2MAZA

Backbone 1h, 13c, and 15n chemical shift assignments for bovine apo calbindin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
75
structure length
75
Chain Sequence
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGMSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Protein S100-G
publication title Prot3DNMR: A Simple and Swift NMR Strategy for Three-Dimensional Structure Determination of Proteins
rcsb
source organism Bos taurus
total genus 22
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2013-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2mazA00
1F4OA 2Q4UA 1IQ3A 3SJSA 2K7CA 1CNPA 2BE4A 3SG7A 2ZRTA 1QIWA 3H4SE 4BY5A 3TZ1A 2QACA 4MBEA 1B8RA 2LMVA 1JUOA 1YURA 3RLZA 2M1KB 1OMDA 3DF0A 1ZFSA 2BECA 3K21A 2M3WA 4PE1A 4N5XA 1K2HA 5G08A 4MVFA 1ALVA 5AFPA 2GGZA 2F2OA 2M7LA 2R2IA 3CR4X 2OPOA 1JWDA 1J55A 2HF5A 2LV7A 3SG4A 1J7OA 1CKKA 2JZIA 4U8DA 3IQQA 2KBMA 2JRFA 1S26D 3LK0A 2E6WA 4OR9B 1CM1A 1QIVA 1IGVA 1K96A 4ORAB 3AKAA 1S5GZ 1UWOA 1ODBA 1PVBA 1J1DA 1DJWA 1Y1UA 2BL0B 1QX2A 1NCXA 1RECA 1FI6A 2FCDA 2ZNDA 3CWGA 1OSAA 1RROA 1SYMA 4MRYA 1JSAA 3DVJA 3DD4A 3O2PA 3PLFB 5I2OA 1DMOA 1KK8B 3D10A 1NPQA 2M9GA 1DJGA 3OP0A 5IBWA 1SRAA 4YGBB 1BF5A 1A75B 3BUWB 2CNPA 5CSFA 1BOCA 1BR4B 1QV1A 1NYAA 1DVIA 2LAPA 2MLFC 2I2RE 1KK7Y 3OX5A 2BKIB 4XYNA 1UHIA 1PULA 2F33A 5DKQA 2BL0C 5K89A 1TN4A 1OE9B 2JC2A 2LCPA 2LP3A 1ALWA 2MJWB 4DRWA 3NXAA 4YGCB 1S6JA 3BYAA 2KYCA 1JFJA 1OQPA 1KK8C 4L9MA 1W7JB 4A4BA 2LNKA 5I2QA 2IS9A 1DJIA 4PCWA 1YRTB 3AAJA 2NCPA 5KSZA 3RM1A 1HT9A 2MRDA 1QV0A 3JTDC 4OV2A 4R1EA 1E8AA 2CBLA 2LVVA 1WDCB 1U5IB 1UHJA 2B1UA 2PVBA 2H61A 2M7NA 1AUIB 2Y1NA 2AAOA 2M1UA 1BMOA 1PALA 2LP2A 3FIAA 1KFUL 1Y6WA 5HKWA 1WRLA 1K93D 1UHKA 1Y0VH 3CS1A 3ICBA 2A4JA 2COLB 4PHJA 1DT7B 1B8CA 1QS7A 1SL8A 2PASA 1CB1A 2KI6D 3VROA 1NUBA 1UUSA 5TNCA 2ISDA 5ER5A 2M8UA 3DVKA 1UURA 4XJKA 2QPTA 3BOWB 1AVSA 1S1EA 3AKBA 1WDCC 1YTZC 2MAZA 1CLBA 1XYDA 5DKNA 2D8NA 2KSPA 1CFFA 2EGDA 4GGFC 1ZACA 1YUSA 1FF1A 2EC6B 5CSNA 1RWYA 4FQOA 1Y1XA 5AXIA 2CT9A 5D7FA 1BR1B 2OTGB 3EVRA 1OMVA 2KGRA 1QJTA 1N2DA 3DF0B 2JNXA 2K61A 3O6BA 1M46A 1PSBA 4GBAA 1OZOA 2V53A 2JXCA 2BCXA 4USLA 4HSZA 2ZFDA 4M2QA 5I2LA 2FOTA 1EG3A 1TNWA 5CSJA 2CCMA 1ZOTB 3ZNIA 1EL4A 4CFRA 2JULA 3TUYB 4PE7A 4ETOA 2K0JA 1S6IA 2LHIA 1FPWA 1TTXA 3DVMA 1B47A 3I5IB 1RK9A 3PSRA 4YGAA 2OTGC 4MN0A 4C0KA 2I94A 1J7RA 2L4HA 4AQJA 3E3RA 3HX4A 4OCIA 3CTNA 1VRKA 2KI6C 3F45A 4CLNA 1DF0A 1KFXL 2MHHA 1SPYA 1XK4C 1YUTA 2LC5A 3KPXA 3GK1A 1NX0A 2LVKA 1KFXS 5AANA 1OZSA 1A2XA 1M63B 2K7DA 3C1VA 3CR2A 3PATA 4WRIA 3TUYC 2HQWA 1XK4A 1TIZA 1Q80A 1JFKA 5AEQA 3I5IC 1A03A 1GGZA 5HLOA 2VRGA 2M97A 1FBVA 5B8IB 2BBNA 5J3XA 1AJ4A 4DS7A 2KYFA 1BODA 4PHKA 3I5HB 2WORA 1N0YA 1NX3A 4DUQA 1JF0A 2F2PA 3IQOA 3LK1A 1FW4A 1GJYA 4ZCUA 2KOTA 2I7AA 1TNPA 2E30A 1QLSA 4AQIA 1SY9A 1KQVA 4BY4A 5KTYA 1W7IB 1BG1A 2KDHA 2KGBC 1XFYO 4I5JA 1PSRA 1XA5A 1G33A 1TOPA 1QTXA 4ORCB 1BLQA 1ZMZA 1XFUO 1SL7A 1MR8A 4HRHA 3I5HC 3TDIA 3EK7A 1DJZA 1DGUA 4Q04A 1NSHA 3SIAA 5KU1A 2KFHA 4PE0A 1SW8A 5HYDA 3PFVA 3JTDB 1SCVA 1WRKA 2PRUA 2KFGA 1FI5A 1XFVO 3WHUB 2KAYA 1OOJA 1UHHA 1IJ5A 2L98A 2LM5A 2JPTA 1CFDA 3LCPC 4NDCA 1V1FA 1AP4A 1C07A 2P6BB 1B7TZ 3EKHA 1BU3A 3OB1B 2PALA 3KEVA 4XJKB 1PVAA 3VGOA 1QX5B 1CLLA 2AMIA 2JT3A 2BBMA 2HQ8A 3IF7A 1WLZA 1B8LA 1EXRA 1QLKA 2EHBA 2HETA 2NLNA 3GK2A 3O4YA 4MRXA 3VRRA 2H61C 1CM4A 1BJFA 1C7VA 1GQMA 1AK8A 1IH0A 4GGNA 1B4CA 1X02A 5ER4X 1JC2A 5PALA 1B1GA 3NSKA 1UHNA 1TNXA 3KO0A 2CTNA 1SMGA 2LLUA 1K9KA 1EG4A 1TNQA 2LMUA 1K9UA 1F4QA 1BT6A 2M0RA 3GOFA 4MZKA 4YBHB 1KFUS 2K7BA 3MSEB 1TRFA 1B9AA 4I5LB 2JNFA 5FYXA 4C0LA 3LLEA 3JVTB 4MZJA 3AAKA 1QVIY 4ICBA 2BKHB 1G4YR 3BUMB 4GAOA 1F71A 2KNEA 3LL8B 1CFCA 1A4PA 1IG5A 3TDUA 4OVNF 3GK4X 3WXAA 1KQMB 3BUOB 3WNXB 1WRZA 4YGDB 1EH2A 2LHLA 2O60A 3HCMA 4OKHA 2K8MB 1DF0B 1GGWA 1MHOA 1MF8B 1YRUB 3JVTC 4AOMA 2CXJA 2ZRSA 3DVEA 3EKJA 4JPZB 2FJUB 2K2FA 1NX2A 2WCEA 5CSIA 1KCYA 1EJ3A 2KAVA 2BE6A 4CIDA 1KQMC 2O5GA 3SG6A 1CTRA 1QVIZ 5JJGA 1CDLA 2KQYA 3BUXB 2LE9B 1NIWA 4QJ3B 4PALA 2NCOA 1NX1A 3QRXA 1MXEA 2Q91A 2BCBA 1S6CA 4CFQA 2L51A 2KAXA 3SG3A 1K9PA 1DJXA 1QATA 3D0YA 3BUNB 2LMTA 3OX6A 2L50A 2HPSA 1SL9A 1PK0D 3NSIA 2JXLA 3I5FC 2ZKMX 1YR5A 1YUUA 4M2PA 1KSMA 1LA0A 1IJ6A 4IL1A 4PDZA 1RFJA 4F0ZB 1SNLA 5AERA 2KFFA 4GFTA 3VRQA 2NXQA 3CLNA 3A4UB 1NWDA 1K94A 2G2BA 4ORBB 3SIBA 2L0PA 4P5OE 3EK8A 4YRUA 1NP8A 1DJHA 3ZWHA 2JT8A 1F8HA 1B7TY 1DTLA 1M31A 4QJ4B 3BXKA 1MQ1A 2LUXA 1LXFC 2M49B 5BPJA 1XVJA 2GV5A 5I8NA 4CPVA 1AJ5A 1K95A 1J7PA 1TCFA 2WNDA 1IWQA 2LLSA 4ZCVA 3PN7C 1G8IA 3PALA 1SR6C 3OHMB 5DKRA 1NCZA 4GUKA 4YI8A 2LLTA 3TDZA 3SG2A 4PE4A 2L5XB 5HLVA 1M39A 1IKUA 4I5KA 4MZLA 4DCKA 4MSPA 1QASA 1F55A 3O78A 5HKZA 1SCMB 1CMGA 2F3YA 2F3ZA 1SKTA 1V1GA 2Y4QA 1J1EA 4GNKB 4M2OA 1S3PA 1CMFA 2SCPA 1XFXO 4P2YB 1PRWA 1XFWO 2SASA 1WLMA 4PHNA 3TS5B 3WHTB 1YX7A 1AHRA 4WQ2A 1D1OA 1R6PA 1NCYA 1LINA 2JOJA 2JU0A 2LUCA 4I5NB 4C0JA 1YVLA 2MBXA 3EK4A 1H8BA 4TNCA 2PSRA 4QJ5B 3M0WA 1M45A 1SCMC 2LVJA 4A4CA 2JWWA 1OMRA 1N65A 1YVHA 2GGMA 1CLMA 2NZ0A 4D1EA 1DJYA 1C7WA 3NSLA 3NSOA 1WY9A 1L2OB 2ZN9A 4MEWA 3FWBA 4JWQA 1A29A 1K90D 3TS5C 2KBIA 5D69A 4PHMA 1IQ5A 4UPGA 1SBJA 2DOQA 4NDBA 1QX7A 4GPLB 1CDNA 4HREE 1F70A 2PMYA 2BCAA 3BQ3A 5HKYA 2LANA 3EVUA 2KI4B 4YI9A 5JOLA 1XO5A 4NDDA 1R2UA 2M29A 1KSOA 1A75A 2K7OA 2ZNEA 1JBAA 1QXPA 1MUXA 3FWCA 1L2OC 2WC8A 3EVVA 1S36A 3SG5A 1CDPA 3I5GB 4JQ0D 5F6TA 1KK7Z 3D0YB 1RTP1 1K8UA 1UP5A 2I18A 3A8RA 3CR5X 2WCFA 2F8PA 2AUCA 2JTZA 5CPVA 3KF9A 1DGVA 2KI4C 1LA3A 2TN4A 4WQ3A 4FTGA 2G9BA 2MLEC 1CFPA 1Y1AA 1RJVA 3CZTX 1H4BA 1IRJA 1KWOB 1ZUZA 2K2AA 2LVIA 2MA2A 3I5FB 1MXLC 2OS8B 2Y5IA 3I5GC 1XFZO 2H2KA 4DIRA 3CGAA 5GQQC 2KQ6A 3OB2B 1LVCD 1U5IA 4YGEB 1HQVA 3PM8A 2L2EA 1MWNA 4GGFA 2L4IA 1J7QA 4HRGA 4MLWA 4E68A 1SK6D 3FS7A 1JF2A 4N1GA 2JT0A 2JQ6A 1YX8A 4NQGA 1CDMA 3VRPA 3KHEA 1KWOC 1L7ZA 2WOSA 2ZN8A 2OS8C 3BOWA 2KHNA 2EC6C 2Y1MA 1LKJA 1F54A 2WCBA 2JTTA 1S5GY 2RGIA 2FCEA 3PN7B 1TCOB 1SR6B 3VRNA 4N1FA
chains in the Genus database with same CATH superfamily
1F4OA 2Q4UA 3OGNA 1IQ3A 3SJSA 2K7CA 1CNPA 2BE4A 3SG7A 2ZRTA 1QIWA 3H4SE 4BY5A 3FE6A 3DZTA 3TZ1A 2QACA 3D74A 4MBEA 1B8RA 2LMVA 1JUOA 1YURA 3RLZA 2M1KB 1OMDA 3DF0A 1ZFSA 2BECA 3K21A 2M3WA 4PE1A 4N5XA 1K2HA 4OZDA 1XFRA 2L2CA 5G08A 3BFBA 4MVFA 1ALVA 5EL2A 5AFPA 2GGZA 2F2OA 2M7LA 2R2IA 3CR4X 2OPOA 1JWDA 1J55A 2HF5A 3PJIA 2LV7A 3SG4A 1J7OA 1CKKA 2JZIA 4U8DA 3IQQA 2ERBA 2KBMA 2JRFA 1S26D 3LK0A 2E6WA 3CZ1A 4JKTA 4OR9B 1CM1A 1QIVA 1IGVA 1K96A 4ORAB 3AKAA 1S5GZ 3L47A 1UWOA 1ODBA 1PVBA 1J1DA 1IIOA 1DJWA 3CDNA 1Y1UA 2BL0B 1QX2A 3L4AA 1NCXA 1RECA 3O4XA 1FI6A 2FCDA 2ZNDA 3CWGA 1OSAA 1RROA 1SYMA 4MRYA 1JSAA 3DVJA 5HL1A 3DD4A 3O2PA 3PLFB 2KLEA 5I2OA 2QEHA 1DMOA 1KK8B 3D10A 3R1OA 1NPQA 2M9GA 1DJGA 3OP0A 5IBWA 1SRAA 2WC5A 4YGBB 3UNWA 1BF5A 1A75B 3BUWB 2CNPA 5CSFA 1BOCA 3RZSA 1BR4B 1QV1A 1NYAA 1DVIA 2LAPA 2MLFC 2QEOA 2I2RE 1KK7Y 3OX5A 2BKIB 4XYNA 1UHIA 1PULA 2F33A 5DKQA 2BL0C 2GTEA 5K89A 1TN4A 1OE9B 2JC2A 2LCPA 2LP3A 3B7AA 1ALWA 2MJWB 3BFAA 4DRWA 3NXAA 3EG5B 4YGCB 1S6JA 3BYAA 2KYCA 1JFJA 1OQPA 1KK8C 4L9MA 1W7JB 4A4BA 2LNKA 5I2QA 2QEBA 2IS9A 1DJIA 4PCWA 1YRTB 3AAJA 2NCPA 3QMEA 5KSZA 2H8VA 3RM1A 1HT9A 2MRDA 1QV0A 3JTDC 4OV2A 4R1EA 1E8AA 2CBLA 2LVVA 1WDCB 1U5IB 1UHJA 2B1UA 2PVBA 2H61A 2M7NA 1AUIB 2Y1NA 2AAOA 2M1UA 1BMOA 1PALA 2LP2A 3FIAA 1KFUL 1Y6WA 5HKWA 1WRLA 1K93D 1UHKA 1Y0VH 3CS1A 3ICBA 3UO9A 2A4JA 2COLB 4PHJA 1DT7B 1B8CA 1QS7A 1SL8A 2PASA 1CB1A 2KI6D 3VROA 1NUBA 1UUSA 5TNCA 2ISDA 5ER5A 2M8UA 3DVKA 1UURA 4XJKA 2QPTA 3BOWB 1AVSA 1S1EA 3AKBA 1WDCC 1YTZC 2MAZA 1CLBA 1XYDA 5DKNA 2D8NA 2KSPA 1CFFA 2EGDA 4GGFC 1ZACA 1DEKA 1YUSA 1FF1A 2EC6B 5CSNA 1RWYA 4FQOA 1Y1XA 5AXIA 2K60A 2CT9A 2BAPA 3D77A 5D7FA 1BR1B 2OTGB 3EVRA 2QDIA 1OMVA 2KGRA 1QJTA 1N2DA 3DF0B 2JNXA 2K61A 3O6BA 1M46A 1PSBA 4GBAA 1OZOA 2V53A 2JXCA 2BNXA 2BCXA 4USLA 4HSZA 2PYQA 2ZFDA 4M2QA 5I2LA 2FOTA 1EG3A 1TNWA 5CSJA 2CCMA 1ZOTB 3ZNIA 1EL4A 4CFRA 2JULA 3TUYB 4PE7A 4ETOA 2K0JA 1S6IA 2LHIA 1FPWA 1TTXA 3DVMA 1B47A 3I5IB 1RK9A 3PSRA 4YGAA 2OTGC 4MN0A 4C0KA 2I94A 1J7RA 2L4HA 3CZ2A 4AQJA 3E3RA 3HX4A 4OCIA 3CTNA 4FQTA 1VRKA 2KI6C 3F45A 4CLNA 1DF0A 1KFXL 2MHHA 1SPYA 1XK4C 1YUTA 2LC5A 3KPXA 2PQLA 1SSEB 3GK1A 1NX0A 2LVKA 1KFXS 3PM2A 3B88A 5AANA 2WCHA 1OZSA 1A2XA 1M63B 2K7DA 3C1VA 3CR2A 3PATA 4WRIA 3TUYC 2HQWA 1XK4A 1TIZA 3R1VA 1Q80A 1JFKA 5AEQA 3I5IC 1A03A 1GGZA 3BFHA 5HLOA 2VRGA 2M97A 1FBVA 5B8IB 2BBNA 5J3XA 1AJ4A 3IF7A 2P70A 2WC6A 4DS7A 2KYFA 1BODA 4KYNA 4PHKA 2WCKA 3I5HB 2WORA 3CABA 1N0YA 1NX3A 4DUQA 1JF0A 2F2PA 3IQOA 3LK1A 1FW4A 1GJYA 4ZCUA 2KOTA 3NHIA 2I7AA 1TNPA 2E30A 1QLSA 4AQIA 1SY9A 1KQVA 1C3ZA 4BY4A 5KTYA 1W7IB 2WCJA 1BG1A 2KDHA 2KGBC 1XFYO 4I5JA 1PSRA 1XA5A 1G33A 1TOPA 1QTXA 4ORCB 1BLQA 1ZMZA 3S0EA 1XFUO 3SS5A 1SL7A 1MR8A 4HRHA 3I5HC 3TDIA 3EK7A 1DJZA 1DGUA 4Q04A 1NSHA 3SIAA 5KU1A 2KFHA 4PE0A 1SW8A 3DYEA 5HYDA 3PFVA 3JTDB 1DELA 1SCVA 1WRKA 2PRUA 2KFGA 1FI5A 1XFVO 3WHUB 2KAYA 1OOJA 1UHHA 1IJ5A 2L98A 2LM5A 2JPTA 1CFDA 3LCPC 4NDCA 1V1FA 1AP4A 1C07A 2P6BB 1B7TZ 3EKHA 1BU3A 3OB1B 2PALA 3KEVA 3NHTA 1PVAA 4XJKB 3VGOA 1QX5B 1CLLA 2AMIA 2JT3A 1DQEA 2BBMA 2HQ8A 3BJHA 1WLZA 1B8LA 1EXRA 1QLKA 2EHBA 2HETA 2NLNA 3GK2A 3O4YA 4MRXA 5FI2A 2H61C 3VRRA 1CM4A 1QWVA 1BJFA 1C7VA 1GQMA 1TWOA 1AK8A 1IH0A 4GGNA 1B4CA 1X02A 5ER4X 1JC2A 5PALA 1B1GA 3NSKA 1UHNA 1TNXA 3KO0A 3R1PA 4PT1A 2CTNA 1SMGA 2LLUA 1K9KA 1EG4A 1TNQA 2LMUA 1K9UA 1F4QA 1BT6A 2M0RA 3GOFA 5D3OA 3FE8A 4MZKA 4YBHB 1KFUS 2K7BA 3MSEB 1TRFA 1B9AA 2FJYA 2JNFA 4I5LB 5FYXA 4IJ7A 5I94A 4C0LA 3LLEA 3JVTB 4MZJA 3AAKA 1QVIY 4ICBA 2BKHB 1G4YR 3BUMB 4GAOA 1F71A 2KNEA 3LL8B 1CFCA 1A4PA 4INWA 5DICA 2WCMA 1Z4HA 1IG5A 3TDUA 4OVNF 3GK4X 3WXAA 1KQMB 3BUOB 3WNXB 1WRZA 4YGDB 1EH2A 2LHLA 2O60A 3HCMA 3D75A 3SS3A 4OKHA 2K8MB 1DF0B 1GGWA 1MHOA 1MF8B 1YRUB 3JVTC 4AOMA 2CXJA 2ZRSA 3DVEA 3EKJA 4JPZB 2FJUB 2K2FA 1NX2A 2WCEA 5CSIA 1KCYA 1EJ3A 2KAVA 2BE6A 4CIDA 1KQMC 2O5GA 3SG6A 1CTRA 1QVIZ 5JJGA 2KLDA 1CDLA 2KQYA 3BUXB 2LE9B 1NIWA 2KPHA 3B86A 4PALA 2NCOA 4QJ3B 1DC1A 1NX1A 3QRXA 1MXEA 2Q91A 2BCBA 1OOIX 1S6CA 4CFQA 2L51A 2KAXA 3SG3A 1K9PA 3N7HA 3B6XA 1DJXA 1QATA 3D0YA 3BUNB 2LMTA 3OX6A 2L50A 3L4LA 2HPSA 1SL9A 1PK0D 3NSIA 4JD9A 3CYZA 5FI6A 2JXLA 3I5FC 2ZKMX 1C3YA 1YR5A 1YUUA 4M2PA 1KSMA 1LA0A 1IJ6A 4IL1A 4PDZA 1RFJA 4F0ZB 1SNLA 5AERA 2KFFA 4GFTA 3SS4A 3VRQA 2NXQA 3CLNA 1LS8A 1NWDA 1K94A 2G2BA 3A4UB 4ORBB 3SIBA 2L0PA 4P5OE 3EK8A 4YRUA 1NP8A 1DJHA 3ZWHA 2JT8A 1F8HA 1GM0A 1B7TY 1DTLA 1M31A 4QJ4B 3BXKA 1MQ1A 2LUXA 1LXFC 2M49B 5BPJA 1XVJA 2GV5A 5I8NA 4CPVA 1AJ5A 1K95A 3D76A 1J7PA 1TCFA 2WNDA 3VB1A 1IWQA 2LLSA 4ZCVA 3PN7C 1G8IA 3PALA 1SR6C 2L5YA 3OHMB 5DKRA 1NCZA 4GUKA 4YI8A 2LLTA 1OW4A 3TDZA 3SG2A 4PE4A 2L5XB 5HLVA 1M39A 1IKUA 2WCLA 4I5KA 4MZLA 4DCKA 4MSPA 1QASA 1F55A 3O78A 5HKZA 1SCMB 1CMGA 2F3YA 2F3ZA 1SKTA 1V1GA 2Y4QA 1J1EA 4GNKB 4M2OA 1S3PA 1CMFA 3K1EA 2SCPA 1XFXO 4P2YB 1PRWA 1XFWO 2SASA 1WLMA 4PHNA 3TS5B 3WHTB 1YX7A 1AHRA 4WQ2A 1D1OA 1R6PA 1NCYA 1LINA 2JOJA 2JU0A 2LUCA 4I5NB 4C0JA 1YVLA 2MBXA 3EK4A 1H8BA 4TNCA 2PSRA 4QJ5B 3M0WA 1M45A 1SCMC 2LVJA 3FE9A 2JWWA 4A4CA 1OMRA 1N65A 1YVHA 2GGMA 3S0GA 2JPOA 1CLMA 2NZ0A 4D1EA 1DJYA 1C7WA 3NSLA 3NSOA 1WY9A 1L2OB 2ZN9A 3NGVA 4MEWA 3FWBA 4JWQA 1A29A 1K90D 3TS5C 2KBIA 5D69A 4PHMA 1IQ5A 1OOFA 4UPGA 1SBJA 2DOQA 4NDBA 1QX7A 4GPLB 1CDNA 3S0BA 4HREE 1F70A 2PMYA 2BCAA 3D73A 3BQ3A 5HKYA 2LANA 3EVUA 2KI4B 3DXLA 4YI9A 5JOLA 1XO5A 4NDDA 1R2UA 2M29A 1KSOA 1A75A 2K7OA 5FI7A 3S0DA 2ZNEA 1JBAA 4F7FA 1QXPA 1MUXA 3FWCA 1L2OC 2WC8A 1P28A 3EVVA 1S36A 3SG5A 1CDPA 3I5GB 4JQ0D 5F6TA 1KK7Z 3D0YB 1RTP1 1K8UA 1UP5A 2I18A 3A8RA 3CR5X 2WCFA 2F8PA 2AUCA 2JTZA 5CPVA 3Q8IA 3KF9A 1DGVA 2KI4C 3V2LA 1LA3A 2TN4A 4WQ3A 4FTGA 2G9BA 2MLEC 1CFPA 1Y1AA 1TUZA 1RJVA 3CZTX 1H4BA 1IRJA 1KWOB 1ZUZA 2K2AA 3B87A 2LVIA 2MA2A 3I5FB 1W9ZA 1MXLC 2OS8B 2QEVA 2Y5IA 1XFZO 2H2KA 3I5GC 4DIRA 3CGAA 5GQQC 3CZ0A 2KQ6A 3OB2B 1LVCD 3S0FA 1U5IA 4YGEB 1HQVA 3PM8A 1TUJA 2L2EA 3DY9A 3R72A 1MWNA 4GGFA 2L4IA 1J7QA 1OOGA 4HRGA 4MLWA 4E68A 1SK6D 3FS7A 2P71A 1JF2A 4N1GA 2JT0A 2JQ6A 1YX8A 4NQGA 1CDMA 3VRPA 3KHEA 1KWOC 3OBVA 1L7ZA 2WOSA 1OOHA 3S0AA 2ZN8A 3IVTA 1Z2CB 2OS8C 3BOWA 2KHNA 2EC6C 2Y1MA 1LKJA 1F54A 3D78A 1T14A 2WCBA 2JTTA 4INXA 1S5GY 2RGIA 2FCEA 3PN7B 1ORGA 1TCOB 1SR6B 2YGUA 3VRNA 4N1FA
chains in the Genus database with same CATH topology
1F4OA 2Q4UA 1IQ3A 3SJSA 2K7CA 1CNPA 2BE4A 3SG7A 2ZRTA 1QIWA 3H4SE 4BY5A 3TZ1A 2QACA 4MBEA 1B8RA 2LMVA 1JUOA 1YURA 3RLZA 2M1KB 1OMDA 3DF0A 1ZFSA 2BECA 3K21A 2M3WA 4PE1A 4N5XA 1K2HA 5G08A 4MVFA 1ALVA 5AFPA 2GGZA 2F2OA 2M7LA 2R2IA 3CR4X 2OPOA 1JWDA 1J55A 2HF5A 2LV7A 3SG4A 1J7OA 1CKKA 2JZIA 4U8DA 3IQQA 2KBMA 2JRFA 1S26D 3LK0A 2E6WA 4OR9B 1CM1A 1QIVA 1IGVA 1K96A 4ORAB 3AKAA 1S5GZ 1UWOA 1ODBA 1PVBA 1J1DA 1DJWA 1Y1UA 2BL0B 1QX2A 1NCXA 1RECA 1FI6A 2FCDA 2ZNDA 3CWGA 1OSAA 1RROA 1SYMA 4MRYA 1JSAA 3DVJA 3DD4A 3O2PA 3PLFB 5I2OA 1DMOA 1KK8B 3D10A 1NPQA 2M9GA 1DJGA 3OP0A 5IBWA 1SRAA 4YGBB 1BF5A 1A75B 3BUWB 2CNPA 5CSFA 1BOCA 1BR4B 1QV1A 1NYAA 1DVIA 2LAPA 2MLFC 2I2RE 1KK7Y 3OX5A 2BKIB 4XYNA 1UHIA 1PULA 2F33A 5DKQA 2BL0C 5K89A 1TN4A 1OE9B 2JC2A 2LCPA 2LP3A 1ALWA 2MJWB 4DRWA 3NXAA 4YGCB 1S6JA 3BYAA 2KYCA 1JFJA 1OQPA 1KK8C 4L9MA 1W7JB 4A4BA 2LNKA 5I2QA 2IS9A 1DJIA 4PCWA 1YRTB 3AAJA 2NCPA 5KSZA 3RM1A 1HT9A 2MRDA 1QV0A 3JTDC 4OV2A 4R1EA 1E8AA 2CBLA 2LVVA 1WDCB 1U5IB 1UHJA 2B1UA 2PVBA 2H61A 2M7NA 1AUIB 2Y1NA 2AAOA 2M1UA 1BMOA 1PALA 2LP2A 3FIAA 1KFUL 1Y6WA 5HKWA 1WRLA 1K93D 1UHKA 1Y0VH 3CS1A 3ICBA 2A4JA 2COLB 4PHJA 1DT7B 1B8CA 1QS7A 1SL8A 2PASA 1CB1A 2KI6D 3VROA 1NUBA 1UUSA 5TNCA 2ISDA 5ER5A 2M8UA 3DVKA 1UURA 4XJKA 2QPTA 3BOWB 1AVSA 1S1EA 3AKBA 1WDCC 1YTZC 2MAZA 1CLBA 1XYDA 5DKNA 2D8NA 2KSPA 1CFFA 2EGDA 4GGFC 1ZACA 1YUSA 1FF1A 2EC6B 5CSNA 1RWYA 4FQOA 1Y1XA 5AXIA 2CT9A 5D7FA 1BR1B 2OTGB 3EVRA 1OMVA 2KGRA 1QJTA 1N2DA 3DF0B 2JNXA 2K61A 3O6BA 1M46A 1PSBA 4GBAA 1OZOA 2V53A 2JXCA 2BCXA 4USLA 4HSZA 2ZFDA 4M2QA 5I2LA 2FOTA 1EG3A 1TNWA 5CSJA 2CCMA 1ZOTB 3ZNIA 1EL4A 4CFRA 2JULA 3TUYB 4PE7A 4ETOA 2K0JA 1S6IA 2LHIA 1FPWA 1TTXA 3DVMA 1B47A 3I5IB 1RK9A 3PSRA 4YGAA 2OTGC 4MN0A 4C0KA 2I94A 1J7RA 2L4HA 4AQJA 3E3RA 3HX4A 4OCIA 3CTNA 1VRKA 2KI6C 3F45A 4CLNA 1DF0A 1KFXL 2MHHA 1SPYA 1XK4C 1YUTA 2LC5A 3KPXA 3GK1A 1NX0A 2LVKA 1KFXS 5AANA 1OZSA 1A2XA 1M63B 2K7DA 3C1VA 3CR2A 3PATA 4WRIA 3TUYC 2HQWA 1XK4A 1TIZA 1Q80A 1JFKA 5AEQA 3I5IC 1A03A 1GGZA 5HLOA 2VRGA 2M97A 1FBVA 5B8IB 2BBNA 5J3XA 1AJ4A 4DS7A 2KYFA 1BODA 4PHKA 3I5HB 2WORA 1N0YA 1NX3A 4DUQA 1JF0A 2F2PA 3IQOA 3LK1A 1FW4A 1GJYA 4ZCUA 2KOTA 2I7AA 1TNPA 2E30A 1QLSA 4AQIA 1SY9A 1KQVA 4BY4A 5KTYA 1W7IB 1BG1A 2KDHA 2KGBC 1XFYO 4I5JA 1PSRA 1XA5A 1G33A 1TOPA 1QTXA 4ORCB 1BLQA 1ZMZA 1XFUO 1SL7A 1MR8A 4HRHA 3I5HC 3TDIA 3EK7A 1DJZA 1DGUA 4Q04A 1NSHA 3SIAA 5KU1A 2KFHA 4PE0A 1SW8A 5HYDA 3PFVA 3JTDB 1SCVA 1WRKA 2PRUA 2KFGA 1FI5A 1XFVO 3WHUB 2KAYA 1OOJA 1UHHA 1IJ5A 2L98A 2LM5A 2JPTA 1CFDA 3LCPC 4NDCA 1V1FA 1AP4A 1C07A 2P6BB 1B7TZ 3EKHA 1BU3A 3OB1B 2PALA 3KEVA 4XJKB 1PVAA 3VGOA 1QX5B 1CLLA 2AMIA 2JT3A 2BBMA 2HQ8A 3IF7A 1WLZA 1B8LA 1EXRA 1QLKA 2EHBA 2HETA 2NLNA 3GK2A 3O4YA 4MRXA 3VRRA 2H61C 1CM4A 1BJFA 1C7VA 1GQMA 1AK8A 1IH0A 4GGNA 1B4CA 1X02A 5ER4X 1JC2A 5PALA 1B1GA 3NSKA 1UHNA 1TNXA 3KO0A 2CTNA 1SMGA 2LLUA 1K9KA 1EG4A 1TNQA 2LMUA 1K9UA 1F4QA 1BT6A 2M0RA 3GOFA 4MZKA 4YBHB 1KFUS 2K7BA 3MSEB 1TRFA 1B9AA 4I5LB 2JNFA 5FYXA 4C0LA 3LLEA 3JVTB 4MZJA 3AAKA 1QVIY 4ICBA 2BKHB 1G4YR 3BUMB 4GAOA 1F71A 2KNEA 3LL8B 1CFCA 1A4PA 1IG5A 3TDUA 4OVNF 3GK4X 3WXAA 1KQMB 3BUOB 3WNXB 1WRZA 4YGDB 1EH2A 2LHLA 2O60A 3HCMA 4OKHA 2K8MB 1DF0B 1GGWA 1MHOA 1MF8B 1YRUB 3JVTC 4AOMA 2CXJA 2ZRSA 3DVEA 3EKJA 4JPZB 2FJUB 2K2FA 1NX2A 2WCEA 5CSIA 1KCYA 1EJ3A 2KAVA 2BE6A 4CIDA 1KQMC 2O5GA 3SG6A 1CTRA 1QVIZ 5JJGA 1CDLA 2KQYA 3BUXB 2LE9B 1NIWA 4QJ3B 4PALA 2NCOA 1NX1A 3QRXA 1MXEA 2Q91A 2BCBA 1S6CA 4CFQA 2L51A 2KAXA 3SG3A 1K9PA 1DJXA 1QATA 3D0YA 3BUNB 2LMTA 3OX6A 2L50A 2HPSA 1SL9A 1PK0D 3NSIA 2JXLA 3I5FC 2ZKMX 1YR5A 1YUUA 4M2PA 1KSMA 1LA0A 1IJ6A 4IL1A 4PDZA 1RFJA 4F0ZB 1SNLA 5AERA 2KFFA 4GFTA 3VRQA 2NXQA 3CLNA 3A4UB 1NWDA 1K94A 2G2BA 4ORBB 3SIBA 2L0PA 4P5OE 3EK8A 4YRUA 1NP8A 1DJHA 3ZWHA 2JT8A 1F8HA 1B7TY 1DTLA 1M31A 4QJ4B 3BXKA 1MQ1A 2LUXA 1LXFC 2M49B 5BPJA 1XVJA 2GV5A 5I8NA 4CPVA 1AJ5A 1K95A 1J7PA 1TCFA 2WNDA 1IWQA 2LLSA 4ZCVA 3PN7C 1G8IA 3PALA 1SR6C 3OHMB 5DKRA 1NCZA 4GUKA 4YI8A 2LLTA 3TDZA 3SG2A 4PE4A 2L5XB 5HLVA 1M39A 1IKUA 4I5KA 4MZLA 4DCKA 4MSPA 1QASA 1F55A 3O78A 5HKZA 1SCMB 1CMGA 2F3YA 2F3ZA 1SKTA 1V1GA 2Y4QA 1J1EA 4GNKB 4M2OA 1S3PA 1CMFA 2SCPA 1XFXO 4P2YB 1PRWA 1XFWO 2SASA 1WLMA 4PHNA 3TS5B 3WHTB 1YX7A 1AHRA 4WQ2A 1D1OA 1R6PA 1NCYA 1LINA 2JOJA 2JU0A 2LUCA 4I5NB 4C0JA 1YVLA 2MBXA 3EK4A 1H8BA 4TNCA 2PSRA 4QJ5B 3M0WA 1M45A 1SCMC 2LVJA 4A4CA 2JWWA 1OMRA 1N65A 1YVHA 2GGMA 1CLMA 2NZ0A 4D1EA 1DJYA 1C7WA 3NSLA 3NSOA 1WY9A 1L2OB 2ZN9A 4MEWA 3FWBA 4JWQA 1A29A 1K90D 3TS5C 2KBIA 5D69A 4PHMA 1IQ5A 4UPGA 1SBJA 2DOQA 4NDBA 1QX7A 4GPLB 1CDNA 4HREE 1F70A 2PMYA 2BCAA 3BQ3A 5HKYA 2LANA 3EVUA 2KI4B 4YI9A 5JOLA 1XO5A 4NDDA 1R2UA 2M29A 1KSOA 1A75A 2K7OA 2ZNEA 1JBAA 1QXPA 1MUXA 3FWCA 1L2OC 2WC8A 3EVVA 1S36A 3SG5A 1CDPA 3I5GB 4JQ0D 5F6TA 1KK7Z 3D0YB 1RTP1 1K8UA 1UP5A 2I18A 3A8RA 3CR5X 2WCFA 2F8PA 2AUCA 2JTZA 5CPVA 3KF9A 1DGVA 2KI4C 1LA3A 2TN4A 4WQ3A 4FTGA 2G9BA 2MLEC 1CFPA 1Y1AA 1RJVA 3CZTX 1H4BA 1IRJA 1KWOB 1ZUZA 2K2AA 2LVIA 2MA2A 3I5FB 1MXLC 2OS8B 2Y5IA 3I5GC 1XFZO 2H2KA 4DIRA 3CGAA 5GQQC 2KQ6A 3OB2B 1LVCD 1U5IA 4YGEB 1HQVA 3PM8A 2L2EA 1MWNA 4GGFA 2L4IA 1J7QA 4HRGA 4MLWA 4E68A 1SK6D 3FS7A 1JF2A 4N1GA 2JT0A 2JQ6A 1YX8A 4NQGA 1CDMA 3VRPA 3KHEA 1KWOC 1L7ZA 2WOSA 2ZN8A 2OS8C 3BOWA 2KHNA 2EC6C 2Y1MA 1LKJA 1F54A 2WCBA 2JTTA 1S5GY 2RGIA 2FCEA 3PN7B 1TCOB 1SR6B 3VRNA 4N1FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F4O A;  2Q4U A;  1IQ3 A;  3SJS A;  2K7C A;  1CNP A;  2BE4 A;  3SG7 A;  2ZRT A;  1QIW A;  3H4S E;  4BY5 A;  3TZ1 A;  2QAC A;  4MBE A;  1B8R A;  2LMV A;  1JUO A;  1YUR A;  3RLZ A;  2M1K B;  1OMD A;  3DF0 A;  1ZFS A;  2BEC A;  3K21 A;  2M3W A;  4PE1 A;  4N5X A;  1K2H A;  5G08 A;  4MVF A;  1ALV A;  5AFP A;  2GGZ A;  2F2O A;  2M7L A;  2R2I A;  3CR4 X;  2OPO A;  1JWD A;  1J55 A;  2HF5 A;  2LV7 A;  3SG4 A;  1J7O A;  1CKK A;  2JZI A;  4U8D A;  3IQQ A;  2KBM A;  2JRF A;  1S26 D;  3LK0 A;  2E6W A;  4OR9 B;  1CM1 A;  1QIV A;  1IGV A;  1K96 A;  4ORA B;  3AKA A;  1S5G Z;  1UWO A;  1ODB A;  1PVB A;  1J1D A;  1DJW A;  1Y1U A;  2BL0 B;  1QX2 A;  1NCX A;  1REC A;  1FI6 A;  2FCD A;  2ZND A;  3CWG A;  1OSA A;  1RRO A;  1SYM A;  4MRY A;  1JSA A;  3DVJ A;  3DD4 A;  3O2P A;  3PLF B;  5I2O A;  1DMO A;  1KK8 B;  3D10 A;  1NPQ A;  2M9G A;  1DJG A;  3OP0 A;  5IBW A;  1SRA A;  4YGB B;  1BF5 A;  1A75 B;  3BUW B;  2CNP A;  5CSF A;  1BOC A;  1BR4 B;  1QV1 A;  1NYA A;  1DVI A;  2LAP A;  2MLF C;  2I2R E;  1KK7 Y;  3OX5 A;  2BKI B;  4XYN A;  1UHI A;  1PUL A;  2F33 A;  5DKQ A;  2BL0 C;  5K89 A;  1TN4 A;  1OE9 B;  2JC2 A;  2LCP A;  2LP3 A;  1ALW A;  2MJW B;  4DRW A;  3NXA A;  4YGC B;  1S6J A;  3BYA A;  2KYC A;  1JFJ A;  1OQP A;  1KK8 C;  4L9M A;  1W7J B;  4A4B A;  2LNK A;  5I2Q A;  2IS9 A;  1DJI A;  4PCW A;  1YRT B;  3AAJ A;  2NCP A;  5KSZ A;  3RM1 A;  1HT9 A;  2MRD A;  1QV0 A;  3JTD C;  4OV2 A;  4R1E A;  1E8A A;  2CBL A;  2LVV A;  1WDC B;  1U5I B;  1UHJ A;  2B1U A;  2PVB A;  2H61 A;  2M7N A;  1AUI B;  2Y1N A;  2AAO A;  2M1U A;  1BMO A;  1PAL A;  2LP2 A;  3FIA A;  1KFU L;  1Y6W A;  5HKW A;  1WRL A;  1K93 D;  1UHK A;  1Y0V H;  3CS1 A;  3ICB A;  2A4J A;  2COL B;  4PHJ A;  1DT7 B;  1B8C A;  1QS7 A;  1SL8 A;  2PAS A;  1CB1 A;  2KI6 D;  3VRO A;  1NUB A;  1UUS A;  5TNC A;  2ISD A;  5ER5 A;  2M8U A;  3DVK A;  1UUR A;  4XJK A;  2QPT A;  3BOW B;  1AVS A;  1S1E A;  3AKB A;  1WDC C;  1YTZ C;  2MAZ A;  1CLB A;  1XYD A;  5DKN A;  2D8N A;  2KSP A;  1CFF A;  2EGD A;  4GGF C;  1ZAC A;  1YUS A;  1FF1 A;  2EC6 B;  5CSN A;  1RWY A;  4FQO A;  1Y1X A;  5AXI A;  2CT9 A;  5D7F A;  1BR1 B;  2OTG B;  3EVR A;  1OMV A;  2KGR A;  1QJT A;  1N2D A;  3DF0 B;  2JNX A;  2K61 A;  3O6B A;  1M46 A;  1PSB A;  4GBA A;  1OZO A;  2V53 A;  2JXC A;  2BCX A;  4USL A;  4HSZ A;  2ZFD A;  4M2Q A;  5I2L A;  2FOT A;  1EG3 A;  1TNW A;  5CSJ A;  2CCM A;  1ZOT B;  3ZNI A;  1EL4 A;  4CFR A;  2JUL A;  3TUY B;  4PE7 A;  4ETO A;  2K0J A;  1S6I A;  2LHI A;  1FPW A;  1TTX A;  3DVM A;  1B47 A;  3I5I B;  1RK9 A;  3PSR A;  4YGA A;  2OTG C;  4MN0 A;  4C0K A;  2I94 A;  1J7R A;  2L4H A;  4AQJ A;  3E3R A;  3HX4 A;  4OCI A;  3CTN A;  1VRK A;  2KI6 C;  3F45 A;  4CLN A;  1DF0 A;  1KFX L;  2MHH A;  1SPY A;  1XK4 C;  1YUT A;  2LC5 A;  3KPX A;  3GK1 A;  1NX0 A;  2LVK A;  1KFX S;  5AAN A;  1OZS A;  1A2X A;  1M63 B;  2K7D A;  3C1V A;  3CR2 A;  3PAT A;  4WRI A;  3TUY C;  2HQW A;  1XK4 A;  1TIZ A;  1Q80 A;  1JFK A;  5AEQ A;  3I5I C;  1A03 A;  1GGZ A;  5HLO A;  2VRG A;  2M97 A;  1FBV A;  5B8I B;  2BBN A;  5J3X A;  1AJ4 A;  4DS7 A;  2KYF A;  1BOD A;  4PHK A;  3I5H B;  2WOR A;  1N0Y A;  1NX3 A;  4DUQ A;  1JF0 A;  2F2P A;  3IQO A;  3LK1 A;  1FW4 A;  1GJY A;  4ZCU A;  2KOT A;  2I7A A;  1TNP A;  2E30 A;  1QLS A;  4AQI A;  1SY9 A;  1KQV A;  4BY4 A;  5KTY A;  1W7I B;  1BG1 A;  2KDH A;  2KGB C;  1XFY O;  4I5J A;  1PSR A;  1XA5 A;  1G33 A;  1TOP A;  1QTX A;  4ORC B;  1BLQ A;  1ZMZ A;  1XFU O;  1SL7 A;  1MR8 A;  4HRH A;  3I5H C;  3TDI A;  3EK7 A;  1DJZ A;  1DGU A;  4Q04 A;  1NSH A;  3SIA A;  5KU1 A;  2KFH A;  4PE0 A;  1SW8 A;  5HYD A;  3PFV A;  3JTD B;  1SCV A;  1WRK A;  2PRU A;  2KFG A;  1FI5 A;  1XFV O;  3WHU B;  2KAY A;  1OOJ A;  1UHH A;  1IJ5 A;  2L98 A;  2LM5 A;  2JPT A;  1CFD A;  3LCP C;  4NDC A;  1V1F A;  1AP4 A;  1C07 A;  2P6B B;  1B7T Z;  3EKH A;  1BU3 A;  3OB1 B;  2PAL A;  3KEV A;  4XJK B;  1PVA A;  3VGO A;  1QX5 B;  1CLL A;  2AMI A;  2JT3 A;  2BBM A;  2HQ8 A;  3IF7 A;  1WLZ A;  1B8L A;  1EXR A;  1QLK A;  2EHB A;  2HET A;  2NLN A;  3GK2 A;  3O4Y A;  4MRX A;  3VRR A;  2H61 C;  1CM4 A;  1BJF A;  1C7V A;  1GQM A;  1AK8 A;  1IH0 A;  4GGN A;  1B4C A;  1X02 A;  5ER4 X;  1JC2 A;  5PAL A;  1B1G A;  3NSK A;  1UHN A;  1TNX A;  3KO0 A;  2CTN A;  1SMG A;  2LLU A;  1K9K A;  1EG4 A;  1TNQ A;  2LMU A;  1K9U A;  1F4Q A;  1BT6 A;  2M0R A;  3GOF A;  4MZK A;  4YBH B;  1KFU S;  2K7B A;  3MSE B;  1TRF A;  1B9A A;  4I5L B;  2JNF A;  5FYX A;  4C0L A;  3LLE A;  3JVT B;  4MZJ A;  3AAK A;  1QVI Y;  4ICB A;  2BKH B;  1G4Y R;  3BUM B;  4GAO A;  1F71 A;  2KNE A;  3LL8 B;  1CFC A;  1A4P A;  1IG5 A;  3TDU A;  4OVN F;  3GK4 X;  3WXA A;  1KQM B;  3BUO B;  3WNX B;  1WRZ A;  4YGD B;  1EH2 A;  2LHL A;  2O60 A;  3HCM A;  4OKH A;  2K8M B;  1DF0 B;  1GGW A;  1MHO A;  1MF8 B;  1YRU B;  3JVT C;  4AOM A;  2CXJ A;  2ZRS A;  3DVE A;  3EKJ A;  4JPZ B;  2FJU B;  2K2F A;  1NX2 A;  2WCE A;  5CSI A;  1KCY A;  1EJ3 A;  2KAV A;  2BE6 A;  4CID A;  1KQM C;  2O5G A;  3SG6 A;  1CTR A;  1QVI Z;  5JJG A;  1CDL A;  2KQY A;  3BUX B;  2LE9 B;  1NIW A;  4QJ3 B;  4PAL A;  2NCO A;  1NX1 A;  3QRX A;  1MXE A;  2Q91 A;  2BCB A;  1S6C A;  4CFQ A;  2L51 A;  2KAX A;  3SG3 A;  1K9P A;  1DJX A;  1QAT A;  3D0Y A;  3BUN B;  2LMT A;  3OX6 A;  2L50 A;  2HPS A;  1SL9 A;  1PK0 D;  3NSI A;  2JXL A;  3I5F C;  2ZKM X;  1YR5 A;  1YUU A;  4M2P A;  1KSM A;  1LA0 A;  1IJ6 A;  4IL1 A;  4PDZ A;  1RFJ A;  4F0Z B;  1SNL A;  5AER A;  2KFF A;  4GFT A;  3VRQ A;  2NXQ A;  3CLN A;  3A4U B;  1NWD A;  1K94 A;  2G2B A;  4ORB B;  3SIB A;  2L0P A;  4P5O E;  3EK8 A;  4YRU A;  1NP8 A;  1DJH A;  3ZWH A;  2JT8 A;  1F8H A;  1B7T Y;  1DTL A;  1M31 A;  4QJ4 B;  3BXK A;  1MQ1 A;  2LUX A;  1LXF C;  2M49 B;  5BPJ A;  1XVJ A;  2GV5 A;  5I8N A;  4CPV A;  1AJ5 A;  1K95 A;  1J7P A;  1TCF A;  2WND A;  1IWQ A;  2LLS A;  4ZCV A;  3PN7 C;  1G8I A;  3PAL A;  1SR6 C;  3OHM B;  5DKR A;  1NCZ A;  4GUK A;  4YI8 A;  2LLT A;  3TDZ A;  3SG2 A;  4PE4 A;  2L5X B;  5HLV A;  1M39 A;  1IKU A;  4I5K A;  4MZL A;  4DCK A;  4MSP A;  1QAS A;  1F55 A;  3O78 A;  5HKZ A;  1SCM B;  1CMG A;  2F3Y A;  2F3Z A;  1SKT A;  1V1G A;  2Y4Q A;  1J1E A;  4GNK B;  4M2O A;  1S3P A;  1CMF A;  2SCP A;  1XFX O;  4P2Y B;  1PRW A;  1XFW O;  2SAS A;  1WLM A;  4PHN A;  3TS5 B;  3WHT B;  1YX7 A;  1AHR A;  4WQ2 A;  1D1O A;  1R6P A;  1NCY A;  1LIN A;  2JOJ A;  2JU0 A;  2LUC A;  4I5N B;  4C0J A;  1YVL A;  2MBX A;  3EK4 A;  1H8B A;  4TNC A;  2PSR A;  4QJ5 B;  3M0W A;  1M45 A;  1SCM C;  2LVJ A;  4A4C A;  2JWW A;  1OMR A;  1N65 A;  1YVH A;  2GGM A;  1CLM A;  2NZ0 A;  4D1E A;  1DJY A;  1C7W A;  3NSL A;  3NSO A;  1WY9 A;  1L2O B;  2ZN9 A;  4MEW A;  3FWB A;  4JWQ A;  1A29 A;  1K90 D;  3TS5 C;  2KBI A;  5D69 A;  4PHM A;  1IQ5 A;  4UPG A;  1SBJ A;  2DOQ A;  4NDB A;  1QX7 A;  4GPL B;  1CDN A;  4HRE E;  1F70 A;  2PMY A;  2BCA A;  3BQ3 A;  5HKY A;  2LAN A;  3EVU A;  2KI4 B;  4YI9 A;  5JOL A;  1XO5 A;  4NDD A;  1R2U A;  2M29 A;  1KSO A;  1A75 A;  2K7O A;  2ZNE A;  1JBA A;  1QXP A;  1MUX A;  3FWC A;  1L2O C;  2WC8 A;  3EVV A;  1S36 A;  3SG5 A;  1CDP A;  3I5G B;  4JQ0 D;  5F6T A;  1KK7 Z;  3D0Y B;  1RTP 1;  1K8U A;  1UP5 A;  2I18 A;  3A8R A;  3CR5 X;  2WCF A;  2F8P A;  2AUC A;  2JTZ A;  5CPV A;  3KF9 A;  1DGV A;  2KI4 C;  1LA3 A;  2TN4 A;  4WQ3 A;  4FTG A;  2G9B A;  2MLE C;  1CFP A;  1Y1A A;  1RJV A;  3CZT X;  1H4B A;  1IRJ A;  1KWO B;  1ZUZ A;  2K2A A;  2LVI A;  2MA2 A;  3I5F B;  1MXL C;  2OS8 B;  2Y5I A;  3I5G C;  1XFZ O;  2H2K A;  4DIR A;  3CGA A;  5GQQ C;  2KQ6 A;  3OB2 B;  1LVC D;  1U5I A;  4YGE B;  1HQV A;  3PM8 A;  2L2E A;  1MWN A;  4GGF A;  2L4I A;  1J7Q A;  4HRG A;  4MLW A;  4E68 A;  1SK6 D;  3FS7 A;  1JF2 A;  4N1G A;  2JT0 A;  2JQ6 A;  1YX8 A;  4NQG A;  1CDM A;  3VRP A;  3KHE A;  1KWO C;  1L7Z A;  2WOS A;  2ZN8 A;  2OS8 C;  3BOW A;  2KHN A;  2EC6 C;  2Y1M A;  1LKJ A;  1F54 A;  2WCB A;  2JTT A;  1S5G Y;  2RGI A;  2FCE A;  3PN7 B;  1TCO B;  1SR6 B;  3VRN A;  4N1F A; 
#chains in the Genus database with same CATH topology
 1F4O A;  2Q4U A;  3OGN A;  1IQ3 A;  3SJS A;  2K7C A;  1CNP A;  2BE4 A;  3SG7 A;  2ZRT A;  1QIW A;  3H4S E;  4BY5 A;  3FE6 A;  3DZT A;  3TZ1 A;  2QAC A;  3D74 A;  4MBE A;  1B8R A;  2LMV A;  1JUO A;  1YUR A;  3RLZ A;  2M1K B;  1OMD A;  3DF0 A;  1ZFS A;  2BEC A;  3K21 A;  2M3W A;  4PE1 A;  4N5X A;  1K2H A;  4OZD A;  1XFR A;  2L2C A;  5G08 A;  3BFB A;  4MVF A;  1ALV A;  5EL2 A;  5AFP A;  2GGZ A;  2F2O A;  2M7L A;  2R2I A;  3CR4 X;  2OPO A;  1JWD A;  1J55 A;  2HF5 A;  3PJI A;  2LV7 A;  3SG4 A;  1J7O A;  1CKK A;  2JZI A;  4U8D A;  3IQQ A;  2ERB A;  2KBM A;  2JRF A;  1S26 D;  3LK0 A;  2E6W A;  3CZ1 A;  4JKT A;  4OR9 B;  1CM1 A;  1QIV A;  1IGV A;  1K96 A;  4ORA B;  3AKA A;  1S5G Z;  3L47 A;  1UWO A;  1ODB A;  1PVB A;  1J1D A;  1IIO A;  1DJW A;  3CDN A;  1Y1U A;  2BL0 B;  1QX2 A;  3L4A A;  1NCX A;  1REC A;  3O4X A;  1FI6 A;  2FCD A;  2ZND A;  3CWG A;  1OSA A;  1RRO A;  1SYM A;  4MRY A;  1JSA A;  3DVJ A;  5HL1 A;  3DD4 A;  3O2P A;  3PLF B;  2KLE A;  5I2O A;  2QEH A;  1DMO A;  1KK8 B;  3D10 A;  3R1O A;  1NPQ A;  2M9G A;  1DJG A;  3OP0 A;  5IBW A;  1SRA A;  2WC5 A;  4YGB B;  3UNW A;  1BF5 A;  1A75 B;  3BUW B;  2CNP A;  5CSF A;  1BOC A;  3RZS A;  1BR4 B;  1QV1 A;  1NYA A;  1DVI A;  2LAP A;  2MLF C;  2QEO A;  2I2R E;  1KK7 Y;  3OX5 A;  2BKI B;  4XYN A;  1UHI A;  1PUL A;  2F33 A;  5DKQ A;  2BL0 C;  2GTE A;  5K89 A;  1TN4 A;  1OE9 B;  2JC2 A;  2LCP A;  2LP3 A;  3B7A A;  1ALW A;  2MJW B;  3BFA A;  4DRW A;  3NXA A;  3EG5 B;  4YGC B;  1S6J A;  3BYA A;  2KYC A;  1JFJ A;  1OQP A;  1KK8 C;  4L9M A;  1W7J B;  4A4B A;  2LNK A;  5I2Q A;  2QEB A;  2IS9 A;  1DJI A;  4PCW A;  1YRT B;  3AAJ A;  2NCP A;  3QME A;  5KSZ A;  2H8V A;  3RM1 A;  1HT9 A;  2MRD A;  1QV0 A;  3JTD C;  4OV2 A;  4R1E A;  1E8A A;  2CBL A;  2LVV A;  1WDC B;  1U5I B;  1UHJ A;  2B1U A;  2PVB A;  2H61 A;  2M7N A;  1AUI B;  2Y1N A;  2AAO A;  2M1U A;  1BMO A;  1PAL A;  2LP2 A;  3FIA A;  1KFU L;  1Y6W A;  5HKW A;  1WRL A;  1K93 D;  1UHK A;  1Y0V H;  3CS1 A;  3ICB A;  3UO9 A;  2A4J A;  2COL B;  4PHJ A;  1DT7 B;  1B8C A;  1QS7 A;  1SL8 A;  2PAS A;  1CB1 A;  2KI6 D;  3VRO A;  1NUB A;  1UUS A;  5TNC A;  2ISD A;  5ER5 A;  2M8U A;  3DVK A;  1UUR A;  4XJK A;  2QPT A;  3BOW B;  1AVS A;  1S1E A;  3AKB A;  1WDC C;  1YTZ C;  2MAZ A;  1CLB A;  1XYD A;  5DKN A;  2D8N A;  2KSP A;  1CFF A;  2EGD A;  4GGF C;  1ZAC A;  1DEK A;  1YUS A;  1FF1 A;  2EC6 B;  5CSN A;  1RWY A;  4FQO A;  1Y1X A;  5AXI A;  2K60 A;  2CT9 A;  2BAP A;  3D77 A;  5D7F A;  1BR1 B;  2OTG B;  3EVR A;  2QDI A;  1OMV A;  2KGR A;  1QJT A;  1N2D A;  3DF0 B;  2JNX A;  2K61 A;  3O6B A;  1M46 A;  1PSB A;  4GBA A;  1OZO A;  2V53 A;  2JXC A;  2BNX A;  2BCX A;  4USL A;  4HSZ A;  2PYQ A;  2ZFD A;  4M2Q A;  5I2L A;  2FOT A;  1EG3 A;  1TNW A;  5CSJ A;  2CCM A;  1ZOT B;  3ZNI A;  1EL4 A;  4CFR A;  2JUL A;  3TUY B;  4PE7 A;  4ETO A;  2K0J A;  1S6I A;  2LHI A;  1FPW A;  1TTX A;  3DVM A;  1B47 A;  3I5I B;  1RK9 A;  3PSR A;  4YGA A;  2OTG C;  4MN0 A;  4C0K A;  2I94 A;  1J7R A;  2L4H A;  3CZ2 A;  4AQJ A;  3E3R A;  3HX4 A;  4OCI A;  3CTN A;  4FQT A;  1VRK A;  2KI6 C;  3F45 A;  4CLN A;  1DF0 A;  1KFX L;  2MHH A;  1SPY A;  1XK4 C;  1YUT A;  2LC5 A;  3KPX A;  2PQL A;  1SSE B;  3GK1 A;  1NX0 A;  2LVK A;  1KFX S;  3PM2 A;  3B88 A;  5AAN A;  2WCH A;  1OZS A;  1A2X A;  1M63 B;  2K7D A;  3C1V A;  3CR2 A;  3PAT A;  4WRI A;  3TUY C;  2HQW A;  1XK4 A;  1TIZ A;  3R1V A;  1Q80 A;  1JFK A;  5AEQ A;  3I5I C;  1A03 A;  1GGZ A;  3BFH A;  5HLO A;  2VRG A;  2M97 A;  1FBV A;  5B8I B;  2BBN A;  5J3X A;  1AJ4 A;  3IF7 A;  2P70 A;  2WC6 A;  4DS7 A;  2KYF A;  1BOD A;  4KYN A;  4PHK A;  2WCK A;  3I5H B;  2WOR A;  3CAB A;  1N0Y A;  1NX3 A;  4DUQ A;  1JF0 A;  2F2P A;  3IQO A;  3LK1 A;  1FW4 A;  1GJY A;  4ZCU A;  2KOT A;  3NHI A;  2I7A A;  1TNP A;  2E30 A;  1QLS A;  4AQI A;  1SY9 A;  1KQV A;  1C3Z A;  4BY4 A;  5KTY A;  1W7I B;  2WCJ A;  1BG1 A;  2KDH A;  2KGB C;  1XFY O;  4I5J A;  1PSR A;  1XA5 A;  1G33 A;  1TOP A;  1QTX A;  4ORC B;  1BLQ A;  1ZMZ A;  3S0E A;  1XFU O;  3SS5 A;  1SL7 A;  1MR8 A;  4HRH A;  3I5H C;  3TDI A;  3EK7 A;  1DJZ A;  1DGU A;  4Q04 A;  1NSH A;  3SIA A;  5KU1 A;  2KFH A;  4PE0 A;  1SW8 A;  3DYE A;  5HYD A;  3PFV A;  3JTD B;  1DEL A;  1SCV A;  1WRK A;  2PRU A;  2KFG A;  1FI5 A;  1XFV O;  3WHU B;  2KAY A;  1OOJ A;  1UHH A;  1IJ5 A;  2L98 A;  2LM5 A;  2JPT A;  1CFD A;  3LCP C;  4NDC A;  1V1F A;  1AP4 A;  1C07 A;  2P6B B;  1B7T Z;  3EKH A;  1BU3 A;  3OB1 B;  2PAL A;  3KEV A;  3NHT A;  1PVA A;  4XJK B;  3VGO A;  1QX5 B;  1CLL A;  2AMI A;  2JT3 A;  1DQE A;  2BBM A;  2HQ8 A;  3BJH A;  1WLZ A;  1B8L A;  1EXR A;  1QLK A;  2EHB A;  2HET A;  2NLN A;  3GK2 A;  3O4Y A;  4MRX A;  5FI2 A;  2H61 C;  3VRR A;  1CM4 A;  1QWV A;  1BJF A;  1C7V A;  1GQM A;  1TWO A;  1AK8 A;  1IH0 A;  4GGN A;  1B4C A;  1X02 A;  5ER4 X;  1JC2 A;  5PAL A;  1B1G A;  3NSK A;  1UHN A;  1TNX A;  3KO0 A;  3R1P A;  4PT1 A;  2CTN A;  1SMG A;  2LLU A;  1K9K A;  1EG4 A;  1TNQ A;  2LMU A;  1K9U A;  1F4Q A;  1BT6 A;  2M0R A;  3GOF A;  5D3O A;  3FE8 A;  4MZK A;  4YBH B;  1KFU S;  2K7B A;  3MSE B;  1TRF A;  1B9A A;  2FJY A;  2JNF A;  4I5L B;  5FYX A;  4IJ7 A;  5I94 A;  4C0L A;  3LLE A;  3JVT B;  4MZJ A;  3AAK A;  1QVI Y;  4ICB A;  2BKH B;  1G4Y R;  3BUM B;  4GAO A;  1F71 A;  2KNE A;  3LL8 B;  1CFC A;  1A4P A;  4INW A;  5DIC A;  2WCM A;  1Z4H A;  1IG5 A;  3TDU A;  4OVN F;  3GK4 X;  3WXA A;  1KQM B;  3BUO B;  3WNX B;  1WRZ A;  4YGD B;  1EH2 A;  2LHL A;  2O60 A;  3HCM A;  3D75 A;  3SS3 A;  4OKH A;  2K8M B;  1DF0 B;  1GGW A;  1MHO A;  1MF8 B;  1YRU B;  3JVT C;  4AOM A;  2CXJ A;  2ZRS A;  3DVE A;  3EKJ A;  4JPZ B;  2FJU B;  2K2F A;  1NX2 A;  2WCE A;  5CSI A;  1KCY A;  1EJ3 A;  2KAV A;  2BE6 A;  4CID A;  1KQM C;  2O5G A;  3SG6 A;  1CTR A;  1QVI Z;  5JJG A;  2KLD A;  1CDL A;  2KQY A;  3BUX B;  2LE9 B;  1NIW A;  2KPH A;  3B86 A;  4PAL A;  2NCO A;  4QJ3 B;  1DC1 A;  1NX1 A;  3QRX A;  1MXE A;  2Q91 A;  2BCB A;  1OOI X;  1S6C A;  4CFQ A;  2L51 A;  2KAX A;  3SG3 A;  1K9P A;  3N7H A;  3B6X A;  1DJX A;  1QAT A;  3D0Y A;  3BUN B;  2LMT A;  3OX6 A;  2L50 A;  3L4L A;  2HPS A;  1SL9 A;  1PK0 D;  3NSI A;  4JD9 A;  3CYZ A;  5FI6 A;  2JXL A;  3I5F C;  2ZKM X;  1C3Y A;  1YR5 A;  1YUU A;  4M2P A;  1KSM A;  1LA0 A;  1IJ6 A;  4IL1 A;  4PDZ A;  1RFJ A;  4F0Z B;  1SNL A;  5AER A;  2KFF A;  4GFT A;  3SS4 A;  3VRQ A;  2NXQ A;  3CLN A;  1LS8 A;  1NWD A;  1K94 A;  2G2B A;  3A4U B;  4ORB B;  3SIB A;  2L0P A;  4P5O E;  3EK8 A;  4YRU A;  1NP8 A;  1DJH A;  3ZWH A;  2JT8 A;  1F8H A;  1GM0 A;  1B7T Y;  1DTL A;  1M31 A;  4QJ4 B;  3BXK A;  1MQ1 A;  2LUX A;  1LXF C;  2M49 B;  5BPJ A;  1XVJ A;  2GV5 A;  5I8N A;  4CPV A;  1AJ5 A;  1K95 A;  3D76 A;  1J7P A;  1TCF A;  2WND A;  3VB1 A;  1IWQ A;  2LLS A;  4ZCV A;  3PN7 C;  1G8I A;  3PAL A;  1SR6 C;  2L5Y A;  3OHM B;  5DKR A;  1NCZ A;  4GUK A;  4YI8 A;  2LLT A;  1OW4 A;  3TDZ A;  3SG2 A;  4PE4 A;  2L5X B;  5HLV A;  1M39 A;  1IKU A;  2WCL A;  4I5K A;  4MZL A;  4DCK A;  4MSP A;  1QAS A;  1F55 A;  3O78 A;  5HKZ A;  1SCM B;  1CMG A;  2F3Y A;  2F3Z A;  1SKT A;  1V1G A;  2Y4Q A;  1J1E A;  4GNK B;  4M2O A;  1S3P A;  1CMF A;  3K1E A;  2SCP A;  1XFX O;  4P2Y B;  1PRW A;  1XFW O;  2SAS A;  1WLM A;  4PHN A;  3TS5 B;  3WHT B;  1YX7 A;  1AHR A;  4WQ2 A;  1D1O A;  1R6P A;  1NCY A;  1LIN A;  2JOJ A;  2JU0 A;  2LUC A;  4I5N B;  4C0J A;  1YVL A;  2MBX A;  3EK4 A;  1H8B A;  4TNC A;  2PSR A;  4QJ5 B;  3M0W A;  1M45 A;  1SCM C;  2LVJ A;  3FE9 A;  2JWW A;  4A4C A;  1OMR A;  1N65 A;  1YVH A;  2GGM A;  3S0G A;  2JPO A;  1CLM A;  2NZ0 A;  4D1E A;  1DJY A;  1C7W A;  3NSL A;  3NSO A;  1WY9 A;  1L2O B;  2ZN9 A;  3NGV A;  4MEW A;  3FWB A;  4JWQ A;  1A29 A;  1K90 D;  3TS5 C;  2KBI A;  5D69 A;  4PHM A;  1IQ5 A;  1OOF A;  4UPG A;  1SBJ A;  2DOQ A;  4NDB A;  1QX7 A;  4GPL B;  1CDN A;  3S0B A;  4HRE E;  1F70 A;  2PMY A;  2BCA A;  3D73 A;  3BQ3 A;  5HKY A;  2LAN A;  3EVU A;  2KI4 B;  3DXL A;  4YI9 A;  5JOL A;  1XO5 A;  4NDD A;  1R2U A;  2M29 A;  1KSO A;  1A75 A;  2K7O A;  5FI7 A;  3S0D A;  2ZNE A;  1JBA A;  4F7F A;  1QXP A;  1MUX A;  3FWC A;  1L2O C;  2WC8 A;  1P28 A;  3EVV A;  1S36 A;  3SG5 A;  1CDP A;  3I5G B;  4JQ0 D;  5F6T A;  1KK7 Z;  3D0Y B;  1RTP 1;  1K8U A;  1UP5 A;  2I18 A;  3A8R A;  3CR5 X;  2WCF A;  2F8P A;  2AUC A;  2JTZ A;  5CPV A;  3Q8I A;  3KF9 A;  1DGV A;  2KI4 C;  3V2L A;  1LA3 A;  2TN4 A;  4WQ3 A;  4FTG A;  2G9B A;  2MLE C;  1CFP A;  1Y1A A;  1TUZ A;  1RJV A;  3CZT X;  1H4B A;  1IRJ A;  1KWO B;  1ZUZ A;  2K2A A;  3B87 A;  2LVI A;  2MA2 A;  3I5F B;  1W9Z A;  1MXL C;  2OS8 B;  2QEV A;  2Y5I A;  1XFZ O;  2H2K A;  3I5G C;  4DIR A;  3CGA A;  5GQQ C;  3CZ0 A;  2KQ6 A;  3OB2 B;  1LVC D;  3S0F A;  1U5I A;  4YGE B;  1HQV A;  3PM8 A;  1TUJ A;  2L2E A;  3DY9 A;  3R72 A;  1MWN A;  4GGF A;  2L4I A;  1J7Q A;  1OOG A;  4HRG A;  4MLW A;  4E68 A;  1SK6 D;  3FS7 A;  2P71 A;  1JF2 A;  4N1G A;  2JT0 A;  2JQ6 A;  1YX8 A;  4NQG A;  1CDM A;  3VRP A;  3KHE A;  1KWO C;  3OBV A;  1L7Z A;  2WOS A;  1OOH A;  3S0A A;  2ZN8 A;  3IVT A;  1Z2C B;  2OS8 C;  3BOW A;  2KHN A;  2EC6 C;  2Y1M A;  1LKJ A;  1F54 A;  3D78 A;  1T14 A;  2WCB A;  2JTT A;  4INX A;  1S5G Y;  2RGI A;  2FCE A;  3PN7 B;  1ORG A;  1TCO B;  1SR6 B;  2YGU A;  3VRN A;  4N1F A; 
#chains in the Genus database with same CATH homology
 1F4O A;  2Q4U A;  1IQ3 A;  3SJS A;  2K7C A;  1CNP A;  2BE4 A;  3SG7 A;  2ZRT A;  1QIW A;  3H4S E;  4BY5 A;  3TZ1 A;  2QAC A;  4MBE A;  1B8R A;  2LMV A;  1JUO A;  1YUR A;  3RLZ A;  2M1K B;  1OMD A;  3DF0 A;  1ZFS A;  2BEC A;  3K21 A;  2M3W A;  4PE1 A;  4N5X A;  1K2H A;  5G08 A;  4MVF A;  1ALV A;  5AFP A;  2GGZ A;  2F2O A;  2M7L A;  2R2I A;  3CR4 X;  2OPO A;  1JWD A;  1J55 A;  2HF5 A;  2LV7 A;  3SG4 A;  1J7O A;  1CKK A;  2JZI A;  4U8D A;  3IQQ A;  2KBM A;  2JRF A;  1S26 D;  3LK0 A;  2E6W A;  4OR9 B;  1CM1 A;  1QIV A;  1IGV A;  1K96 A;  4ORA B;  3AKA A;  1S5G Z;  1UWO A;  1ODB A;  1PVB A;  1J1D A;  1DJW A;  1Y1U A;  2BL0 B;  1QX2 A;  1NCX A;  1REC A;  1FI6 A;  2FCD A;  2ZND A;  3CWG A;  1OSA A;  1RRO A;  1SYM A;  4MRY A;  1JSA A;  3DVJ A;  3DD4 A;  3O2P A;  3PLF B;  5I2O A;  1DMO A;  1KK8 B;  3D10 A;  1NPQ A;  2M9G A;  1DJG A;  3OP0 A;  5IBW A;  1SRA A;  4YGB B;  1BF5 A;  1A75 B;  3BUW B;  2CNP A;  5CSF A;  1BOC A;  1BR4 B;  1QV1 A;  1NYA A;  1DVI A;  2LAP A;  2MLF C;  2I2R E;  1KK7 Y;  3OX5 A;  2BKI B;  4XYN A;  1UHI A;  1PUL A;  2F33 A;  5DKQ A;  2BL0 C;  5K89 A;  1TN4 A;  1OE9 B;  2JC2 A;  2LCP A;  2LP3 A;  1ALW A;  2MJW B;  4DRW A;  3NXA A;  4YGC B;  1S6J A;  3BYA A;  2KYC A;  1JFJ A;  1OQP A;  1KK8 C;  4L9M A;  1W7J B;  4A4B A;  2LNK A;  5I2Q A;  2IS9 A;  1DJI A;  4PCW A;  1YRT B;  3AAJ A;  2NCP A;  5KSZ A;  3RM1 A;  1HT9 A;  2MRD A;  1QV0 A;  3JTD C;  4OV2 A;  4R1E A;  1E8A A;  2CBL A;  2LVV A;  1WDC B;  1U5I B;  1UHJ A;  2B1U A;  2PVB A;  2H61 A;  2M7N A;  1AUI B;  2Y1N A;  2AAO A;  2M1U A;  1BMO A;  1PAL A;  2LP2 A;  3FIA A;  1KFU L;  1Y6W A;  5HKW A;  1WRL A;  1K93 D;  1UHK A;  1Y0V H;  3CS1 A;  3ICB A;  2A4J A;  2COL B;  4PHJ A;  1DT7 B;  1B8C A;  1QS7 A;  1SL8 A;  2PAS A;  1CB1 A;  2KI6 D;  3VRO A;  1NUB A;  1UUS A;  5TNC A;  2ISD A;  5ER5 A;  2M8U A;  3DVK A;  1UUR A;  4XJK A;  2QPT A;  3BOW B;  1AVS A;  1S1E A;  3AKB A;  1WDC C;  1YTZ C;  2MAZ A;  1CLB A;  1XYD A;  5DKN A;  2D8N A;  2KSP A;  1CFF A;  2EGD A;  4GGF C;  1ZAC A;  1YUS A;  1FF1 A;  2EC6 B;  5CSN A;  1RWY A;  4FQO A;  1Y1X A;  5AXI A;  2CT9 A;  5D7F A;  1BR1 B;  2OTG B;  3EVR A;  1OMV A;  2KGR A;  1QJT A;  1N2D A;  3DF0 B;  2JNX A;  2K61 A;  3O6B A;  1M46 A;  1PSB A;  4GBA A;  1OZO A;  2V53 A;  2JXC A;  2BCX A;  4USL A;  4HSZ A;  2ZFD A;  4M2Q A;  5I2L A;  2FOT A;  1EG3 A;  1TNW A;  5CSJ A;  2CCM A;  1ZOT B;  3ZNI A;  1EL4 A;  4CFR A;  2JUL A;  3TUY B;  4PE7 A;  4ETO A;  2K0J A;  1S6I A;  2LHI A;  1FPW A;  1TTX A;  3DVM A;  1B47 A;  3I5I B;  1RK9 A;  3PSR A;  4YGA A;  2OTG C;  4MN0 A;  4C0K A;  2I94 A;  1J7R A;  2L4H A;  4AQJ A;  3E3R A;  3HX4 A;  4OCI A;  3CTN A;  1VRK A;  2KI6 C;  3F45 A;  4CLN A;  1DF0 A;  1KFX L;  2MHH A;  1SPY A;  1XK4 C;  1YUT A;  2LC5 A;  3KPX A;  3GK1 A;  1NX0 A;  2LVK A;  1KFX S;  5AAN A;  1OZS A;  1A2X A;  1M63 B;  2K7D A;  3C1V A;  3CR2 A;  3PAT A;  4WRI A;  3TUY C;  2HQW A;  1XK4 A;  1TIZ A;  1Q80 A;  1JFK A;  5AEQ A;  3I5I C;  1A03 A;  1GGZ A;  5HLO A;  2VRG A;  2M97 A;  1FBV A;  5B8I B;  2BBN A;  5J3X A;  1AJ4 A;  4DS7 A;  2KYF A;  1BOD A;  4PHK A;  3I5H B;  2WOR A;  1N0Y A;  1NX3 A;  4DUQ A;  1JF0 A;  2F2P A;  3IQO A;  3LK1 A;  1FW4 A;  1GJY A;  4ZCU A;  2KOT A;  2I7A A;  1TNP A;  2E30 A;  1QLS A;  4AQI A;  1SY9 A;  1KQV A;  4BY4 A;  5KTY A;  1W7I B;  1BG1 A;  2KDH A;  2KGB C;  1XFY O;  4I5J A;  1PSR A;  1XA5 A;  1G33 A;  1TOP A;  1QTX A;  4ORC B;  1BLQ A;  1ZMZ A;  1XFU O;  1SL7 A;  1MR8 A;  4HRH A;  3I5H C;  3TDI A;  3EK7 A;  1DJZ A;  1DGU A;  4Q04 A;  1NSH A;  3SIA A;  5KU1 A;  2KFH A;  4PE0 A;  1SW8 A;  5HYD A;  3PFV A;  3JTD B;  1SCV A;  1WRK A;  2PRU A;  2KFG A;  1FI5 A;  1XFV O;  3WHU B;  2KAY A;  1OOJ A;  1UHH A;  1IJ5 A;  2L98 A;  2LM5 A;  2JPT A;  1CFD A;  3LCP C;  4NDC A;  1V1F A;  1AP4 A;  1C07 A;  2P6B B;  1B7T Z;  3EKH A;  1BU3 A;  3OB1 B;  2PAL A;  3KEV A;  4XJK B;  1PVA A;  3VGO A;  1QX5 B;  1CLL A;  2AMI A;  2JT3 A;  2BBM A;  2HQ8 A;  3IF7 A;  1WLZ A;  1B8L A;  1EXR A;  1QLK A;  2EHB A;  2HET A;  2NLN A;  3GK2 A;  3O4Y A;  4MRX A;  3VRR A;  2H61 C;  1CM4 A;  1BJF A;  1C7V A;  1GQM A;  1AK8 A;  1IH0 A;  4GGN A;  1B4C A;  1X02 A;  5ER4 X;  1JC2 A;  5PAL A;  1B1G A;  3NSK A;  1UHN A;  1TNX A;  3KO0 A;  2CTN A;  1SMG A;  2LLU A;  1K9K A;  1EG4 A;  1TNQ A;  2LMU A;  1K9U A;  1F4Q A;  1BT6 A;  2M0R A;  3GOF A;  4MZK A;  4YBH B;  1KFU S;  2K7B A;  3MSE B;  1TRF A;  1B9A A;  4I5L B;  2JNF A;  5FYX A;  4C0L A;  3LLE A;  3JVT B;  4MZJ A;  3AAK A;  1QVI Y;  4ICB A;  2BKH B;  1G4Y R;  3BUM B;  4GAO A;  1F71 A;  2KNE A;  3LL8 B;  1CFC A;  1A4P A;  1IG5 A;  3TDU A;  4OVN F;  3GK4 X;  3WXA A;  1KQM B;  3BUO B;  3WNX B;  1WRZ A;  4YGD B;  1EH2 A;  2LHL A;  2O60 A;  3HCM A;  4OKH A;  2K8M B;  1DF0 B;  1GGW A;  1MHO A;  1MF8 B;  1YRU B;  3JVT C;  4AOM A;  2CXJ A;  2ZRS A;  3DVE A;  3EKJ A;  4JPZ B;  2FJU B;  2K2F A;  1NX2 A;  2WCE A;  5CSI A;  1KCY A;  1EJ3 A;  2KAV A;  2BE6 A;  4CID A;  1KQM C;  2O5G A;  3SG6 A;  1CTR A;  1QVI Z;  5JJG A;  1CDL A;  2KQY A;  3BUX B;  2LE9 B;  1NIW A;  4QJ3 B;  4PAL A;  2NCO A;  1NX1 A;  3QRX A;  1MXE A;  2Q91 A;  2BCB A;  1S6C A;  4CFQ A;  2L51 A;  2KAX A;  3SG3 A;  1K9P A;  1DJX A;  1QAT A;  3D0Y A;  3BUN B;  2LMT A;  3OX6 A;  2L50 A;  2HPS A;  1SL9 A;  1PK0 D;  3NSI A;  2JXL A;  3I5F C;  2ZKM X;  1YR5 A;  1YUU A;  4M2P A;  1KSM A;  1LA0 A;  1IJ6 A;  4IL1 A;  4PDZ A;  1RFJ A;  4F0Z B;  1SNL A;  5AER A;  2KFF A;  4GFT A;  3VRQ A;  2NXQ A;  3CLN A;  3A4U B;  1NWD A;  1K94 A;  2G2B A;  4ORB B;  3SIB A;  2L0P A;  4P5O E;  3EK8 A;  4YRU A;  1NP8 A;  1DJH A;  3ZWH A;  2JT8 A;  1F8H A;  1B7T Y;  1DTL A;  1M31 A;  4QJ4 B;  3BXK A;  1MQ1 A;  2LUX A;  1LXF C;  2M49 B;  5BPJ A;  1XVJ A;  2GV5 A;  5I8N A;  4CPV A;  1AJ5 A;  1K95 A;  1J7P A;  1TCF A;  2WND A;  1IWQ A;  2LLS A;  4ZCV A;  3PN7 C;  1G8I A;  3PAL A;  1SR6 C;  3OHM B;  5DKR A;  1NCZ A;  4GUK A;  4YI8 A;  2LLT A;  3TDZ A;  3SG2 A;  4PE4 A;  2L5X B;  5HLV A;  1M39 A;  1IKU A;  4I5K A;  4MZL A;  4DCK A;  4MSP A;  1QAS A;  1F55 A;  3O78 A;  5HKZ A;  1SCM B;  1CMG A;  2F3Y A;  2F3Z A;  1SKT A;  1V1G A;  2Y4Q A;  1J1E A;  4GNK B;  4M2O A;  1S3P A;  1CMF A;  2SCP A;  1XFX O;  4P2Y B;  1PRW A;  1XFW O;  2SAS A;  1WLM A;  4PHN A;  3TS5 B;  3WHT B;  1YX7 A;  1AHR A;  4WQ2 A;  1D1O A;  1R6P A;  1NCY A;  1LIN A;  2JOJ A;  2JU0 A;  2LUC A;  4I5N B;  4C0J A;  1YVL A;  2MBX A;  3EK4 A;  1H8B A;  4TNC A;  2PSR A;  4QJ5 B;  3M0W A;  1M45 A;  1SCM C;  2LVJ A;  4A4C A;  2JWW A;  1OMR A;  1N65 A;  1YVH A;  2GGM A;  1CLM A;  2NZ0 A;  4D1E A;  1DJY A;  1C7W A;  3NSL A;  3NSO A;  1WY9 A;  1L2O B;  2ZN9 A;  4MEW A;  3FWB A;  4JWQ A;  1A29 A;  1K90 D;  3TS5 C;  2KBI A;  5D69 A;  4PHM A;  1IQ5 A;  4UPG A;  1SBJ A;  2DOQ A;  4NDB A;  1QX7 A;  4GPL B;  1CDN A;  4HRE E;  1F70 A;  2PMY A;  2BCA A;  3BQ3 A;  5HKY A;  2LAN A;  3EVU A;  2KI4 B;  4YI9 A;  5JOL A;  1XO5 A;  4NDD A;  1R2U A;  2M29 A;  1KSO A;  1A75 A;  2K7O A;  2ZNE A;  1JBA A;  1QXP A;  1MUX A;  3FWC A;  1L2O C;  2WC8 A;  3EVV A;  1S36 A;  3SG5 A;  1CDP A;  3I5G B;  4JQ0 D;  5F6T A;  1KK7 Z;  3D0Y B;  1RTP 1;  1K8U A;  1UP5 A;  2I18 A;  3A8R A;  3CR5 X;  2WCF A;  2F8P A;  2AUC A;  2JTZ A;  5CPV A;  3KF9 A;  1DGV A;  2KI4 C;  1LA3 A;  2TN4 A;  4WQ3 A;  4FTG A;  2G9B A;  2MLE C;  1CFP A;  1Y1A A;  1RJV A;  3CZT X;  1H4B A;  1IRJ A;  1KWO B;  1ZUZ A;  2K2A A;  2LVI A;  2MA2 A;  3I5F B;  1MXL C;  2OS8 B;  2Y5I A;  3I5G C;  1XFZ O;  2H2K A;  4DIR A;  3CGA A;  5GQQ C;  2KQ6 A;  3OB2 B;  1LVC D;  1U5I A;  4YGE B;  1HQV A;  3PM8 A;  2L2E A;  1MWN A;  4GGF A;  2L4I A;  1J7Q A;  4HRG A;  4MLW A;  4E68 A;  1SK6 D;  3FS7 A;  1JF2 A;  4N1G A;  2JT0 A;  2JQ6 A;  1YX8 A;  4NQG A;  1CDM A;  3VRP A;  3KHE A;  1KWO C;  1L7Z A;  2WOS A;  2ZN8 A;  2OS8 C;  3BOW A;  2KHN A;  2EC6 C;  2Y1M A;  1LKJ A;  1F54 A;  2WCB A;  2JTT A;  1S5G Y;  2RGI A;  2FCE A;  3PN7 B;  1TCO B;  1SR6 B;  3VRN A;  4N1F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...