2BL0B

Physarum polycephalum myosin ii regulatory domain
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
145
structure length
145
Chain Sequence
TASADQIQECFQIFDKDNDGKVSIEELGSALRSLGKNPTNAELNTIKGQLNAKEFDLATFKTVYRKPIKTPTEQSKEMLDAFRALDKEGNGTIQEAELRQLLLNLGDALTSSEVEELMKEVSVSGDGAINYESFVDMLVTGYPLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MAJOR PLASMODIAL MYOSIN HEAVY CHAIN
publication title Structural Evidence for Non-Canonical Binding of Ca2+ to a Canonical EF-Hand of a Conventional Myosin.
pubmed doi rcsb
source organism Physarum polycephalum
molecule tags Muscle protein
total genus 44
structure length 145
sequence length 145
ec nomenclature ec 3.6.1.32: Transferred entry: 5.6.1.8.
pdb deposition date 2005-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00036 EF-hand_1 EF hand
B PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2bl0B02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2bl0B01
4YI8A 2NZ0A 1XFUO 2HQ8A 5TNCA 1JFJA 1NX0A 1RECA 3SJSA 2KI4C 3EK7A 1CMGA 1TCOB 5AXIA 1FF1A 4DIRA 2K7OA 1RTP1 3LK0A 2MBXA 1K2HA 1IWQA 3ZNIA 3I5GB 1SRAA 3SG4A 1K8UA 2DOQA 2KGBC 2MHHA 4MZJA 3ZWHA 3JTDB 3I5FC 1GQMA 3FWCA 1QLKA 4MLWA 1A75A 2PSRA 2M1UA 1XFYO 1YRUB 2CTNA 1DMOA 1BU3A 1H8BA 3SG5A 1S6JA 2LNKA 1BJFA 2M1KB 3DVMA 4R1EA 1H4BA 4NDCA 1M45A 5I2OA 1SR6B 1B7TZ 2OS8C 4I5NB 2L5XB 3TS5B 5CSJA 1QASA 1CM4A 2WC8A 1CM1A 1U5IB 3E3RA 2M9GA 3EVVA 1DF0A 1DJHA 1GJYA 2JT3A 3BUNB 4GAOA 4AQJA 1NWDA 5CPVA 1IKUA 1LA3A 4CFRA 1DTLA 4D1EA 2LMVA 4PHMA 4JQ0D 1CLLA 2Y1NA 1YUUA 1IG5A 1JSAA 3DVKA 3GK1A 3CZTX 1OQPA 2F8PA 4F0ZB 1AHRA 4PHNA 4CFQA 1CTRA 3GK4X 2M3WA 1IGVA 2QACA 2M7LA 3KF9A 1XVJA 1M31A 3OB2B 2A4JA 1RJVA 2KYCA 1J7RA 1K96A 4GGFC 1TNXA 2I94A 3I5HB 1Y6WA 2KFGA 1KCYA 3IQOA 3LL8B 2WCFA 2LCPA 1B8CA 2JXCA 2ZNDA 4QJ3B 4XJKB 4CLNA 1AK8A 2L98A 1ZMZA 4DUQA 2FJUB 2AMIA 2D8NA 2LVKA 1UHKA 2SCPA 2ZN8A 2KBMA 1EG4A 2BL0C 1KFUL 2K2FA 1TCFA 2L50A 5G08A 3WHTB 1CFFA 3RLZA 1PSRA 4WQ2A 2L2EA 3SG2A 1J55A 4CIDA 2LC5A 1NX3A 5DKRA 4YGEB 1JC2A 5CSNA 2KGRA 5AFPA 2IS9A 1F4QA 2VRGA 4MZKA 1BR4B 1J1EA 4ORBB 1B1GA 3CLNA 4HREE 3BQ3A 2PMYA 2QPTA 1SL7A 4OKHA 2JTTA 4ORCB 1Y0VH 2G9BA 2PALA 1J7OA 3DF0A 2CCMA 2KAVA 4C0JA 1D1OA 3ICBA 4Q04A 2LLUA 1BOCA 2R2IA 4PDZA 2G2BA 2ZN9A 4GBAA 4JPZB 3IQQA 4MBEA 3MSEB 1CFCA 1SKTA 5ER4X 2AAOA 2HPSA 2V53A 3CS1A 1FI6A 1U5IA 2LP3A 1L7ZA 1NYAA 1UUSA 2MRDA 3NSKA 4FQOA 1HT9A 4M2PA 1VRKA 3BOWB 1NSHA 1F70A 2NXQA 1UHJA 2LVJA 1J7QA 5HKWA 3LK1A 2ISDA 1BF5A 1Y1UA 1UURA 5ER5A 1TIZA 2FCDA 4MRYA 5JOLA 1ZOTB 3CTNA 3NSIA 2O60A 2BE4A 1F55A 1JF0A 1MQ1A 1WDCC 1XFVO 2RGIA 2H2KA 2BCBA 2E6WA 1SCMC 1CB1A 3TDUA 1BODA 1QJTA 1S3PA 2JULA 1S5GZ 2CNPA 4XJKA 5F6TA 2KFFA 1JFKA 1R2UA 3PM8A 2K7DA 3QRXA 1A03A 1JWDA 1K95A 1TOPA 1WRZA 1QVIZ 1TNQA 5HKYA 2EHBA 1RFJA 4XYNA 4GUKA 4YGDB 2JT8A 1M39A 1YR5A 2ZRSA 4ETOA 3VRQA 2M97A 1OZSA 3A8RA 3BYAA 1ZFSA 4PE1A 1AVSA 1WLMA 2ZFDA 1XK4A 1CLMA 2LVIA 3BXKA 4QJ4B 4M2OA 1EXRA 1ALWA 1K9PA 1V1FA 1CLBA 2LLSA 1OSAA 1NCZA 2BBMA 3OHMB 1QV1A 2CBLA 2WORA 1RWYA 4GGNA 1SL9A 1UP5A 1Y1AA 3OP0A 1CFPA 5HKZA 2BL0B 2OPOA 5CSFA 5KU1A 2L51A 1JBAA 4YGAA 2GV5A 3KPXA 3DVEA 1J7PA 3BUXB 2WNDA 1K93D 1CFDA 4I5JA 4MVFA 3TUYB 4I5LB 1W7IB 4AQIA 2MA2A 2JOJA 1PK0D 1SCVA 5KSZA 3SG7A 1KK7Z 1XFWO 2LUXA 2Y5IA 1R6PA 3O6BA 1ZUZA 1MF8B 3EVRA 1QX5B 1EL4A 1LA0A 3BOWA 3I5IB 1AJ5A 4IL1A 4L9MA 1IQ3A 2SASA 1S26D 2KBIA 2NLNA 1KQVA 1RK9A 2Q91A 2EC6C 4A4CA 3PN7C 1WY9A 2H61A 2KI6D 3O2PA 4PHJA 2JZIA 1CKKA 2KFHA 4MEWA 1KSOA 3LLEA 1UHIA 3SG6A 1IRJA 4N1GA 4C0KA 2NCPA 4U8DA 4N5XA 2K61A 3CGAA 4OV2A 3TDIA 2LV7A 4ZCVA 1KFXS 2KYFA 3AKBA 5PALA 3I5GC 1K94A 1K9UA 1N0YA 1TN4A 3D0YB 3DD4A 1Y1XA 5HYDA 2WOSA 2GGZA 1KWOB 1SW8A 1CDMA 3JTDC 2GGMA 1UHHA 3NSLA 1SL8A 3JVTB 1QLSA 3WXAA 1N65A 2MLFC 4PALA 2AUCA 2BCXA 1OE9B 3EK8A 1YUTA 1SCMB 3CR4X 4GGFA 2F2OA 2HQWA 1K9KA 3TS5C 1F71A 4GPLB 1QIVA 1MXLC 1ALVA 1DVIA 1MR8A 3F45A 1A2XA 1MUXA 3BUWB 2KI4B 4HRGA 1EH2A 4PE4A 5JJGA 4E68A 3VRNA 1YX7A 1GGZA 1QV0A 1XFXO 2KNEA 1QXPA 1S36A 1E8AA 3M0WA 2JXLA 2LVVA 2JQ6A 3I5FB 4WQ3A 3PSRA 3GK2A 1CNPA 3AAJA 3VRPA 3PFVA 3VROA 3SIAA 1V1GA 1EG3A 1J1DA 4NDBA 2BE6A 4PCWA 2BCAA 1XFZO 2OTGC 1MXEA 1C7VA 1YVLA 4BY4A 1IH0A 1B7TY 1DGVA 1OMDA 1RROA 1HQVA 3OB1B 1B8RA 1A4PA 2JT0A 2P6BB 5J3XA 2OS8B 1S6CA 1FBVA 1PRWA 3KEVA 1SPYA 1LINA 1TNPA 3WHUB 4HSZA 4YGBB 1PSBA 2M8UA 1B47A 1KK7Y 1F8HA 2NCOA 2ZRTA 3KO0A 3D10A 1YTZC 3O4YA 2E30A 1MWNA 1DJGA 2FCEA 4BY5A 1XK4C 2LMUA 4AOMA 3C1VA 3HX4A 4QJ5B 5DKNA 5CSIA 1SYMA 1LVCD 1NCXA 3PLFB 3WNXB 4I5KA 2JTZA 3VGOA 1BMOA 2BKIB 2MLEC 1TNWA 2M0RA 2K2AA 1NIWA 3EKHA 1FPWA 1FI5A 3PATA 1L2OC 2LE9B 1DJWA 2JU0A 2JNXA 1CDLA 2LM5A 2ZNEA 4OR9B 3PALA 2HF5A 1Q80A 2WCEA 4DCKA 1SBJA 5KTYA 2KOTA 1OMRA 4DRWA 1SK6D 3O78A 1JUOA 1NCYA 1X02A 1OOJA 1YRTB 3FIAA 4PHKA 5I2LA 1MHOA 3SG3A 1S1EA 1W7JB 1A29A 1NPQA 3DVJA 2O5GA 4P2YB 3FS7A 5DKQA 1KQMC 3SIBA 3RM1A 5D7FA 5B8IB 4PE7A 4HRHA 2H61C 2LMTA 1UWOA 2KI6C 3DF0B 2FOTA 3BUOB 3CR2A 5HLOA 4YI9A 2JNFA 4JWQA 2F3ZA 4USLA 2F3YA 1ZACA 1KFXL 2L0PA 4NQGA 1XO5A 2M29A 2CXJA 5I2QA 4ZCUA 1WRLA 1B4CA 1LKJA 4GNKB 1DJXA 3HCMA 3LCPC 5AEQA 1KK8C 1PALA 1CMFA 3A4UB 2LP2A 1OZOA 1S6IA 1IQ5A 4MN0A 1C07A 1PVBA 4WRIA 3TDZA 2LANA 1SY9A 1QX2A 4ICBA 2MJWB 2F33A 2BKHB 2KSPA 4M2QA 1OMVA 1G4YR 2COLB 2KQYA 1PULA 4NDDA 1JF2A 5AERA 1IJ6A 3OX6A 2OTGB 1CDPA 1PVAA 3GOFA 1FW4A 4UPGA 1AJ4A 1WDCB 1GGWA 4YGCB 1YVHA 1NUBA 3CWGA 3EKJA 4TNCA 2LHLA 4MSPA 1DT7B 1N2DA 1NX1A 1SR6C 1S5GY 1BG1A 4PE0A 3VRRA 4N1FA 1QVIY 1NX2A 4DS7A 3TUYC 2BECA 1ODBA 3TZ1A 2LUCA 4C0LA 5I8NA 1C7WA 3IF7A 2JWWA 3AAKA 1UHNA 1TTXA 1DGUA 1KSMA 1A75B 1KFUS 3I5IC 1LXFC 2I18A 1M46A 5K89A 1F4OA 2KAXA 2LAPA 1BLQA 2M7NA 1WRKA 1CDNA 1L2OB 2BBNA 1EJ3A 2L4HA 1YX8A 1B8LA 1QTXA 2K0JA 4YRUA 5BPJA 2CT9A 2Q4UA 2ZKMX 3I5HC 2I2RE 2LHIA 1AUIB 1AP4A 2TN4A 1QX7A 2MAZA 2Y1MA 3KHEA 1YUSA 1DF0B 4GFTA 2WCBA 4MZLA 5FYXA 3BUMB 1G8IA 1NP8A 2JC2A 2KQ6A 2L4IA 3EK4A 4YBHB 2Y4QA 1QS7A 1SMGA 1YURA 5GQQC 1QIWA 2K7CA 4P5OE 5IBWA 2K7BA 1DJZA 2KAYA 3OX5A 2HETA 3FWBA 4MRXA 1B9AA 3H4SE 3EVUA 1DJYA 1KQMB 1XYDA 4CPVA 5AANA 2EGDA 1KWOC 2PRUA 4ORAB 1F54A 1QATA 3AKAA 1SNLA 3NSOA 2PASA 1K90D 2F2PA 3CR5X 1TRFA 3JVTC 4A4BA 2B1UA 1M63B 1DJIA 4FTGA 3D0YA 2M49B 5D69A 2JPTA 5HLVA 2KHNA 2K8MB 4OVNF 1BR1B 4OCIA 1IJ5A 2EC6B 3PN7B 1G33A 3NXAA 2JRFA 2LLTA 1BT6A 2KDHA 1XA5A 1WLZA 3K21A 2I7AA 1KK8B 2PVBA
chains in the Genus database with same CATH superfamily
3D73A 4YI8A 2NZ0A 1XFUO 2HQ8A 5TNCA 1JFJA 3L4AA 1NX0A 1RECA 3SJSA 2KI4C 3EK7A 1CMGA 1TCOB 2WCJA 3B86A 5AXIA 1TUJA 1FF1A 4DIRA 2K7OA 1RTP1 3LK0A 2MBXA 1K2HA 1IWQA 3ZNIA 3I5GB 1SRAA 3D78A 3SG4A 1K8UA 2DOQA 2KGBC 2MHHA 3CZ1A 4MZJA 3ZWHA 3JTDB 3I5FC 1QWVA 1GQMA 3FWCA 1QLKA 4MLWA 1A75A 2PSRA 2M1UA 1XFYO 4PT1A 1YRUB 2CTNA 1DMOA 1BU3A 1H8BA 3SG5A 1S6JA 2LNKA 1BJFA 2M1KB 3DVMA 4R1EA 3NHTA 1H4BA 4NDCA 1M45A 3BFBA 5I2OA 1SR6B 1B7TZ 2OS8C 4I5NB 2L5XB 3TS5B 5CSJA 1QASA 1CM4A 1DEKA 2WC8A 1CM1A 3K1EA 1U5IB 3E3RA 2M9GA 3EVVA 1DF0A 1DJHA 1GJYA 2JT3A 3BUNB 3R1OA 4GAOA 4JKTA 4AQJA 1NWDA 5CPVA 1IKUA 1LA3A 4CFRA 1DTLA 4D1EA 1W9ZA 2LMVA 4PHMA 4JQ0D 1CLLA 2Y1NA 1YUUA 1IG5A 1JSAA 3DVKA 3GK1A 3CZTX 1OQPA 2F8PA 3NGVA 1AHRA 4F0ZB 4PHNA 4CFQA 1CTRA 3GK4X 2M3WA 1IGVA 2QACA 3B7AA 3DYEA 3Q8IA 2M7LA 3KF9A 1XVJA 1M31A 3OB2B 2A4JA 1RJVA 2KYCA 1J7RA 1K96A 4GGFC 1TNXA 2I94A 3I5HB 1Y6WA 1DQEA 2KFGA 1KCYA 3IQOA 3LL8B 1XFRA 2WCFA 2LCPA 1B8CA 2JXCA 2ZNDA 4QJ3B 4XJKB 4CLNA 1AK8A 2L98A 1ZMZA 4DUQA 2FJUB 2AMIA 2D8NA 2LVKA 1UHKA 2SCPA 2ZN8A 2KBMA 1EG4A 2BL0C 1KFUL 2K2FA 1TCFA 2L50A 5G08A 3WHTB 1CFFA 3RLZA 1PSRA 4WQ2A 2L2EA 3SG2A 1J55A 4CIDA 5HL1A 2LC5A 1NX3A 5DKRA 1TWOA 4YGEB 3D77A 1JC2A 5CSNA 2KGRA 5AFPA 2IS9A 1F4QA 2VRGA 4MZKA 1BR4B 1J1EA 4ORBB 1B1GA 3CLNA 4HREE 3BQ3A 4FQTA 2PMYA 2QPTA 1SL7A 4OKHA 2JTTA 4ORCB 3OBVA 1Y0VH 3B88A 2G9BA 2PALA 1J7OA 3DF0A 2CCMA 2KAVA 4C0JA 1D1OA 3ICBA 4Q04A 2LLUA 1BOCA 2R2IA 4PDZA 2G2BA 2ZN9A 4GBAA 4JPZB 3DZTA 3IQQA 4MBEA 3MSEB 1CFCA 1SKTA 5ER4X 2AAOA 2HPSA 2V53A 3CS1A 1FI6A 1U5IA 2LP3A 1L7ZA 1NYAA 1UUSA 2MRDA 3NSKA 3NHIA 1HT9A 4FQOA 4M2PA 1VRKA 2H8VA 3BOWB 1NSHA 3OGNA 3SS3A 2NXQA 1F70A 1UHJA 2LVJA 1J7QA 5HKWA 3LK1A 2ISDA 1BF5A 1Y1UA 3UNWA 1UURA 5ER5A 1TIZA 2FCDA 4MRYA 5JOLA 1ZOTB 3CTNA 3NSIA 2O60A 3S0FA 2BE4A 1F55A 1JF0A 1MQ1A 1WDCC 1XFVO 2RGIA 2H2KA 2BCBA 2E6WA 1SCMC 1CB1A 3TDUA 1BODA 1QJTA 1S3PA 2JULA 1S5GZ 2CNPA 4XJKA 5F6TA 2KFFA 1JFKA 1R2UA 3PM8A 2K7DA 3QRXA 1A03A 1JWDA 1K95A 1TOPA 1WRZA 1QVIZ 1TNQA 5HKYA 1OOFA 3S0AA 2EHBA 1RFJA 2K60A 4GUKA 4XYNA 2JT8A 4YGDB 1M39A 1YR5A 2ZRSA 5FI6A 3VRQA 4ETOA 5DICA 2M97A 1OZSA 3A8RA 3BYAA 1OOIX 1ZFSA 4PE1A 1AVSA 1WLMA 2ZFDA 1XK4A 1CLMA 2LVIA 3BXKA 4QJ4B 4M2OA 1EXRA 1ALWA 1K9PA 1V1FA 1CLBA 2LLSA 1OSAA 1NCZA 2BBMA 3OHMB 1QV1A 2CBLA 2WORA 1RWYA 4GGNA 1SL9A 1UP5A 1Y1AA 3OP0A 3S0GA 1CFPA 5HKZA 2BL0B 2OPOA 5CSFA 5KU1A 2L5YA 2L51A 1JBAA 5EL2A 4YGAA 2P71A 2GV5A 3KPXA 3DVEA 1J7PA 3BUXB 2WNDA 1K93D 1CFDA 4I5JA 4MVFA 3TUYB 4I5LB 1W7IB 4AQIA 2MA2A 2JOJA 1PK0D 1SCVA 5KSZA 3SG7A 3CZ0A 1KK7Z 1XFWO 2LUXA 2Y5IA 1R6PA 3O6BA 1ZUZA 1MF8B 3CZ2A 3EVRA 4INWA 1QX5B 1EL4A 1LA0A 3BOWA 3I5IB 1AJ5A 4IL1A 4L9MA 1IQ3A 2SASA 1S26D 2KBIA 2QDIA 2NLNA 2YGUA 5I94A 1KQVA 3R1VA 1RK9A 2Q91A 2EC6C 4A4CA 3PN7C 1WY9A 2H61A 2KI6D 3O2PA 4PHJA 1TUZA 2JZIA 1CKKA 2KFHA 4MEWA 1KSOA 3LLEA 1UHIA 3SG6A 1IRJA 4N1GA 3CDNA 4C0KA 2NCPA 3V2LA 4U8DA 4N5XA 2K61A 3CGAA 4OV2A 3TDIA 2LV7A 2QEOA 4ZCVA 1KFXS 2KYFA 3PM2A 3AKBA 5PALA 3D74A 3I5GC 1K94A 1K9UA 1N0YA 1TN4A 3BFHA 3D0YB 3DD4A 1Y1XA 5HYDA 2WOSA 2GGZA 1KWOB 1SW8A 1CDMA 3JTDC 3DXLA 2GGMA 1UHHA 3NSLA 1SL8A 3JVTB 3O4XA 1QLSA 3WXAA 4OZDA 1N65A 5FI7A 2MLFC 4PALA 3R72A 2AUCA 2QEBA 2BCXA 1OE9B 3EK8A 1YUTA 1SCMB 3CR4X 4GGFA 2WC5A 3B6XA 2F2OA 2HQWA 1C3YA 1K9KA 3TS5C 1F71A 4GPLB 1QIVA 1Z4HA 1MXLC 1ALVA 1OOHA 1DVIA 1MR8A 2JPOA 3F45A 1A2XA 1MUXA 3BUWB 2KI4B 4HRGA 1EH2A 3S0DA 4PE4A 5JJGA 4E68A 1SSEB 1YX7A 3CABA 3IVTA 3VRNA 1GGZA 3L47A 1QV0A 1XFXO 2KNEA 4JD9A 1QXPA 1S36A 1E8AA 3M0WA 2JXLA 2LVVA 2JQ6A 3I5FB 4WQ3A 3PSRA 1ORGA 3GK2A 3PJIA 1CNPA 3AAJA 3VRPA 3PFVA 3VROA 3SIAA 1V1GA 1EG3A 1J1DA 4NDBA 2BE6A 4PCWA 2BCAA 1XFZO 2OTGC 1MXEA 3DY9A 1C7VA 1YVLA 4BY4A 1IH0A 1B7TY 1DGVA 1OMDA 1RROA 1HQVA 3OB1B 1C3ZA 1B8RA 1A4PA 2JT0A 2P6BB 4KYNA 5J3XA 4F7FA 2OS8B 1S6CA 1FBVA 1PRWA 3KEVA 1SPYA 1LINA 1TNPA 3WHUB 4HSZA 4YGBB 1PSBA 2M8UA 1B47A 1KK7Y 1F8HA 2NCOA 2ZRTA 3FE9A 1OOGA 3D10A 3KO0A 1YTZC 3O4YA 2E30A 1MWNA 1DJGA 2FCEA 4BY5A 1XK4C 2KPHA 2LMUA 3C1VA 3HX4A 4AOMA 5DKNA 4QJ5B 5CSIA 3FE8A 3D75A 1SYMA 1LVCD 1NCXA 3PLFB 3WNXB 4I5KA 2JTZA 3VGOA 1BMOA 2BKIB 2MLEC 1TNWA 2M0RA 3UO9A 2K2AA 1NIWA 3EKHA 1FPWA 3D76A 3PATA 1FI5A 1L2OC 2LE9B 1DJWA 2JU0A 2JNXA 2WCKA 3BJHA 1CDLA 2LM5A 2ZNEA 3SS4A 4OR9B 3PALA 2HF5A 1Q80A 2WCEA 2WCHA 4DCKA 1SBJA 5KTYA 2KOTA 1OMRA 4DRWA 2WC6A 1SK6D 3O78A 1JUOA 1NCYA 1X02A 1OOJA 1YRTB 3FIAA 4PHKA 5I2LA 1MHOA 3SG3A 1P28A 1S1EA 1W7JB 1A29A 1NPQA 3DVJA 2O5GA 4P2YB 3FS7A 5DKQA 1IIOA 1KQMC 2FJYA 5D3OA 3RM1A 3SIBA 5D7FA 5B8IB 4PE7A 4INXA 2GTEA 4HRHA 2H61C 2LMTA 1UWOA 2KI6C 3DF0B 2FOTA 3BUOB 3CR2A 5HLOA 4YI9A 2JNFA 4JWQA 3N7HA 2F3ZA 2PQLA 4USLA 2F3YA 1ZACA 1KFXL 2L0PA 4NQGA 1XO5A 2M29A 2CXJA 5I2QA 1DC1A 4ZCUA 1WRLA 1B4CA 1LKJA 4GNKB 1DJXA 3HCMA 3LCPC 5AEQA 1KK8C 1PALA 2P70A 1CMFA 3A4UB 2LP2A 1OZOA 1S6IA 1IQ5A 2ERBA 2KLEA 4MN0A 1C07A 1PVBA 4WRIA 3TDZA 2LANA 1SY9A 1QX2A 2WCMA 4ICBA 2MJWB 2F33A 2BKHB 2KSPA 4M2QA 1Z2CB 1OMVA 1G4YR 2COLB 2KQYA 1PULA 4NDDA 3R1PA 1JF2A 5AERA 1IJ6A 3OX6A 2OTGB 1CDPA 1PVAA 3GOFA 1FW4A 4IJ7A 4UPGA 1AJ4A 1WDCB 1GGWA 4YGCB 3S0EA 1YVHA 3BFAA 1NUBA 3CWGA 3EKJA 4TNCA 2LHLA 4MSPA 1DT7B 1N2DA 1NX1A 1SR6C 1GM0A 1S5GY 2WCLA 3QMEA 1BG1A 4PE0A 3S0BA 3VRRA 4N1FA 3FE6A 1QVIY 1NX2A 4DS7A 3TUYC 2BECA 1ODBA 3TZ1A 2LUCA 1DELA 4C0LA 3CYZA 5I8NA 1C7WA 3IF7A 2JWWA 3AAKA 5FI2A 1UHNA 1TTXA 1DGUA 1KSMA 1A75B 1KFUS 3I5IC 1LXFC 2BAPA 2I18A 1M46A 1T14A 5K89A 1F4OA 2KAXA 2LAPA 1BLQA 2M7NA 1WRKA 1CDNA 1L2OB 2BBNA 1EJ3A 2L4HA 1YX8A 1B8LA 1QTXA 2K0JA 4YRUA 5BPJA 2CT9A 2Q4UA 3L4LA 1OW4A 2ZKMX 3I5HC 2I2RE 2LHIA 1AUIB 1AP4A 1LS8A 1QX7A 2MAZA 2TN4A 2Y1MA 3KHEA 1YUSA 1DF0B 4GFTA 2WCBA 2KLDA 4MZLA 5FYXA 3BUMB 1G8IA 1NP8A 2JC2A 2KQ6A 2L4IA 3EK4A 3SS5A 4YBHB 2Y4QA 1QS7A 1SMGA 1YURA 5GQQC 1QIWA 2K7CA 4P5OE 5IBWA 2K7BA 1DJZA 2KAYA 2QEHA 2HETA 3FWBA 3OX5A 4MRXA 1B9AA 3H4SE 3EVUA 1DJYA 1KQMB 1XYDA 4CPVA 5AANA 3B87A 3EG5B 2EGDA 1KWOC 2PRUA 4ORAB 1F54A 1QATA 3AKAA 1SNLA 3NSOA 2PASA 1K90D 2F2PA 3CR5X 1TRFA 3JVTC 4A4BA 2B1UA 1M63B 2L2CA 1DJIA 2BNXA 2PYQA 2QEVA 4FTGA 3D0YA 2M49B 5D69A 2JPTA 5HLVA 2KHNA 2K8MB 4OVNF 1BR1B 4OCIA 1IJ5A 2EC6B 3PN7B 1G33A 3NXAA 2JRFA 2LLTA 3RZSA 1BT6A 2KDHA 1XA5A 1WLZA 3K21A 3VB1A 2I7AA 1KK8B 2PVBA
chains in the Genus database with same CATH topology
4YI8A 2NZ0A 1XFUO 2HQ8A 5TNCA 1JFJA 1NX0A 1RECA 3SJSA 2KI4C 3EK7A 1CMGA 1TCOB 5AXIA 1FF1A 4DIRA 2K7OA 1RTP1 3LK0A 2MBXA 1K2HA 1IWQA 3ZNIA 3I5GB 1SRAA 3SG4A 1K8UA 2DOQA 2KGBC 2MHHA 4MZJA 3ZWHA 3JTDB 3I5FC 1GQMA 3FWCA 1QLKA 4MLWA 1A75A 2PSRA 2M1UA 1XFYO 1YRUB 2CTNA 1DMOA 1BU3A 1H8BA 3SG5A 1S6JA 2LNKA 1BJFA 2M1KB 3DVMA 4R1EA 1H4BA 4NDCA 1M45A 5I2OA 1SR6B 1B7TZ 2OS8C 4I5NB 2L5XB 3TS5B 5CSJA 1QASA 1CM4A 2WC8A 1CM1A 1U5IB 3E3RA 2M9GA 3EVVA 1DF0A 1DJHA 1GJYA 2JT3A 3BUNB 4GAOA 4AQJA 1NWDA 5CPVA 1IKUA 1LA3A 4CFRA 1DTLA 4D1EA 2LMVA 4PHMA 4JQ0D 1CLLA 2Y1NA 1YUUA 1IG5A 1JSAA 3DVKA 3GK1A 3CZTX 1OQPA 2F8PA 4F0ZB 1AHRA 4PHNA 4CFQA 1CTRA 3GK4X 2M3WA 1IGVA 2QACA 2M7LA 3KF9A 1XVJA 1M31A 3OB2B 2A4JA 1RJVA 2KYCA 1J7RA 1K96A 4GGFC 1TNXA 2I94A 3I5HB 1Y6WA 2KFGA 1KCYA 3IQOA 3LL8B 2WCFA 2LCPA 1B8CA 2JXCA 2ZNDA 4QJ3B 4XJKB 4CLNA 1AK8A 2L98A 1ZMZA 4DUQA 2FJUB 2AMIA 2D8NA 2LVKA 1UHKA 2SCPA 2ZN8A 2KBMA 1EG4A 2BL0C 1KFUL 2K2FA 1TCFA 2L50A 5G08A 3WHTB 1CFFA 3RLZA 1PSRA 4WQ2A 2L2EA 3SG2A 1J55A 4CIDA 2LC5A 1NX3A 5DKRA 4YGEB 1JC2A 5CSNA 2KGRA 5AFPA 2IS9A 1F4QA 2VRGA 4MZKA 1BR4B 1J1EA 4ORBB 1B1GA 3CLNA 4HREE 3BQ3A 2PMYA 2QPTA 1SL7A 4OKHA 2JTTA 4ORCB 1Y0VH 2G9BA 2PALA 1J7OA 3DF0A 2CCMA 2KAVA 4C0JA 1D1OA 3ICBA 4Q04A 2LLUA 1BOCA 2R2IA 4PDZA 2G2BA 2ZN9A 4GBAA 4JPZB 3IQQA 4MBEA 3MSEB 1CFCA 1SKTA 5ER4X 2AAOA 2HPSA 2V53A 3CS1A 1FI6A 1U5IA 2LP3A 1L7ZA 1NYAA 1UUSA 2MRDA 3NSKA 4FQOA 1HT9A 4M2PA 1VRKA 3BOWB 1NSHA 1F70A 2NXQA 1UHJA 2LVJA 1J7QA 5HKWA 3LK1A 2ISDA 1BF5A 1Y1UA 1UURA 5ER5A 1TIZA 2FCDA 4MRYA 5JOLA 1ZOTB 3CTNA 3NSIA 2O60A 2BE4A 1F55A 1JF0A 1MQ1A 1WDCC 1XFVO 2RGIA 2H2KA 2BCBA 2E6WA 1SCMC 1CB1A 3TDUA 1BODA 1QJTA 1S3PA 2JULA 1S5GZ 2CNPA 4XJKA 5F6TA 2KFFA 1JFKA 1R2UA 3PM8A 2K7DA 3QRXA 1A03A 1JWDA 1K95A 1TOPA 1WRZA 1QVIZ 1TNQA 5HKYA 2EHBA 1RFJA 4XYNA 4GUKA 4YGDB 2JT8A 1M39A 1YR5A 2ZRSA 4ETOA 3VRQA 2M97A 1OZSA 3A8RA 3BYAA 1ZFSA 4PE1A 1AVSA 1WLMA 2ZFDA 1XK4A 1CLMA 2LVIA 3BXKA 4QJ4B 4M2OA 1EXRA 1ALWA 1K9PA 1V1FA 1CLBA 2LLSA 1OSAA 1NCZA 2BBMA 3OHMB 1QV1A 2CBLA 2WORA 1RWYA 4GGNA 1SL9A 1UP5A 1Y1AA 3OP0A 1CFPA 5HKZA 2BL0B 2OPOA 5CSFA 5KU1A 2L51A 1JBAA 4YGAA 2GV5A 3KPXA 3DVEA 1J7PA 3BUXB 2WNDA 1K93D 1CFDA 4I5JA 4MVFA 3TUYB 4I5LB 1W7IB 4AQIA 2MA2A 2JOJA 1PK0D 1SCVA 5KSZA 3SG7A 1KK7Z 1XFWO 2LUXA 2Y5IA 1R6PA 3O6BA 1ZUZA 1MF8B 3EVRA 1QX5B 1EL4A 1LA0A 3BOWA 3I5IB 1AJ5A 4IL1A 4L9MA 1IQ3A 2SASA 1S26D 2KBIA 2NLNA 1KQVA 1RK9A 2Q91A 2EC6C 4A4CA 3PN7C 1WY9A 2H61A 2KI6D 3O2PA 4PHJA 2JZIA 1CKKA 2KFHA 4MEWA 1KSOA 3LLEA 1UHIA 3SG6A 1IRJA 4N1GA 4C0KA 2NCPA 4U8DA 4N5XA 2K61A 3CGAA 4OV2A 3TDIA 2LV7A 4ZCVA 1KFXS 2KYFA 3AKBA 5PALA 3I5GC 1K94A 1K9UA 1N0YA 1TN4A 3D0YB 3DD4A 1Y1XA 5HYDA 2WOSA 2GGZA 1KWOB 1SW8A 1CDMA 3JTDC 2GGMA 1UHHA 3NSLA 1SL8A 3JVTB 1QLSA 3WXAA 1N65A 2MLFC 4PALA 2AUCA 2BCXA 1OE9B 3EK8A 1YUTA 1SCMB 3CR4X 4GGFA 2F2OA 2HQWA 1K9KA 3TS5C 1F71A 4GPLB 1QIVA 1MXLC 1ALVA 1DVIA 1MR8A 3F45A 1A2XA 1MUXA 3BUWB 2KI4B 4HRGA 1EH2A 4PE4A 5JJGA 4E68A 3VRNA 1YX7A 1GGZA 1QV0A 1XFXO 2KNEA 1QXPA 1S36A 1E8AA 3M0WA 2JXLA 2LVVA 2JQ6A 3I5FB 4WQ3A 3PSRA 3GK2A 1CNPA 3AAJA 3VRPA 3PFVA 3VROA 3SIAA 1V1GA 1EG3A 1J1DA 4NDBA 2BE6A 4PCWA 2BCAA 1XFZO 2OTGC 1MXEA 1C7VA 1YVLA 4BY4A 1IH0A 1B7TY 1DGVA 1OMDA 1RROA 1HQVA 3OB1B 1B8RA 1A4PA 2JT0A 2P6BB 5J3XA 2OS8B 1S6CA 1FBVA 1PRWA 3KEVA 1SPYA 1LINA 1TNPA 3WHUB 4HSZA 4YGBB 1PSBA 2M8UA 1B47A 1KK7Y 1F8HA 2NCOA 2ZRTA 3KO0A 3D10A 1YTZC 3O4YA 2E30A 1MWNA 1DJGA 2FCEA 4BY5A 1XK4C 2LMUA 4AOMA 3C1VA 3HX4A 4QJ5B 5DKNA 5CSIA 1SYMA 1LVCD 1NCXA 3PLFB 3WNXB 4I5KA 2JTZA 3VGOA 1BMOA 2BKIB 2MLEC 1TNWA 2M0RA 2K2AA 1NIWA 3EKHA 1FPWA 1FI5A 3PATA 1L2OC 2LE9B 1DJWA 2JU0A 2JNXA 1CDLA 2LM5A 2ZNEA 4OR9B 3PALA 2HF5A 1Q80A 2WCEA 4DCKA 1SBJA 5KTYA 2KOTA 1OMRA 4DRWA 1SK6D 3O78A 1JUOA 1NCYA 1X02A 1OOJA 1YRTB 3FIAA 4PHKA 5I2LA 1MHOA 3SG3A 1S1EA 1W7JB 1A29A 1NPQA 3DVJA 2O5GA 4P2YB 3FS7A 5DKQA 1KQMC 3SIBA 3RM1A 5D7FA 5B8IB 4PE7A 4HRHA 2H61C 2LMTA 1UWOA 2KI6C 3DF0B 2FOTA 3BUOB 3CR2A 5HLOA 4YI9A 2JNFA 4JWQA 2F3ZA 4USLA 2F3YA 1ZACA 1KFXL 2L0PA 4NQGA 1XO5A 2M29A 2CXJA 5I2QA 4ZCUA 1WRLA 1B4CA 1LKJA 4GNKB 1DJXA 3HCMA 3LCPC 5AEQA 1KK8C 1PALA 1CMFA 3A4UB 2LP2A 1OZOA 1S6IA 1IQ5A 4MN0A 1C07A 1PVBA 4WRIA 3TDZA 2LANA 1SY9A 1QX2A 4ICBA 2MJWB 2F33A 2BKHB 2KSPA 4M2QA 1OMVA 1G4YR 2COLB 2KQYA 1PULA 4NDDA 1JF2A 5AERA 1IJ6A 3OX6A 2OTGB 1CDPA 1PVAA 3GOFA 1FW4A 4UPGA 1AJ4A 1WDCB 1GGWA 4YGCB 1YVHA 1NUBA 3CWGA 3EKJA 4TNCA 2LHLA 4MSPA 1DT7B 1N2DA 1NX1A 1SR6C 1S5GY 1BG1A 4PE0A 3VRRA 4N1FA 1QVIY 1NX2A 4DS7A 3TUYC 2BECA 1ODBA 3TZ1A 2LUCA 4C0LA 5I8NA 1C7WA 3IF7A 2JWWA 3AAKA 1UHNA 1TTXA 1DGUA 1KSMA 1A75B 1KFUS 3I5IC 1LXFC 2I18A 1M46A 5K89A 1F4OA 2KAXA 2LAPA 1BLQA 2M7NA 1WRKA 1CDNA 1L2OB 2BBNA 1EJ3A 2L4HA 1YX8A 1B8LA 1QTXA 2K0JA 4YRUA 5BPJA 2CT9A 2Q4UA 2ZKMX 3I5HC 2I2RE 2LHIA 1AUIB 1AP4A 2TN4A 1QX7A 2MAZA 2Y1MA 3KHEA 1YUSA 1DF0B 4GFTA 2WCBA 4MZLA 5FYXA 3BUMB 1G8IA 1NP8A 2JC2A 2KQ6A 2L4IA 3EK4A 4YBHB 2Y4QA 1QS7A 1SMGA 1YURA 5GQQC 1QIWA 2K7CA 4P5OE 5IBWA 2K7BA 1DJZA 2KAYA 3OX5A 2HETA 3FWBA 4MRXA 1B9AA 3H4SE 3EVUA 1DJYA 1KQMB 1XYDA 4CPVA 5AANA 2EGDA 1KWOC 2PRUA 4ORAB 1F54A 1QATA 3AKAA 1SNLA 3NSOA 2PASA 1K90D 2F2PA 3CR5X 1TRFA 3JVTC 4A4BA 2B1UA 1M63B 1DJIA 4FTGA 3D0YA 2M49B 5D69A 2JPTA 5HLVA 2KHNA 2K8MB 4OVNF 1BR1B 4OCIA 1IJ5A 2EC6B 3PN7B 1G33A 3NXAA 2JRFA 2LLTA 1BT6A 2KDHA 1XA5A 1WLZA 3K21A 2I7AA 1KK8B 2PVBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YI8 A;  2NZ0 A;  1XFU O;  2HQ8 A;  5TNC A;  1JFJ A;  1NX0 A;  1REC A;  3SJS A;  2KI4 C;  3EK7 A;  1CMG A;  1TCO B;  5AXI A;  1FF1 A;  4DIR A;  2K7O A;  1RTP 1;  3LK0 A;  2MBX A;  1K2H A;  1IWQ A;  3ZNI A;  3I5G B;  1SRA A;  3SG4 A;  1K8U A;  2DOQ A;  2KGB C;  2MHH A;  4MZJ A;  3ZWH A;  3JTD B;  3I5F C;  1GQM A;  3FWC A;  1QLK A;  4MLW A;  1A75 A;  2PSR A;  2M1U A;  1XFY O;  1YRU B;  2CTN A;  1DMO A;  1BU3 A;  1H8B A;  3SG5 A;  1S6J A;  2LNK A;  1BJF A;  2M1K B;  3DVM A;  4R1E A;  1H4B A;  4NDC A;  1M45 A;  5I2O A;  1SR6 B;  1B7T Z;  2OS8 C;  4I5N B;  2L5X B;  3TS5 B;  5CSJ A;  1QAS A;  1CM4 A;  2WC8 A;  1CM1 A;  1U5I B;  3E3R A;  2M9G A;  3EVV A;  1DF0 A;  1DJH A;  1GJY A;  2JT3 A;  3BUN B;  4GAO A;  4AQJ A;  1NWD A;  5CPV A;  1IKU A;  1LA3 A;  4CFR A;  1DTL A;  4D1E A;  2LMV A;  4PHM A;  4JQ0 D;  1CLL A;  2Y1N A;  1YUU A;  1IG5 A;  1JSA A;  3DVK A;  3GK1 A;  3CZT X;  1OQP A;  2F8P A;  4F0Z B;  1AHR A;  4PHN A;  4CFQ A;  1CTR A;  3GK4 X;  2M3W A;  1IGV A;  2QAC A;  2M7L A;  3KF9 A;  1XVJ A;  1M31 A;  3OB2 B;  2A4J A;  1RJV A;  2KYC A;  1J7R A;  1K96 A;  4GGF C;  1TNX A;  2I94 A;  3I5H B;  1Y6W A;  2KFG A;  1KCY A;  3IQO A;  3LL8 B;  2WCF A;  2LCP A;  1B8C A;  2JXC A;  2ZND A;  4QJ3 B;  4XJK B;  4CLN A;  1AK8 A;  2L98 A;  1ZMZ A;  4DUQ A;  2FJU B;  2AMI A;  2D8N A;  2LVK A;  1UHK A;  2SCP A;  2ZN8 A;  2KBM A;  1EG4 A;  2BL0 C;  1KFU L;  2K2F A;  1TCF A;  2L50 A;  5G08 A;  3WHT B;  1CFF A;  3RLZ A;  1PSR A;  4WQ2 A;  2L2E A;  3SG2 A;  1J55 A;  4CID A;  2LC5 A;  1NX3 A;  5DKR A;  4YGE B;  1JC2 A;  5CSN A;  2KGR A;  5AFP A;  2IS9 A;  1F4Q A;  2VRG A;  4MZK A;  1BR4 B;  1J1E A;  4ORB B;  1B1G A;  3CLN A;  4HRE E;  3BQ3 A;  2PMY A;  2QPT A;  1SL7 A;  4OKH A;  2JTT A;  4ORC B;  1Y0V H;  2G9B A;  2PAL A;  1J7O A;  3DF0 A;  2CCM A;  2KAV A;  4C0J A;  1D1O A;  3ICB A;  4Q04 A;  2LLU A;  1BOC A;  2R2I A;  4PDZ A;  2G2B A;  2ZN9 A;  4GBA A;  4JPZ B;  3IQQ A;  4MBE A;  3MSE B;  1CFC A;  1SKT A;  5ER4 X;  2AAO A;  2HPS A;  2V53 A;  3CS1 A;  1FI6 A;  1U5I A;  2LP3 A;  1L7Z A;  1NYA A;  1UUS A;  2MRD A;  3NSK A;  4FQO A;  1HT9 A;  4M2P A;  1VRK A;  3BOW B;  1NSH A;  1F70 A;  2NXQ A;  1UHJ A;  2LVJ A;  1J7Q A;  5HKW A;  3LK1 A;  2ISD A;  1BF5 A;  1Y1U A;  1UUR A;  5ER5 A;  1TIZ A;  2FCD A;  4MRY A;  5JOL A;  1ZOT B;  3CTN A;  3NSI A;  2O60 A;  2BE4 A;  1F55 A;  1JF0 A;  1MQ1 A;  1WDC C;  1XFV O;  2RGI A;  2H2K A;  2BCB A;  2E6W A;  1SCM C;  1CB1 A;  3TDU A;  1BOD A;  1QJT A;  1S3P A;  2JUL A;  1S5G Z;  2CNP A;  4XJK A;  5F6T A;  2KFF A;  1JFK A;  1R2U A;  3PM8 A;  2K7D A;  3QRX A;  1A03 A;  1JWD A;  1K95 A;  1TOP A;  1WRZ A;  1QVI Z;  1TNQ A;  5HKY A;  2EHB A;  1RFJ A;  4XYN A;  4GUK A;  4YGD B;  2JT8 A;  1M39 A;  1YR5 A;  2ZRS A;  4ETO A;  3VRQ A;  2M97 A;  1OZS A;  3A8R A;  3BYA A;  1ZFS A;  4PE1 A;  1AVS A;  1WLM A;  2ZFD A;  1XK4 A;  1CLM A;  2LVI A;  3BXK A;  4QJ4 B;  4M2O A;  1EXR A;  1ALW A;  1K9P A;  1V1F A;  1CLB A;  2LLS A;  1OSA A;  1NCZ A;  2BBM A;  3OHM B;  1QV1 A;  2CBL A;  2WOR A;  1RWY A;  4GGN A;  1SL9 A;  1UP5 A;  1Y1A A;  3OP0 A;  1CFP A;  5HKZ A;  2BL0 B;  2OPO A;  5CSF A;  5KU1 A;  2L51 A;  1JBA A;  4YGA A;  2GV5 A;  3KPX A;  3DVE A;  1J7P A;  3BUX B;  2WND A;  1K93 D;  1CFD A;  4I5J A;  4MVF A;  3TUY B;  4I5L B;  1W7I B;  4AQI A;  2MA2 A;  2JOJ A;  1PK0 D;  1SCV A;  5KSZ A;  3SG7 A;  1KK7 Z;  1XFW O;  2LUX A;  2Y5I A;  1R6P A;  3O6B A;  1ZUZ A;  1MF8 B;  3EVR A;  1QX5 B;  1EL4 A;  1LA0 A;  3BOW A;  3I5I B;  1AJ5 A;  4IL1 A;  4L9M A;  1IQ3 A;  2SAS A;  1S26 D;  2KBI A;  2NLN A;  1KQV A;  1RK9 A;  2Q91 A;  2EC6 C;  4A4C A;  3PN7 C;  1WY9 A;  2H61 A;  2KI6 D;  3O2P A;  4PHJ A;  2JZI A;  1CKK A;  2KFH A;  4MEW A;  1KSO A;  3LLE A;  1UHI A;  3SG6 A;  1IRJ A;  4N1G A;  4C0K A;  2NCP A;  4U8D A;  4N5X A;  2K61 A;  3CGA A;  4OV2 A;  3TDI A;  2LV7 A;  4ZCV A;  1KFX S;  2KYF A;  3AKB A;  5PAL A;  3I5G C;  1K94 A;  1K9U A;  1N0Y A;  1TN4 A;  3D0Y B;  3DD4 A;  1Y1X A;  5HYD A;  2WOS A;  2GGZ A;  1KWO B;  1SW8 A;  1CDM A;  3JTD C;  2GGM A;  1UHH A;  3NSL A;  1SL8 A;  3JVT B;  1QLS A;  3WXA A;  1N65 A;  2MLF C;  4PAL A;  2AUC A;  2BCX A;  1OE9 B;  3EK8 A;  1YUT A;  1SCM B;  3CR4 X;  4GGF A;  2F2O A;  2HQW A;  1K9K A;  3TS5 C;  1F71 A;  4GPL B;  1QIV A;  1MXL C;  1ALV A;  1DVI A;  1MR8 A;  3F45 A;  1A2X A;  1MUX A;  3BUW B;  2KI4 B;  4HRG A;  1EH2 A;  4PE4 A;  5JJG A;  4E68 A;  3VRN A;  1YX7 A;  1GGZ A;  1QV0 A;  1XFX O;  2KNE A;  1QXP A;  1S36 A;  1E8A A;  3M0W A;  2JXL A;  2LVV A;  2JQ6 A;  3I5F B;  4WQ3 A;  3PSR A;  3GK2 A;  1CNP A;  3AAJ A;  3VRP A;  3PFV A;  3VRO A;  3SIA A;  1V1G A;  1EG3 A;  1J1D A;  4NDB A;  2BE6 A;  4PCW A;  2BCA A;  1XFZ O;  2OTG C;  1MXE A;  1C7V A;  1YVL A;  4BY4 A;  1IH0 A;  1B7T Y;  1DGV A;  1OMD A;  1RRO A;  1HQV A;  3OB1 B;  1B8R A;  1A4P A;  2JT0 A;  2P6B B;  5J3X A;  2OS8 B;  1S6C A;  1FBV A;  1PRW A;  3KEV A;  1SPY A;  1LIN A;  1TNP A;  3WHU B;  4HSZ A;  4YGB B;  1PSB A;  2M8U A;  1B47 A;  1KK7 Y;  1F8H A;  2NCO A;  2ZRT A;  3KO0 A;  3D10 A;  1YTZ C;  3O4Y A;  2E30 A;  1MWN A;  1DJG A;  2FCE A;  4BY5 A;  1XK4 C;  2LMU A;  4AOM A;  3C1V A;  3HX4 A;  4QJ5 B;  5DKN A;  5CSI A;  1SYM A;  1LVC D;  1NCX A;  3PLF B;  3WNX B;  4I5K A;  2JTZ A;  3VGO A;  1BMO A;  2BKI B;  2MLE C;  1TNW A;  2M0R A;  2K2A A;  1NIW A;  3EKH A;  1FPW A;  1FI5 A;  3PAT A;  1L2O C;  2LE9 B;  1DJW A;  2JU0 A;  2JNX A;  1CDL A;  2LM5 A;  2ZNE A;  4OR9 B;  3PAL A;  2HF5 A;  1Q80 A;  2WCE A;  4DCK A;  1SBJ A;  5KTY A;  2KOT A;  1OMR A;  4DRW A;  1SK6 D;  3O78 A;  1JUO A;  1NCY A;  1X02 A;  1OOJ A;  1YRT B;  3FIA A;  4PHK A;  5I2L A;  1MHO A;  3SG3 A;  1S1E A;  1W7J B;  1A29 A;  1NPQ A;  3DVJ A;  2O5G A;  4P2Y B;  3FS7 A;  5DKQ A;  1KQM C;  3SIB A;  3RM1 A;  5D7F A;  5B8I B;  4PE7 A;  4HRH A;  2H61 C;  2LMT A;  1UWO A;  2KI6 C;  3DF0 B;  2FOT A;  3BUO B;  3CR2 A;  5HLO A;  4YI9 A;  2JNF A;  4JWQ A;  2F3Z A;  4USL A;  2F3Y A;  1ZAC A;  1KFX L;  2L0P A;  4NQG A;  1XO5 A;  2M29 A;  2CXJ A;  5I2Q A;  4ZCU A;  1WRL A;  1B4C A;  1LKJ A;  4GNK B;  1DJX A;  3HCM A;  3LCP C;  5AEQ A;  1KK8 C;  1PAL A;  1CMF A;  3A4U B;  2LP2 A;  1OZO A;  1S6I A;  1IQ5 A;  4MN0 A;  1C07 A;  1PVB A;  4WRI A;  3TDZ A;  2LAN A;  1SY9 A;  1QX2 A;  4ICB A;  2MJW B;  2F33 A;  2BKH B;  2KSP A;  4M2Q A;  1OMV A;  1G4Y R;  2COL B;  2KQY A;  1PUL A;  4NDD A;  1JF2 A;  5AER A;  1IJ6 A;  3OX6 A;  2OTG B;  1CDP A;  1PVA A;  3GOF A;  1FW4 A;  4UPG A;  1AJ4 A;  1WDC B;  1GGW A;  4YGC B;  1YVH A;  1NUB A;  3CWG A;  3EKJ A;  4TNC A;  2LHL A;  4MSP A;  1DT7 B;  1N2D A;  1NX1 A;  1SR6 C;  1S5G Y;  1BG1 A;  4PE0 A;  3VRR A;  4N1F A;  1QVI Y;  1NX2 A;  4DS7 A;  3TUY C;  2BEC A;  1ODB A;  3TZ1 A;  2LUC A;  4C0L A;  5I8N A;  1C7W A;  3IF7 A;  2JWW A;  3AAK A;  1UHN A;  1TTX A;  1DGU A;  1KSM A;  1A75 B;  1KFU S;  3I5I C;  1LXF C;  2I18 A;  1M46 A;  5K89 A;  1F4O A;  2KAX A;  2LAP A;  1BLQ A;  2M7N A;  1WRK A;  1CDN A;  1L2O B;  2BBN A;  1EJ3 A;  2L4H A;  1YX8 A;  1B8L A;  1QTX A;  2K0J A;  4YRU A;  5BPJ A;  2CT9 A;  2Q4U A;  2ZKM X;  3I5H C;  2I2R E;  2LHI A;  1AUI B;  1AP4 A;  2TN4 A;  1QX7 A;  2MAZ A;  2Y1M A;  3KHE A;  1YUS A;  1DF0 B;  4GFT A;  2WCB A;  4MZL A;  5FYX A;  3BUM B;  1G8I A;  1NP8 A;  2JC2 A;  2KQ6 A;  2L4I A;  3EK4 A;  4YBH B;  2Y4Q A;  1QS7 A;  1SMG A;  1YUR A;  5GQQ C;  1QIW A;  2K7C A;  4P5O E;  5IBW A;  2K7B A;  1DJZ A;  2KAY A;  3OX5 A;  2HET A;  3FWB A;  4MRX A;  1B9A A;  3H4S E;  3EVU A;  1DJY A;  1KQM B;  1XYD A;  4CPV A;  5AAN A;  2EGD A;  1KWO C;  2PRU A;  4ORA B;  1F54 A;  1QAT A;  3AKA A;  1SNL A;  3NSO A;  2PAS A;  1K90 D;  2F2P A;  3CR5 X;  1TRF A;  3JVT C;  4A4B A;  2B1U A;  1M63 B;  1DJI A;  4FTG A;  3D0Y A;  2M49 B;  5D69 A;  2JPT A;  5HLV A;  2KHN A;  2K8M B;  4OVN F;  1BR1 B;  4OCI A;  1IJ5 A;  2EC6 B;  3PN7 B;  1G33 A;  3NXA A;  2JRF A;  2LLT A;  1BT6 A;  2KDH A;  1XA5 A;  1WLZ A;  3K21 A;  2I7A A;  1KK8 B;  2PVB A; 
#chains in the Genus database with same CATH topology
 3D73 A;  4YI8 A;  2NZ0 A;  1XFU O;  2HQ8 A;  5TNC A;  1JFJ A;  3L4A A;  1NX0 A;  1REC A;  3SJS A;  2KI4 C;  3EK7 A;  1CMG A;  1TCO B;  2WCJ A;  3B86 A;  5AXI A;  1TUJ A;  1FF1 A;  4DIR A;  2K7O A;  1RTP 1;  3LK0 A;  2MBX A;  1K2H A;  1IWQ A;  3ZNI A;  3I5G B;  1SRA A;  3D78 A;  3SG4 A;  1K8U A;  2DOQ A;  2KGB C;  2MHH A;  3CZ1 A;  4MZJ A;  3ZWH A;  3JTD B;  3I5F C;  1QWV A;  1GQM A;  3FWC A;  1QLK A;  4MLW A;  1A75 A;  2PSR A;  2M1U A;  1XFY O;  4PT1 A;  1YRU B;  2CTN A;  1DMO A;  1BU3 A;  1H8B A;  3SG5 A;  1S6J A;  2LNK A;  1BJF A;  2M1K B;  3DVM A;  4R1E A;  3NHT A;  1H4B A;  4NDC A;  1M45 A;  3BFB A;  5I2O A;  1SR6 B;  1B7T Z;  2OS8 C;  4I5N B;  2L5X B;  3TS5 B;  5CSJ A;  1QAS A;  1CM4 A;  1DEK A;  2WC8 A;  1CM1 A;  3K1E A;  1U5I B;  3E3R A;  2M9G A;  3EVV A;  1DF0 A;  1DJH A;  1GJY A;  2JT3 A;  3BUN B;  3R1O A;  4GAO A;  4JKT A;  4AQJ A;  1NWD A;  5CPV A;  1IKU A;  1LA3 A;  4CFR A;  1DTL A;  4D1E A;  1W9Z A;  2LMV A;  4PHM A;  4JQ0 D;  1CLL A;  2Y1N A;  1YUU A;  1IG5 A;  1JSA A;  3DVK A;  3GK1 A;  3CZT X;  1OQP A;  2F8P A;  3NGV A;  1AHR A;  4F0Z B;  4PHN A;  4CFQ A;  1CTR A;  3GK4 X;  2M3W A;  1IGV A;  2QAC A;  3B7A A;  3DYE A;  3Q8I A;  2M7L A;  3KF9 A;  1XVJ A;  1M31 A;  3OB2 B;  2A4J A;  1RJV A;  2KYC A;  1J7R A;  1K96 A;  4GGF C;  1TNX A;  2I94 A;  3I5H B;  1Y6W A;  1DQE A;  2KFG A;  1KCY A;  3IQO A;  3LL8 B;  1XFR A;  2WCF A;  2LCP A;  1B8C A;  2JXC A;  2ZND A;  4QJ3 B;  4XJK B;  4CLN A;  1AK8 A;  2L98 A;  1ZMZ A;  4DUQ A;  2FJU B;  2AMI A;  2D8N A;  2LVK A;  1UHK A;  2SCP A;  2ZN8 A;  2KBM A;  1EG4 A;  2BL0 C;  1KFU L;  2K2F A;  1TCF A;  2L50 A;  5G08 A;  3WHT B;  1CFF A;  3RLZ A;  1PSR A;  4WQ2 A;  2L2E A;  3SG2 A;  1J55 A;  4CID A;  5HL1 A;  2LC5 A;  1NX3 A;  5DKR A;  1TWO A;  4YGE B;  3D77 A;  1JC2 A;  5CSN A;  2KGR A;  5AFP A;  2IS9 A;  1F4Q A;  2VRG A;  4MZK A;  1BR4 B;  1J1E A;  4ORB B;  1B1G A;  3CLN A;  4HRE E;  3BQ3 A;  4FQT A;  2PMY A;  2QPT A;  1SL7 A;  4OKH A;  2JTT A;  4ORC B;  3OBV A;  1Y0V H;  3B88 A;  2G9B A;  2PAL A;  1J7O A;  3DF0 A;  2CCM A;  2KAV A;  4C0J A;  1D1O A;  3ICB A;  4Q04 A;  2LLU A;  1BOC A;  2R2I A;  4PDZ A;  2G2B A;  2ZN9 A;  4GBA A;  4JPZ B;  3DZT A;  3IQQ A;  4MBE A;  3MSE B;  1CFC A;  1SKT A;  5ER4 X;  2AAO A;  2HPS A;  2V53 A;  3CS1 A;  1FI6 A;  1U5I A;  2LP3 A;  1L7Z A;  1NYA A;  1UUS A;  2MRD A;  3NSK A;  3NHI A;  1HT9 A;  4FQO A;  4M2P A;  1VRK A;  2H8V A;  3BOW B;  1NSH A;  3OGN A;  3SS3 A;  2NXQ A;  1F70 A;  1UHJ A;  2LVJ A;  1J7Q A;  5HKW A;  3LK1 A;  2ISD A;  1BF5 A;  1Y1U A;  3UNW A;  1UUR A;  5ER5 A;  1TIZ A;  2FCD A;  4MRY A;  5JOL A;  1ZOT B;  3CTN A;  3NSI A;  2O60 A;  3S0F A;  2BE4 A;  1F55 A;  1JF0 A;  1MQ1 A;  1WDC C;  1XFV O;  2RGI A;  2H2K A;  2BCB A;  2E6W A;  1SCM C;  1CB1 A;  3TDU A;  1BOD A;  1QJT A;  1S3P A;  2JUL A;  1S5G Z;  2CNP A;  4XJK A;  5F6T A;  2KFF A;  1JFK A;  1R2U A;  3PM8 A;  2K7D A;  3QRX A;  1A03 A;  1JWD A;  1K95 A;  1TOP A;  1WRZ A;  1QVI Z;  1TNQ A;  5HKY A;  1OOF A;  3S0A A;  2EHB A;  1RFJ A;  2K60 A;  4GUK A;  4XYN A;  2JT8 A;  4YGD B;  1M39 A;  1YR5 A;  2ZRS A;  5FI6 A;  3VRQ A;  4ETO A;  5DIC A;  2M97 A;  1OZS A;  3A8R A;  3BYA A;  1OOI X;  1ZFS A;  4PE1 A;  1AVS A;  1WLM A;  2ZFD A;  1XK4 A;  1CLM A;  2LVI A;  3BXK A;  4QJ4 B;  4M2O A;  1EXR A;  1ALW A;  1K9P A;  1V1F A;  1CLB A;  2LLS A;  1OSA A;  1NCZ A;  2BBM A;  3OHM B;  1QV1 A;  2CBL A;  2WOR A;  1RWY A;  4GGN A;  1SL9 A;  1UP5 A;  1Y1A A;  3OP0 A;  3S0G A;  1CFP A;  5HKZ A;  2BL0 B;  2OPO A;  5CSF A;  5KU1 A;  2L5Y A;  2L51 A;  1JBA A;  5EL2 A;  4YGA A;  2P71 A;  2GV5 A;  3KPX A;  3DVE A;  1J7P A;  3BUX B;  2WND A;  1K93 D;  1CFD A;  4I5J A;  4MVF A;  3TUY B;  4I5L B;  1W7I B;  4AQI A;  2MA2 A;  2JOJ A;  1PK0 D;  1SCV A;  5KSZ A;  3SG7 A;  3CZ0 A;  1KK7 Z;  1XFW O;  2LUX A;  2Y5I A;  1R6P A;  3O6B A;  1ZUZ A;  1MF8 B;  3CZ2 A;  3EVR A;  4INW A;  1QX5 B;  1EL4 A;  1LA0 A;  3BOW A;  3I5I B;  1AJ5 A;  4IL1 A;  4L9M A;  1IQ3 A;  2SAS A;  1S26 D;  2KBI A;  2QDI A;  2NLN A;  2YGU A;  5I94 A;  1KQV A;  3R1V A;  1RK9 A;  2Q91 A;  2EC6 C;  4A4C A;  3PN7 C;  1WY9 A;  2H61 A;  2KI6 D;  3O2P A;  4PHJ A;  1TUZ A;  2JZI A;  1CKK A;  2KFH A;  4MEW A;  1KSO A;  3LLE A;  1UHI A;  3SG6 A;  1IRJ A;  4N1G A;  3CDN A;  4C0K A;  2NCP A;  3V2L A;  4U8D A;  4N5X A;  2K61 A;  3CGA A;  4OV2 A;  3TDI A;  2LV7 A;  2QEO A;  4ZCV A;  1KFX S;  2KYF A;  3PM2 A;  3AKB A;  5PAL A;  3D74 A;  3I5G C;  1K94 A;  1K9U A;  1N0Y A;  1TN4 A;  3BFH A;  3D0Y B;  3DD4 A;  1Y1X A;  5HYD A;  2WOS A;  2GGZ A;  1KWO B;  1SW8 A;  1CDM A;  3JTD C;  3DXL A;  2GGM A;  1UHH A;  3NSL A;  1SL8 A;  3JVT B;  3O4X A;  1QLS A;  3WXA A;  4OZD A;  1N65 A;  5FI7 A;  2MLF C;  4PAL A;  3R72 A;  2AUC A;  2QEB A;  2BCX A;  1OE9 B;  3EK8 A;  1YUT A;  1SCM B;  3CR4 X;  4GGF A;  2WC5 A;  3B6X A;  2F2O A;  2HQW A;  1C3Y A;  1K9K A;  3TS5 C;  1F71 A;  4GPL B;  1QIV A;  1Z4H A;  1MXL C;  1ALV A;  1OOH A;  1DVI A;  1MR8 A;  2JPO A;  3F45 A;  1A2X A;  1MUX A;  3BUW B;  2KI4 B;  4HRG A;  1EH2 A;  3S0D A;  4PE4 A;  5JJG A;  4E68 A;  1SSE B;  1YX7 A;  3CAB A;  3IVT A;  3VRN A;  1GGZ A;  3L47 A;  1QV0 A;  1XFX O;  2KNE A;  4JD9 A;  1QXP A;  1S36 A;  1E8A A;  3M0W A;  2JXL A;  2LVV A;  2JQ6 A;  3I5F B;  4WQ3 A;  3PSR A;  1ORG A;  3GK2 A;  3PJI A;  1CNP A;  3AAJ A;  3VRP A;  3PFV A;  3VRO A;  3SIA A;  1V1G A;  1EG3 A;  1J1D A;  4NDB A;  2BE6 A;  4PCW A;  2BCA A;  1XFZ O;  2OTG C;  1MXE A;  3DY9 A;  1C7V A;  1YVL A;  4BY4 A;  1IH0 A;  1B7T Y;  1DGV A;  1OMD A;  1RRO A;  1HQV A;  3OB1 B;  1C3Z A;  1B8R A;  1A4P A;  2JT0 A;  2P6B B;  4KYN A;  5J3X A;  4F7F A;  2OS8 B;  1S6C A;  1FBV A;  1PRW A;  3KEV A;  1SPY A;  1LIN A;  1TNP A;  3WHU B;  4HSZ A;  4YGB B;  1PSB A;  2M8U A;  1B47 A;  1KK7 Y;  1F8H A;  2NCO A;  2ZRT A;  3FE9 A;  1OOG A;  3D10 A;  3KO0 A;  1YTZ C;  3O4Y A;  2E30 A;  1MWN A;  1DJG A;  2FCE A;  4BY5 A;  1XK4 C;  2KPH A;  2LMU A;  3C1V A;  3HX4 A;  4AOM A;  5DKN A;  4QJ5 B;  5CSI A;  3FE8 A;  3D75 A;  1SYM A;  1LVC D;  1NCX A;  3PLF B;  3WNX B;  4I5K A;  2JTZ A;  3VGO A;  1BMO A;  2BKI B;  2MLE C;  1TNW A;  2M0R A;  3UO9 A;  2K2A A;  1NIW A;  3EKH A;  1FPW A;  3D76 A;  3PAT A;  1FI5 A;  1L2O C;  2LE9 B;  1DJW A;  2JU0 A;  2JNX A;  2WCK A;  3BJH A;  1CDL A;  2LM5 A;  2ZNE A;  3SS4 A;  4OR9 B;  3PAL A;  2HF5 A;  1Q80 A;  2WCE A;  2WCH A;  4DCK A;  1SBJ A;  5KTY A;  2KOT A;  1OMR A;  4DRW A;  2WC6 A;  1SK6 D;  3O78 A;  1JUO A;  1NCY A;  1X02 A;  1OOJ A;  1YRT B;  3FIA A;  4PHK A;  5I2L A;  1MHO A;  3SG3 A;  1P28 A;  1S1E A;  1W7J B;  1A29 A;  1NPQ A;  3DVJ A;  2O5G A;  4P2Y B;  3FS7 A;  5DKQ A;  1IIO A;  1KQM C;  2FJY A;  5D3O A;  3RM1 A;  3SIB A;  5D7F A;  5B8I B;  4PE7 A;  4INX A;  2GTE A;  4HRH A;  2H61 C;  2LMT A;  1UWO A;  2KI6 C;  3DF0 B;  2FOT A;  3BUO B;  3CR2 A;  5HLO A;  4YI9 A;  2JNF A;  4JWQ A;  3N7H A;  2F3Z A;  2PQL A;  4USL A;  2F3Y A;  1ZAC A;  1KFX L;  2L0P A;  4NQG A;  1XO5 A;  2M29 A;  2CXJ A;  5I2Q A;  1DC1 A;  4ZCU A;  1WRL A;  1B4C A;  1LKJ A;  4GNK B;  1DJX A;  3HCM A;  3LCP C;  5AEQ A;  1KK8 C;  1PAL A;  2P70 A;  1CMF A;  3A4U B;  2LP2 A;  1OZO A;  1S6I A;  1IQ5 A;  2ERB A;  2KLE A;  4MN0 A;  1C07 A;  1PVB A;  4WRI A;  3TDZ A;  2LAN A;  1SY9 A;  1QX2 A;  2WCM A;  4ICB A;  2MJW B;  2F33 A;  2BKH B;  2KSP A;  4M2Q A;  1Z2C B;  1OMV A;  1G4Y R;  2COL B;  2KQY A;  1PUL A;  4NDD A;  3R1P A;  1JF2 A;  5AER A;  1IJ6 A;  3OX6 A;  2OTG B;  1CDP A;  1PVA A;  3GOF A;  1FW4 A;  4IJ7 A;  4UPG A;  1AJ4 A;  1WDC B;  1GGW A;  4YGC B;  3S0E A;  1YVH A;  3BFA A;  1NUB A;  3CWG A;  3EKJ A;  4TNC A;  2LHL A;  4MSP A;  1DT7 B;  1N2D A;  1NX1 A;  1SR6 C;  1GM0 A;  1S5G Y;  2WCL A;  3QME A;  1BG1 A;  4PE0 A;  3S0B A;  3VRR A;  4N1F A;  3FE6 A;  1QVI Y;  1NX2 A;  4DS7 A;  3TUY C;  2BEC A;  1ODB A;  3TZ1 A;  2LUC A;  1DEL A;  4C0L A;  3CYZ A;  5I8N A;  1C7W A;  3IF7 A;  2JWW A;  3AAK A;  5FI2 A;  1UHN A;  1TTX A;  1DGU A;  1KSM A;  1A75 B;  1KFU S;  3I5I C;  1LXF C;  2BAP A;  2I18 A;  1M46 A;  1T14 A;  5K89 A;  1F4O A;  2KAX A;  2LAP A;  1BLQ A;  2M7N A;  1WRK A;  1CDN A;  1L2O B;  2BBN A;  1EJ3 A;  2L4H A;  1YX8 A;  1B8L A;  1QTX A;  2K0J A;  4YRU A;  5BPJ A;  2CT9 A;  2Q4U A;  3L4L A;  1OW4 A;  2ZKM X;  3I5H C;  2I2R E;  2LHI A;  1AUI B;  1AP4 A;  1LS8 A;  1QX7 A;  2MAZ A;  2TN4 A;  2Y1M A;  3KHE A;  1YUS A;  1DF0 B;  4GFT A;  2WCB A;  2KLD A;  4MZL A;  5FYX A;  3BUM B;  1G8I A;  1NP8 A;  2JC2 A;  2KQ6 A;  2L4I A;  3EK4 A;  3SS5 A;  4YBH B;  2Y4Q A;  1QS7 A;  1SMG A;  1YUR A;  5GQQ C;  1QIW A;  2K7C A;  4P5O E;  5IBW A;  2K7B A;  1DJZ A;  2KAY A;  2QEH A;  2HET A;  3FWB A;  3OX5 A;  4MRX A;  1B9A A;  3H4S E;  3EVU A;  1DJY A;  1KQM B;  1XYD A;  4CPV A;  5AAN A;  3B87 A;  3EG5 B;  2EGD A;  1KWO C;  2PRU A;  4ORA B;  1F54 A;  1QAT A;  3AKA A;  1SNL A;  3NSO A;  2PAS A;  1K90 D;  2F2P A;  3CR5 X;  1TRF A;  3JVT C;  4A4B A;  2B1U A;  1M63 B;  2L2C A;  1DJI A;  2BNX A;  2PYQ A;  2QEV A;  4FTG A;  3D0Y A;  2M49 B;  5D69 A;  2JPT A;  5HLV A;  2KHN A;  2K8M B;  4OVN F;  1BR1 B;  4OCI A;  1IJ5 A;  2EC6 B;  3PN7 B;  1G33 A;  3NXA A;  2JRF A;  2LLT A;  3RZS A;  1BT6 A;  2KDH A;  1XA5 A;  1WLZ A;  3K21 A;  3VB1 A;  2I7A A;  1KK8 B;  2PVB A; 
#chains in the Genus database with same CATH homology
 4YI8 A;  2NZ0 A;  1XFU O;  2HQ8 A;  5TNC A;  1JFJ A;  1NX0 A;  1REC A;  3SJS A;  2KI4 C;  3EK7 A;  1CMG A;  1TCO B;  5AXI A;  1FF1 A;  4DIR A;  2K7O A;  1RTP 1;  3LK0 A;  2MBX A;  1K2H A;  1IWQ A;  3ZNI A;  3I5G B;  1SRA A;  3SG4 A;  1K8U A;  2DOQ A;  2KGB C;  2MHH A;  4MZJ A;  3ZWH A;  3JTD B;  3I5F C;  1GQM A;  3FWC A;  1QLK A;  4MLW A;  1A75 A;  2PSR A;  2M1U A;  1XFY O;  1YRU B;  2CTN A;  1DMO A;  1BU3 A;  1H8B A;  3SG5 A;  1S6J A;  2LNK A;  1BJF A;  2M1K B;  3DVM A;  4R1E A;  1H4B A;  4NDC A;  1M45 A;  5I2O A;  1SR6 B;  1B7T Z;  2OS8 C;  4I5N B;  2L5X B;  3TS5 B;  5CSJ A;  1QAS A;  1CM4 A;  2WC8 A;  1CM1 A;  1U5I B;  3E3R A;  2M9G A;  3EVV A;  1DF0 A;  1DJH A;  1GJY A;  2JT3 A;  3BUN B;  4GAO A;  4AQJ A;  1NWD A;  5CPV A;  1IKU A;  1LA3 A;  4CFR A;  1DTL A;  4D1E A;  2LMV A;  4PHM A;  4JQ0 D;  1CLL A;  2Y1N A;  1YUU A;  1IG5 A;  1JSA A;  3DVK A;  3GK1 A;  3CZT X;  1OQP A;  2F8P A;  4F0Z B;  1AHR A;  4PHN A;  4CFQ A;  1CTR A;  3GK4 X;  2M3W A;  1IGV A;  2QAC A;  2M7L A;  3KF9 A;  1XVJ A;  1M31 A;  3OB2 B;  2A4J A;  1RJV A;  2KYC A;  1J7R A;  1K96 A;  4GGF C;  1TNX A;  2I94 A;  3I5H B;  1Y6W A;  2KFG A;  1KCY A;  3IQO A;  3LL8 B;  2WCF A;  2LCP A;  1B8C A;  2JXC A;  2ZND A;  4QJ3 B;  4XJK B;  4CLN A;  1AK8 A;  2L98 A;  1ZMZ A;  4DUQ A;  2FJU B;  2AMI A;  2D8N A;  2LVK A;  1UHK A;  2SCP A;  2ZN8 A;  2KBM A;  1EG4 A;  2BL0 C;  1KFU L;  2K2F A;  1TCF A;  2L50 A;  5G08 A;  3WHT B;  1CFF A;  3RLZ A;  1PSR A;  4WQ2 A;  2L2E A;  3SG2 A;  1J55 A;  4CID A;  2LC5 A;  1NX3 A;  5DKR A;  4YGE B;  1JC2 A;  5CSN A;  2KGR A;  5AFP A;  2IS9 A;  1F4Q A;  2VRG A;  4MZK A;  1BR4 B;  1J1E A;  4ORB B;  1B1G A;  3CLN A;  4HRE E;  3BQ3 A;  2PMY A;  2QPT A;  1SL7 A;  4OKH A;  2JTT A;  4ORC B;  1Y0V H;  2G9B A;  2PAL A;  1J7O A;  3DF0 A;  2CCM A;  2KAV A;  4C0J A;  1D1O A;  3ICB A;  4Q04 A;  2LLU A;  1BOC A;  2R2I A;  4PDZ A;  2G2B A;  2ZN9 A;  4GBA A;  4JPZ B;  3IQQ A;  4MBE A;  3MSE B;  1CFC A;  1SKT A;  5ER4 X;  2AAO A;  2HPS A;  2V53 A;  3CS1 A;  1FI6 A;  1U5I A;  2LP3 A;  1L7Z A;  1NYA A;  1UUS A;  2MRD A;  3NSK A;  4FQO A;  1HT9 A;  4M2P A;  1VRK A;  3BOW B;  1NSH A;  1F70 A;  2NXQ A;  1UHJ A;  2LVJ A;  1J7Q A;  5HKW A;  3LK1 A;  2ISD A;  1BF5 A;  1Y1U A;  1UUR A;  5ER5 A;  1TIZ A;  2FCD A;  4MRY A;  5JOL A;  1ZOT B;  3CTN A;  3NSI A;  2O60 A;  2BE4 A;  1F55 A;  1JF0 A;  1MQ1 A;  1WDC C;  1XFV O;  2RGI A;  2H2K A;  2BCB A;  2E6W A;  1SCM C;  1CB1 A;  3TDU A;  1BOD A;  1QJT A;  1S3P A;  2JUL A;  1S5G Z;  2CNP A;  4XJK A;  5F6T A;  2KFF A;  1JFK A;  1R2U A;  3PM8 A;  2K7D A;  3QRX A;  1A03 A;  1JWD A;  1K95 A;  1TOP A;  1WRZ A;  1QVI Z;  1TNQ A;  5HKY A;  2EHB A;  1RFJ A;  4XYN A;  4GUK A;  4YGD B;  2JT8 A;  1M39 A;  1YR5 A;  2ZRS A;  4ETO A;  3VRQ A;  2M97 A;  1OZS A;  3A8R A;  3BYA A;  1ZFS A;  4PE1 A;  1AVS A;  1WLM A;  2ZFD A;  1XK4 A;  1CLM A;  2LVI A;  3BXK A;  4QJ4 B;  4M2O A;  1EXR A;  1ALW A;  1K9P A;  1V1F A;  1CLB A;  2LLS A;  1OSA A;  1NCZ A;  2BBM A;  3OHM B;  1QV1 A;  2CBL A;  2WOR A;  1RWY A;  4GGN A;  1SL9 A;  1UP5 A;  1Y1A A;  3OP0 A;  1CFP A;  5HKZ A;  2BL0 B;  2OPO A;  5CSF A;  5KU1 A;  2L51 A;  1JBA A;  4YGA A;  2GV5 A;  3KPX A;  3DVE A;  1J7P A;  3BUX B;  2WND A;  1K93 D;  1CFD A;  4I5J A;  4MVF A;  3TUY B;  4I5L B;  1W7I B;  4AQI A;  2MA2 A;  2JOJ A;  1PK0 D;  1SCV A;  5KSZ A;  3SG7 A;  1KK7 Z;  1XFW O;  2LUX A;  2Y5I A;  1R6P A;  3O6B A;  1ZUZ A;  1MF8 B;  3EVR A;  1QX5 B;  1EL4 A;  1LA0 A;  3BOW A;  3I5I B;  1AJ5 A;  4IL1 A;  4L9M A;  1IQ3 A;  2SAS A;  1S26 D;  2KBI A;  2NLN A;  1KQV A;  1RK9 A;  2Q91 A;  2EC6 C;  4A4C A;  3PN7 C;  1WY9 A;  2H61 A;  2KI6 D;  3O2P A;  4PHJ A;  2JZI A;  1CKK A;  2KFH A;  4MEW A;  1KSO A;  3LLE A;  1UHI A;  3SG6 A;  1IRJ A;  4N1G A;  4C0K A;  2NCP A;  4U8D A;  4N5X A;  2K61 A;  3CGA A;  4OV2 A;  3TDI A;  2LV7 A;  4ZCV A;  1KFX S;  2KYF A;  3AKB A;  5PAL A;  3I5G C;  1K94 A;  1K9U A;  1N0Y A;  1TN4 A;  3D0Y B;  3DD4 A;  1Y1X A;  5HYD A;  2WOS A;  2GGZ A;  1KWO B;  1SW8 A;  1CDM A;  3JTD C;  2GGM A;  1UHH A;  3NSL A;  1SL8 A;  3JVT B;  1QLS A;  3WXA A;  1N65 A;  2MLF C;  4PAL A;  2AUC A;  2BCX A;  1OE9 B;  3EK8 A;  1YUT A;  1SCM B;  3CR4 X;  4GGF A;  2F2O A;  2HQW A;  1K9K A;  3TS5 C;  1F71 A;  4GPL B;  1QIV A;  1MXL C;  1ALV A;  1DVI A;  1MR8 A;  3F45 A;  1A2X A;  1MUX A;  3BUW B;  2KI4 B;  4HRG A;  1EH2 A;  4PE4 A;  5JJG A;  4E68 A;  3VRN A;  1YX7 A;  1GGZ A;  1QV0 A;  1XFX O;  2KNE A;  1QXP A;  1S36 A;  1E8A A;  3M0W A;  2JXL A;  2LVV A;  2JQ6 A;  3I5F B;  4WQ3 A;  3PSR A;  3GK2 A;  1CNP A;  3AAJ A;  3VRP A;  3PFV A;  3VRO A;  3SIA A;  1V1G A;  1EG3 A;  1J1D A;  4NDB A;  2BE6 A;  4PCW A;  2BCA A;  1XFZ O;  2OTG C;  1MXE A;  1C7V A;  1YVL A;  4BY4 A;  1IH0 A;  1B7T Y;  1DGV A;  1OMD A;  1RRO A;  1HQV A;  3OB1 B;  1B8R A;  1A4P A;  2JT0 A;  2P6B B;  5J3X A;  2OS8 B;  1S6C A;  1FBV A;  1PRW A;  3KEV A;  1SPY A;  1LIN A;  1TNP A;  3WHU B;  4HSZ A;  4YGB B;  1PSB A;  2M8U A;  1B47 A;  1KK7 Y;  1F8H A;  2NCO A;  2ZRT A;  3KO0 A;  3D10 A;  1YTZ C;  3O4Y A;  2E30 A;  1MWN A;  1DJG A;  2FCE A;  4BY5 A;  1XK4 C;  2LMU A;  4AOM A;  3C1V A;  3HX4 A;  4QJ5 B;  5DKN A;  5CSI A;  1SYM A;  1LVC D;  1NCX A;  3PLF B;  3WNX B;  4I5K A;  2JTZ A;  3VGO A;  1BMO A;  2BKI B;  2MLE C;  1TNW A;  2M0R A;  2K2A A;  1NIW A;  3EKH A;  1FPW A;  1FI5 A;  3PAT A;  1L2O C;  2LE9 B;  1DJW A;  2JU0 A;  2JNX A;  1CDL A;  2LM5 A;  2ZNE A;  4OR9 B;  3PAL A;  2HF5 A;  1Q80 A;  2WCE A;  4DCK A;  1SBJ A;  5KTY A;  2KOT A;  1OMR A;  4DRW A;  1SK6 D;  3O78 A;  1JUO A;  1NCY A;  1X02 A;  1OOJ A;  1YRT B;  3FIA A;  4PHK A;  5I2L A;  1MHO A;  3SG3 A;  1S1E A;  1W7J B;  1A29 A;  1NPQ A;  3DVJ A;  2O5G A;  4P2Y B;  3FS7 A;  5DKQ A;  1KQM C;  3SIB A;  3RM1 A;  5D7F A;  5B8I B;  4PE7 A;  4HRH A;  2H61 C;  2LMT A;  1UWO A;  2KI6 C;  3DF0 B;  2FOT A;  3BUO B;  3CR2 A;  5HLO A;  4YI9 A;  2JNF A;  4JWQ A;  2F3Z A;  4USL A;  2F3Y A;  1ZAC A;  1KFX L;  2L0P A;  4NQG A;  1XO5 A;  2M29 A;  2CXJ A;  5I2Q A;  4ZCU A;  1WRL A;  1B4C A;  1LKJ A;  4GNK B;  1DJX A;  3HCM A;  3LCP C;  5AEQ A;  1KK8 C;  1PAL A;  1CMF A;  3A4U B;  2LP2 A;  1OZO A;  1S6I A;  1IQ5 A;  4MN0 A;  1C07 A;  1PVB A;  4WRI A;  3TDZ A;  2LAN A;  1SY9 A;  1QX2 A;  4ICB A;  2MJW B;  2F33 A;  2BKH B;  2KSP A;  4M2Q A;  1OMV A;  1G4Y R;  2COL B;  2KQY A;  1PUL A;  4NDD A;  1JF2 A;  5AER A;  1IJ6 A;  3OX6 A;  2OTG B;  1CDP A;  1PVA A;  3GOF A;  1FW4 A;  4UPG A;  1AJ4 A;  1WDC B;  1GGW A;  4YGC B;  1YVH A;  1NUB A;  3CWG A;  3EKJ A;  4TNC A;  2LHL A;  4MSP A;  1DT7 B;  1N2D A;  1NX1 A;  1SR6 C;  1S5G Y;  1BG1 A;  4PE0 A;  3VRR A;  4N1F A;  1QVI Y;  1NX2 A;  4DS7 A;  3TUY C;  2BEC A;  1ODB A;  3TZ1 A;  2LUC A;  4C0L A;  5I8N A;  1C7W A;  3IF7 A;  2JWW A;  3AAK A;  1UHN A;  1TTX A;  1DGU A;  1KSM A;  1A75 B;  1KFU S;  3I5I C;  1LXF C;  2I18 A;  1M46 A;  5K89 A;  1F4O A;  2KAX A;  2LAP A;  1BLQ A;  2M7N A;  1WRK A;  1CDN A;  1L2O B;  2BBN A;  1EJ3 A;  2L4H A;  1YX8 A;  1B8L A;  1QTX A;  2K0J A;  4YRU A;  5BPJ A;  2CT9 A;  2Q4U A;  2ZKM X;  3I5H C;  2I2R E;  2LHI A;  1AUI B;  1AP4 A;  2TN4 A;  1QX7 A;  2MAZ A;  2Y1M A;  3KHE A;  1YUS A;  1DF0 B;  4GFT A;  2WCB A;  4MZL A;  5FYX A;  3BUM B;  1G8I A;  1NP8 A;  2JC2 A;  2KQ6 A;  2L4I A;  3EK4 A;  4YBH B;  2Y4Q A;  1QS7 A;  1SMG A;  1YUR A;  5GQQ C;  1QIW A;  2K7C A;  4P5O E;  5IBW A;  2K7B A;  1DJZ A;  2KAY A;  3OX5 A;  2HET A;  3FWB A;  4MRX A;  1B9A A;  3H4S E;  3EVU A;  1DJY A;  1KQM B;  1XYD A;  4CPV A;  5AAN A;  2EGD A;  1KWO C;  2PRU A;  4ORA B;  1F54 A;  1QAT A;  3AKA A;  1SNL A;  3NSO A;  2PAS A;  1K90 D;  2F2P A;  3CR5 X;  1TRF A;  3JVT C;  4A4B A;  2B1U A;  1M63 B;  1DJI A;  4FTG A;  3D0Y A;  2M49 B;  5D69 A;  2JPT A;  5HLV A;  2KHN A;  2K8M B;  4OVN F;  1BR1 B;  4OCI A;  1IJ5 A;  2EC6 B;  3PN7 B;  1G33 A;  3NXA A;  2JRF A;  2LLT A;  1BT6 A;  2KDH A;  1XA5 A;  1WLZ A;  3K21 A;  2I7A A;  1KK8 B;  2PVB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...