQA 1CDLA 1NX2A 1S6CA 2CNPA 3OBVA 1YR5A 2F2OA 2NLNA 3SIAA 2WNDA 1CKKA 1CLLA 2LHLA 4PDZA 1C7WA 2K8MB 4HSZA 1WRKA 4PHMA 3AAJA 2KQ6A 3O6BA 1HQVA 2K61A 2JT8A 3SS3A 3TDIA 2Y4QA 4MSPA 4MRXA 1LS8A 4HRHA 4N1FA 1AUIB 3F45A 2M7LA 3PATA 4C0JA 4C0LA 1IH0A 3BUNB 3LL8B 2TN4A 1KWOB 3FE9A 4JWQA 1IRJA 2FOTA 2LLTA 5IBWA 3PFVA 2WC6A 3CZ1A 1SK6D 2P6BB 3ZWHA 3H4SE 1LXFC 1CMGA 3DZTA 3D78A 3VRRA 2Q91A 2K60A 1ZUZA 3OGNA 5ER4X 3RLZA 1ZOTB 1CDMA 5HKWA 1AP4A 1OZSA 2H2KA 2BKIB 1K8UA 5AEQA 3LCPC 1DJYA 1GM0A 1UWOA 1TNXA 1JFJA 2Y1MA 4I5NB 2M8UA 1U5IB 2LP2A 2LMUA 1QJTA 2BL0B 2LANA 1AVSA 1KFXL 1WRZA 1DGUA 1YUTA 1MQ1A 2KYCA 2AMIA 2KOTA 2VRGA 2E30A 5J3XA 1AK8A 3TS5C 1BLQA 1Y6WA 1B7TZ 2CXJA 4F0ZB 5DKQA 4PALA 1YX7A 4I5KA 1PVBA 1XA5A 3OB1B 4MVFA 1FF1A 3ZNIA 1YUSA 4XJKB 2JT0A 1AJ5A 3BQ3A 4CLNA 1WY9A 2EC6C 3O4YA 1SL9A 3CABA 1YTZC 2FCDA 4N5XA 2L0PA 1CB1A 1A75A 2WCJA 3IQOA 3CWGA 3CR5X 3A4UB 3M0WA 1K96A 3LLEA 3E3RA 4HREE 1QVIY 3FS7A 4D1EA 1GJYA 2MJWB 1QVIZ 3SG5A 1CTRA 2HPSA 1YUUA 3BFBA 2LMTA 1RROA 5B8IB 2L4IA 1QXPA 1YVHA 2HF5A 4YGCB 4QJ5B 1C07A 1S1EA 3GOFA 1UHKA 5JOLA 1FI6A 3NXAA 1DJGA 1QX2A 2JC2A 4GUKA 1DF0B 4MLWA 1B8CA 1SR6C 3PSRA 1KCYA 4I5JA 1RECA 2CCMA 2BE4A 5AFPA 3L47A 1W9ZA 2KFGA 5EL2A 1Y1XA 3WHTB 1UURA 3SG2A 2JQ6A 1FPWA 1F8HA 4HRGA 1KFUL 2LUCA 2LAPA 2V53A 2L5XB 2JNFA 3BXKA 4JQ0D 3FWCA 2KDHA 2F8PA 4AOMA 4OV2A 3VRNA 1QWVA 4R1EA 3VROA 2ERBA 3TZ1A 2B1UA 3MSEB 4M2QA 1DJHA 2CBLA 1TUZA 2K7DA 2JU0A 3S0BA 1BF5A 4GGFA 1JUOA 1KQMC 3LK0A 4DUQA 3DVEA 3EK4A 1TTXA 1IKUA 1RWYA 1WLZA 1A4PA 1S6JA 3R72A 4FTGA 4JPZB 1K94A 1IQ5A 2JULA 1BU3A 4JKTA 1CM1A 4L9MA 4OZDA 1XK4C 4XJKA 1C3YA 3D0YA 1SR6B 1TNQA 1OOIX 4GNKB 4UPGA 4BY4A 1LINA 3UNWA 4Q04A 1DT7B 3CGAA 1WDCC 3D77A 2M97A 1X02A 2DOQA 1NSHA 3D74A 2MBXA 1KSOA 5JJGA 2BKHB 4USLA 2JOJA 3SG6A 1L2OC 2KPHA 3PM2A 4YRUA 3OX6A 1G33A 2K0JA 2LC5A 1MHOA 2SASA 1OSAA 3CZ0A 3EK7A 3JTDC 1B1GA 1B7TY 1Y1AA 1NIWA 2WC8A 3QMEA 2MLEC 1PSRA 1UUSA 1PK0D 1DEKA 3TDZA 1BJFA 1SL8A 3IQQA 4KYNA 2JWWA 2PYQA 3PLFB 5F6TA 1JC2A 1EH2A 1SCVA 3NHTA 2WOSA 1XVJA 1XFYO 1IWQA 1IJ6A 2WCFA 3DD4A 1J55A 3ICBA 2EC6B 1YRTB 1TUJA 3S0EA 1N0YA 2ZN9A 1DELA 1GQMA 2GV5A 2QEHA 2LUXA 3VGOA 2LLSA 3S0FA 5I2QA 4GBAA 2NZ0A 2WORA 1CDPA 2BCBA 1M39A 2K7CA 3OHMB 4FQTA 3Q8IA 1CLBA 5I2OA 3D0YB 1OE9B 3NSLA 3SJSA 4IJ7A 1LA0A 1NX3A 3SS4A 3IVTA 2BL0C 3N7HA 3I5IB 1DQEA 2M1KB 3D10A 3I5FB 1EG3A 1SL7A 2SCPA 4CFRA 3PM8A 5KSZA 1CFCA 1CMFA 3BUMB 1S3PA 1TNPA 1UHJA 1OOFA 1J7QA 3O78A 1AJ4A 1RK9A 1BG1A 1W7JB 4CIDA 4INWA 4PHJA 4NDDA 2EHBA 2OTGC 2MRDA 1AHRA 5HLOA 1FW4A 4WRIA 1BMOA 1UHHA 5GQQC 1QIWA 3SIBA 3HX4A 4ZCUA 1K90D 5D7FA 1OMVA 1SY9A 2BCXA 3DVJA 2L5YA 1SRAA 4OKHA 1ODBA 3TDUA 1OZOA 1ALVA 1KWOC 3BYAA 1J1DA 4JD9A 3EKJA 2CTNA 2A4JA 2L4HA 3B87A 4YGBB 5CSJA 1XYDA 2FJYA 2KLEA 1MUXA 3I5GC 3CR4X 1TRFA 3CTNA 5HYDA 1S6IA 2WCEA 1J7RA 3AKAA 1QV1A 1BR1B 2G9BA 3FWBA 4XYNA 2MLFC 3BUWB 1N65A 2H8VA 2KI4B 1S26D 2HQ8A 1S5GY 3DF0B 5PALA 3EG5B 1MF8B 1TOPA 4C0KA 1SW8A 2LVVA 2OPOA 2WCBA 1CFDA 2LLUA 2AUCA 1DJIA 1UHIA 4PE4A 4M2PA 1PALA 3KHEA 2L98A 2O5GA 1JF0A 4ZCVA 1OOGA 3CZTX 1L7ZA 3UO9A 4MZJA 3I5GB 1A75B 1A29A 1LVCD 1TNWA 3O4XA 5FI2A 1FBVA 2WCLA 2JT3A 3NHIA 4PCWA 3B88A 2K7OA 2ZFDA 3D73A 3B6XA 3TUYB 2EGDA 1J1EA 1V1GA 1SSEB 1C7VA 2WC5A 2MAZA 3NSKA 3VRPA 3GK4X 2PVBA 3HCMA 2ZKMX 2GGZA 3O2PA 2I18A 4PT1A 1Y0VH 1SNLA 2QEBA 1NP8A 3OX5A 3JTDB 1NX0A 1XFZO 2BAPA 2JPTA 4GPLB 2L50A 2WCKA 3WXAA 2LP3A 3DY9A 4PHNA 3S0DA 2M7NA 5K89A 3DVKA 4YI9A 2I7AA 4WQ3A 5DKNA 1RJVA 4GGFC 4NDBA 4MBEA 3VRQA 3KF9A 3JVTC 1BODA 2PSRA 2YGUA 2LVKA 5AERA 1NCXA 1NPQA 2MA2A 2F3YA 4NQGA 4BY5A 2ZRSA 1QTXA 1K9UA 2KI6C 2PALA 1LA3A 4FQOA 2HETA 2LHIA 2JTZA 1PULA 1J7OA 2JXLA 1DTLA 1NYAA 4TNCA 2KBIA 3EVVA 2KSPA 1F54A 3DXLA 3CYZA 1SPYA 1EL4A 3SG3A 1M31A 3B86A 5HL1A 3TUYC 1CDNA 1TIZA 5FYXA 1MXEA 1BT6A 4IL1A 1W7IB 3KEVA 2ZNDA 1CLMA 1PRWA 2KAVA 2ZN8A 3V2LA 2K2AA 1PVAA 4YI8A 5G08A 2HQWA 4MRYA 2QACA 3QRXA 3WNXB 5FI6A 1QASA 2ISDA 3VB1A 4I5LB 2LNKA 3RM1A 1QLKA 2M1UA 1IQ3A 5HKZA 2LCPA 1F70A 1G4YR 1JBAA 2GTEA 5DICA 1CNPA 5CSFA 1IIOA 1XK4A 1EXRA 1OOHA 1YURA 3R1OA 1R6PA 1OW4A 2L2CA 2IS9A 1MWNA 1T14A 1M63B 2M49B 4ORCB 2M9GA 5HKYA 1WRLA 1CFFA 2LMVA 1ZMZA 2QEVA 1N2DA 1DC1A 1DJWA 5I2LA 2BECA 4WQ2A 3EVRA 4GAOA 1XFWO 2H61C 4DRWA 3RZSA 1MXLC 2BCAA 1KQMB 2RGIA 2CT9A 2GGMA 2LVIA 1JSAA 1A03A 2KQYA 5CSNA 1QX5B 3AAKA 1GGZA 2M3WA 3PJIA 1DGVA 2Y1NA 3A8RA 4YGAA 5ER5A 4ORAB 1NCYA 2KHNA 3S0AA 2JXCA 2JTTA 4N1GA 3WHUB 1KQVA 1NUBA 3BOWA 1QIVA 3DVMA 3I5HC 3PN7B 4GGNA 2LVJA 1KFUS 2KBMA 3NSIA 4A4CA 1MR8A 3BUOB 5KU1A 4YGEB
chains in the Genus database with same CATH topology
1XFVO 3DF0A 2O60A 1K2HA 4DS7A 3GK1A 2KGBC 1V1FA 1F4QA 2MHHA 1Y1UA 2G2BA 3EK8A 2KAYA 4M2OA 1YVLA 1ZACA 1QV0A 2BBMA 1FI5A 1EG4A 1QLSA 1KK7Z 1KSMA 4YGDB 3BOWB 1WLMA 2Y5IA 2AAOA 5BPJA 1A2XA 1K95A 1RFJA 1CFPA 3BUXB 3EVUA 1B8RA 1KK8B 4E68A 1JWDA 1HT9A 2L51A 1YRUB 4A4BA 1LKJA 2I94A 1M45A 1R2UA 1DF0A 2BBNA 1DJXA 2I2RE 1YX8A 1J7PA 2FCEA 1RTP1 4MEWA 1B47A 2LM5A 1BR4B 2JZIA 3CLNA 3FIAA 3SG7A 2M29A 1OMDA 3GK2A 2H61A 2R2IA 1XFUO 3LK1A 3TS5B 2JRFA 1SCMC 3CR2A 4ORBB 1NWDA 2NCOA 3KPXA 1E8AA 1CM4A 1SBJA 5AANA 3SG4A 1KK8C 3NSOA 4MN0A 2NCPA 3I5FC 4U8DA 2OS8C 1UHNA 2ZNEA 3PALA 4AQJA 1SMGA 5D69A 2M0RA 3JVTB 2K7BA 2L2EA 1L2OB 4MZLA 1S36A 1K9PA 1K9KA 2K2FA 5KTYA 3IF7A 4ICBA 1XO5A 1OQPA 3C1VA 1F55A 1QS7A 1QX7A 3K21A 4P2YB 1EJ3A 2OTGB 1Q80A 2NXQA 2COLB 3OB2B 1SKTA 1K93D 1UP5A 4P5OE 4QJ3B 1JFKA 3OP0A 4ETOA 5CPVA 4OVNF 2F2PA 1F4OA 1OOJA 4OCIA 3PN7C 1GGWA 3I5HB 1M46A 1PSBA 1D1OA 4YBHB 2FJUB 1VRKA 2LE9B 4OR9B 4AQIA 1SYMA 4GFTA 1BOCA 1H4BA 4PHKA 1ZFSA 1TCFA 4MZKA 1DMOA 2JNXA 4PE0A 1KK7Y 2D8NA 2KFHA 4DIRA 2PMYA 1OMRA 2Q4UA 1IGVA 5I8NA 1IJ5A 1B9AA 1ALWA 1DVIA 2LV7A 3AKBA 2OS8B 4PE7A 5DKRA 2KAXA 2F3ZA 1B8LA 4CPVA 3CS1A 2BE6A 3I5IC 1WDCB 1NX1A 1DJZA 1KFXS 1S5GZ 1TN4A 2KGRA 4QJ4B 2PASA 1JF2A 1TCOB 3KO0A 1SCMB 3EKHA 5HLVA 2F33A 1NCZA 2KYFA 1G8IA 4NDCA 1H8BA 2E6WA 4PE1A 4DCKA 1XFXO 1QATA 1B4CA 2KFFA 2KI6D 2ZRTA 2QPTA 5CSIA 2KNEA 1F71A 2KI4C 5TNCA 1IG5A 5AXIA 1U5IA 2PRUA 4CFQA 1CDLA 1NX2A 1S6CA 2CNPA 1YR5A 2F2OA 2NLNA 3SIAA 2WNDA 1CKKA 1CLLA 2LHLA 4PDZA 1C7WA 2K8MB 4HSZA 1WRKA 4PHMA 3AAJA 2KQ6A 3O6BA 1HQVA 2K61A 2JT8A 3TDIA 2Y4QA 4MSPA 4MRXA 4HRHA 4N1FA 1AUIB 3F45A 2M7LA 3PATA 4C0JA 4C0LA 1IH0A 3BUNB 3LL8B 2TN4A 1KWOB 4JWQA 1IRJA 2FOTA 2LLTA 5IBWA 3PFVA 1SK6D 2P6BB 3ZWHA 3H4SE 1LXFC 1CMGA 3VRRA 2Q91A 1ZUZA 5ER4X 3RLZA 1ZOTB 1CDMA 5HKWA 1AP4A 1OZSA 2H2KA 2BKIB 1K8UA 5AEQA 3LCPC 1DJYA 1UWOA 1TNXA 1JFJA 2Y1MA 4I5NB 2M8UA 1U5IB 2LP2A 2LMUA 1QJTA 2BL0B 2LANA 1AVSA 1KFXL 1WRZA 1DGUA 1YUTA 1MQ1A 2KYCA 2AMIA 2KOTA 2VRGA 2E30A 5J3XA 1AK8A 3TS5C 1BLQA 1Y6WA 1B7TZ 2CXJA 4F0ZB 5DKQA 4PALA 1YX7A 4I5KA 1PVBA 1XA5A 3OB1B 4MVFA 1FF1A 3ZNIA 1YUSA 4XJKB 2JT0A 1AJ5A 3BQ3A 4CLNA 1WY9A 2EC6C 3O4YA 1SL9A 1YTZC 2FCDA 4N5XA 2L0PA 1CB1A 1A75A 3IQOA 3CWGA 3CR5X 3A4UB 3M0WA 1K96A 3LLEA 3E3RA 4HREE 1QVIY 3FS7A 4D1EA 1GJYA 2MJWB 1QVIZ 3SG5A 1CTRA 2HPSA 1YUUA 2LMTA 1RROA 5B8IB 2L4IA 2HF5A 1QXPA 1YVHA 4YGCB 4QJ5B 1C07A 1S1EA 3GOFA 1UHKA 5JOLA 1FI6A 3NXAA 1DJGA 1QX2A 2JC2A 4GUKA 1DF0B 4MLWA 1B8CA 1SR6C 3PSRA 1KCYA 4I5JA 1RECA 2CCMA 2BE4A 5AFPA 2KFGA 1Y1XA 3WHTB 1UURA 3SG2A 2JQ6A 1FPWA 1F8HA 4HRGA 1KFUL 2LUCA 2LAPA 2V53A 2L5XB 2JNFA 3BXKA 4JQ0D 3FWCA 2KDHA 2F8PA 4AOMA 4OV2A 3VRNA 4R1EA 3VROA 3TZ1A 2B1UA 3MSEB 4M2QA 1DJHA 2CBLA 2K7DA 1BF5A 2JU0A 4GGFA 1JUOA 1KQMC 3LK0A 4DUQA 3DVEA 3EK4A 1TTXA 1IKUA 1RWYA 1WLZA 1A4PA 1S6JA 4FTGA 4JPZB 4L9MA 1K94A 1IQ5A 2JULA 1BU3A 1CM1A 1XK4C 4XJKA 3D0YA 1SR6B 1TNQA 4GNKB 4UPGA 4BY4A 1LINA 4Q04A 1DT7B 3CGAA 1WDCC 2M97A 1X02A 2DOQA 1NSHA 2MBXA 1KSOA 5JJGA 2BKHB 4USLA 2JOJA 3SG6A 1L2OC 4YRUA 3OX6A 1G33A 2K0JA 2LC5A 1MHOA 2SASA 1OSAA 3EK7A 1B1GA 3JTDC 1B7TY 1Y1AA 1NIWA 2WC8A 2MLEC 1PSRA 1UUSA 1PK0D 3TDZA 1BJFA 1SL8A 3IQQA 2JWWA 3PLFB 5F6TA 1JC2A 1EH2A 1SCVA 2WOSA 1XVJA 1XFYO 1IWQA 1IJ6A 2WCFA 3DD4A 1J55A 3ICBA 2EC6B 1YRTB 1N0YA 2ZN9A 2GV5A 1GQMA 2LUXA 3VGOA 2LLSA 5I2QA 4GBAA 2NZ0A 2WORA 1CDPA 2BCBA 1M39A 2K7CA 3OHMB 1CLBA 5I2OA 3D0YB 1OE9B 3NSLA 3SJSA 1LA0A 1NX3A 2BL0C 3I5IB 2M1KB 3D10A 3I5FB 1EG3A 1SL7A 2SCPA 4CFRA 3PM8A 5KSZA 1CFCA 1CMFA 3BUMB 1S3PA 1TNPA 1UHJA 1J7QA 3O78A 1AJ4A 1RK9A 1BG1A 1W7JB 4CIDA 4PHJA 4NDDA 2EHBA 2OTGC 2MRDA 1AHRA 5HLOA 1FW4A 4WRIA 1BMOA 1UHHA 5GQQC 1QIWA 3SIBA 3HX4A 4ZCUA 1K90D 5D7FA 1OMVA 1SY9A 2BCXA 3DVJA 1SRAA 4OKHA 1ODBA 3TDUA 1OZOA 1ALVA 1KWOC 3BYAA 1J1DA 3EKJA 2CTNA 2A4JA 2L4HA 4YGBB 5CSJA 1XYDA 1MUXA 3I5GC 3CR4X 1TRFA 3CTNA 5HYDA 1S6IA 2WCEA 1J7RA 3AKAA 1QV1A 1BR1B 2G9BA 3FWBA 4XYNA 2MLFC 3BUWB 1N65A 2KI4B 1S26D 2HQ8A 1S5GY 3DF0B 5PALA 1MF8B 1TOPA 4C0KA 1SW8A 2LVVA 2OPOA 2WCBA 1CFDA 2LLUA 2AUCA 1DJIA 1UHIA 4PE4A 4M2PA 1PALA 3KHEA 2L98A 2O5GA 1JF0A 4ZCVA 3CZTX 1L7ZA 4MZJA 3I5GB 1A75B 1A29A 1LVCD 1TNWA 1FBVA 2JT3A 4PCWA 2K7OA 2ZFDA 3TUYB 2EGDA 1J1EA 1V1GA 1C7VA 2MAZA 3NSKA 3VRPA 3GK4X 2PVBA 3HCMA 2ZKMX 2GGZA 3O2PA 2I18A 1Y0VH 1SNLA 1NP8A 3OX5A 3JTDB 1NX0A 1XFZO 2JPTA 4GPLB 2L50A 3WXAA 2LP3A 4PHNA 2M7NA 5K89A 3DVKA 4YI9A 2I7AA 4WQ3A 5DKNA 1RJVA 4GGFC 4NDBA 4MBEA 3VRQA 3KF9A 3JVTC 1BODA 2PSRA 5AERA 2LVKA 1NCXA 1NPQA 2MA2A 2F3YA 4NQGA 4BY5A 2ZRSA 1QTXA 1K9UA 2KI6C 2PALA 1LA3A 4FQOA 2HETA 2LHIA 2JTZA 1PULA 1J7OA 2JXLA 1DTLA 1NYAA 4TNCA 2KBIA 3EVVA 2KSPA 1F54A 1SPYA 1EL4A 3SG3A 1M31A 1CDNA 3TUYC 1TIZA 5FYXA 1MXEA 1BT6A 4IL1A 1W7IB 3KEVA 2ZNDA 1CLMA 1PRWA 2KAVA 2ZN8A 2K2AA 1PVAA 4YI8A 5G08A 2HQWA 4MRYA 2QACA 3QRXA 3WNXB 1QASA 2ISDA 4I5LB 2LNKA 3RM1A 1QLKA 2M1UA 1IQ3A 5HKZA 2LCPA 1F70A 1G4YR 1JBAA 1CNPA 5CSFA 1XK4A 1EXRA 1YURA 1R6PA 2IS9A 1MWNA 4ORCB 1M63B 2M49B 1CFFA 2M9GA 5HKYA 1WRLA 2LMVA 1ZMZA 1N2DA 1DJWA 5I2LA 2BECA 4WQ2A 3EVRA 4GAOA 1XFWO 2H61C 4DRWA 1MXLC 2BCAA 1KQMB 2RGIA 2CT9A 2GGMA 2LVIA 1JSAA 1A03A 2KQYA 5CSNA 1QX5B 3AAKA 1GGZA 2M3WA 1DGVA 2Y1NA 3A8RA 4YGAA 5ER5A 4ORAB 1NCYA 2KHNA 2JXCA 2JTTA 4N1GA 3WHUB 1KQVA 1NUBA 3BOWA 1QIVA 3DVMA 3I5HC 3PN7B 4GGNA 2LVJA 1KFUS 2KBMA 3NSIA 4A4CA 1MR8A 3BUOB 5KU1A 4YGEB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XFV O;  3DF0 A;  2O60 A;  1K2H A;  4DS7 A;  3GK1 A;  2KGB C;  1V1F A;  1F4Q A;  2MHH A;  1Y1U A;  2G2B A;  3EK8 A;  2KAY A;  4M2O A;  1YVL A;  1ZAC A;  1QV0 A;  2BBM A;  1FI5 A;  1EG4 A;  1QLS A;  1KK7 Z;  1KSM A;  4YGD B;  3BOW B;  1WLM A;  2Y5I A;  2AAO A;  5BPJ A;  1A2X A;  1K95 A;  1RFJ A;  1CFP A;  3BUX B;  3EVU A;  1B8R A;  1KK8 B;  4E68 A;  1JWD A;  1HT9 A;  2L51 A;  1YRU B;  4A4B A;  1LKJ A;  2I94 A;  1M45 A;  1R2U A;  1DF0 A;  2BBN A;  1DJX A;  2I2R E;  1YX8 A;  1J7P A;  2FCE A;  1RTP 1;  4MEW A;  1B47 A;  2LM5 A;  1BR4 B;  2JZI A;  3CLN A;  3FIA A;  3SG7 A;  2M29 A;  1OMD A;  3GK2 A;  2H61 A;  2R2I A;  1XFU O;  3LK1 A;  3TS5 B;  2JRF A;  1SCM C;  3CR2 A;  4ORB B;  1NWD A;  2NCO A;  3KPX A;  1E8A A;  1CM4 A;  1SBJ A;  5AAN A;  3SG4 A;  1KK8 C;  3NSO A;  4MN0 A;  2NCP A;  3I5F C;  4U8D A;  2OS8 C;  1UHN A;  2ZNE A;  3PAL A;  4AQJ A;  1SMG A;  5D69 A;  2M0R A;  3JVT B;  2K7B A;  2L2E A;  1L2O B;  4MZL A;  1S36 A;  1K9P A;  1K9K A;  2K2F A;  5KTY A;  3IF7 A;  4ICB A;  1XO5 A;  1OQP A;  3C1V A;  1F55 A;  1QS7 A;  1QX7 A;  3K21 A;  4P2Y B;  1EJ3 A;  2OTG B;  1Q80 A;  2NXQ A;  2COL B;  3OB2 B;  1SKT A;  1K93 D;  1UP5 A;  4P5O E;  4QJ3 B;  1JFK A;  3OP0 A;  4ETO A;  5CPV A;  4OVN F;  2F2P A;  1F4O A;  1OOJ A;  4OCI A;  3PN7 C;  1GGW A;  3I5H B;  1M46 A;  1PSB A;  1D1O A;  4YBH B;  2FJU B;  1VRK A;  2LE9 B;  4OR9 B;  4AQI A;  1SYM A;  4GFT A;  1BOC A;  1H4B A;  4PHK A;  1ZFS A;  1TCF A;  4MZK A;  1DMO A;  2JNX A;  4PE0 A;  1KK7 Y;  2D8N A;  2KFH A;  4DIR A;  2PMY A;  1OMR A;  2Q4U A;  1IGV A;  5I8N A;  1IJ5 A;  1B9A A;  1ALW A;  1DVI A;  2LV7 A;  3AKB A;  2OS8 B;  4PE7 A;  5DKR A;  2KAX A;  2F3Z A;  1B8L A;  4CPV A;  3CS1 A;  2BE6 A;  3I5I C;  1WDC B;  1NX1 A;  1DJZ A;  1KFX S;  1S5G Z;  1TN4 A;  2KGR A;  4QJ4 B;  2PAS A;  1JF2 A;  1TCO B;  3KO0 A;  1SCM B;  3EKH A;  5HLV A;  2F33 A;  1NCZ A;  2KYF A;  1G8I A;  4NDC A;  1H8B A;  2E6W A;  4PE1 A;  4DCK A;  1XFX O;  1QAT A;  1B4C A;  2KFF A;  2KI6 D;  2ZRT A;  2QPT A;  5CSI A;  2KNE A;  1F71 A;  2KI4 C;  5TNC A;  1IG5 A;  5AXI A;  1U5I A;  2PRU A;  4CFQ A;  1CDL A;  1NX2 A;  1S6C A;  2CNP A;  1YR5 A;  2F2O A;  2NLN A;  3SIA A;  2WND A;  1CKK A;  1CLL A;  2LHL A;  4PDZ A;  1C7W A;  2K8M B;  4HSZ A;  1WRK A;  4PHM A;  3AAJ A;  2KQ6 A;  3O6B A;  1HQV A;  2K61 A;  2JT8 A;  3TDI A;  2Y4Q A;  4MSP A;  4MRX A;  4HRH A;  4N1F A;  1AUI B;  3F45 A;  2M7L A;  3PAT A;  4C0J A;  4C0L A;  1IH0 A;  3BUN B;  3LL8 B;  2TN4 A;  1KWO B;  4JWQ A;  1IRJ A;  2FOT A;  2LLT A;  5IBW A;  3PFV A;  1SK6 D;  2P6B B;  3ZWH A;  3H4S E;  1LXF C;  1CMG A;  3VRR A;  2Q91 A;  1ZUZ A;  5ER4 X;  3RLZ A;  1ZOT B;  1CDM A;  5HKW A;  1AP4 A;  1OZS A;  2H2K A;  2BKI B;  1K8U A;  5AEQ A;  3LCP C;  1DJY A;  1UWO A;  1TNX A;  1JFJ A;  2Y1M A;  4I5N B;  2M8U A;  1U5I B;  2LP2 A;  2LMU A;  1QJT A;  2BL0 B;  2LAN A;  1AVS A;  1KFX L;  1WRZ A;  1DGU A;  1YUT A;  1MQ1 A;  2KYC A;  2AMI A;  2KOT A;  2VRG A;  2E30 A;  5J3X A;  1AK8 A;  3TS5 C;  1BLQ A;  1Y6W A;  1B7T Z;  2CXJ A;  4F0Z B;  5DKQ A;  4PAL A;  1YX7 A;  4I5K A;  1PVB A;  1XA5 A;  3OB1 B;  4MVF A;  1FF1 A;  3ZNI A;  1YUS A;  4XJK B;  2JT0 A;  1AJ5 A;  3BQ3 A;  4CLN A;  1WY9 A;  2EC6 C;  3O4Y A;  1SL9 A;  1YTZ C;  2FCD A;  4N5X A;  2L0P A;  1CB1 A;  1A75 A;  3IQO A;  3CWG A;  3CR5 X;  3A4U B;  3M0W A;  1K96 A;  3LLE A;  3E3R A;  4HRE E;  1QVI Y;  3FS7 A;  4D1E A;  1GJY A;  2MJW B;  1QVI Z;  3SG5 A;  1CTR A;  2HPS A;  1YUU A;  2LMT A;  1RRO A;  5B8I B;  2L4I A;  2HF5 A;  1QXP A;  1YVH A;  4YGC B;  4QJ5 B;  1C07 A;  1S1E A;  3GOF A;  1UHK A;  5JOL A;  1FI6 A;  3NXA A;  1DJG A;  1QX2 A;  2JC2 A;  4GUK A;  1DF0 B;  4MLW A;  1B8C A;  1SR6 C;  3PSR A;  1KCY A;  4I5J A;  1REC A;  2CCM A;  2BE4 A;  5AFP A;  2KFG A;  1Y1X A;  3WHT B;  1UUR A;  3SG2 A;  2JQ6 A;  1FPW A;  1F8H A;  4HRG A;  1KFU L;  2LUC A;  2LAP A;  2V53 A;  2L5X B;  2JNF A;  3BXK A;  4JQ0 D;  3FWC A;  2KDH A;  2F8P A;  4AOM A;  4OV2 A;  3VRN A;  4R1E A;  3VRO A;  3TZ1 A;  2B1U A;  3MSE B;  4M2Q A;  1DJH A;  2CBL A;  2K7D A;  1BF5 A;  2JU0 A;  4GGF A;  1JUO A;  1KQM C;  3LK0 A;  4DUQ A;  3DVE A;  3EK4 A;  1TTX A;  1IKU A;  1RWY A;  1WLZ A;  1A4P A;  1S6J A;  4FTG A;  4JPZ B;  4L9M A;  1K94 A;  1IQ5 A;  2JUL A;  1BU3 A;  1CM1 A;  1XK4 C;  4XJK A;  3D0Y A;  1SR6 B;  1TNQ A;  4GNK B;  4UPG A;  4BY4 A;  1LIN A;  4Q04 A;  1DT7 B;  3CGA A;  1WDC C;  2M97 A;  1X02 A;  2DOQ A;  1NSH A;  2MBX A;  1KSO A;  5JJG A;  2BKH B;  4USL A;  2JOJ A;  3SG6 A;  1L2O C;  4YRU A;  3OX6 A;  1G33 A;  2K0J A;  2LC5 A;  1MHO A;  2SAS A;  1OSA A;  3EK7 A;  1B1G A;  3JTD C;  1B7T Y;  1Y1A A;  1NIW A;  2WC8 A;  2MLE C;  1PSR A;  1UUS A;  1PK0 D;  3TDZ A;  1BJF A;  1SL8 A;  3IQQ A;  2JWW A;  3PLF B;  5F6T A;  1JC2 A;  1EH2 A;  1SCV A;  2WOS A;  1XVJ A;  1XFY O;  1IWQ A;  1IJ6 A;  2WCF A;  3DD4 A;  1J55 A;  3ICB A;  2EC6 B;  1YRT B;  1N0Y A;  2ZN9 A;  2GV5 A;  1GQM A;  2LUX A;  3VGO A;  2LLS A;  5I2Q A;  4GBA A;  2NZ0 A;  2WOR A;  1CDP A;  2BCB A;  1M39 A;  2K7C A;  3OHM B;  1CLB A;  5I2O A;  3D0Y B;  1OE9 B;  3NSL A;  3SJS A;  1LA0 A;  1NX3 A;  2BL0 C;  3I5I B;  2M1K B;  3D10 A;  3I5F B;  1EG3 A;  1SL7 A;  2SCP A;  4CFR A;  3PM8 A;  5KSZ A;  1CFC A;  1CMF A;  3BUM B;  1S3P A;  1TNP A;  1UHJ A;  1J7Q A;  3O78 A;  1AJ4 A;  1RK9 A;  1BG1 A;  1W7J B;  4CID A;  4PHJ A;  4NDD A;  2EHB A;  2OTG C;  2MRD A;  1AHR A;  5HLO A;  1FW4 A;  4WRI A;  1BMO A;  1UHH A;  5GQQ C;  1QIW A;  3SIB A;  3HX4 A;  4ZCU A;  1K90 D;  5D7F A;  1OMV A;  1SY9 A;  2BCX A;  3DVJ A;  1SRA A;  4OKH A;  1ODB A;  3TDU A;  1OZO A;  1ALV A;  1KWO C;  3BYA A;  1J1D A;  3EKJ A;  2CTN A;  2A4J A;  2L4H A;  4YGB B;  5CSJ A;  1XYD A;  1MUX A;  3I5G C;  3CR4 X;  1TRF A;  3CTN A;  5HYD A;  1S6I A;  2WCE A;  1J7R A;  3AKA A;  1QV1 A;  1BR1 B;  2G9B A;  3FWB A;  4XYN A;  2MLF C;  3BUW B;  1N65 A;  2KI4 B;  1S26 D;  2HQ8 A;  1S5G Y;  3DF0 B;  5PAL A;  1MF8 B;  1TOP A;  4C0K A;  1SW8 A;  2LVV A;  2OPO A;  2WCB A;  1CFD A;  2LLU A;  2AUC A;  1DJI A;  1UHI A;  4PE4 A;  4M2P A;  1PAL A;  3KHE A;  2L98 A;  2O5G A;  1JF0 A;  4ZCV A;  3CZT X;  1L7Z A;  4MZJ A;  3I5G B;  1A75 B;  1A29 A;  1LVC D;  1TNW A;  1FBV A;  2JT3 A;  4PCW A;  2K7O A;  2ZFD A;  3TUY B;  2EGD A;  1J1E A;  1V1G A;  1C7V A;  2MAZ A;  3NSK A;  3VRP A;  3GK4 X;  2PVB A;  3HCM A;  2ZKM X;  2GGZ A;  3O2P A;  2I18 A;  1Y0V H;  1SNL A;  1NP8 A;  3OX5 A;  3JTD B;  1NX0 A;  1XFZ O;  2JPT A;  4GPL B;  2L50 A;  3WXA A;  2LP3 A;  4PHN A;  2M7N A;  5K89 A;  3DVK A;  4YI9 A;  2I7A A;  4WQ3 A;  5DKN A;  1RJV A;  4GGF C;  4NDB A;  4MBE A;  3VRQ A;  3KF9 A;  3JVT C;  1BOD A;  2PSR A;  5AER A;  2LVK A;  1NCX A;  1NPQ A;  2MA2 A;  2F3Y A;  4NQG A;  4BY5 A;  2ZRS A;  1QTX A;  1K9U A;  2KI6 C;  2PAL A;  1LA3 A;  4FQO A;  2HET A;  2LHI A;  2JTZ A;  1PUL A;  1J7O A;  2JXL A;  1DTL A;  1NYA A;  4TNC A;  2KBI A;  3EVV A;  2KSP A;  1F54 A;  1SPY A;  1EL4 A;  3SG3 A;  1M31 A;  1CDN A;  3TUY C;  1TIZ A;  5FYX A;  1MXE A;  1BT6 A;  4IL1 A;  1W7I B;  3KEV A;  2ZND A;  1CLM A;  1PRW A;  2KAV A;  2ZN8 A;  2K2A A;  1PVA A;  4YI8 A;  5G08 A;  2HQW A;  4MRY A;  2QAC A;  3QRX A;  3WNX B;  1QAS A;  2ISD A;  4I5L B;  2LNK A;  3RM1 A;  1QLK A;  2M1U A;  1IQ3 A;  5HKZ A;  2LCP A;  1F70 A;  1G4Y R;  1JBA A;  1CNP A;  5CSF A;  1XK4 A;  1EXR A;  1YUR A;  1R6P A;  2IS9 A;  1MWN A;  4ORC B;  1M63 B;  2M49 B;  1CFF A;  2M9G A;  5HKY A;  1WRL A;  2LMV A;  1ZMZ A;  1N2D A;  1DJW A;  5I2L A;  2BEC A;  4WQ2 A;  3EVR A;  4GAO A;  1XFW O;  2H61 C;  4DRW A;  1MXL C;  2BCA A;  1KQM B;  2RGI A;  2CT9 A;  2GGM A;  2LVI A;  1JSA A;  1A03 A;  2KQY A;  5CSN A;  1QX5 B;  3AAK A;  1GGZ A;  2M3W A;  1DGV A;  2Y1N A;  3A8R A;  4YGA A;  5ER5 A;  4ORA B;  1NCY A;  2KHN A;  2JXC A;  2JTT A;  4N1G A;  3WHU B;  1KQV A;  1NUB A;  3BOW A;  1QIV A;  3DVM A;  3I5H C;  3PN7 B;  4GGN A;  2LVJ A;  1KFU S;  2KBM A;  3NSI A;  4A4C A;  1MR8 A;  3BUO B;  5KU1 A;  4YGE B; 
#chains in the Genus database with same CATH topology
 1XFV O;  3DF0 A;  2O60 A;  1K2H A;  4DS7 A;  3L4A A;  3GK1 A;  2KGB C;  1V1F A;  3S0G A;  1F4Q A;  2MHH A;  1Y1U A;  2G2B A;  3EK8 A;  2KAY A;  4M2O A;  1YVL A;  1ZAC A;  1QV0 A;  2BBM A;  1FI5 A;  1EG4 A;  2WCM A;  2QEO A;  1QLS A;  1KK7 Z;  1KSM A;  4YGD B;  3BOW B;  1WLM A;  2Y5I A;  2AAO A;  5BPJ A;  3R1V A;  1A2X A;  1K95 A;  1RFJ A;  3DYE A;  1CFP A;  3BUX B;  3EVU A;  1B8R A;  1C3Z A;  1KK8 B;  3BJH A;  4E68 A;  1JWD A;  1HT9 A;  2L51 A;  1YRU B;  4A4B A;  1LKJ A;  2I94 A;  1M45 A;  1R2U A;  1DF0 A;  2BBN A;  1DJX A;  3L4L A;  2I2R E;  1YX8 A;  1J7P A;  2FCE A;  1RTP 1;  3K1E A;  4MEW A;  2KLD A;  1B47 A;  2LM5 A;  5D3O A;  1BR4 B;  2JZI A;  3CLN A;  3FIA A;  3SG7 A;  2M29 A;  1OMD A;  3GK2 A;  2H61 A;  2R2I A;  1XFU O;  3LK1 A;  3TS5 B;  2JRF A;  1SCM C;  3CR2 A;  4ORB B;  1NWD A;  2NCO A;  3KPX A;  1E8A A;  1CM4 A;  2PQL A;  1SBJ A;  5AAN A;  3SG4 A;  3BFH A;  1KK8 C;  3NSO A;  4MN0 A;  3CDN A;  1XFR A;  2NCP A;  3CZ2 A;  3I5F C;  4U8D A;  2OS8 C;  1UHN A;  2ZNE A;  3PAL A;  3R1P A;  4AQJ A;  1SMG A;  5D69 A;  2M0R A;  3JVT B;  2K7B A;  2L2E A;  1L2O B;  3D76 A;  4MZL A;  1S36 A;  1K9P A;  1K9K A;  2K2F A;  5KTY A;  3IF7 A;  4ICB A;  1XO5 A;  1OQP A;  3FE6 A;  3C1V A;  3B7A A;  1F55 A;  1QS7 A;  1QX7 A;  2QDI A;  3K21 A;  4P2Y B;  1EJ3 A;  2OTG B;  1Q80 A;  1TWO A;  2COL B;  2NXQ A;  3OB2 B;  1SKT A;  1K93 D;  1UP5 A;  4P5O E;  4QJ3 B;  1JFK A;  3OP0 A;  4ETO A;  5CPV A;  4OVN F;  2F2P A;  1F4O A;  1OOJ A;  4OCI A;  3PN7 C;  1GGW A;  3I5H B;  1M46 A;  1PSB A;  5FI7 A;  4YBH B;  2FJU B;  1D1O A;  1VRK A;  2LE9 B;  4OR9 B;  4AQI A;  1SYM A;  2BNX A;  4GFT A;  1BOC A;  1H4B A;  4PHK A;  1ZFS A;  1TCF A;  3BFA A;  4MZK A;  1DMO A;  2JNX A;  1P28 A;  4PE0 A;  5I94 A;  1KK7 Y;  2D8N A;  2KFH A;  1ORG A;  2PMY A;  4DIR A;  1OMR A;  2Q4U A;  1IGV A;  5I8N A;  1IJ5 A;  1B9A A;  1ALW A;  1DVI A;  2LV7 A;  3AKB A;  2OS8 B;  4PE7 A;  5DKR A;  2KAX A;  2F3Z A;  1B8L A;  4CPV A;  3CS1 A;  2BE6 A;  3I5I C;  1WDC B;  1NX1 A;  3SS5 A;  1DJZ A;  1KFX S;  1S5G Z;  1TN4 A;  2KGR A;  4QJ4 B;  2PAS A;  1JF2 A;  1TCO B;  3KO0 A;  1Z2C B;  1SCM B;  3NGV A;  3EKH A;  5HLV A;  2F33 A;  1NCZ A;  2KYF A;  1Z4H A;  1G8I A;  4NDC A;  1H8B A;  2E6W A;  2JPO A;  4PE1 A;  2P71 A;  4DCK A;  3D75 A;  1XFX O;  1QAT A;  1B4C A;  2KFF A;  2KI6 D;  2ZRT A;  3FE8 A;  2QPT A;  5CSI A;  4F7F A;  2KNE A;  2P70 A;  1F71 A;  2KI4 C;  5TNC A;  1IG5 A;  4INX A;  5AXI A;  2WCH A;  1U5I A;  2PRU A;  4CFQ A;  1CDL A;  1NX2 A;  1S6C A;  2CNP A;  3OBV A;  1YR5 A;  2F2O A;  2NLN A;  3SIA A;  2WND A;  1CKK A;  1CLL A;  2LHL A;  4PDZ A;  1C7W A;  2K8M B;  4HSZ A;  1WRK A;  4PHM A;  3AAJ A;  2KQ6 A;  3O6B A;  1HQV A;  2K61 A;  2JT8 A;  3SS3 A;  3TDI A;  2Y4Q A;  4MSP A;  4MRX A;  1LS8 A;  4HRH A;  4N1F A;  1AUI B;  3F45 A;  2M7L A;  3PAT A;  4C0J A;  4C0L A;  1IH0 A;  3BUN B;  3LL8 B;  2TN4 A;  1KWO B;  3FE9 A;  4JWQ A;  1IRJ A;  2FOT A;  2LLT A;  5IBW A;  3PFV A;  2WC6 A;  3CZ1 A;  1SK6 D;  2P6B B;  3ZWH A;  3H4S E;  1LXF C;  1CMG A;  3DZT A;  3D78 A;  3VRR A;  2Q91 A;  2K60 A;  1ZUZ A;  3OGN A;  5ER4 X;  3RLZ A;  1ZOT B;  1CDM A;  5HKW A;  1AP4 A;  1OZS A;  2H2K A;  2BKI B;  1K8U A;  5AEQ A;  3LCP C;  1DJY A;  1GM0 A;  1UWO A;  1TNX A;  1JFJ A;  2Y1M A;  4I5N B;  2M8U A;  1U5I B;  2LP2 A;  2LMU A;  1QJT A;  2BL0 B;  2LAN A;  1AVS A;  1KFX L;  1WRZ A;  1DGU A;  1YUT A;  1MQ1 A;  2KYC A;  2AMI A;  2KOT A;  2VRG A;  2E30 A;  5J3X A;  1AK8 A;  3TS5 C;  1BLQ A;  1Y6W A;  1B7T Z;  2CXJ A;  4F0Z B;  5DKQ A;  4PAL A;  1YX7 A;  4I5K A;  1PVB A;  1XA5 A;  3OB1 B;  4MVF A;  1FF1 A;  3ZNI A;  1YUS A;  4XJK B;  2JT0 A;  1AJ5 A;  3BQ3 A;  4CLN A;  1WY9 A;  2EC6 C;  3O4Y A;  1SL9 A;  3CAB A;  1YTZ C;  2FCD A;  4N5X A;  2L0P A;  1CB1 A;  1A75 A;  2WCJ A;  3IQO A;  3CWG A;  3CR5 X;  3A4U B;  3M0W A;  1K96 A;  3LLE A;  3E3R A;  4HRE E;  1QVI Y;  3FS7 A;  4D1E A;  1GJY A;  2MJW B;  1QVI Z;  3SG5 A;  1CTR A;  2HPS A;  1YUU A;  3BFB A;  2LMT A;  1RRO A;  5B8I B;  2L4I A;  1QXP A;  1YVH A;  2HF5 A;  4YGC B;  4QJ5 B;  1C07 A;  1S1E A;  3GOF A;  1UHK A;  5JOL A;  1FI6 A;  3NXA A;  1DJG A;  1QX2 A;  2JC2 A;  4GUK A;  1DF0 B;  4MLW A;  1B8C A;  1SR6 C;  3PSR A;  1KCY A;  4I5J A;  1REC A;  2CCM A;  2BE4 A;  5AFP A;  3L47 A;  1W9Z A;  2KFG A;  5EL2 A;  1Y1X A;  3WHT B;  1UUR A;  3SG2 A;  2JQ6 A;  1FPW A;  1F8H A;  4HRG A;  1KFU L;  2LUC A;  2LAP A;  2V53 A;  2L5X B;  2JNF A;  3BXK A;  4JQ0 D;  3FWC A;  2KDH A;  2F8P A;  4AOM A;  4OV2 A;  3VRN A;  1QWV A;  4R1E A;  3VRO A;  2ERB A;  3TZ1 A;  2B1U A;  3MSE B;  4M2Q A;  1DJH A;  2CBL A;  1TUZ A;  2K7D A;  2JU0 A;  3S0B A;  1BF5 A;  4GGF A;  1JUO A;  1KQM C;  3LK0 A;  4DUQ A;  3DVE A;  3EK4 A;  1TTX A;  1IKU A;  1RWY A;  1WLZ A;  1A4P A;  1S6J A;  3R72 A;  4FTG A;  4JPZ B;  1K94 A;  1IQ5 A;  2JUL A;  1BU3 A;  4JKT A;  1CM1 A;  4L9M A;  4OZD A;  1XK4 C;  4XJK A;  1C3Y A;  3D0Y A;  1SR6 B;  1TNQ A;  1OOI X;  4GNK B;  4UPG A;  4BY4 A;  1LIN A;  3UNW A;  4Q04 A;  1DT7 B;  3CGA A;  1WDC C;  3D77 A;  2M97 A;  1X02 A;  2DOQ A;  1NSH A;  3D74 A;  2MBX A;  1KSO A;  5JJG A;  2BKH B;  4USL A;  2JOJ A;  3SG6 A;  1L2O C;  2KPH A;  3PM2 A;  4YRU A;  3OX6 A;  1G33 A;  2K0J A;  2LC5 A;  1MHO A;  2SAS A;  1OSA A;  3CZ0 A;  3EK7 A;  3JTD C;  1B1G A;  1B7T Y;  1Y1A A;  1NIW A;  2WC8 A;  3QME A;  2MLE C;  1PSR A;  1UUS A;  1PK0 D;  1DEK A;  3TDZ A;  1BJF A;  1SL8 A;  3IQQ A;  4KYN A;  2JWW A;  2PYQ A;  3PLF B;  5F6T A;  1JC2 A;  1EH2 A;  1SCV A;  3NHT A;  2WOS A;  1XVJ A;  1XFY O;  1IWQ A;  1IJ6 A;  2WCF A;  3DD4 A;  1J55 A;  3ICB A;  2EC6 B;  1YRT B;  1TUJ A;  3S0E A;  1N0Y A;  2ZN9 A;  1DEL A;  1GQM A;  2GV5 A;  2QEH A;  2LUX A;  3VGO A;  2LLS A;  3S0F A;  5I2Q A;  4GBA A;  2NZ0 A;  2WOR A;  1CDP A;  2BCB A;  1M39 A;  2K7C A;  3OHM B;  4FQT A;  3Q8I A;  1CLB A;  5I2O A;  3D0Y B;  1OE9 B;  3NSL A;  3SJS A;  4IJ7 A;  1LA0 A;  1NX3 A;  3SS4 A;  3IVT A;  2BL0 C;  3N7H A;  3I5I B;  1DQE A;  2M1K B;  3D10 A;  3I5F B;  1EG3 A;  1SL7 A;  2SCP A;  4CFR A;  3PM8 A;  5KSZ A;  1CFC A;  1CMF A;  3BUM B;  1S3P A;  1TNP A;  1UHJ A;  1OOF A;  1J7Q A;  3O78 A;  1AJ4 A;  1RK9 A;  1BG1 A;  1W7J B;  4CID A;  4INW A;  4PHJ A;  4NDD A;  2EHB A;  2OTG C;  2MRD A;  1AHR A;  5HLO A;  1FW4 A;  4WRI A;  1BMO A;  1UHH A;  5GQQ C;  1QIW A;  3SIB A;  3HX4 A;  4ZCU A;  1K90 D;  5D7F A;  1OMV A;  1SY9 A;  2BCX A;  3DVJ A;  2L5Y A;  1SRA A;  4OKH A;  1ODB A;  3TDU A;  1OZO A;  1ALV A;  1KWO C;  3BYA A;  1J1D A;  4JD9 A;  3EKJ A;  2CTN A;  2A4J A;  2L4H A;  3B87 A;  4YGB B;  5CSJ A;  1XYD A;  2FJY A;  2KLE A;  1MUX A;  3I5G C;  3CR4 X;  1TRF A;  3CTN A;  5HYD A;  1S6I A;  2WCE A;  1J7R A;  3AKA A;  1QV1 A;  1BR1 B;  2G9B A;  3FWB A;  4XYN A;  2MLF C;  3BUW B;  1N65 A;  2H8V A;  2KI4 B;  1S26 D;  2HQ8 A;  1S5G Y;  3DF0 B;  5PAL A;  3EG5 B;  1MF8 B;  1TOP A;  4C0K A;  1SW8 A;  2LVV A;  2OPO A;  2WCB A;  1CFD A;  2LLU A;  2AUC A;  1DJI A;  1UHI A;  4PE4 A;  4M2P A;  1PAL A;  3KHE A;  2L98 A;  2O5G A;  1JF0 A;  4ZCV A;  1OOG A;  3CZT X;  1L7Z A;  3UO9 A;  4MZJ A;  3I5G B;  1A75 B;  1A29 A;  1LVC D;  1TNW A;  3O4X A;  5FI2 A;  1FBV A;  2WCL A;  2JT3 A;  3NHI A;  4PCW A;  3B88 A;  2K7O A;  2ZFD A;  3D73 A;  3B6X A;  3TUY B;  2EGD A;  1J1E A;  1V1G A;  1SSE B;  1C7V A;  2WC5 A;  2MAZ A;  3NSK A;  3VRP A;  3GK4 X;  2PVB A;  3HCM A;  2ZKM X;  2GGZ A;  3O2P A;  2I18 A;  4PT1 A;  1Y0V H;  1SNL A;  2QEB A;  1NP8 A;  3OX5 A;  3JTD B;  1NX0 A;  1XFZ O;  2BAP A;  2JPT A;  4GPL B;  2L50 A;  2WCK A;  3WXA A;  2LP3 A;  3DY9 A;  4PHN A;  3S0D A;  2M7N A;  5K89 A;  3DVK A;  4YI9 A;  2I7A A;  4WQ3 A;  5DKN A;  1RJV A;  4GGF C;  4NDB A;  4MBE A;  3VRQ A;  3KF9 A;  3JVT C;  1BOD A;  2PSR A;  2YGU A;  2LVK A;  5AER A;  1NCX A;  1NPQ A;  2MA2 A;  2F3Y A;  4NQG A;  4BY5 A;  2ZRS A;  1QTX A;  1K9U A;  2KI6 C;  2PAL A;  1LA3 A;  4FQO A;  2HET A;  2LHI A;  2JTZ A;  1PUL A;  1J7O A;  2JXL A;  1DTL A;  1NYA A;  4TNC A;  2KBI A;  3EVV A;  2KSP A;  1F54 A;  3DXL A;  3CYZ A;  1SPY A;  1EL4 A;  3SG3 A;  1M31 A;  3B86 A;  5HL1 A;  3TUY C;  1CDN A;  1TIZ A;  5FYX A;  1MXE A;  1BT6 A;  4IL1 A;  1W7I B;  3KEV A;  2ZND A;  1CLM A;  1PRW A;  2KAV A;  2ZN8 A;  3V2L A;  2K2A A;  1PVA A;  4YI8 A;  5G08 A;  2HQW A;  4MRY A;  2QAC A;  3QRX A;  3WNX B;  5FI6 A;  1QAS A;  2ISD A;  3VB1 A;  4I5L B;  2LNK A;  3RM1 A;  1QLK A;  2M1U A;  1IQ3 A;  5HKZ A;  2LCP A;  1F70 A;  1G4Y R;  1JBA A;  2GTE A;  5DIC A;  1CNP A;  5CSF A;  1IIO A;  1XK4 A;  1EXR A;  1OOH A;  1YUR A;  3R1O A;  1R6P A;  1OW4 A;  2L2C A;  2IS9 A;  1MWN A;  1T14 A;  1M63 B;  2M49 B;  4ORC B;  2M9G A;  5HKY A;  1WRL A;  1CFF A;  2LMV A;  1ZMZ A;  2QEV A;  1N2D A;  1DC1 A;  1DJW A;  5I2L A;  2BEC A;  4WQ2 A;  3EVR A;  4GAO A;  1XFW O;  2H61 C;  4DRW A;  3RZS A;  1MXL C;  2BCA A;  1KQM B;  2RGI A;  2CT9 A;  2GGM A;  2LVI A;  1JSA A;  1A03 A;  2KQY A;  5CSN A;  1QX5 B;  3AAK A;  1GGZ A;  2M3W A;  3PJI A;  1DGV A;  2Y1N A;  3A8R A;  4YGA A;  5ER5 A;  4ORA B;  1NCY A;  2KHN A;  3S0A A;  2JXC A;  2JTT A;  4N1G A;  3WHU B;  1KQV A;  1NUB A;  3BOW A;  1QIV A;  3DVM A;  3I5H C;  3PN7 B;  4GGN A;  2LVJ A;  1KFU S;  2KBM A;  3NSI A;  4A4C A;  1MR8 A;  3BUO B;  5KU1 A;  4YGE B; 
#chains in the Genus database with same CATH homology
 1XFV O;  3DF0 A;  2O60 A;  1K2H A;  4DS7 A;  3GK1 A;  2KGB C;  1V1F A;  1F4Q A;  2MHH A;  1Y1U A;  2G2B A;  3EK8 A;  2KAY A;  4M2O A;  1YVL A;  1ZAC A;  1QV0 A;  2BBM A;  1FI5 A;  1EG4 A;  1QLS A;  1KK7 Z;  1KSM A;  4YGD B;  3BOW B;  1WLM A;  2Y5I A;  2AAO A;  5BPJ A;  1A2X A;  1K95 A;  1RFJ A;  1CFP A;  3BUX B;  3EVU A;  1B8R A;  1KK8 B;  4E68 A;  1JWD A;  1HT9 A;  2L51 A;  1YRU B;  4A4B A;  1LKJ A;  2I94 A;  1M45 A;  1R2U A;  1DF0 A;  2BBN A;  1DJX A;  2I2R E;  1YX8 A;  1J7P A;  2FCE A;  1RTP 1;  4MEW A;  1B47 A;  2LM5 A;  1BR4 B;  2JZI A;  3CLN A;  3FIA A;  3SG7 A;  2M29 A;  1OMD A;  3GK2 A;  2H61 A;  2R2I A;  1XFU O;  3LK1 A;  3TS5 B;  2JRF A;  1SCM C;  3CR2 A;  4ORB B;  1NWD A;  2NCO A;  3KPX A;  1E8A A;  1CM4 A;  1SBJ A;  5AAN A;  3SG4 A;  1KK8 C;  3NSO A;  4MN0 A;  2NCP A;  3I5F C;  4U8D A;  2OS8 C;  1UHN A;  2ZNE A;  3PAL A;  4AQJ A;  1SMG A;  5D69 A;  2M0R A;  3JVT B;  2K7B A;  2L2E A;  1L2O B;  4MZL A;  1S36 A;  1K9P A;  1K9K A;  2K2F A;  5KTY A;  3IF7 A;  4ICB A;  1XO5 A;  1OQP A;  3C1V A;  1F55 A;  1QS7 A;  1QX7 A;  3K21 A;  4P2Y B;  1EJ3 A;  2OTG B;  1Q80 A;  2NXQ A;  2COL B;  3OB2 B;  1SKT A;  1K93 D;  1UP5 A;  4P5O E;  4QJ3 B;  1JFK A;  3OP0 A;  4ETO A;  5CPV A;  4OVN F;  2F2P A;  1F4O A;  1OOJ A;  4OCI A;  3PN7 C;  1GGW A;  3I5H B;  1M46 A;  1PSB A;  1D1O A;  4YBH B;  2FJU B;  1VRK A;  2LE9 B;  4OR9 B;  4AQI A;  1SYM A;  4GFT A;  1BOC A;  1H4B A;  4PHK A;  1ZFS A;  1TCF A;  4MZK A;  1DMO A;  2JNX A;  4PE0 A;  1KK7 Y;  2D8N A;  2KFH A;  4DIR A;  2PMY A;  1OMR A;  2Q4U A;  1IGV A;  5I8N A;  1IJ5 A;  1B9A A;  1ALW A;  1DVI A;  2LV7 A;  3AKB A;  2OS8 B;  4PE7 A;  5DKR A;  2KAX A;  2F3Z A;  1B8L A;  4CPV A;  3CS1 A;  2BE6 A;  3I5I C;  1WDC B;  1NX1 A;  1DJZ A;  1KFX S;  1S5G Z;  1TN4 A;  2KGR A;  4QJ4 B;  2PAS A;  1JF2 A;  1TCO B;  3KO0 A;  1SCM B;  3EKH A;  5HLV A;  2F33 A;  1NCZ A;  2KYF A;  1G8I A;  4NDC A;  1H8B A;  2E6W A;  4PE1 A;  4DCK A;  1XFX O;  1QAT A;  1B4C A;  2KFF A;  2KI6 D;  2ZRT A;  2QPT A;  5CSI A;  2KNE A;  1F71 A;  2KI4 C;  5TNC A;  1IG5 A;  5AXI A;  1U5I A;  2PRU A;  4CFQ A;  1CDL A;  1NX2 A;  1S6C A;  2CNP A;  1YR5 A;  2F2O A;  2NLN A;  3SIA A;  2WND A;  1CKK A;  1CLL A;  2LHL A;  4PDZ A;  1C7W A;  2K8M B;  4HSZ A;  1WRK A;  4PHM A;  3AAJ A;  2KQ6 A;  3O6B A;  1HQV A;  2K61 A;  2JT8 A;  3TDI A;  2Y4Q A;  4MSP A;  4MRX A;  4HRH A;  4N1F A;  1AUI B;  3F45 A;  2M7L A;  3PAT A;  4C0J A;  4C0L A;  1IH0 A;  3BUN B;  3LL8 B;  2TN4 A;  1KWO B;  4JWQ A;  1IRJ A;  2FOT A;  2LLT A;  5IBW A;  3PFV A;  1SK6 D;  2P6B B;  3ZWH A;  3H4S E;  1LXF C;  1CMG A;  3VRR A;  2Q91 A;  1ZUZ A;  5ER4 X;  3RLZ A;  1ZOT B;  1CDM A;  5HKW A;  1AP4 A;  1OZS A;  2H2K A;  2BKI B;  1K8U A;  5AEQ A;  3LCP C;  1DJY A;  1UWO A;  1TNX A;  1JFJ A;  2Y1M A;  4I5N B;  2M8U A;  1U5I B;  2LP2 A;  2LMU A;  1QJT A;  2BL0 B;  2LAN A;  1AVS A;  1KFX L;  1WRZ A;  1DGU A;  1YUT A;  1MQ1 A;  2KYC A;  2AMI A;  2KOT A;  2VRG A;  2E30 A;  5J3X A;  1AK8 A;  3TS5 C;  1BLQ A;  1Y6W A;  1B7T Z;  2CXJ A;  4F0Z B;  5DKQ A;  4PAL A;  1YX7 A;  4I5K A;  1PVB A;  1XA5 A;  3OB1 B;  4MVF A;  1FF1 A;  3ZNI A;  1YUS A;  4XJK B;  2JT0 A;  1AJ5 A;  3BQ3 A;  4CLN A;  1WY9 A;  2EC6 C;  3O4Y A;  1SL9 A;  1YTZ C;  2FCD A;  4N5X A;  2L0P A;  1CB1 A;  1A75 A;  3IQO A;  3CWG A;  3CR5 X;  3A4U B;  3M0W A;  1K96 A;  3LLE A;  3E3R A;  4HRE E;  1QVI Y;  3FS7 A;  4D1E A;  1GJY A;  2MJW B;  1QVI Z;  3SG5 A;  1CTR A;  2HPS A;  1YUU A;  2LMT A;  1RRO A;  5B8I B;  2L4I A;  2HF5 A;  1QXP A;  1YVH A;  4YGC B;  4QJ5 B;  1C07 A;  1S1E A;  3GOF A;  1UHK A;  5JOL A;  1FI6 A;  3NXA A;  1DJG A;  1QX2 A;  2JC2 A;  4GUK A;  1DF0 B;  4MLW A;  1B8C A;  1SR6 C;  3PSR A;  1KCY A;  4I5J A;  1REC A;  2CCM A;  2BE4 A;  5AFP A;  2KFG A;  1Y1X A;  3WHT B;  1UUR A;  3SG2 A;  2JQ6 A;  1FPW A;  1F8H A;  4HRG A;  1KFU L;  2LUC A;  2LAP A;  2V53 A;  2L5X B;  2JNF A;  3BXK A;  4JQ0 D;  3FWC A;  2KDH A;  2F8P A;  4AOM A;  4OV2 A;  3VRN A;  4R1E A;  3VRO A;  3TZ1 A;  2B1U A;  3MSE B;  4M2Q A;  1DJH A;  2CBL A;  2K7D A;  1BF5 A;  2JU0 A;  4GGF A;  1JUO A;  1KQM C;  3LK0 A;  4DUQ A;  3DVE A;  3EK4 A;  1TTX A;  1IKU A;  1RWY A;  1WLZ A;  1A4P A;  1S6J A;  4FTG A;  4JPZ B;  4L9M A;  1K94 A;  1IQ5 A;  2JUL A;  1BU3 A;  1CM1 A;  1XK4 C;  4XJK A;  3D0Y A;  1SR6 B;  1TNQ A;  4GNK B;  4UPG A;  4BY4 A;  1LIN A;  4Q04 A;  1DT7 B;  3CGA A;  1WDC C;  2M97 A;  1X02 A;  2DOQ A;  1NSH A;  2MBX A;  1KSO A;  5JJG A;  2BKH B;  4USL A;  2JOJ A;  3SG6 A;  1L2O C;  4YRU A;  3OX6 A;  1G33 A;  2K0J A;  2LC5 A;  1MHO A;  2SAS A;  1OSA A;  3EK7 A;  1B1G A;  3JTD C;  1B7T Y;  1Y1A A;  1NIW A;  2WC8 A;  2MLE C;  1PSR A;  1UUS A;  1PK0 D;  3TDZ A;  1BJF A;  1SL8 A;  3IQQ A;  2JWW A;  3PLF B;  5F6T A;  1JC2 A;  1EH2 A;  1SCV A;  2WOS A;  1XVJ A;  1XFY O;  1IWQ A;  1IJ6 A;  2WCF A;  3DD4 A;  1J55 A;  3ICB A;  2EC6 B;  1YRT B;  1N0Y A;  2ZN9 A;  2GV5 A;  1GQM A;  2LUX A;  3VGO A;  2LLS A;  5I2Q A;  4GBA A;  2NZ0 A;  2WOR A;  1CDP A;  2BCB A;  1M39 A;  2K7C A;  3OHM B;  1CLB A;  5I2O A;  3D0Y B;  1OE9 B;  3NSL A;  3SJS A;  1LA0 A;  1NX3 A;  2BL0 C;  3I5I B;  2M1K B;  3D10 A;  3I5F B;  1EG3 A;  1SL7 A;  2SCP A;  4CFR A;  3PM8 A;  5KSZ A;  1CFC A;  1CMF A;  3BUM B;  1S3P A;  1TNP A;  1UHJ A;  1J7Q A;  3O78 A;  1AJ4 A;  1RK9 A;  1BG1 A;  1W7J B;  4CID A;  4PHJ A;  4NDD A;  2EHB A;  2OTG C;  2MRD A;  1AHR A;  5HLO A;  1FW4 A;  4WRI A;  1BMO A;  1UHH A;  5GQQ C;  1QIW A;  3SIB A;  3HX4 A;  4ZCU A;  1K90 D;  5D7F A;  1OMV A;  1SY9 A;  2BCX A;  3DVJ A;  1SRA A;  4OKH A;  1ODB A;  3TDU A;  1OZO A;  1ALV A;  1KWO C;  3BYA A;  1J1D A;  3EKJ A;  2CTN A;  2A4J A;  2L4H A;  4YGB B;  5CSJ A;  1XYD A;  1MUX A;  3I5G C;  3CR4 X;  1TRF A;  3CTN A;  5HYD A;  1S6I A;  2WCE A;  1J7R A;  3AKA A;  1QV1 A;  1BR1 B;  2G9B A;  3FWB A;  4XYN A;  2MLF C;  3BUW B;  1N65 A;  2KI4 B;  1S26 D;  2HQ8 A;  1S5G Y;  3DF0 B;  5PAL A;  1MF8 B;  1TOP A;  4C0K A;  1SW8 A;  2LVV A;  2OPO A;  2WCB A;  1CFD A;  2LLU A;  2AUC A;  1DJI A;  1UHI A;  4PE4 A;  4M2P A;  1PAL A;  3KHE A;  2L98 A;  2O5G A;  1JF0 A;  4ZCV A;  3CZT X;  1L7Z A;  4MZJ A;  3I5G B;  1A75 B;  1A29 A;  1LVC D;  1TNW A;  1FBV A;  2JT3 A;  4PCW A;  2K7O A;  2ZFD A;  3TUY B;  2EGD A;  1J1E A;  1V1G A;  1C7V A;  2MAZ A;  3NSK A;  3VRP A;  3GK4 X;  2PVB A;  3HCM A;  2ZKM X;  2GGZ A;  3O2P A;  2I18 A;  1Y0V H;  1SNL A;  1NP8 A;  3OX5 A;  3JTD B;  1NX0 A;  1XFZ O;  2JPT A;  4GPL B;  2L50 A;  3WXA A;  2LP3 A;  4PHN A;  2M7N A;  5K89 A;  3DVK A;  4YI9 A;  2I7A A;  4WQ3 A;  5DKN A;  1RJV A;  4GGF C;  4NDB A;  4MBE A;  3VRQ A;  3KF9 A;  3JVT C;  1BOD A;  2PSR A;  5AER A;  2LVK A;  1NCX A;  1NPQ A;  2MA2 A;  2F3Y A;  4NQG A;  4BY5 A;  2ZRS A;  1QTX A;  1K9U A;  2KI6 C;  2PAL A;  1LA3 A;  4FQO A;  2HET A;  2LHI A;  2JTZ A;  1PUL A;  1J7O A;  2JXL A;  1DTL A;  1NYA A;  4TNC A;  2KBI A;  3EVV A;  2KSP A;  1F54 A;  1SPY A;  1EL4 A;  3SG3 A;  1M31 A;  1CDN A;  3TUY C;  1TIZ A;  5FYX A;  1MXE A;  1BT6 A;  4IL1 A;  1W7I B;  3KEV A;  2ZND A;  1CLM A;  1PRW A;  2KAV A;  2ZN8 A;  2K2A A;  1PVA A;  4YI8 A;  5G08 A;  2HQW A;  4MRY A;  2QAC A;  3QRX A;  3WNX B;  1QAS A;  2ISD A;  4I5L B;  2LNK A;  3RM1 A;  1QLK A;  2M1U A;  1IQ3 A;  5HKZ A;  2LCP A;  1F70 A;  1G4Y R;  1JBA A;  1CNP A;  5CSF A;  1XK4 A;  1EXR A;  1YUR A;  1R6P A;  2IS9 A;  1MWN A;  4ORC B;  1M63 B;  2M49 B;  1CFF A;  2M9G A;  5HKY A;  1WRL A;  2LMV A;  1ZMZ A;  1N2D A;  1DJW A;  5I2L A;  2BEC A;  4WQ2 A;  3EVR A;  4GAO A;  1XFW O;  2H61 C;  4DRW A;  1MXL C;  2BCA A;  1KQM B;  2RGI A;  2CT9 A;  2GGM A;  2LVI A;  1JSA A;  1A03 A;  2KQY A;  5CSN A;  1QX5 B;  3AAK A;  1GGZ A;  2M3W A;  1DGV A;  2Y1N A;  3A8R A;  4YGA A;  5ER5 A;  4ORA B;  1NCY A;  2KHN A;  2JXC A;  2JTT A;  4N1G A;  3WHU B;  1KQV A;  1NUB A;  3BOW A;  1QIV A;  3DVM A;  3I5H C;  3PN7 B;  4GGN A;  2LVJ A;  1KFU S;  2KBM A;  3NSI A;  4A4C A;  1MR8 A;  3BUO B;  5KU1 A;  4YGE B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...