2BL0B

Physarum polycephalum myosin ii regulatory domain
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
145
structure length
145
Chain Sequence
TASADQIQECFQIFDKDNDGKVSIEELGSALRSLGKNPTNAELNTIKGQLNAKEFDLATFKTVYRKPIKTPTEQSKEMLDAFRALDKEGNGTIQEAELRQLLLNLGDALTSSEVEELMKEVSVSGDGAINYESFVDMLVTGYPLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Muscle protein
molecule keywords MAJOR PLASMODIAL MYOSIN HEAVY CHAIN
publication title Structural Evidence for Non-Canonical Binding of Ca2+ to a Canonical EF-Hand of a Conventional Myosin.
pubmed doi rcsb
source organism Physarum polycephalum
total genus 44
structure length 145
sequence length 145
ec nomenclature ec 3.6.1.32: Transferred entry: 5.6.1.8.
pdb deposition date 2005-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00036 EF-hand_1 EF hand
B PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2bl0B02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2bl0B01
2LLUA 3CZTX 2KYFA 4MSPA 2L50A 1SCMB 2BKIB 3PFVA 3OB2B 1ZOTB 2KQ6A 2H61C 3FS7A 1A75B 1JF0A 1CDNA 1M46A 2M0RA 3PSRA 2SCPA 1UHNA 4YBHB 2COLB 2F3ZA 2WCEA 1KFXS 1AJ4A 1WDCC 3KEVA 1EH2A 1TNQA 5ER4X 3IF7A 2LAPA 4C0LA 1HT9A 2PVBA 1IQ5A 1JSAA 1BF5A 1M45A 1SMGA 3O4YA 5GQQC 1S36A 2NCPA 1LKJA 4YGCB 3I5HB 2OS8C 3DD4A 2BBMA 1DTLA 4GFTA 2K61A 3SG7A 1OZOA 2ZRSA 4QJ3B 1BMOA 4PE4A 4WRIA 1S1EA 4C0JA 1Y6WA 2AAOA 2JT8A 2BE4A 5JOLA 1KSOA 2E30A 2KAXA 2GGMA 1YUSA 2LV7A 5AXIA 1DT7B 3A4UB 2CNPA 4HRGA 1NCYA 3LCPC 1L7ZA 1CTRA 4CPVA 5AERA 2F2OA 3D0YA 1TTXA 1QX5B 5DKNA 1SYMA 1C07A 1F54A 5HLVA 1BOCA 5D7FA 1KFUS 1B8RA 5HLOA 1CKKA 3LK0A 1F70A 1NX1A 2K0JA 1ZACA 1KFXL 3DF0B 1K9PA 1H4BA 2KQYA 1QTXA 4QJ5B 2M29A 1AHRA 1K95A 4NDDA 4MVFA 1J7RA 4NQGA 3NSLA 2RGIA 1KQVA 1NUBA 4ETOA 4MLWA 1XFUO 2QPTA 2Y5IA 1IJ5A 3JTDC 2K7CA 1G8IA 2JT0A 3EKHA 2HQWA 2JTTA 4L9MA 2LE9B 5DKQA 2HPSA 2EHBA 2L4HA 4AOMA 2KOTA 1G4YR 2ZNDA 1AJ5A 1OZSA 1PSRA 5J3XA 4DS7A 1NX2A 1OMVA 3O2PA 1BR1B 3WHUB 2JXCA 1SKTA 1ZFSA 1S26D 1YURA 4HSZA 1KQMC 3I5GC 1XA5A 2HETA 4R1EA 3DVJA 1XFWO 4OKHA 2LNKA 4XYNA 1MXEA 1LXFC 3NXAA 1CFFA 1PRWA 2LVKA 3D0YB 1W7IB 1WLZA 3TDIA 2KAVA 2WORA 1IG5A 3DVMA 1QASA 4PCWA 4HREE 1KFUL 1QVIZ 2BCXA 2H61A 4CLNA 3BQ3A 2M3WA 1K9UA 3DVEA 1GGWA 1A75A 3CWGA 1CB1A 1DJIA 2EC6B 3TS5C 1TRFA 2F2PA 1BR4B 1DJWA 2PALA 3E3RA 2KGRA 2L5XB 2NCOA 3ZWHA 1F4QA 3AAKA 1QXPA 2LHIA 2WC8A 2NLNA 5DKRA 5KU1A 5KTYA 1CM4A 1KK8C 4HRHA 1SL7A 1OOJA 1CLLA 1CFPA 3PN7B 2M7NA 3VGOA 2O5GA 1J7QA 1B7TZ 1UUSA 3CGAA 1NWDA 3FWCA 1WRLA 3HX4A 1L2OB 2LHLA 1Q80A 2JPTA 1NX0A 1TIZA 1OQPA 2KFHA 1JC2A 2L2EA 1K9KA 2BBNA 2FCDA 3RLZA 1YVHA 4C0KA 4OVNF 5CSIA 3HCMA 1F55A 1QVIY 1AUIB 1SRAA 3BOWA 4GUKA 3VRPA 5K89A 1SR6C 4YGAA 2LVJA 3CR2A 4MN0A 2WOSA 1AK8A 3EVUA 4M2QA 1DMOA 2M1KB 1VRKA 3CS1A 3C1VA 2G9BA 5CSFA 1U5IB 4JQ0D 5KSZA 1CNPA 1B4CA 1FPWA 1B7TY 2M97A 1SNLA 1R2UA 2F8PA 2LMTA 3KO0A 4PE0A 1YTZC 1XFXO 3EK8A 2LM5A 1WDCB 3MSEB 3DF0A 3GK2A 3H4SE 1QX2A 1J7PA 1J7OA 1J1EA 2R2IA 1KWOC 3NSIA 3WHTB 1NCXA 1UP5A 2QACA 2JXLA 1MR8A 2NZ0A 1PVAA 1JFKA 2HQ8A 2KFGA 1PK0D 4GPLB 2OTGC 5JJGA 1FI6A 2OS8B 1LA0A 2Q4UA 3KF9A 1A29A 5TNCA 4UPGA 1K2HA 4MZJA 2LUXA 3QRXA 1RTP1 2NXQA 1IQ3A 2JNFA 3SG4A 1XVJA 3BOWB 2ISDA 1J55A 3GOFA 3SG3A 1DJXA 1RK9A 3A8RA 1NYAA 1YX7A 2LUCA 3M0WA 4PHJA 2DOQA 1K93D 3CR4X 3CLNA 1XO5A 2LC5A 2JZIA 2LP3A 1BT6A 3GK1A 1YRTB 1TNXA 3KPXA 2BKHB 3AKBA 2PMYA 2IS9A 4MZKA 2K2FA 1B8LA 4TNCA 3JTDB 1CLBA 2WCFA 3I5IC 1NIWA 1TCFA 1B47A 2KSPA 3SG5A 1EG3A 1XK4C 2KI4C 4CFRA 3GK4X 4DRWA 1OMRA 3TUYC 1F71A 2VRGA 2Y1MA 1DVIA 1OMDA 1TOPA 2GV5A 5AFPA 1HQVA 4ORCB 2LCPA 5FYXA 3BXKA 4WQ2A 3I5FC 1GGZA 3IQOA 1KQMB 1UHIA 4OV2A 3VRQA 3I5GB 3PALA 2LMVA 1A03A 1PSBA 4PE1A 2M1UA 2L51A 2FCEA 3SJSA 1Y1AA 2K8MB 1LA3A 1K90D 1LINA 1R6PA 2ZRTA 4MRYA 2CBLA 4PHKA 5I2LA 3CR5X 1BLQA 4YGDB 4PHMA 1U5IA 1FI5A 1OSAA 2G2BA 3OX5A 1BG1A 4M2PA 1SL8A 4OR9B 3TS5B 3IQQA 1MXLC 1QATA 2KBIA 4GGNA 1WY9A 1CDPA 2FOTA 3BUOB 1TNWA 1DJYA 3LL8B 4XJKA 3VRRA 1SPYA 1KK8B 1FBVA 1B9AA 2I7AA 3WNXB 2AMIA 4PE7A 2JNXA 1RJVA 2JT3A 3EVVA 2ZN8A 2MLEC 5CPVA 5I8NA 3BYAA 1CFDA 1F8HA 4A4CA 2MRDA 1SW8A 1N65A 1TCOB 1YUTA 2I94A 1KSMA 2ZFDA 1DF0A 1QIVA 2MHHA 2LMUA 1LVCD 3EK4A 1C7WA 4ICBA 2JRFA 1DJZA 2L0PA 2EGDA 2M8UA 2WCBA 4PALA 3FWBA 5AANA 1DGVA 1SR6B 3DVKA 2K7OA 2ZKMX 4MEWA 4ZCUA 4I5LB 4YRUA 5ER5A 4CIDA 1SL9A 2LLSA 1S6IA 1V1GA 2MJWB 4GNKB 3OB1B 4ORAB 1ALWA 2JOJA 1D1OA 5D69A 2FJUB 3KHEA 1NP8A 2KI6C 1IKUA 3RM1A 2KAYA 3TDUA 1WRZA 1CLMA 2MLFC 1NSHA 4GGFC 1M31A 3BUXB 3EK7A 4YI9A 1JBAA 2KYCA 4XJKB 3K21A 1QV1A 1SCVA 1Y0VH 1G33A 1YRUB 5HKWA 3SIAA 1NPQA 1UURA 1ALVA 1KWOB 2P6BB 3SG2A 2PSRA 1JFJA 1QLSA 4GBAA 1NX3A 2Y1NA 3JVTC 4AQJA 1JWDA 3NSKA 2OTGB 1DJHA 1XK4A 1KK7Z 4BY4A 2O60A 2AUCA 4DCKA 1DF0B 1GJYA 1SCMC 1PVBA 1EL4A 1UWOA 3EKJA 2JWWA 4WQ3A 2BCAA 2CXJA 2BCBA 1XFZO 1DGUA 3PM8A 1QX7A 1JF2A 1AP4A 2JULA 1N2DA 4E68A 1EXRA 1AVSA 4AQIA 1PULA 4N1GA 1A2XA 1K96A 1TN4A 4F0ZB 1CMFA 4MBEA 4NDCA 1BODA 1UHJA 2CT9A 1FW4A 1YR5A 2LVVA 4IL1A 4MRXA 3I5HC 3BUMB 4MZLA 3VROA 2JQ6A 1EG4A 2SASA 1BJFA 1S5GZ 2LP2A 3LK1A 5F6TA 1CDLA 2BECA 2I18A 1IJ6A 1MQ1A 4PHNA 1M39A 1YVLA 1QV0A 2KGBC 4M2OA 2MA2A 2OPOA 5G08A 1KK7Y 1XFYO 2M7LA 2LVIA 1CFCA 1Y1XA 1QIWA 1N0YA 1B1GA 5B8IB 2L98A 3TDZA 1A4PA 1XFVO 5HYDA 1IRJA 2F3YA 1IH0A 1SK6D 4QJ4B 3I5IB 2MAZA 2ZNEA 1RECA 1J1DA 2D8NA 2JU0A 1E8AA 2KI4B 3TUYB 4N5XA 5HKYA 3AKAA 2KI6D 3NSOA 2LLTA 2M9GA 1W7JB 3VRNA 4FQOA 4NDBA 1RFJA 1BU3A 5I2OA 4YI8A 4USLA 3I5FB 4OCIA 1YX8A 1FF1A 2K2AA 1CMGA 4JPZB 1S5GY 1C7VA 5CSJA 2CTNA 1UHHA 4DUQA 5AEQA 4I5NB 1RWYA 1SBJA 4ZCVA 2KHNA 2CCMA 1MWNA 1M63B 4BY5A 5PALA 4JWQA 3SIBA 1K8UA 3SG6A 1CM1A 1XYDA 4P5OE 1K94A 2K7DA 4P2YB 2LANA 2GGZA 2V53A 3LLEA 2F33A 1MUXA 1B8CA 4PDZA 4GGFA 1IGVA 3O78A 1H8BA 1X02A 3CTNA 1Y1UA 2M49B 1NCZA 3PLFB 1ZUZA 1RROA 2Q91A 2HF5A 2KFFA 3O6BA 5HKZA 2Y4QA 3ICBA 3EVRA 2B1UA 4U8DA 2MBXA 1DJGA 1CDMA 4YGBB 2JC2A 2L4IA 3WXAA 1EJ3A 2BE6A 3OP0A 4GAOA 1QJTA 1PALA 2I2RE 3D10A 2H2KA 1MHOA 1TNPA 4DIRA 2EC6C 1ODBA 5BPJA 2ZN9A 1QS7A 1IWQA 1S6CA 2BL0B 4N1FA 4D1EA 1KCYA 2BL0C 2K7BA 2KDHA 1MF8B 1QLKA 4Q04A 5IBWA 2KNEA 3TZ1A 2A4JA 4ORBB 4I5JA 3PN7C 1S3PA 3OX6A 1WRKA 3BUWB 1WLMA 1L2OC 1V1FA 3PATA 4I5KA 4YGEB 5I2QA 4CFQA 2TN4A 4FTGA 5CSNA 2E6WA 1YUUA 3OHMB 4A4BA 1UHKA 3ZNIA 1GQMA 2PASA 3BUNB 3AAJA 3FIAA 1OE9B 3JVTB 2PRUA 3F45A 1ZMZA 1SY9A 1JUOA 1S6JA 2JTZA 2WNDA 1F4OA 2KBMA
chains in the Genus database with same CATH superfamily
2LLUA 3CZTX 2KYFA 4MSPA 2L50A 1SCMB 2BKIB 3PFVA 3OB2B 1ZOTB 2KQ6A 2H61C 2H8VA 3FS7A 1A75B 1JF0A 4JKTA 1CDNA 1M46A 2M0RA 3PSRA 2SCPA 1UHNA 4YBHB 1QWVA 2COLB 2F3ZA 2WCEA 1KFXS 1AJ4A 1WDCC 3KEVA 1EH2A 1TNQA 5ER4X 3IF7A 2LAPA 4C0LA 1HT9A 2PVBA 1IQ5A 1JSAA 1BF5A 1M45A 1SMGA 3O4YA 5GQQC 1S36A 2NCPA 1LKJA 3D73A 2QEHA 4YGCB 3I5HB 2OS8C 3DD4A 2BBMA 1DTLA 4GFTA 2K61A 3SG7A 1OZOA 2ZRSA 4QJ3B 1BMOA 4PE4A 4WRIA 1S1EA 4C0JA 1Z4HA 1Y6WA 2AAOA 2JT8A 2BE4A 5JOLA 1KSOA 2E30A 2KAXA 2GGMA 1LS8A 1YUSA 2LV7A 2PQLA 5D3OA 5AXIA 1DT7B 3A4UB 2CNPA 4HRGA 1NCYA 3LCPC 1L7ZA 1CTRA 4CPVA 5AERA 2F2OA 3D0YA 1TTXA 1QX5B 2WCKA 1SYMA 2YGUA 1OOFA 5DKNA 3BFHA 5HLVA 1C07A 1BOCA 1F54A 5D7FA 1KFUS 1B8RA 5HLOA 1CKKA 3LK0A 1F70A 1NX1A 2K0JA 1ZACA 1KFXL 3DF0B 1K9PA 1H4BA 2FJYA 2KQYA 1QTXA 4QJ5B 2M29A 1AHRA 2WC5A 1K95A 4NDDA 4MVFA 1J7RA 4NQGA 3NSLA 5FI6A 4KYNA 2RGIA 1KQVA 2WC6A 1NUBA 4ETOA 4MLWA 1XFUO 2QPTA 2Y5IA 1IJ5A 3JTDC 2QEBA 2K7CA 1G8IA 2JT0A 3EKHA 2HQWA 2JTTA 2L2CA 1ORGA 4L9MA 1DQEA 2LE9B 5DKQA 2HPSA 2EHBA 2L4HA 4AOMA 2KOTA 1G4YR 2ZNDA 1AJ5A 1OZSA 1PSRA 5J3XA 3SS3A 4DS7A 1NX2A 1OMVA 3O2PA 1BR1B 3WHUB 2JXCA 1SKTA 1ZFSA 1S26D 1YURA 4HSZA 1KQMC 3I5GC 1XA5A 2HETA 4R1EA 3DVJA 1XFWO 4OKHA 2LNKA 4XYNA 1MXEA 1LXFC 3R1OA 3NXAA 1CFFA 4F7FA 1PRWA 2LVKA 3D0YB 3DZTA 1W7IB 1WLZA 3TDIA 2KAVA 2WORA 1IG5A 3DVMA 1QASA 4PCWA 4HREE 1KFUL 1QVIZ 2BCXA 2H61A 4CLNA 3BQ3A 2M3WA 1K9UA 3DVEA 1GGWA 1A75A 2WCJA 3CWGA 1DJIA 2EC6B 1CB1A 3TS5C 1TRFA 2F2PA 1BR4B 1DJWA 2PALA 3E3RA 2KGRA 2L5XB 2NCOA 3ZWHA 1F4QA 3AAKA 1QXPA 2LHIA 2WC8A 2NLNA 5DKRA 5KU1A 5KTYA 1CM4A 3S0BA 1KK8C 4HRHA 1SL7A 1OOJA 1CLLA 1CFPA 3PN7B 2M7NA 3VGOA 2O5GA 1J7QA 1B7TZ 1UUSA 3CGAA 1NWDA 3FWCA 1WRLA 2L5YA 3HX4A 1L2OB 2LHLA 5DICA 1Q80A 3NHIA 2JPTA 1NX0A 1TIZA 1OQPA 1OOHA 2KFHA 1JC2A 2L2EA 1K9KA 2BBNA 2K60A 2FCDA 3RLZA 1YVHA 3VB1A 4C0KA 4OVNF 5CSIA 3HCMA 1F55A 1QVIY 1AUIB 1SRAA 3BOWA 2QDIA 4GUKA 3VRPA 5K89A 1SR6C 4YGAA 2LVJA 3CR2A 4MN0A 2WOSA 2KLEA 1AK8A 3EVUA 4M2QA 1DMOA 2M1KB 1VRKA 3CS1A 3C1VA 2G9BA 5CSFA 1U5IB 4JQ0D 5KSZA 3FE8A 1CNPA 2ERBA 1B4CA 1FPWA 1B7TY 2M97A 1SNLA 1R2UA 2F8PA 2LMTA 3KO0A 4PE0A 1YTZC 1XFXO 3D76A 3EK8A 2LM5A 1WDCB 3MSEB 3DF0A 3GK2A 3H4SE 3S0AA 1QX2A 1J7PA 1J7OA 1J1EA 2R2IA 1KWOC 3NSIA 3B6XA 3RZSA 3WHTB 1NCXA 1UP5A 2QACA 2JXLA 1MR8A 2NZ0A 3K1EA 1PVAA 3EG5B 1JFKA 2HQ8A 2KFGA 1PK0D 4GPLB 2OTGC 5JJGA 1FI6A 2OS8B 1LA0A 2P71A 2Q4UA 3KF9A 1A29A 5TNCA 4UPGA 1K2HA 1TWOA 4MZJA 1OOIX 2KPHA 2LUXA 3QRXA 1RTP1 3PJIA 3IVTA 2NXQA 1IQ3A 2JNFA 3SG4A 1XVJA 3BOWB 3S0GA 2ISDA 1J55A 3GOFA 3L4LA 3SG3A 1DJXA 1RK9A 3A8RA 1NYAA 1YX7A 2LUCA 2WCLA 3M0WA 1TUZA 3R72A 4PHJA 2DOQA 1K93D 1T14A 1DC1A 3CR4X 3CLNA 3B86A 1XO5A 2LC5A 2JZIA 2LP3A 1BT6A 3GK1A 1YRTB 5FI7A 1TNXA 3KPXA 2BKHB 3AKBA 2PMYA 2IS9A 4MZKA 2K2FA 1B8LA 4TNCA 3CABA 3JTDB 3B87A 1CLBA 2WCFA 3I5IC 1NIWA 1TCFA 1B47A 2KSPA 3SG5A 3L47A 1EG3A 1XK4C 2KI4C 3D78A 2PYQA 3GK4X 1OMRA 4CFRA 4DRWA 3TUYC 1F71A 2VRGA 2Y1MA 2BNXA 1DVIA 1OMDA 1TOPA 2GV5A 5AFPA 1HQVA 4ORCB 2LCPA 5FYXA 3BXKA 4WQ2A 3I5FC 3CZ0A 1GGZA 3IQOA 3PM2A 1KQMB 1UHIA 4OV2A 3VRQA 3I5GB 3SS4A 3PALA 3N7HA 3CYZA 2LMVA 1A03A 1PSBA 4PE1A 2M1UA 2L51A 2FCEA 3SJSA 3SS5A 2P70A 2BAPA 5HL1A 1Y1AA 2K8MB 1LA3A 1K90D 1LINA 1R6PA 2ZRTA 4MRYA 1P28A 2CBLA 4PHKA 5I2LA 3CR5X 1BLQA 4YGDB 4PHMA 1U5IA 1FI5A 1TUJA 1OSAA 2G2BA 3OX5A 1BG1A 4INXA 4M2PA 1SL8A 4OR9B 3TS5B 3IQQA 1MXLC 3OGNA 1QATA 2KBIA 4GGNA 1WY9A 1CDPA 2FOTA 3BUOB 3QMEA 1TNWA 1DJYA 3LL8B 4XJKA 1DEKA 3VRRA 1SPYA 3BJHA 1KK8B 1FBVA 1B9AA 2I7AA 3WNXB 2AMIA 3D77A 2JNXA 1RJVA 2JT3A 4PE7A 3EVVA 5FI2A 2ZN8A 2MLEC 5CPVA 5I8NA 3BYAA 1CFDA 2QEOA 1F8HA 4A4CA 2MRDA 1SW8A 3D75A 1N65A 1TCOB 1YUTA 2I94A 3NGVA 1KSMA 2ZFDA 1DF0A 1QIVA 2MHHA 2LMUA 1LVCD 3EK4A 1W9ZA 1C7WA 4ICBA 2JRFA 1DJZA 2L0PA 2EGDA 2M8UA 2WCBA 5F6TA 4PALA 3FWBA 5AANA 1DGVA 1SR6B 3DVKA 2K7OA 2ZKMX 4MEWA 4ZCUA 4I5LB 4YRUA 3NHTA 5ER5A 4CIDA 1SL9A 2LLSA 3V2LA 1S6IA 1V1GA 2MJWB 4GNKB 3OB1B 1GM0A 4ORAB 1ALWA 2JOJA 1D1OA 5D69A 3OBVA 2FJUB 3KHEA 1NP8A 2KI6C 3L4AA 3RM1A 2KAYA 1IKUA 3TDUA 1OW4A 1WRZA 1CLMA 2MLFC 1NSHA 4GGFC 1C3YA 1M31A 3BUXB 3EK7A 4INWA 4YI9A 1JBAA 2KYCA 4XJKB 3K21A 1QV1A 1SCVA 1Y0VH 1G33A 1YRUB 5HKWA 3SIAA 1NPQA 1UURA 1ALVA 1KWOB 2P6BB 3SG2A 2PSRA 1SSEB 1JFJA 1QLSA 4GBAA 1NX3A 2Y1NA 3JVTC 4AQJA 1JWDA 3NSKA 2OTGB 3CZ2A 1DJHA 1XK4A 1KK7Z 4BY4A 2O60A 2AUCA 4DCKA 1DF0B 1GJYA 1SCMC 1PVBA 1EL4A 1UWOA 3EKJA 2JWWA 4WQ3A 2BCAA 2CXJA 2BCBA 1XFZO 1DGUA 3PM8A 1QX7A 1JF2A 1AP4A 2JULA 1N2DA 4E68A 1XFRA 1EXRA 1AVSA 4AQIA 1PULA 4N1GA 1A2XA 1K96A 1TN4A 4F0ZB 1CMFA 4MBEA 3S0FA 4NDCA 1BODA 1UHJA 2CT9A 1OOGA 1FW4A 1YR5A 2LVVA 2QEVA 4IL1A 3I5HC 3BUMB 4MRXA 4MZLA 3VROA 2JQ6A 1EG4A 2SASA 1BJFA 1S5GZ 2LP2A 3LK1A 5EL2A 1CDLA 2BECA 2I18A 3UO9A 1IJ6A 1MQ1A 4PHNA 1M39A 1YVLA 1QV0A 2KGBC 4M2OA 2MA2A 2OPOA 5G08A 1KK7Y 1XFYO 2M7LA 2LVIA 3FE6A 1CFCA 1Y1XA 1QIWA 1N0YA 1B1GA 5B8IB 2L98A 3TDZA 1A4PA 3S0DA 1XFVO 5HYDA 1IRJA 2F3YA 1IH0A 1SK6D 4QJ4B 3I5IB 2MAZA 2ZNEA 1RECA 3B88A 1J1DA 2D8NA 2JU0A 1E8AA 2KI4B 3TUYB 4N5XA 3UNWA 5HKYA 3AKAA 3R1VA 2KI6D 3NSOA 2LLTA 2M9GA 1W7JB 3VRNA 4FQOA 4NDBA 1RFJA 1BU3A 5I2OA 3BFAA 4USLA 4YI8A 3I5FB 4OCIA 3O4XA 1YX8A 1FF1A 2K2AA 1CMGA 4JPZB 1S5GY 1C7VA 5CSJA 2CTNA 1UHHA 3DYEA 4DUQA 5AEQA 4JD9A 2WCHA 1DELA 4I5NB 1RWYA 3FE9A 1SBJA 4ZCVA 2KHNA 2CCMA 1MWNA 1M63B 4BY5A 5PALA 4JWQA 3SIBA 1K8UA 3SG6A 1CM1A 1XYDA 2GTEA 4P5OE 1K94A 2K7DA 4P2YB 2LANA 2GGZA 2V53A 3LLEA 2F33A 1MUXA 1B8CA 4PDZA 1Z2CB 4GGFA 1IGVA 3O78A 1H8BA 1X02A 3CTNA 1Y1UA 2WCMA 2M49B 1NCZA 2JPOA 1ZUZA 3PLFB 1RROA 2Q91A 2HF5A 5I94A 2KFFA 3O6BA 5HKZA 3D74A 2Y4QA 3ICBA 3EVRA 2B1UA 1C3ZA 4U8DA 2MBXA 3CDNA 1DJGA 3BFBA 1CDMA 4YGBB 2JC2A 2L4IA 3WXAA 1EJ3A 2BE6A 4IJ7A 4OZDA 3OP0A 4GAOA 1QJTA 1PALA 2I2RE 3D10A 2H2KA 1MHOA 1TNPA 4DIRA 2EC6C 1ODBA 5BPJA 2ZN9A 1QS7A 1IWQA 1S6CA 2BL0B 4N1FA 4D1EA 1KCYA 2BL0C 2K7BA 2KDHA 4PT1A 1MF8B 1QLKA 4Q04A 5IBWA 3Q8IA 2KNEA 3R1PA 2KLDA 3TZ1A 2A4JA 4ORBB 4I5JA 3PN7C 3CZ1A 3DY9A 1S3PA 3OX6A 1WRKA 3BUWB 1WLMA 1L2OC 1V1FA 3PATA 4I5KA 4YGEB 5I2QA 1IIOA 4CFQA 3S0EA 2TN4A 4FTGA 5CSNA 3B7AA 2E6WA 1YUUA 3OHMB 4A4BA 3DXLA 1UHKA 3ZNIA 1GQMA 2PASA 3BUNB 3AAJA 3FIAA 1OE9B 3JVTB 4FQTA 2PRUA 3F45A 1ZMZA 1SY9A 1JUOA 1S6JA 2JTZA 2WNDA 1F4OA 2KBMA
chains in the Genus database with same CATH topology
2LLUA 3CZTX 2KYFA 4MSPA 2L50A 1SCMB 2BKIB 3PFVA 3OB2B 1ZOTB 2KQ6A 2H61C 3FS7A 1A75B 1JF0A 1CDNA 1M46A 2M0RA 3PSRA 2SCPA 1UHNA 4YBHB 2COLB 2F3ZA 2WCEA 1KFXS 1AJ4A 1WDCC 3KEVA 1EH2A 1TNQA 5ER4X 3IF7A 2LAPA 4C0LA 1HT9A 2PVBA 1IQ5A 1JSAA 1BF5A 1M45A 1SMGA 3O4YA 5GQQC 1S36A 2NCPA 1LKJA 4YGCB 3I5HB 2OS8C 3DD4A 2BBMA 1DTLA 4GFTA 2K61A 3SG7A 1OZOA 2ZRSA 4QJ3B 1BMOA 4PE4A 4WRIA 1S1EA 4C0JA 1Y6WA 2AAOA 2JT8A 2BE4A 5JOLA 1KSOA 2E30A 2KAXA 2GGMA 1YUSA 2LV7A 5AXIA 1DT7B 3A4UB 2CNPA 4HRGA 1NCYA 3LCPC 1L7ZA 1CTRA 4CPVA 5AERA 2F2OA 3D0YA 1TTXA 1QX5B 5DKNA 1SYMA 1C07A 1F54A 5HLVA 1BOCA 5D7FA 1KFUS 1B8RA 5HLOA 1CKKA 3LK0A 1F70A 1NX1A 2K0JA 1ZACA 1KFXL 3DF0B 1K9PA 1H4BA 2KQYA 1QTXA 4QJ5B 2M29A 1AHRA 1K95A 4NDDA 4MVFA 1J7RA 4NQGA 3NSLA 2RGIA 1KQVA 1NUBA 4ETOA 4MLWA 1XFUO 2QPTA 2Y5IA 1IJ5A 3JTDC 2K7CA 1G8IA 2JT0A 3EKHA 2HQWA 2JTTA 4L9MA 2LE9B 5DKQA 2HPSA 2EHBA 2L4HA 4AOMA 2KOTA 1G4YR 2ZNDA 1AJ5A 1OZSA 1PSRA 5J3XA 4DS7A 1NX2A 1OMVA 3O2PA 1BR1B 3WHUB 2JXCA 1SKTA 1ZFSA 1S26D 1YURA 4HSZA 1KQMC 3I5GC 1XA5A 2HETA 4R1EA 3DVJA 1XFWO 4OKHA 2LNKA 4XYNA 1MXEA 1LXFC 3NXAA 1CFFA 1PRWA 2LVKA 3D0YB 1W7IB 1WLZA 3TDIA 2KAVA 2WORA 1IG5A 3DVMA 1QASA 4PCWA 4HREE 1KFUL 1QVIZ 2BCXA 2H61A 4CLNA 3BQ3A 2M3WA 1K9UA 3DVEA 1GGWA 1A75A 3CWGA 1CB1A 1DJIA 2EC6B 3TS5C 1TRFA 2F2PA 1BR4B 1DJWA 2PALA 3E3RA 2KGRA 2L5XB 2NCOA 3ZWHA 1F4QA 3AAKA 1QXPA 2LHIA 2WC8A 2NLNA 5DKRA 5KU1A 5KTYA 1CM4A 1KK8C 4HRHA 1SL7A 1OOJA 1CLLA 1CFPA 3PN7B 2M7NA 3VGOA 2O5GA 1J7QA 1B7TZ 1UUSA 3CGAA 1NWDA 3FWCA 1WRLA 3HX4A 1L2OB 2LHLA 1Q80A 2JPTA 1NX0A 1TIZA 1OQPA 2KFHA 1JC2A 2L2EA 1K9KA 2BBNA 2FCDA 3RLZA 1YVHA 4C0KA 4OVNF 5CSIA 3HCMA 1F55A 1QVIY 1AUIB 1SRAA 3BOWA 4GUKA 3VRPA 5K89A 1SR6C 4YGAA 2LVJA 3CR2A 4MN0A 2WOSA 1AK8A 3EVUA 4M2QA 1DMOA 2M1KB 1VRKA 3CS1A 3C1VA 2G9BA 5CSFA 1U5IB 4JQ0D 5KSZA 1CNPA 1B4CA 1FPWA 1B7TY 2M97A 1SNLA 1R2UA 2F8PA 2LMTA 3KO0A 4PE0A 1YTZC 1XFXO 3EK8A 2LM5A 1WDCB 3MSEB 3DF0A 3GK2A 3H4SE 1QX2A 1J7PA 1J7OA 1J1EA 2R2IA 1KWOC 3NSIA 3WHTB 1NCXA 1UP5A 2QACA 2JXLA 1MR8A 2NZ0A 1PVAA 1JFKA 2HQ8A 2KFGA 1PK0D 4GPLB 2OTGC 5JJGA 1FI6A 2OS8B 1LA0A 2Q4UA 3KF9A 1A29A 5TNCA 4UPGA 1K2HA 4MZJA 2LUXA 3QRXA 1RTP1 2NXQA 1IQ3A 2JNFA 3SG4A 1XVJA 3BOWB 2ISDA 1J55A 3GOFA 3SG3A 1DJXA 1RK9A 3A8RA 1NYAA 1YX7A 2LUCA 3M0WA 4PHJA 2DOQA 1K93D 3CR4X 3CLNA 1XO5A 2LC5A 2JZIA 2LP3A 1BT6A 3GK1A 1YRTB 1TNXA 3KPXA 2BKHB 3AKBA 2PMYA 2IS9A 4MZKA 2K2FA 1B8LA 4TNCA 3JTDB 1CLBA 2WCFA 3I5IC 1NIWA 1TCFA 1B47A 2KSPA 3SG5A 1EG3A 1XK4C 2KI4C 4CFRA 3GK4X 4DRWA 1OMRA 3TUYC 1F71A 2VRGA 2Y1MA 1DVIA 1OMDA 1TOPA 2GV5A 5AFPA 1HQVA 4ORCB 2LCPA 5FYXA 3BXKA 4WQ2A 3I5FC 1GGZA 3IQOA 1KQMB 1UHIA 4OV2A 3VRQA 3I5GB 3PALA 2LMVA 1A03A 1PSBA 4PE1A 2M1UA 2L51A 2FCEA 3SJSA 1Y1AA 2K8MB 1LA3A 1K90D 1LINA 1R6PA 2ZRTA 4MRYA 2CBLA 4PHKA 5I2LA 3CR5X 1BLQA 4YGDB 4PHMA 1U5IA 1FI5A 1OSAA 2G2BA 3OX5A 1BG1A 4M2PA 1SL8A 4OR9B 3TS5B 3IQQA 1MXLC 1QATA 2KBIA 4GGNA 1WY9A 1CDPA 2FOTA 3BUOB 1TNWA 1DJYA 3LL8B 4XJKA 3VRRA 1SPYA 1KK8B 1FBVA 1B9AA 2I7AA 3WNXB 2AMIA 4PE7A 2JNXA 1RJVA 2JT3A 3EVVA 2ZN8A 2MLEC 5CPVA 5I8NA 3BYAA 1CFDA 1F8HA 4A4CA 2MRDA 1SW8A 1N65A 1TCOB 1YUTA 2I94A 1KSMA 2ZFDA 1DF0A 1QIVA 2MHHA 2LMUA 1LVCD 3EK4A 1C7WA 4ICBA 2JRFA 1DJZA 2L0PA 2EGDA 2M8UA 2WCBA 4PALA 3FWBA 5AANA 1DGVA 1SR6B 3DVKA 2K7OA 2ZKMX 4MEWA 4ZCUA 4I5LB 4YRUA 5ER5A 4CIDA 1SL9A 2LLSA 1S6IA 1V1GA 2MJWB 4GNKB 3OB1B 4ORAB 1ALWA 2JOJA 1D1OA 5D69A 2FJUB 3KHEA 1NP8A 2KI6C 1IKUA 3RM1A 2KAYA 3TDUA 1WRZA 1CLMA 2MLFC 1NSHA 4GGFC 1M31A 3BUXB 3EK7A 4YI9A 1JBAA 2KYCA 4XJKB 3K21A 1QV1A 1SCVA 1Y0VH 1G33A 1YRUB 5HKWA 3SIAA 1NPQA 1UURA 1ALVA 1KWOB 2P6BB 3SG2A 2PSRA 1JFJA 1QLSA 4GBAA 1NX3A 2Y1NA 3JVTC 4AQJA 1JWDA 3NSKA 2OTGB 1DJHA 1XK4A 1KK7Z 4BY4A 2O60A 2AUCA 4DCKA 1DF0B 1GJYA 1SCMC 1PVBA 1EL4A 1UWOA 3EKJA 2JWWA 4WQ3A 2BCAA 2CXJA 2BCBA 1XFZO 1DGUA 3PM8A 1QX7A 1JF2A 1AP4A 2JULA 1N2DA 4E68A 1EXRA 1AVSA 4AQIA 1PULA 4N1GA 1A2XA 1K96A 1TN4A 4F0ZB 1CMFA 4MBEA 4NDCA 1BODA 1UHJA 2CT9A 1FW4A 1YR5A 2LVVA 4IL1A 4MRXA 3I5HC 3BUMB 4MZLA 3VROA 2JQ6A 1EG4A 2SASA 1BJFA 1S5GZ 2LP2A 3LK1A 5F6TA 1CDLA 2BECA 2I18A 1IJ6A 1MQ1A 4PHNA 1M39A 1YVLA 1QV0A 2KGBC 4M2OA 2MA2A 2OPOA 5G08A 1KK7Y 1XFYO 2M7LA 2LVIA 1CFCA 1Y1XA 1QIWA 1N0YA 1B1GA 5B8IB 2L98A 3TDZA 1A4PA 1XFVO 5HYDA 1IRJA 2F3YA 1IH0A 1SK6D 4QJ4B 3I5IB 2MAZA 2ZNEA 1RECA 1J1DA 2D8NA 2JU0A 1E8AA 2KI4B 3TUYB 4N5XA 5HKYA 3AKAA 2KI6D 3NSOA 2LLTA 2M9GA 1W7JB 3VRNA 4FQOA 4NDBA 1RFJA 1BU3A 5I2OA 4YI8A 4USLA 3I5FB 4OCIA 1YX8A 1FF1A 2K2AA 1CMGA 4JPZB 1S5GY 1C7VA 5CSJA 2CTNA 1UHHA 4DUQA 5AEQA 4I5NB 1RWYA 1SBJA 4ZCVA 2KHNA 2CCMA 1MWNA 1M63B 4BY5A 5PALA 4JWQA 3SIBA 1K8UA 3SG6A 1CM1A 1XYDA 4P5OE 1K94A 2K7DA 4P2YB 2LANA 2GGZA 2V53A 3LLEA 2F33A 1MUXA 1B8CA 4PDZA 4GGFA 1IGVA 3O78A 1H8BA 1X02A 3CTNA 1Y1UA 2M49B 1NCZA 3PLFB 1ZUZA 1RROA 2Q91A 2HF5A 2KFFA 3O6BA 5HKZA 2Y4QA 3ICBA 3EVRA 2B1UA 4U8DA 2MBXA 1DJGA 1CDMA 4YGBB 2JC2A 2L4IA 3WXAA 1EJ3A 2BE6A 3OP0A 4GAOA 1QJTA 1PALA 2I2RE 3D10A 2H2KA 1MHOA 1TNPA 4DIRA 2EC6C 1ODBA 5BPJA 2ZN9A 1QS7A 1IWQA 1S6CA 2BL0B 4N1FA 4D1EA 1KCYA 2BL0C 2K7BA 2KDHA 1MF8B 1QLKA 4Q04A 5IBWA 2KNEA 3TZ1A 2A4JA 4ORBB 4I5JA 3PN7C 1S3PA 3OX6A 1WRKA 3BUWB 1WLMA 1L2OC 1V1FA 3PATA 4I5KA 4YGEB 5I2QA 4CFQA 2TN4A 4FTGA 5CSNA 2E6WA 1YUUA 3OHMB 4A4BA 1UHKA 3ZNIA 1GQMA 2PASA 3BUNB 3AAJA 3FIAA 1OE9B 3JVTB 2PRUA 3F45A 1ZMZA 1SY9A 1JUOA 1S6JA 2JTZA 2WNDA 1F4OA 2KBMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LLU A;  3CZT X;  2KYF A;  4MSP A;  2L50 A;  1SCM B;  2BKI B;  3PFV A;  3OB2 B;  1ZOT B;  2KQ6 A;  2H61 C;  3FS7 A;  1A75 B;  1JF0 A;  1CDN A;  1M46 A;  2M0R A;  3PSR A;  2SCP A;  1UHN A;  4YBH B;  2COL B;  2F3Z A;  2WCE A;  1KFX S;  1AJ4 A;  1WDC C;  3KEV A;  1EH2 A;  1TNQ A;  5ER4 X;  3IF7 A;  2LAP A;  4C0L A;  1HT9 A;  2PVB A;  1IQ5 A;  1JSA A;  1BF5 A;  1M45 A;  1SMG A;  3O4Y A;  5GQQ C;  1S36 A;  2NCP A;  1LKJ A;  4YGC B;  3I5H B;  2OS8 C;  3DD4 A;  2BBM A;  1DTL A;  4GFT A;  2K61 A;  3SG7 A;  1OZO A;  2ZRS A;  4QJ3 B;  1BMO A;  4PE4 A;  4WRI A;  1S1E A;  4C0J A;  1Y6W A;  2AAO A;  2JT8 A;  2BE4 A;  5JOL A;  1KSO A;  2E30 A;  2KAX A;  2GGM A;  1YUS A;  2LV7 A;  5AXI A;  1DT7 B;  3A4U B;  2CNP A;  4HRG A;  1NCY A;  3LCP C;  1L7Z A;  1CTR A;  4CPV A;  5AER A;  2F2O A;  3D0Y A;  1TTX A;  1QX5 B;  5DKN A;  1SYM A;  1C07 A;  1F54 A;  5HLV A;  1BOC A;  5D7F A;  1KFU S;  1B8R A;  5HLO A;  1CKK A;  3LK0 A;  1F70 A;  1NX1 A;  2K0J A;  1ZAC A;  1KFX L;  3DF0 B;  1K9P A;  1H4B A;  2KQY A;  1QTX A;  4QJ5 B;  2M29 A;  1AHR A;  1K95 A;  4NDD A;  4MVF A;  1J7R A;  4NQG A;  3NSL A;  2RGI A;  1KQV A;  1NUB A;  4ETO A;  4MLW A;  1XFU O;  2QPT A;  2Y5I A;  1IJ5 A;  3JTD C;  2K7C A;  1G8I A;  2JT0 A;  3EKH A;  2HQW A;  2JTT A;  4L9M A;  2LE9 B;  5DKQ A;  2HPS A;  2EHB A;  2L4H A;  4AOM A;  2KOT A;  1G4Y R;  2ZND A;  1AJ5 A;  1OZS A;  1PSR A;  5J3X A;  4DS7 A;  1NX2 A;  1OMV A;  3O2P A;  1BR1 B;  3WHU B;  2JXC A;  1SKT A;  1ZFS A;  1S26 D;  1YUR A;  4HSZ A;  1KQM C;  3I5G C;  1XA5 A;  2HET A;  4R1E A;  3DVJ A;  1XFW O;  4OKH A;  2LNK A;  4XYN A;  1MXE A;  1LXF C;  3NXA A;  1CFF A;  1PRW A;  2LVK A;  3D0Y B;  1W7I B;  1WLZ A;  3TDI A;  2KAV A;  2WOR A;  1IG5 A;  3DVM A;  1QAS A;  4PCW A;  4HRE E;  1KFU L;  1QVI Z;  2BCX A;  2H61 A;  4CLN A;  3BQ3 A;  2M3W A;  1K9U A;  3DVE A;  1GGW A;  1A75 A;  3CWG A;  1CB1 A;  1DJI A;  2EC6 B;  3TS5 C;  1TRF A;  2F2P A;  1BR4 B;  1DJW A;  2PAL A;  3E3R A;  2KGR A;  2L5X B;  2NCO A;  3ZWH A;  1F4Q A;  3AAK A;  1QXP A;  2LHI A;  2WC8 A;  2NLN A;  5DKR A;  5KU1 A;  5KTY A;  1CM4 A;  1KK8 C;  4HRH A;  1SL7 A;  1OOJ A;  1CLL A;  1CFP A;  3PN7 B;  2M7N A;  3VGO A;  2O5G A;  1J7Q A;  1B7T Z;  1UUS A;  3CGA A;  1NWD A;  3FWC A;  1WRL A;  3HX4 A;  1L2O B;  2LHL A;  1Q80 A;  2JPT A;  1NX0 A;  1TIZ A;  1OQP A;  2KFH A;  1JC2 A;  2L2E A;  1K9K A;  2BBN A;  2FCD A;  3RLZ A;  1YVH A;  4C0K A;  4OVN F;  5CSI A;  3HCM A;  1F55 A;  1QVI Y;  1AUI B;  1SRA A;  3BOW A;  4GUK A;  3VRP A;  5K89 A;  1SR6 C;  4YGA A;  2LVJ A;  3CR2 A;  4MN0 A;  2WOS A;  1AK8 A;  3EVU A;  4M2Q A;  1DMO A;  2M1K B;  1VRK A;  3CS1 A;  3C1V A;  2G9B A;  5CSF A;  1U5I B;  4JQ0 D;  5KSZ A;  1CNP A;  1B4C A;  1FPW A;  1B7T Y;  2M97 A;  1SNL A;  1R2U A;  2F8P A;  2LMT A;  3KO0 A;  4PE0 A;  1YTZ C;  1XFX O;  3EK8 A;  2LM5 A;  1WDC B;  3MSE B;  3DF0 A;  3GK2 A;  3H4S E;  1QX2 A;  1J7P A;  1J7O A;  1J1E A;  2R2I A;  1KWO C;  3NSI A;  3WHT B;  1NCX A;  1UP5 A;  2QAC A;  2JXL A;  1MR8 A;  2NZ0 A;  1PVA A;  1JFK A;  2HQ8 A;  2KFG A;  1PK0 D;  4GPL B;  2OTG C;  5JJG A;  1FI6 A;  2OS8 B;  1LA0 A;  2Q4U A;  3KF9 A;  1A29 A;  5TNC A;  4UPG A;  1K2H A;  4MZJ A;  2LUX A;  3QRX A;  1RTP 1;  2NXQ A;  1IQ3 A;  2JNF A;  3SG4 A;  1XVJ A;  3BOW B;  2ISD A;  1J55 A;  3GOF A;  3SG3 A;  1DJX A;  1RK9 A;  3A8R A;  1NYA A;  1YX7 A;  2LUC A;  3M0W A;  4PHJ A;  2DOQ A;  1K93 D;  3CR4 X;  3CLN A;  1XO5 A;  2LC5 A;  2JZI A;  2LP3 A;  1BT6 A;  3GK1 A;  1YRT B;  1TNX A;  3KPX A;  2BKH B;  3AKB A;  2PMY A;  2IS9 A;  4MZK A;  2K2F A;  1B8L A;  4TNC A;  3JTD B;  1CLB A;  2WCF A;  3I5I C;  1NIW A;  1TCF A;  1B47 A;  2KSP A;  3SG5 A;  1EG3 A;  1XK4 C;  2KI4 C;  4CFR A;  3GK4 X;  4DRW A;  1OMR A;  3TUY C;  1F71 A;  2VRG A;  2Y1M A;  1DVI A;  1OMD A;  1TOP A;  2GV5 A;  5AFP A;  1HQV A;  4ORC B;  2LCP A;  5FYX A;  3BXK A;  4WQ2 A;  3I5F C;  1GGZ A;  3IQO A;  1KQM B;  1UHI A;  4OV2 A;  3VRQ A;  3I5G B;  3PAL A;  2LMV A;  1A03 A;  1PSB A;  4PE1 A;  2M1U A;  2L51 A;  2FCE A;  3SJS A;  1Y1A A;  2K8M B;  1LA3 A;  1K90 D;  1LIN A;  1R6P A;  2ZRT A;  4MRY A;  2CBL A;  4PHK A;  5I2L A;  3CR5 X;  1BLQ A;  4YGD B;  4PHM A;  1U5I A;  1FI5 A;  1OSA A;  2G2B A;  3OX5 A;  1BG1 A;  4M2P A;  1SL8 A;  4OR9 B;  3TS5 B;  3IQQ A;  1MXL C;  1QAT A;  2KBI A;  4GGN A;  1WY9 A;  1CDP A;  2FOT A;  3BUO B;  1TNW A;  1DJY A;  3LL8 B;  4XJK A;  3VRR A;  1SPY A;  1KK8 B;  1FBV A;  1B9A A;  2I7A A;  3WNX B;  2AMI A;  4PE7 A;  2JNX A;  1RJV A;  2JT3 A;  3EVV A;  2ZN8 A;  2MLE C;  5CPV A;  5I8N A;  3BYA A;  1CFD A;  1F8H A;  4A4C A;  2MRD A;  1SW8 A;  1N65 A;  1TCO B;  1YUT A;  2I94 A;  1KSM A;  2ZFD A;  1DF0 A;  1QIV A;  2MHH A;  2LMU A;  1LVC D;  3EK4 A;  1C7W A;  4ICB A;  2JRF A;  1DJZ A;  2L0P A;  2EGD A;  2M8U A;  2WCB A;  4PAL A;  3FWB A;  5AAN A;  1DGV A;  1SR6 B;  3DVK A;  2K7O A;  2ZKM X;  4MEW A;  4ZCU A;  4I5L B;  4YRU A;  5ER5 A;  4CID A;  1SL9 A;  2LLS A;  1S6I A;  1V1G A;  2MJW B;  4GNK B;  3OB1 B;  4ORA B;  1ALW A;  2JOJ A;  1D1O A;  5D69 A;  2FJU B;  3KHE A;  1NP8 A;  2KI6 C;  1IKU A;  3RM1 A;  2KAY A;  3TDU A;  1WRZ A;  1CLM A;  2MLF C;  1NSH A;  4GGF C;  1M31 A;  3BUX B;  3EK7 A;  4YI9 A;  1JBA A;  2KYC A;  4XJK B;  3K21 A;  1QV1 A;  1SCV A;  1Y0V H;  1G33 A;  1YRU B;  5HKW A;  3SIA A;  1NPQ A;  1UUR A;  1ALV A;  1KWO B;  2P6B B;  3SG2 A;  2PSR A;  1JFJ A;  1QLS A;  4GBA A;  1NX3 A;  2Y1N A;  3JVT C;  4AQJ A;  1JWD A;  3NSK A;  2OTG B;  1DJH A;  1XK4 A;  1KK7 Z;  4BY4 A;  2O60 A;  2AUC A;  4DCK A;  1DF0 B;  1GJY A;  1SCM C;  1PVB A;  1EL4 A;  1UWO A;  3EKJ A;  2JWW A;  4WQ3 A;  2BCA A;  2CXJ A;  2BCB A;  1XFZ O;  1DGU A;  3PM8 A;  1QX7 A;  1JF2 A;  1AP4 A;  2JUL A;  1N2D A;  4E68 A;  1EXR A;  1AVS A;  4AQI A;  1PUL A;  4N1G A;  1A2X A;  1K96 A;  1TN4 A;  4F0Z B;  1CMF A;  4MBE A;  4NDC A;  1BOD A;  1UHJ A;  2CT9 A;  1FW4 A;  1YR5 A;  2LVV A;  4IL1 A;  4MRX A;  3I5H C;  3BUM B;  4MZL A;  3VRO A;  2JQ6 A;  1EG4 A;  2SAS A;  1BJF A;  1S5G Z;  2LP2 A;  3LK1 A;  5F6T A;  1CDL A;  2BEC A;  2I18 A;  1IJ6 A;  1MQ1 A;  4PHN A;  1M39 A;  1YVL A;  1QV0 A;  2KGB C;  4M2O A;  2MA2 A;  2OPO A;  5G08 A;  1KK7 Y;  1XFY O;  2M7L A;  2LVI A;  1CFC A;  1Y1X A;  1QIW A;  1N0Y A;  1B1G A;  5B8I B;  2L98 A;  3TDZ A;  1A4P A;  1XFV O;  5HYD A;  1IRJ A;  2F3Y A;  1IH0 A;  1SK6 D;  4QJ4 B;  3I5I B;  2MAZ A;  2ZNE A;  1REC A;  1J1D A;  2D8N A;  2JU0 A;  1E8A A;  2KI4 B;  3TUY B;  4N5X A;  5HKY A;  3AKA A;  2KI6 D;  3NSO A;  2LLT A;  2M9G A;  1W7J B;  3VRN A;  4FQO A;  4NDB A;  1RFJ A;  1BU3 A;  5I2O A;  4YI8 A;  4USL A;  3I5F B;  4OCI A;  1YX8 A;  1FF1 A;  2K2A A;  1CMG A;  4JPZ B;  1S5G Y;  1C7V A;  5CSJ A;  2CTN A;  1UHH A;  4DUQ A;  5AEQ A;  4I5N B;  1RWY A;  1SBJ A;  4ZCV A;  2KHN A;  2CCM A;  1MWN A;  1M63 B;  4BY5 A;  5PAL A;  4JWQ A;  3SIB A;  1K8U A;  3SG6 A;  1CM1 A;  1XYD A;  4P5O E;  1K94 A;  2K7D A;  4P2Y B;  2LAN A;  2GGZ A;  2V53 A;  3LLE A;  2F33 A;  1MUX A;  1B8C A;  4PDZ A;  4GGF A;  1IGV A;  3O78 A;  1H8B A;  1X02 A;  3CTN A;  1Y1U A;  2M49 B;  1NCZ A;  3PLF B;  1ZUZ A;  1RRO A;  2Q91 A;  2HF5 A;  2KFF A;  3O6B A;  5HKZ A;  2Y4Q A;  3ICB A;  3EVR A;  2B1U A;  4U8D A;  2MBX A;  1DJG A;  1CDM A;  4YGB B;  2JC2 A;  2L4I A;  3WXA A;  1EJ3 A;  2BE6 A;  3OP0 A;  4GAO A;  1QJT A;  1PAL A;  2I2R E;  3D10 A;  2H2K A;  1MHO A;  1TNP A;  4DIR A;  2EC6 C;  1ODB A;  5BPJ A;  2ZN9 A;  1QS7 A;  1IWQ A;  1S6C A;  2BL0 B;  4N1F A;  4D1E A;  1KCY A;  2BL0 C;  2K7B A;  2KDH A;  1MF8 B;  1QLK A;  4Q04 A;  5IBW A;  2KNE A;  3TZ1 A;  2A4J A;  4ORB B;  4I5J A;  3PN7 C;  1S3P A;  3OX6 A;  1WRK A;  3BUW B;  1WLM A;  1L2O C;  1V1F A;  3PAT A;  4I5K A;  4YGE B;  5I2Q A;  4CFQ A;  2TN4 A;  4FTG A;  5CSN A;  2E6W A;  1YUU A;  3OHM B;  4A4B A;  1UHK A;  3ZNI A;  1GQM A;  2PAS A;  3BUN B;  3AAJ A;  3FIA A;  1OE9 B;  3JVT B;  2PRU A;  3F45 A;  1ZMZ A;  1SY9 A;  1JUO A;  1S6J A;  2JTZ A;  2WND A;  1F4O A;  2KBM A; 
#chains in the Genus database with same CATH topology
 2LLU A;  3CZT X;  2KYF A;  4MSP A;  2L50 A;  1SCM B;  2BKI B;  3PFV A;  3OB2 B;  1ZOT B;  2KQ6 A;  2H61 C;  2H8V A;  3FS7 A;  1A75 B;  1JF0 A;  4JKT A;  1CDN A;  1M46 A;  2M0R A;  3PSR A;  2SCP A;  1UHN A;  4YBH B;  1QWV A;  2COL B;  2F3Z A;  2WCE A;  1KFX S;  1AJ4 A;  1WDC C;  3KEV A;  1EH2 A;  1TNQ A;  5ER4 X;  3IF7 A;  2LAP A;  4C0L A;  1HT9 A;  2PVB A;  1IQ5 A;  1JSA A;  1BF5 A;  1M45 A;  1SMG A;  3O4Y A;  5GQQ C;  1S36 A;  2NCP A;  1LKJ A;  3D73 A;  2QEH A;  4YGC B;  3I5H B;  2OS8 C;  3DD4 A;  2BBM A;  1DTL A;  4GFT A;  2K61 A;  3SG7 A;  1OZO A;  2ZRS A;  4QJ3 B;  1BMO A;  4PE4 A;  4WRI A;  1S1E A;  4C0J A;  1Z4H A;  1Y6W A;  2AAO A;  2JT8 A;  2BE4 A;  5JOL A;  1KSO A;  2E30 A;  2KAX A;  2GGM A;  1LS8 A;  1YUS A;  2LV7 A;  2PQL A;  5D3O A;  5AXI A;  1DT7 B;  3A4U B;  2CNP A;  4HRG A;  1NCY A;  3LCP C;  1L7Z A;  1CTR A;  4CPV A;  5AER A;  2F2O A;  3D0Y A;  1TTX A;  1QX5 B;  2WCK A;  1SYM A;  2YGU A;  1OOF A;  5DKN A;  3BFH A;  5HLV A;  1C07 A;  1BOC A;  1F54 A;  5D7F A;  1KFU S;  1B8R A;  5HLO A;  1CKK A;  3LK0 A;  1F70 A;  1NX1 A;  2K0J A;  1ZAC A;  1KFX L;  3DF0 B;  1K9P A;  1H4B A;  2FJY A;  2KQY A;  1QTX A;  4QJ5 B;  2M29 A;  1AHR A;  2WC5 A;  1K95 A;  4NDD A;  4MVF A;  1J7R A;  4NQG A;  3NSL A;  5FI6 A;  4KYN A;  2RGI A;  1KQV A;  2WC6 A;  1NUB A;  4ETO A;  4MLW A;  1XFU O;  2QPT A;  2Y5I A;  1IJ5 A;  3JTD C;  2QEB A;  2K7C A;  1G8I A;  2JT0 A;  3EKH A;  2HQW A;  2JTT A;  2L2C A;  1ORG A;  4L9M A;  1DQE A;  2LE9 B;  5DKQ A;  2HPS A;  2EHB A;  2L4H A;  4AOM A;  2KOT A;  1G4Y R;  2ZND A;  1AJ5 A;  1OZS A;  1PSR A;  5J3X A;  3SS3 A;  4DS7 A;  1NX2 A;  1OMV A;  3O2P A;  1BR1 B;  3WHU B;  2JXC A;  1SKT A;  1ZFS A;  1S26 D;  1YUR A;  4HSZ A;  1KQM C;  3I5G C;  1XA5 A;  2HET A;  4R1E A;  3DVJ A;  1XFW O;  4OKH A;  2LNK A;  4XYN A;  1MXE A;  1LXF C;  3R1O A;  3NXA A;  1CFF A;  4F7F A;  1PRW A;  2LVK A;  3D0Y B;  3DZT A;  1W7I B;  1WLZ A;  3TDI A;  2KAV A;  2WOR A;  1IG5 A;  3DVM A;  1QAS A;  4PCW A;  4HRE E;  1KFU L;  1QVI Z;  2BCX A;  2H61 A;  4CLN A;  3BQ3 A;  2M3W A;  1K9U A;  3DVE A;  1GGW A;  1A75 A;  2WCJ A;  3CWG A;  1DJI A;  2EC6 B;  1CB1 A;  3TS5 C;  1TRF A;  2F2P A;  1BR4 B;  1DJW A;  2PAL A;  3E3R A;  2KGR A;  2L5X B;  2NCO A;  3ZWH A;  1F4Q A;  3AAK A;  1QXP A;  2LHI A;  2WC8 A;  2NLN A;  5DKR A;  5KU1 A;  5KTY A;  1CM4 A;  3S0B A;  1KK8 C;  4HRH A;  1SL7 A;  1OOJ A;  1CLL A;  1CFP A;  3PN7 B;  2M7N A;  3VGO A;  2O5G A;  1J7Q A;  1B7T Z;  1UUS A;  3CGA A;  1NWD A;  3FWC A;  1WRL A;  2L5Y A;  3HX4 A;  1L2O B;  2LHL A;  5DIC A;  1Q80 A;  3NHI A;  2JPT A;  1NX0 A;  1TIZ A;  1OQP A;  1OOH A;  2KFH A;  1JC2 A;  2L2E A;  1K9K A;  2BBN A;  2K60 A;  2FCD A;  3RLZ A;  1YVH A;  3VB1 A;  4C0K A;  4OVN F;  5CSI A;  3HCM A;  1F55 A;  1QVI Y;  1AUI B;  1SRA A;  3BOW A;  2QDI A;  4GUK A;  3VRP A;  5K89 A;  1SR6 C;  4YGA A;  2LVJ A;  3CR2 A;  4MN0 A;  2WOS A;  2KLE A;  1AK8 A;  3EVU A;  4M2Q A;  1DMO A;  2M1K B;  1VRK A;  3CS1 A;  3C1V A;  2G9B A;  5CSF A;  1U5I B;  4JQ0 D;  5KSZ A;  3FE8 A;  1CNP A;  2ERB A;  1B4C A;  1FPW A;  1B7T Y;  2M97 A;  1SNL A;  1R2U A;  2F8P A;  2LMT A;  3KO0 A;  4PE0 A;  1YTZ C;  1XFX O;  3D76 A;  3EK8 A;  2LM5 A;  1WDC B;  3MSE B;  3DF0 A;  3GK2 A;  3H4S E;  3S0A A;  1QX2 A;  1J7P A;  1J7O A;  1J1E A;  2R2I A;  1KWO C;  3NSI A;  3B6X A;  3RZS A;  3WHT B;  1NCX A;  1UP5 A;  2QAC A;  2JXL A;  1MR8 A;  2NZ0 A;  3K1E A;  1PVA A;  3EG5 B;  1JFK A;  2HQ8 A;  2KFG A;  1PK0 D;  4GPL B;  2OTG C;  5JJG A;  1FI6 A;  2OS8 B;  1LA0 A;  2P71 A;  2Q4U A;  3KF9 A;  1A29 A;  5TNC A;  4UPG A;  1K2H A;  1TWO A;  4MZJ A;  1OOI X;  2KPH A;  2LUX A;  3QRX A;  1RTP 1;  3PJI A;  3IVT A;  2NXQ A;  1IQ3 A;  2JNF A;  3SG4 A;  1XVJ A;  3BOW B;  3S0G A;  2ISD A;  1J55 A;  3GOF A;  3L4L A;  3SG3 A;  1DJX A;  1RK9 A;  3A8R A;  1NYA A;  1YX7 A;  2LUC A;  2WCL A;  3M0W A;  1TUZ A;  3R72 A;  4PHJ A;  2DOQ A;  1K93 D;  1T14 A;  1DC1 A;  3CR4 X;  3CLN A;  3B86 A;  1XO5 A;  2LC5 A;  2JZI A;  2LP3 A;  1BT6 A;  3GK1 A;  1YRT B;  5FI7 A;  1TNX A;  3KPX A;  2BKH B;  3AKB A;  2PMY A;  2IS9 A;  4MZK A;  2K2F A;  1B8L A;  4TNC A;  3CAB A;  3JTD B;  3B87 A;  1CLB A;  2WCF A;  3I5I C;  1NIW A;  1TCF A;  1B47 A;  2KSP A;  3SG5 A;  3L47 A;  1EG3 A;  1XK4 C;  2KI4 C;  3D78 A;  2PYQ A;  3GK4 X;  1OMR A;  4CFR A;  4DRW A;  3TUY C;  1F71 A;  2VRG A;  2Y1M A;  2BNX A;  1DVI A;  1OMD A;  1TOP A;  2GV5 A;  5AFP A;  1HQV A;  4ORC B;  2LCP A;  5FYX A;  3BXK A;  4WQ2 A;  3I5F C;  3CZ0 A;  1GGZ A;  3IQO A;  3PM2 A;  1KQM B;  1UHI A;  4OV2 A;  3VRQ A;  3I5G B;  3SS4 A;  3PAL A;  3N7H A;  3CYZ A;  2LMV A;  1A03 A;  1PSB A;  4PE1 A;  2M1U A;  2L51 A;  2FCE A;  3SJS A;  3SS5 A;  2P70 A;  2BAP A;  5HL1 A;  1Y1A A;  2K8M B;  1LA3 A;  1K90 D;  1LIN A;  1R6P A;  2ZRT A;  4MRY A;  1P28 A;  2CBL A;  4PHK A;  5I2L A;  3CR5 X;  1BLQ A;  4YGD B;  4PHM A;  1U5I A;  1FI5 A;  1TUJ A;  1OSA A;  2G2B A;  3OX5 A;  1BG1 A;  4INX A;  4M2P A;  1SL8 A;  4OR9 B;  3TS5 B;  3IQQ A;  1MXL C;  3OGN A;  1QAT A;  2KBI A;  4GGN A;  1WY9 A;  1CDP A;  2FOT A;  3BUO B;  3QME A;  1TNW A;  1DJY A;  3LL8 B;  4XJK A;  1DEK A;  3VRR A;  1SPY A;  3BJH A;  1KK8 B;  1FBV A;  1B9A A;  2I7A A;  3WNX B;  2AMI A;  3D77 A;  2JNX A;  1RJV A;  2JT3 A;  4PE7 A;  3EVV A;  5FI2 A;  2ZN8 A;  2MLE C;  5CPV A;  5I8N A;  3BYA A;  1CFD A;  2QEO A;  1F8H A;  4A4C A;  2MRD A;  1SW8 A;  3D75 A;  1N65 A;  1TCO B;  1YUT A;  2I94 A;  3NGV A;  1KSM A;  2ZFD A;  1DF0 A;  1QIV A;  2MHH A;  2LMU A;  1LVC D;  3EK4 A;  1W9Z A;  1C7W A;  4ICB A;  2JRF A;  1DJZ A;  2L0P A;  2EGD A;  2M8U A;  2WCB A;  5F6T A;  4PAL A;  3FWB A;  5AAN A;  1DGV A;  1SR6 B;  3DVK A;  2K7O A;  2ZKM X;  4MEW A;  4ZCU A;  4I5L B;  4YRU A;  3NHT A;  5ER5 A;  4CID A;  1SL9 A;  2LLS A;  3V2L A;  1S6I A;  1V1G A;  2MJW B;  4GNK B;  3OB1 B;  1GM0 A;  4ORA B;  1ALW A;  2JOJ A;  1D1O A;  5D69 A;  3OBV A;  2FJU B;  3KHE A;  1NP8 A;  2KI6 C;  3L4A A;  3RM1 A;  2KAY A;  1IKU A;  3TDU A;  1OW4 A;  1WRZ A;  1CLM A;  2MLF C;  1NSH A;  4GGF C;  1C3Y A;  1M31 A;  3BUX B;  3EK7 A;  4INW A;  4YI9 A;  1JBA A;  2KYC A;  4XJK B;  3K21 A;  1QV1 A;  1SCV A;  1Y0V H;  1G33 A;  1YRU B;  5HKW A;  3SIA A;  1NPQ A;  1UUR A;  1ALV A;  1KWO B;  2P6B B;  3SG2 A;  2PSR A;  1SSE B;  1JFJ A;  1QLS A;  4GBA A;  1NX3 A;  2Y1N A;  3JVT C;  4AQJ A;  1JWD A;  3NSK A;  2OTG B;  3CZ2 A;  1DJH A;  1XK4 A;  1KK7 Z;  4BY4 A;  2O60 A;  2AUC A;  4DCK A;  1DF0 B;  1GJY A;  1SCM C;  1PVB A;  1EL4 A;  1UWO A;  3EKJ A;  2JWW A;  4WQ3 A;  2BCA A;  2CXJ A;  2BCB A;  1XFZ O;  1DGU A;  3PM8 A;  1QX7 A;  1JF2 A;  1AP4 A;  2JUL A;  1N2D A;  4E68 A;  1XFR A;  1EXR A;  1AVS A;  4AQI A;  1PUL A;  4N1G A;  1A2X A;  1K96 A;  1TN4 A;  4F0Z B;  1CMF A;  4MBE A;  3S0F A;  4NDC A;  1BOD A;  1UHJ A;  2CT9 A;  1OOG A;  1FW4 A;  1YR5 A;  2LVV A;  2QEV A;  4IL1 A;  3I5H C;  3BUM B;  4MRX A;  4MZL A;  3VRO A;  2JQ6 A;  1EG4 A;  2SAS A;  1BJF A;  1S5G Z;  2LP2 A;  3LK1 A;  5EL2 A;  1CDL A;  2BEC A;  2I18 A;  3UO9 A;  1IJ6 A;  1MQ1 A;  4PHN A;  1M39 A;  1YVL A;  1QV0 A;  2KGB C;  4M2O A;  2MA2 A;  2OPO A;  5G08 A;  1KK7 Y;  1XFY O;  2M7L A;  2LVI A;  3FE6 A;  1CFC A;  1Y1X A;  1QIW A;  1N0Y A;  1B1G A;  5B8I B;  2L98 A;  3TDZ A;  1A4P A;  3S0D A;  1XFV O;  5HYD A;  1IRJ A;  2F3Y A;  1IH0 A;  1SK6 D;  4QJ4 B;  3I5I B;  2MAZ A;  2ZNE A;  1REC A;  3B88 A;  1J1D A;  2D8N A;  2JU0 A;  1E8A A;  2KI4 B;  3TUY B;  4N5X A;  3UNW A;  5HKY A;  3AKA A;  3R1V A;  2KI6 D;  3NSO A;  2LLT A;  2M9G A;  1W7J B;  3VRN A;  4FQO A;  4NDB A;  1RFJ A;  1BU3 A;  5I2O A;  3BFA A;  4USL A;  4YI8 A;  3I5F B;  4OCI A;  3O4X A;  1YX8 A;  1FF1 A;  2K2A A;  1CMG A;  4JPZ B;  1S5G Y;  1C7V A;  5CSJ A;  2CTN A;  1UHH A;  3DYE A;  4DUQ A;  5AEQ A;  4JD9 A;  2WCH A;  1DEL A;  4I5N B;  1RWY A;  3FE9 A;  1SBJ A;  4ZCV A;  2KHN A;  2CCM A;  1MWN A;  1M63 B;  4BY5 A;  5PAL A;  4JWQ A;  3SIB A;  1K8U A;  3SG6 A;  1CM1 A;  1XYD A;  2GTE A;  4P5O E;  1K94 A;  2K7D A;  4P2Y B;  2LAN A;  2GGZ A;  2V53 A;  3LLE A;  2F33 A;  1MUX A;  1B8C A;  4PDZ A;  1Z2C B;  4GGF A;  1IGV A;  3O78 A;  1H8B A;  1X02 A;  3CTN A;  1Y1U A;  2WCM A;  2M49 B;  1NCZ A;  2JPO A;  1ZUZ A;  3PLF B;  1RRO A;  2Q91 A;  2HF5 A;  5I94 A;  2KFF A;  3O6B A;  5HKZ A;  3D74 A;  2Y4Q A;  3ICB A;  3EVR A;  2B1U A;  1C3Z A;  4U8D A;  2MBX A;  3CDN A;  1DJG A;  3BFB A;  1CDM A;  4YGB B;  2JC2 A;  2L4I A;  3WXA A;  1EJ3 A;  2BE6 A;  4IJ7 A;  4OZD A;  3OP0 A;  4GAO A;  1QJT A;  1PAL A;  2I2R E;  3D10 A;  2H2K A;  1MHO A;  1TNP A;  4DIR A;  2EC6 C;  1ODB A;  5BPJ A;  2ZN9 A;  1QS7 A;  1IWQ A;  1S6C A;  2BL0 B;  4N1F A;  4D1E A;  1KCY A;  2BL0 C;  2K7B A;  2KDH A;  4PT1 A;  1MF8 B;  1QLK A;  4Q04 A;  5IBW A;  3Q8I A;  2KNE A;  3R1P A;  2KLD A;  3TZ1 A;  2A4J A;  4ORB B;  4I5J A;  3PN7 C;  3CZ1 A;  3DY9 A;  1S3P A;  3OX6 A;  1WRK A;  3BUW B;  1WLM A;  1L2O C;  1V1F A;  3PAT A;  4I5K A;  4YGE B;  5I2Q A;  1IIO A;  4CFQ A;  3S0E A;  2TN4 A;  4FTG A;  5CSN A;  3B7A A;  2E6W A;  1YUU A;  3OHM B;  4A4B A;  3DXL A;  1UHK A;  3ZNI A;  1GQM A;  2PAS A;  3BUN B;  3AAJ A;  3FIA A;  1OE9 B;  3JVT B;  4FQT A;  2PRU A;  3F45 A;  1ZMZ A;  1SY9 A;  1JUO A;  1S6J A;  2JTZ A;  2WND A;  1F4O A;  2KBM A; 
#chains in the Genus database with same CATH homology
 2LLU A;  3CZT X;  2KYF A;  4MSP A;  2L50 A;  1SCM B;  2BKI B;  3PFV A;  3OB2 B;  1ZOT B;  2KQ6 A;  2H61 C;  3FS7 A;  1A75 B;  1JF0 A;  1CDN A;  1M46 A;  2M0R A;  3PSR A;  2SCP A;  1UHN A;  4YBH B;  2COL B;  2F3Z A;  2WCE A;  1KFX S;  1AJ4 A;  1WDC C;  3KEV A;  1EH2 A;  1TNQ A;  5ER4 X;  3IF7 A;  2LAP A;  4C0L A;  1HT9 A;  2PVB A;  1IQ5 A;  1JSA A;  1BF5 A;  1M45 A;  1SMG A;  3O4Y A;  5GQQ C;  1S36 A;  2NCP A;  1LKJ A;  4YGC B;  3I5H B;  2OS8 C;  3DD4 A;  2BBM A;  1DTL A;  4GFT A;  2K61 A;  3SG7 A;  1OZO A;  2ZRS A;  4QJ3 B;  1BMO A;  4PE4 A;  4WRI A;  1S1E A;  4C0J A;  1Y6W A;  2AAO A;  2JT8 A;  2BE4 A;  5JOL A;  1KSO A;  2E30 A;  2KAX A;  2GGM A;  1YUS A;  2LV7 A;  5AXI A;  1DT7 B;  3A4U B;  2CNP A;  4HRG A;  1NCY A;  3LCP C;  1L7Z A;  1CTR A;  4CPV A;  5AER A;  2F2O A;  3D0Y A;  1TTX A;  1QX5 B;  5DKN A;  1SYM A;  1C07 A;  1F54 A;  5HLV A;  1BOC A;  5D7F A;  1KFU S;  1B8R A;  5HLO A;  1CKK A;  3LK0 A;  1F70 A;  1NX1 A;  2K0J A;  1ZAC A;  1KFX L;  3DF0 B;  1K9P A;  1H4B A;  2KQY A;  1QTX A;  4QJ5 B;  2M29 A;  1AHR A;  1K95 A;  4NDD A;  4MVF A;  1J7R A;  4NQG A;  3NSL A;  2RGI A;  1KQV A;  1NUB A;  4ETO A;  4MLW A;  1XFU O;  2QPT A;  2Y5I A;  1IJ5 A;  3JTD C;  2K7C A;  1G8I A;  2JT0 A;  3EKH A;  2HQW A;  2JTT A;  4L9M A;  2LE9 B;  5DKQ A;  2HPS A;  2EHB A;  2L4H A;  4AOM A;  2KOT A;  1G4Y R;  2ZND A;  1AJ5 A;  1OZS A;  1PSR A;  5J3X A;  4DS7 A;  1NX2 A;  1OMV A;  3O2P A;  1BR1 B;  3WHU B;  2JXC A;  1SKT A;  1ZFS A;  1S26 D;  1YUR A;  4HSZ A;  1KQM C;  3I5G C;  1XA5 A;  2HET A;  4R1E A;  3DVJ A;  1XFW O;  4OKH A;  2LNK A;  4XYN A;  1MXE A;  1LXF C;  3NXA A;  1CFF A;  1PRW A;  2LVK A;  3D0Y B;  1W7I B;  1WLZ A;  3TDI A;  2KAV A;  2WOR A;  1IG5 A;  3DVM A;  1QAS A;  4PCW A;  4HRE E;  1KFU L;  1QVI Z;  2BCX A;  2H61 A;  4CLN A;  3BQ3 A;  2M3W A;  1K9U A;  3DVE A;  1GGW A;  1A75 A;  3CWG A;  1CB1 A;  1DJI A;  2EC6 B;  3TS5 C;  1TRF A;  2F2P A;  1BR4 B;  1DJW A;  2PAL A;  3E3R A;  2KGR A;  2L5X B;  2NCO A;  3ZWH A;  1F4Q A;  3AAK A;  1QXP A;  2LHI A;  2WC8 A;  2NLN A;  5DKR A;  5KU1 A;  5KTY A;  1CM4 A;  1KK8 C;  4HRH A;  1SL7 A;  1OOJ A;  1CLL A;  1CFP A;  3PN7 B;  2M7N A;  3VGO A;  2O5G A;  1J7Q A;  1B7T Z;  1UUS A;  3CGA A;  1NWD A;  3FWC A;  1WRL A;  3HX4 A;  1L2O B;  2LHL A;  1Q80 A;  2JPT A;  1NX0 A;  1TIZ A;  1OQP A;  2KFH A;  1JC2 A;  2L2E A;  1K9K A;  2BBN A;  2FCD A;  3RLZ A;  1YVH A;  4C0K A;  4OVN F;  5CSI A;  3HCM A;  1F55 A;  1QVI Y;  1AUI B;  1SRA A;  3BOW A;  4GUK A;  3VRP A;  5K89 A;  1SR6 C;  4YGA A;  2LVJ A;  3CR2 A;  4MN0 A;  2WOS A;  1AK8 A;  3EVU A;  4M2Q A;  1DMO A;  2M1K B;  1VRK A;  3CS1 A;  3C1V A;  2G9B A;  5CSF A;  1U5I B;  4JQ0 D;  5KSZ A;  1CNP A;  1B4C A;  1FPW A;  1B7T Y;  2M97 A;  1SNL A;  1R2U A;  2F8P A;  2LMT A;  3KO0 A;  4PE0 A;  1YTZ C;  1XFX O;  3EK8 A;  2LM5 A;  1WDC B;  3MSE B;  3DF0 A;  3GK2 A;  3H4S E;  1QX2 A;  1J7P A;  1J7O A;  1J1E A;  2R2I A;  1KWO C;  3NSI A;  3WHT B;  1NCX A;  1UP5 A;  2QAC A;  2JXL A;  1MR8 A;  2NZ0 A;  1PVA A;  1JFK A;  2HQ8 A;  2KFG A;  1PK0 D;  4GPL B;  2OTG C;  5JJG A;  1FI6 A;  2OS8 B;  1LA0 A;  2Q4U A;  3KF9 A;  1A29 A;  5TNC A;  4UPG A;  1K2H A;  4MZJ A;  2LUX A;  3QRX A;  1RTP 1;  2NXQ A;  1IQ3 A;  2JNF A;  3SG4 A;  1XVJ A;  3BOW B;  2ISD A;  1J55 A;  3GOF A;  3SG3 A;  1DJX A;  1RK9 A;  3A8R A;  1NYA A;  1YX7 A;  2LUC A;  3M0W A;  4PHJ A;  2DOQ A;  1K93 D;  3CR4 X;  3CLN A;  1XO5 A;  2LC5 A;  2JZI A;  2LP3 A;  1BT6 A;  3GK1 A;  1YRT B;  1TNX A;  3KPX A;  2BKH B;  3AKB A;  2PMY A;  2IS9 A;  4MZK A;  2K2F A;  1B8L A;  4TNC A;  3JTD B;  1CLB A;  2WCF A;  3I5I C;  1NIW A;  1TCF A;  1B47 A;  2KSP A;  3SG5 A;  1EG3 A;  1XK4 C;  2KI4 C;  4CFR A;  3GK4 X;  4DRW A;  1OMR A;  3TUY C;  1F71 A;  2VRG A;  2Y1M A;  1DVI A;  1OMD A;  1TOP A;  2GV5 A;  5AFP A;  1HQV A;  4ORC B;  2LCP A;  5FYX A;  3BXK A;  4WQ2 A;  3I5F C;  1GGZ A;  3IQO A;  1KQM B;  1UHI A;  4OV2 A;  3VRQ A;  3I5G B;  3PAL A;  2LMV A;  1A03 A;  1PSB A;  4PE1 A;  2M1U A;  2L51 A;  2FCE A;  3SJS A;  1Y1A A;  2K8M B;  1LA3 A;  1K90 D;  1LIN A;  1R6P A;  2ZRT A;  4MRY A;  2CBL A;  4PHK A;  5I2L A;  3CR5 X;  1BLQ A;  4YGD B;  4PHM A;  1U5I A;  1FI5 A;  1OSA A;  2G2B A;  3OX5 A;  1BG1 A;  4M2P A;  1SL8 A;  4OR9 B;  3TS5 B;  3IQQ A;  1MXL C;  1QAT A;  2KBI A;  4GGN A;  1WY9 A;  1CDP A;  2FOT A;  3BUO B;  1TNW A;  1DJY A;  3LL8 B;  4XJK A;  3VRR A;  1SPY A;  1KK8 B;  1FBV A;  1B9A A;  2I7A A;  3WNX B;  2AMI A;  4PE7 A;  2JNX A;  1RJV A;  2JT3 A;  3EVV A;  2ZN8 A;  2MLE C;  5CPV A;  5I8N A;  3BYA A;  1CFD A;  1F8H A;  4A4C A;  2MRD A;  1SW8 A;  1N65 A;  1TCO B;  1YUT A;  2I94 A;  1KSM A;  2ZFD A;  1DF0 A;  1QIV A;  2MHH A;  2LMU A;  1LVC D;  3EK4 A;  1C7W A;  4ICB A;  2JRF A;  1DJZ A;  2L0P A;  2EGD A;  2M8U A;  2WCB A;  4PAL A;  3FWB A;  5AAN A;  1DGV A;  1SR6 B;  3DVK A;  2K7O A;  2ZKM X;  4MEW A;  4ZCU A;  4I5L B;  4YRU A;  5ER5 A;  4CID A;  1SL9 A;  2LLS A;  1S6I A;  1V1G A;  2MJW B;  4GNK B;  3OB1 B;  4ORA B;  1ALW A;  2JOJ A;  1D1O A;  5D69 A;  2FJU B;  3KHE A;  1NP8 A;  2KI6 C;  1IKU A;  3RM1 A;  2KAY A;  3TDU A;  1WRZ A;  1CLM A;  2MLF C;  1NSH A;  4GGF C;  1M31 A;  3BUX B;  3EK7 A;  4YI9 A;  1JBA A;  2KYC A;  4XJK B;  3K21 A;  1QV1 A;  1SCV A;  1Y0V H;  1G33 A;  1YRU B;  5HKW A;  3SIA A;  1NPQ A;  1UUR A;  1ALV A;  1KWO B;  2P6B B;  3SG2 A;  2PSR A;  1JFJ A;  1QLS A;  4GBA A;  1NX3 A;  2Y1N A;  3JVT C;  4AQJ A;  1JWD A;  3NSK A;  2OTG B;  1DJH A;  1XK4 A;  1KK7 Z;  4BY4 A;  2O60 A;  2AUC A;  4DCK A;  1DF0 B;  1GJY A;  1SCM C;  1PVB A;  1EL4 A;  1UWO A;  3EKJ A;  2JWW A;  4WQ3 A;  2BCA A;  2CXJ A;  2BCB A;  1XFZ O;  1DGU A;  3PM8 A;  1QX7 A;  1JF2 A;  1AP4 A;  2JUL A;  1N2D A;  4E68 A;  1EXR A;  1AVS A;  4AQI A;  1PUL A;  4N1G A;  1A2X A;  1K96 A;  1TN4 A;  4F0Z B;  1CMF A;  4MBE A;  4NDC A;  1BOD A;  1UHJ A;  2CT9 A;  1FW4 A;  1YR5 A;  2LVV A;  4IL1 A;  4MRX A;  3I5H C;  3BUM B;  4MZL A;  3VRO A;  2JQ6 A;  1EG4 A;  2SAS A;  1BJF A;  1S5G Z;  2LP2 A;  3LK1 A;  5F6T A;  1CDL A;  2BEC A;  2I18 A;  1IJ6 A;  1MQ1 A;  4PHN A;  1M39 A;  1YVL A;  1QV0 A;  2KGB C;  4M2O A;  2MA2 A;  2OPO A;  5G08 A;  1KK7 Y;  1XFY O;  2M7L A;  2LVI A;  1CFC A;  1Y1X A;  1QIW A;  1N0Y A;  1B1G A;  5B8I B;  2L98 A;  3TDZ A;  1A4P A;  1XFV O;  5HYD A;  1IRJ A;  2F3Y A;  1IH0 A;  1SK6 D;  4QJ4 B;  3I5I B;  2MAZ A;  2ZNE A;  1REC A;  1J1D A;  2D8N A;  2JU0 A;  1E8A A;  2KI4 B;  3TUY B;  4N5X A;  5HKY A;  3AKA A;  2KI6 D;  3NSO A;  2LLT A;  2M9G A;  1W7J B;  3VRN A;  4FQO A;  4NDB A;  1RFJ A;  1BU3 A;  5I2O A;  4YI8 A;  4USL A;  3I5F B;  4OCI A;  1YX8 A;  1FF1 A;  2K2A A;  1CMG A;  4JPZ B;  1S5G Y;  1C7V A;  5CSJ A;  2CTN A;  1UHH A;  4DUQ A;  5AEQ A;  4I5N B;  1RWY A;  1SBJ A;  4ZCV A;  2KHN A;  2CCM A;  1MWN A;  1M63 B;  4BY5 A;  5PAL A;  4JWQ A;  3SIB A;  1K8U A;  3SG6 A;  1CM1 A;  1XYD A;  4P5O E;  1K94 A;  2K7D A;  4P2Y B;  2LAN A;  2GGZ A;  2V53 A;  3LLE A;  2F33 A;  1MUX A;  1B8C A;  4PDZ A;  4GGF A;  1IGV A;  3O78 A;  1H8B A;  1X02 A;  3CTN A;  1Y1U A;  2M49 B;  1NCZ A;  3PLF B;  1ZUZ A;  1RRO A;  2Q91 A;  2HF5 A;  2KFF A;  3O6B A;  5HKZ A;  2Y4Q A;  3ICB A;  3EVR A;  2B1U A;  4U8D A;  2MBX A;  1DJG A;  1CDM A;  4YGB B;  2JC2 A;  2L4I A;  3WXA A;  1EJ3 A;  2BE6 A;  3OP0 A;  4GAO A;  1QJT A;  1PAL A;  2I2R E;  3D10 A;  2H2K A;  1MHO A;  1TNP A;  4DIR A;  2EC6 C;  1ODB A;  5BPJ A;  2ZN9 A;  1QS7 A;  1IWQ A;  1S6C A;  2BL0 B;  4N1F A;  4D1E A;  1KCY A;  2BL0 C;  2K7B A;  2KDH A;  1MF8 B;  1QLK A;  4Q04 A;  5IBW A;  2KNE A;  3TZ1 A;  2A4J A;  4ORB B;  4I5J A;  3PN7 C;  1S3P A;  3OX6 A;  1WRK A;  3BUW B;  1WLM A;  1L2O C;  1V1F A;  3PAT A;  4I5K A;  4YGE B;  5I2Q A;  4CFQ A;  2TN4 A;  4FTG A;  5CSN A;  2E6W A;  1YUU A;  3OHM B;  4A4B A;  1UHK A;  3ZNI A;  1GQM A;  2PAS A;  3BUN B;  3AAJ A;  3FIA A;  1OE9 B;  3JVT B;  2PRU A;  3F45 A;  1ZMZ A;  1SY9 A;  1JUO A;  1S6J A;  2JTZ A;  2WND A;  1F4O A;  2KBM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...