2LVIA

Solution structure of apo-phl p 7
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
77
structure length
77
Chain Sequence
ADDMERIFKRFDTNGDGKISLSELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFNEFISFCNANPGLMKDVAKVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Allergen
molecule keywords Polcalcin Phl p 7
publication title Solution structures of polcalcin Phl p 7 in three ligation states: Apo-, hemi-Mg(2+) -bound, and fully Ca(2+) -bound.
pubmed doi rcsb
source organism Phleum pratense
total genus 6
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2012-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2lviA00
4YGAA 1TCOB 1YVLA 2KI6C 1S6JA 4PE1A 4ETOA 2WOSA 4OCIA 1W7IB 1XFVO 4NDCA 2BKHB 1C7WA 5D7FA 1SNLA 2JT8A 3FWBA 1DJZA 1QIWA 3LLEA 1CDMA 2PASA 3D0YA 3MSEB 1SK6D 2EGDA 1SCVA 2LP3A 4AQJA 1NYAA 1R2UA 4AQIA 1BMOA 1J1EA 1F70A 1UUSA 4DIRA 1JF0A 1YX7A 2EHBA 5AANA 1OOJA 2KDHA 1C07A 4QJ3B 1QATA 1CLBA 3ZWHA 1YX8A 1SYMA 3K21A 2BL0C 1MHOA 1SR6B 5KSZA 1QTXA 2KI6D 1Y1UA 2PVBA 1E8AA 2JQ6A 1B9AA 5G08A 1ALVA 2BE6A 1RJVA 1WY9A 1EL4A 2D8NA 3EK7A 2L0PA 2B1UA 2KGBC 1ZFSA 2V53A 4MBEA 4GUKA 3VRNA 1EG3A 4WQ2A 2JTZA 1KWOB 1KFXS 1QX2A 2LLTA 4GBAA 4PHNA 4MEWA 1CDNA 2HQWA 2OPOA 1BT6A 1DF0A 1IG5A 1MXEA 2LMVA 2HETA 4MSPA 2HPSA 1EJ3A 1RFJA 2I94A 1YURA 2NLNA 1LKJA 1AK8A 4GFTA 5D69A 3TUYC 3EVRA 3PFVA 1BODA 4PE7A 1ZACA 3KPXA 3H4SE 4DCKA 2ZNEA 1IQ5A 2LVKA 1MXLC 1NP8A 4N5XA 1HQVA 1H4BA 1U5IA 4PALA 5JOLA 3BOWB 4MVFA 4C0KA 3F45A 1DMOA 1L2OC 2Y1MA 1S6CA 3PALA 3LL8B 2M49B 3FWCA 4GGFA 4Q04A 3DF0A 1WRKA 2BL0B 1SL9A 4C0JA 2G9BA 4NDDA 3SG6A 3CGAA 1TCFA 2MA2A 5HYDA 3I5GC 1RTP1 4I5NB 1X02A 1J55A 1CNPA 1B47A 2WNDA 1YRTB 4CFRA 4XYNA 2LVVA 5CSFA 1CFDA 1BJFA 4JQ0D 1BR4B 1NUBA 1SW8A 1QVIZ 2F2OA 2COLB 1QLSA 1QX5B 2HF5A 2NCPA 1K96A 1F54A 1JSAA 2LNKA 2MJWB 2JT3A 2P6BB 5HLVA 1A75A 4M2PA 1IGVA 4AOMA 1NX0A 1K9PA 1UHJA 4F0ZB 1H8BA 2CTNA 1TN4A 2RGIA 3DVJA 2F2PA 5KU1A 1KK7Z 4GNKB 1PRWA 1A03A 5I2QA 1XFZO 2K2FA 5FYXA 3O6BA 1NSHA 1L2OB 3JVTC 1YRUB 3D10A 2KYCA 1OZSA 2QPTA 1IJ5A 1J7QA 1M39A 1SY9A 1IKUA 2NXQA 1B7TY 1YTZC 2K7OA 2FOTA 2KYFA 2MLEC 2LV7A 2L98A 2O60A 3I5GB 3GOFA 1DJIA 4CPVA 1CMFA 2LAPA 4YGCB 5JJGA 4IL1A 4HREE 3OB2B 2LC5A 1EG4A 1OMDA 2SCPA 2ZRTA 4I5JA 3CS1A 1XK4A 3NSLA 1MUXA 2H2KA 1LA3A 4MRYA 2K0JA 2LHIA 2ZKMX 4PDZA 5I2LA 1QXPA 2WCBA 1SPYA 1B4CA 1IQ3A 4ICBA 1SL7A 1YVHA 1OMVA 1TRFA 2H61A 3AAKA 3NSKA 2WCEA 1BF5A 4MZKA 1PVAA 3CR4X 4BY4A 2FJUB 2KHNA 3C1VA 1TIZA 4QJ5B 2JNXA 2KAXA 1N65A 3VROA 2JXLA 2FCDA 2M29A 3I5FC 1NCZA 2F3YA 4N1GA 1A29A 3JVTB 3WXAA 4M2OA 2EC6C 2FCEA 1OQPA 3EK8A 4FTGA 3SG3A 1XYDA 2K7BA 1CLLA 2JULA 3DVKA 2LVJA 1KSMA 1GQMA 2Q4UA 3LK1A 4GPLB 2M97A 1Y0VH 5J3XA 1K94A 2BE4A 1ODBA 1YUUA 2R2IA 4YI8A 1F55A 1J7PA 1IJ6A 2JTTA 5AEQA 4YRUA 2LUXA 3HCMA 3DF0B 3OX5A 2ISDA 2AUCA 2CNPA 3PN7C 2BBNA 1S5GY 1PK0D 2M7NA 4OVNF 2DOQA 3M0WA 2KQYA 2KGRA 2I7AA 2M9GA 1N0YA 1IWQA 1MQ1A 1NCYA 2LLUA 3EKJA 1DJYA 1NX3A 4OKHA 4R1EA 3O4YA 3KEVA 2LP2A 3I5FB 1BU3A 2VRGA 1S5GZ 2BCXA 1GGZA 1KK8C 3BUMB 4PHJA 2JOJA 3NSOA 1B8CA 1XK4C 2EC6B 1GGWA 2Q91A 2ZFDA 2BCAA 4DRWA 1S3PA 2LM5A 1A75B 2F3ZA 2AAOA 2PALA 3VRPA 3I5IC 5HKWA 1SBJA 1FF1A 3AKBA 2LLSA 1S26D 2HQ8A 2WC8A 1A4PA 5CSJA 1DT7B 1MWNA 1QVIY 3IF7A 2CXJA 2PSRA 2I18A 1CFPA 4JPZB 4M2QA 1WLZA 4NDBA 1WLMA 1QV1A 1BOCA 1LA0A 4P5OE 3KHEA 1NX1A 4YBHB 4QJ4B 1C7VA 2L2EA 2L5XB 2MBXA 3PN7B 1TTXA 1CKKA 1M46A 1FBVA 1QLKA 3BUWB 3A8RA 4CLNA 1KK7Y 5DKRA 1AP4A 3FS7A 3SG2A 2KFFA 1CTRA 1AUIB 3TUYB 4HRHA 1A2XA 1OSAA 4DS7A 1S6IA 2MLFC 5AERA 2K2AA 1NCXA 1YUTA 1KK8B 1F71A 1Y1AA 3TDZA 4YGBB 3EK4A 3CWGA 1KQMC 3OHMB 4E68A 1NPQA 2LCPA 2OTGC 2JXCA 1KFUL 2M3WA 3SIBA 4ZCVA 3WHTB 1SL8A 3CR2A 3I5IB 1UWOA 1G8IA 4UPGA 3SG7A 2MHHA 1CB1A 1XFUO 1K95A 4WRIA 3BOWA 2M1KB 1DTLA 3PM8A 1CMGA 1M31A 1UP5A 4PE4A 1FI6A 3JTDC 2CCMA 2G2BA 1J7RA 1DGUA 1PULA 1Q80A 3BUOB 4YGEB 3ICBA 3OP0A 1TNWA 3D0YB 1LXFC 2M0RA 3BXKA 1S36A 2KNEA 2Y4QA 5CPVA 1BR1B 1LVCD 5HKZA 1JC2A 1DJHA 5BPJA 3HX4A 3BYAA 4A4BA 1SMGA 4CFQA 5DKQA 4GGFC 1DJWA 1MR8A 1V1GA 1PALA 1J7OA 1AHRA 4CIDA 3RM1A 1TNXA 1F4OA 1KSOA 3BUNB 1KQMB 4FQOA 2JZIA 2M1UA 1F8HA 4P2YB 3WNXB 1IH0A 2OTGB 3DVMA 5CSIA 3AKAA 4YGDB 2K61A 5GQQC 2LMUA 3EVVA 1WDCC 1PSRA 1OE9B 4DUQA 1B1GA 1N2DA 2JWWA 1DGVA 2JNFA 1DF0B 1SKTA 1CFCA 1R6PA 1JFKA 3VRRA 4PCWA 1JBAA 1K90D 1D1OA 1B8LA 1CDPA 1KWOC 3GK1A 3JTDB 2K7DA 1KFUS 1K9UA 4JWQA 1K9KA 1BLQA 1K2HA 4PHMA 1U5IB 1CDLA 2LE9B 2M7LA 3O2PA 5K89A 1EH2A 1Y6WA 1NIWA 1TNQA 2KI4C 4OV2A 3CTNA 2PMYA 1M45A 1ZUZA 3CLNA 4XJKA 1TOPA 3I5HC 3VRQA 2LMTA 5KTYA 1TNPA 1DJXA 1W7JB 1YUSA 5AXIA 2BKIB 4C0LA 2WCFA 3QRXA 1CLMA 2F8PA 1VRKA 2TN4A 4HSZA 4GAOA 1QASA 1AJ5A 2JC2A 3BQ3A 1WDCB 1OMRA 3GK2A 1QIVA 1QX7A 2KAVA 1DVIA 2WORA 1ZMZA 3RLZA 1L7ZA 3IQQA 2LUCA 2ZN9A 2MRDA 1XFWO 2CBLA 3KO0A 2JRFA 2JPTA 2PRUA 4MZJA 3SG5A 2ZN8A 2MAZA 4ORCB 1CFFA 2NZ0A 1B8RA 3AAJA 1CM1A 1XO5A 2L50A 4PE0A 2H61C 2KBMA 4MRXA 5B8IB 1MF8B 2KAYA 3VGOA 4L9MA 5TNCA 2E6WA 2L4IA 5PALA 2KFHA 1JUOA 1M63B 4BY5A 2KBIA 4USLA 4YI9A 2KI4B 1RK9A 3OX6A 4GGNA 2KOTA 1EXRA 5AFPA 3CR5X 1RWYA 3LCPC 3I5HB 3DD4A 2JU0A 5ER4X 3OB1B 2L4HA 4NQGA 3KF9A 1WRLA 3PLFB 1UHKA 2K7CA 1S1EA 1JF2A 1V1FA 1J1DA 1SRAA 1FPWA 2I2RE 2Y1NA 2BBMA 2QACA 5I8NA 1KQVA 5IBWA 2OS8C 1DJGA 5DKNA 2ZRSA 1UHIA 1XVJA 4ORAB 1LINA 2AMIA 4PHKA 2M8UA 1F4QA 2KFGA 1XA5A 3TS5C 1AJ4A 3WHUB 1K8UA 3BUXB 4OR9B 1HT9A 2NCOA 4D1EA 1KCYA 1SCMC 1UHNA 1XFXO 3DVEA 1K93D 4I5KA 3ZNIA 1JWDA 1QV0A 1XFYO 3EVUA 3FIAA 1WRZA 5ER5A 2SASA 2GV5A 1ALWA 3EKHA 3LK0A 1RROA 3TDIA 3PSRA 1OZOA 1RECA 5F6TA 4I5LB 1NWDA 4ORBB 1UHHA 2L51A 3NSIA 4TNCA 3E3RA 4MN0A 1G4YR 2F33A 3IQOA 5HLOA 3TZ1A 1AVSA 1G33A 1YR5A 2ZNDA 2GGMA 2OS8B 1IRJA 2LANA 3A4UB 3PATA 5HKYA 1QJTA 4ZCUA 1FW4A 4A4CA 2Y5IA 3SG4A 4WQ3A 3TDUA 1JFJA 1GJYA 1Y1XA 1UURA 3O78A 1NX2A 1ZOTB 5I2OA 2JT0A 1KFXL 2O5GA 3TS5B 1PVBA 2E30A 2KSPA 3GK4X 4XJKB 4HRGA 1B7TZ 2LVIA 4MZLA 1SR6C 2A4JA 3CZTX 2IS9A 2K8MB 2KQ6A 1QS7A 1BG1A 1SCMB 4MLWA 3SIAA 5CSNA 4U8DA 3SJSA 3NXAA 1CM4A 2CT9A 2BECA 1FI5A 1PSBA 2GGZA 4N1FA 2LHLA 2BCBA
chains in the Genus database with same CATH superfamily
4YGAA 1TCOB 1YVLA 2KI6C 1S6JA 3R1PA 4PE1A 4ETOA 2WOSA 4OCIA 1W7IB 1XFVO 3R1VA 4NDCA 2WCJA 2BKHB 1C7WA 5D7FA 1SNLA 2JT8A 3FWBA 1DJZA 1QIWA 3PM2A 3LLEA 3D76A 1CDMA 2PASA 3D0YA 3MSEB 1SK6D 2EGDA 1SCVA 2LP3A 4AQJA 1NYAA 1R2UA 4AQIA 1BMOA 1J1EA 1F70A 1UUSA 4DIRA 1JF0A 1YX7A 2EHBA 5AANA 1OOJA 2KDHA 1C07A 4QJ3B 1QATA 1CLBA 3ZWHA 1YX8A 1SYMA 3K21A 2BL0C 1MHOA 2QEVA 1SR6B 5KSZA 1QTXA 2KI6D 1Y1UA 2PVBA 3CDNA 1E8AA 2JQ6A 1B9AA 5G08A 1ALVA 2BE6A 1RJVA 1WY9A 1EL4A 2D8NA 3EK7A 2L0PA 5FI6A 2B1UA 2KGBC 1ZFSA 2V53A 4MBEA 4GUKA 3VRNA 1EG3A 4WQ2A 2JTZA 1KWOB 1KFXS 1QX2A 2LLTA 4GBAA 2P71A 4PHNA 4MEWA 1CDNA 2HQWA 2OPOA 5DICA 3BFHA 1BT6A 1DF0A 1IG5A 1MXEA 2LMVA 2HETA 4MSPA 2HPSA 1EJ3A 1RFJA 2I94A 1YURA 2NLNA 1LKJA 1AK8A 4GFTA 5D69A 3TUYC 3EVRA 3PFVA 1BODA 4PE7A 1ZACA 3KPXA 3H4SE 4DCKA 2ZNEA 1IQ5A 3CZ1A 2LVKA 1ORGA 1MXLC 1GM0A 1NP8A 2WCLA 4N5XA 1HQVA 1H4BA 1U5IA 4PALA 5JOLA 3BOWB 3B6XA 4MVFA 4C0KA 3F45A 1DMOA 1L2OC 2Y1MA 1S6CA 2WCMA 3PALA 3LL8B 2M49B 3NHIA 5FI2A 3FWCA 4GGFA 4Q04A 3DF0A 1WRKA 2BL0B 1SL9A 4C0JA 2G9BA 4NDDA 3SG6A 3CGAA 1TCFA 2MA2A 5HYDA 3I5GC 1RTP1 4I5NB 1X02A 1J55A 3L4AA 1B47A 2WNDA 1YRTB 4CFRA 1CNPA 4XYNA 2LVVA 5CSFA 1CFDA 1BJFA 4JQ0D 1BR4B 1NUBA 1SW8A 1QVIZ 2F2OA 2COLB 3R1OA 1QLSA 3B7AA 1QX5B 2HF5A 2NCPA 3O4XA 1K96A 1F54A 1DEKA 1JSAA 2LNKA 2MJWB 2JT3A 2P6BB 5HLVA 1A75A 4M2PA 3N7HA 1IGVA 4AOMA 3D73A 1NX0A 3SS3A 1K9PA 1UHJA 4F0ZB 1H8BA 2CTNA 1TN4A 2RGIA 3DVJA 2F2PA 5KU1A 1KK7Z 4GNKB 1PRWA 1A03A 5I2QA 1XFZO 2K2FA 5FYXA 3O6BA 2K60A 1NSHA 1L2OB 3JVTC 1YRUB 3D10A 1OOGA 2KYCA 3D78A 1OZSA 2QPTA 3VB1A 1IJ5A 1J7QA 1M39A 1SY9A 1IKUA 2BAPA 2NXQA 1B7TY 1YTZC 3K1EA 2K7OA 2FOTA 2KYFA 2MLEC 2LV7A 2L2CA 2L98A 2O60A 3I5GB 3GOFA 1DJIA 4CPVA 1CMFA 2LAPA 4YGCB 5JJGA 4IL1A 4HREE 2QEBA 3OB2B 2LC5A 1EG4A 1OMDA 2SCPA 2ZRTA 3OBVA 1TWOA 2KPHA 4I5JA 3CS1A 1XK4A 3NSLA 1MUXA 2H2KA 1LA3A 3RZSA 4MRYA 2K0JA 2LHIA 2ZKMX 4PDZA 5I2LA 1QXPA 1Z4HA 2WCBA 1SPYA 1B4CA 2H8VA 1IQ3A 3S0BA 4ICBA 1SL7A 1YVHA 1OMVA 1Z2CB 1TRFA 2H61A 3AAKA 3NSKA 2WCEA 1BF5A 3DYEA 4MZKA 4PT1A 1PVAA 3CR4X 4BY4A 2FJUB 2KHNA 3C1VA 1TIZA 4QJ5B 2JNXA 2KAXA 1N65A 1DELA 2JXLA 2FCDA 2M29A 3B87A 1NCZA 2F3YA 3I5FC 1A29A 3JVTB 3NGVA 3WXAA 3S0FA 4M2OA 2EC6C 2FCEA 1OQPA 3EK8A 4FTGA 3SG3A 1XYDA 2K7BA 1CLLA 2JULA 3DVKA 2LVJA 1KSMA 1GQMA 3D77A 2Q4UA 3LK1A 3BJHA 4GPLB 2L5YA 2M97A 1Y0VH 5J3XA 1K94A 3S0DA 2BE4A 1ODBA 1YUUA 2R2IA 4YI8A 1F55A 1J7PA 3L4LA 1IJ6A 5HL1A 4FQTA 5FI7A 3CZ2A 1SSEB 2JTTA 3CZ0A 5AEQA 4YRUA 2LUXA 3HCMA 3DF0B 3OX5A 2ISDA 1TUZA 2AUCA 2CNPA 2GTEA 2WCKA 2BBNA 3PN7C 1S5GY 1PK0D 2M7NA 4OVNF 2DOQA 3M0WA 2KQYA 2KGRA 2I7AA 2M9GA 1N0YA 1IWQA 1MQ1A 1NCYA 2LLUA 3EKJA 1DJYA 1NX3A 4INXA 4OKHA 4R1EA 3O4YA 3KEVA 2LP2A 3I5FB 1BU3A 2VRGA 1S5GZ 2BCXA 1GGZA 1KK8C 3BUMB 4PHJA 2JOJA 3NSOA 1B8CA 1XK4C 2EC6B 1GGWA 2Q91A 2KLDA 2ZFDA 2BCAA 3UNWA 4DRWA 1S3PA 2LM5A 1A75B 3OGNA 2F3ZA 2AAOA 2PALA 3S0GA 3VRPA 3I5IC 5HKWA 1SBJA 3FE9A 1OOIX 1FF1A 3AKBA 2LLSA 1P28A 4OZDA 1S26D 2HQ8A 2WC8A 1A4PA 5CSJA 1DT7B 1MWNA 1QVIY 3IF7A 2CXJA 2PSRA 2I18A 1CFPA 4JPZB 4M2QA 1WLZA 4NDBA 1WLMA 1QV1A 1BOCA 1LA0A 2YGUA 4P5OE 1C3ZA 3D74A 1NX1A 3KHEA 4YBHB 4QJ4B 2L2EA 2L5XB 2MBXA 3PN7B 1TTXA 1C7VA 1CKKA 1M46A 1FBVA 1QLKA 3BUWB 3A8RA 4CLNA 1KK7Y 5DKRA 1AP4A 3FS7A 3SG2A 2KFFA 3SS4A 1CTRA 1AUIB 3TUYB 4HRHA 1A2XA 1OSAA 4DS7A 1S6IA 2MLFC 5AERA 2K2AA 1YUTA 1NCXA 1KK8B 1W9ZA 1Y1AA 1F71A 3TDZA 4YGBB 3EK4A 3CWGA 1KQMC 3OHMB 3DXLA 3FE6A 2KLEA 4E68A 1NPQA 2LCPA 2OTGC 2JXCA 1KFUL 2WC5A 2M3WA 3SIBA 4ZCVA 3WHTB 1SL8A 3CR2A 3I5IB 1UWOA 3DZTA 4IJ7A 1G8IA 4UPGA 3SG7A 2MHHA 1CB1A 1XFUO 1K95A 4WRIA 3BOWA 2M1KB 1DTLA 3PM8A 1CMGA 1M31A 1UP5A 3D75A 4PE4A 2P70A 1FI6A 3JTDC 3PJIA 3FE8A 2CCMA 2G2BA 1J7RA 1DGUA 1PULA 1Q80A 3BUOB 4YGEB 3ICBA 3OP0A 1TNWA 3D0YB 1LXFC 2M0RA 3VROA 3BXKA 1S36A 4JD9A 2KNEA 2PQLA 2Y4QA 3NHTA 5CPVA 1BR1B 1LVCD 5HKZA 1JC2A 1DJHA 5BPJA 3HX4A 3BYAA 4A4BA 1SMGA 4CFQA 5DKQA 4GGFC 1DJWA 1MR8A 1DC1A 1V1GA 1PALA 1J7OA 1AHRA 4CIDA 3RM1A 3S0AA 2ERBA 1TNXA 1F4OA 1KSOA 3BUNB 3R72A 1KQMB 4FQOA 2JZIA 2M1UA 1F8HA 4F7FA 4P2YB 1DQEA 3WNXB 1IH0A 2OTGB 3DVMA 5CSIA 3AKAA 4YGDB 2K61A 5GQQC 2LMUA 3EVVA 1WDCC 1PSRA 1OE9B 4DUQA 1B1GA 1N2DA 2JWWA 1DGVA 2QDIA 2JNFA 1DF0B 1SKTA 1CFCA 1R6PA 1JFKA 3VRRA 4PCWA 1JBAA 1K90D 1D1OA 1B8LA 1CDPA 1KWOC 3GK1A 3JTDB 2K7DA 1KFUS 3BFBA 1K9UA 4JWQA 1K9KA 1BLQA 1K2HA 4PHMA 1U5IB 1CDLA 2LE9B 3B86A 3O2PA 4INWA 2M7LA 5K89A 1EH2A 1Y6WA 1NIWA 1TNQA 2KI4C 4OV2A 3CTNA 2PMYA 1M45A 1ZUZA 3CLNA 3EG5B 3Q8IA 4XJKA 1TOPA 3I5HC 3VRQA 2LMTA 1OOFA 5KTYA 5EL2A 1TNPA 1DJXA 1W7JB 1YUSA 4JKTA 5AXIA 2BKIB 2WC6A 4C0LA 2WCFA 3QRXA 1CLMA 2F8PA 1VRKA 2TN4A 3BFAA 1IIOA 4HSZA 4GAOA 1QASA 1AJ5A 2FJYA 2JC2A 3BQ3A 1WDCB 2QEHA 1OMRA 3SS5A 3GK2A 1QIVA 2BNXA 1QX7A 2KAVA 1DVIA 2WORA 1ZMZA 3RLZA 1L7ZA 3IQQA 2LUCA 2ZN9A 2MRDA 1XFWO 2CBLA 2WCHA 2JRFA 3KO0A 2JPTA 3CABA 2PRUA 4MZJA 3SG5A 2ZN8A 2MAZA 4ORCB 1CFFA 5I94A 2NZ0A 1B8RA 3AAJA 1CM1A 1XO5A 2L50A 3IVTA 4PE0A 2H61C 5D3OA 2KBMA 4MRXA 5B8IB 1MF8B 1C3YA 2KAYA 3VGOA 4L9MA 5TNCA 2E6WA 3S0EA 1T14A 2L4IA 5PALA 2KFHA 1JUOA 1M63B 4BY5A 2KBIA 4USLA 4YI9A 2KI4B 1RK9A 3OX6A 4GGNA 2KOTA 1EXRA 5AFPA 3CR5X 1RWYA 3LCPC 3I5HB 3DD4A 2JU0A 4KYNA 5ER4X 3OB1B 2L4HA 4N1GA 4NQGA 3KF9A 1WRLA 3PLFB 1UHKA 2K7CA 1S1EA 1JF2A 1V1FA 1J1DA 1SRAA 1FPWA 2I2RE 2Y1NA 2BBMA 2QACA 5I8NA 1KQVA 5IBWA 2OS8C 1DJGA 5DKNA 2ZRSA 1UHIA 1XVJA 4ORAB 1LINA 2AMIA 4PHKA 2M8UA 2PYQA 3DY9A 1F4QA 2KFGA 1XA5A 2JPOA 3TS5C 1AJ4A 3WHUB 3UO9A 1K8UA 3BUXB 3QMEA 1HT9A 4OR9B 2NCOA 3V2LA 4D1EA 1KCYA 1SCMC 1UHNA 1XFXO 3DVEA 1K93D 4I5KA 3ZNIA 1JWDA 1QV0A 1XFYO 3EVUA 3FIAA 1WRZA 5ER5A 2QEOA 2SASA 2GV5A 1ALWA 3EKHA 3LK0A 1RROA 3TDIA 3PSRA 1OZOA 1RECA 5F6TA 4I5LB 1NWDA 4ORBB 1UHHA 2L51A 3NSIA 4TNCA 3E3RA 4MN0A 1G4YR 2F33A 3IQOA 5HLOA 1LS8A 1AVSA 1G33A 3B88A 1YR5A 3TZ1A 2ZNDA 2GGMA 2OS8B 1OOHA 1IRJA 2LANA 3A4UB 3PATA 5HKYA 1QJTA 4ZCUA 1FW4A 4A4CA 2Y5IA 3SG4A 3L47A 4WQ3A 3TDUA 1JFJA 1TUJA 1GJYA 1Y1XA 1UURA 3O78A 1NX2A 1ZOTB 5I2OA 2JT0A 1KFXL 2O5GA 3TS5B 1PVBA 2E30A 2KSPA 3GK4X 4XJKB 3CYZA 4HRGA 1B7TZ 1OW4A 2LVIA 4MZLA 1SR6C 2A4JA 3CZTX 1XFRA 2IS9A 2K8MB 2KQ6A 1QS7A 1BG1A 1SCMB 1QWVA 4MLWA 3SIAA 5CSNA 4U8DA 3SJSA 3NXAA 1CM4A 2CT9A 2BECA 1FI5A 1PSBA 2GGZA 4N1FA 2LHLA 2BCBA
chains in the Genus database with same CATH topology
4YGAA 1TCOB 1YVLA 2KI6C 1S6JA 4PE1A 4ETOA 2WOSA 4OCIA 1W7IB 1XFVO 4NDCA 2BKHB 1C7WA 5D7FA 1SNLA 2JT8A 3FWBA 1DJZA 1QIWA 3LLEA 1CDMA 2PASA 3D0YA 3MSEB 1SK6D 2EGDA 1SCVA 2LP3A 4AQJA 1NYAA 1R2UA 4AQIA 1BMOA 1J1EA 1F70A 1UUSA 4DIRA 1JF0A 1YX7A 2EHBA 5AANA 1OOJA 2KDHA 1C07A 4QJ3B 1QATA 1CLBA 3ZWHA 1YX8A 1SYMA 3K21A 2BL0C 1MHOA 1SR6B 5KSZA 1QTXA 2KI6D 1Y1UA 2PVBA 1E8AA 2JQ6A 1B9AA 5G08A 1ALVA 2BE6A 1RJVA 1WY9A 1EL4A 2D8NA 3EK7A 2L0PA 2B1UA 2KGBC 1ZFSA 2V53A 4MBEA 4GUKA 3VRNA 1EG3A 4WQ2A 2JTZA 1KWOB 1KFXS 1QX2A 2LLTA 4GBAA 4PHNA 4MEWA 1CDNA 2HQWA 2OPOA 1BT6A 1DF0A 1IG5A 1MXEA 2LMVA 2HETA 4MSPA 2HPSA 1EJ3A 1RFJA 2I94A 1YURA 2NLNA 1LKJA 1AK8A 4GFTA 5D69A 3TUYC 3EVRA 3PFVA 1BODA 4PE7A 1ZACA 3KPXA 3H4SE 4DCKA 2ZNEA 1IQ5A 2LVKA 1MXLC 1NP8A 4N5XA 1HQVA 1H4BA 1U5IA 4PALA 5JOLA 3BOWB 4MVFA 4C0KA 3F45A 1DMOA 1L2OC 2Y1MA 1S6CA 3PALA 3LL8B 2M49B 3FWCA 4GGFA 4Q04A 3DF0A 1WRKA 2BL0B 1SL9A 4C0JA 2G9BA 4NDDA 3SG6A 3CGAA 1TCFA 2MA2A 5HYDA 3I5GC 1RTP1 4I5NB 1X02A 1J55A 1CNPA 1B47A 2WNDA 1YRTB 4CFRA 4XYNA 2LVVA 5CSFA 1CFDA 1BJFA 4JQ0D 1BR4B 1NUBA 1SW8A 1QVIZ 2F2OA 2COLB 1QLSA 1QX5B 2HF5A 2NCPA 1K96A 1F54A 1JSAA 2LNKA 2MJWB 2JT3A 2P6BB 5HLVA 1A75A 4M2PA 1IGVA 4AOMA 1NX0A 1K9PA 1UHJA 4F0ZB 1H8BA 2CTNA 1TN4A 2RGIA 3DVJA 2F2PA 5KU1A 1KK7Z 4GNKB 1PRWA 1A03A 5I2QA 1XFZO 2K2FA 5FYXA 3O6BA 1NSHA 1L2OB 3JVTC 1YRUB 3D10A 2KYCA 1OZSA 2QPTA 1IJ5A 1J7QA 1M39A 1SY9A 1IKUA 2NXQA 1B7TY 1YTZC 2K7OA 2FOTA 2KYFA 2MLEC 2LV7A 2L98A 2O60A 3I5GB 3GOFA 1DJIA 4CPVA 1CMFA 2LAPA 4YGCB 5JJGA 4IL1A 4HREE 3OB2B 2LC5A 1EG4A 1OMDA 2SCPA 2ZRTA 4I5JA 3CS1A 1XK4A 3NSLA 1MUXA 2H2KA 1LA3A 4MRYA 2K0JA 2LHIA 2ZKMX 4PDZA 5I2LA 1QXPA 2WCBA 1SPYA 1B4CA 1IQ3A 4ICBA 1SL7A 1YVHA 1OMVA 1TRFA 2H61A 3AAKA 3NSKA 2WCEA 1BF5A 4MZKA 1PVAA 3CR4X 4BY4A 2FJUB 2KHNA 3C1VA 1TIZA 4QJ5B 2JNXA 2KAXA 1N65A 3VROA 2JXLA 2FCDA 2M29A 3I5FC 1NCZA 2F3YA 4N1GA 1A29A 3JVTB 3WXAA 4M2OA 2EC6C 2FCEA 1OQPA 3EK8A 4FTGA 3SG3A 1XYDA 2K7BA 1CLLA 2JULA 3DVKA 2LVJA 1KSMA 1GQMA 2Q4UA 3LK1A 4GPLB 2M97A 1Y0VH 5J3XA 1K94A 2BE4A 1ODBA 1YUUA 2R2IA 4YI8A 1F55A 1J7PA 1IJ6A 2JTTA 5AEQA 4YRUA 2LUXA 3HCMA 3DF0B 3OX5A 2ISDA 2AUCA 2CNPA 3PN7C 2BBNA 1S5GY 1PK0D 2M7NA 4OVNF 2DOQA 3M0WA 2KQYA 2KGRA 2I7AA 2M9GA 1N0YA 1IWQA 1MQ1A 1NCYA 2LLUA 3EKJA 1DJYA 1NX3A 4OKHA 4R1EA 3O4YA 3KEVA 2LP2A 3I5FB 1BU3A 2VRGA 1S5GZ 2BCXA 1GGZA 1KK8C 3BUMB 4PHJA 2JOJA 3NSOA 1B8CA 1XK4C 2EC6B 1GGWA 2Q91A 2ZFDA 2BCAA 4DRWA 1S3PA 2LM5A 1A75B 2F3ZA 2AAOA 2PALA 3VRPA 3I5IC 5HKWA 1SBJA 1FF1A 3AKBA 2LLSA 1S26D 2HQ8A 2WC8A 1A4PA 5CSJA 1DT7B 1MWNA 1QVIY 3IF7A 2CXJA 2PSRA 2I18A 1CFPA 4JPZB 4M2QA 1WLZA 4NDBA 1WLMA 1QV1A 1BOCA 1LA0A 4P5OE 3KHEA 1NX1A 4YBHB 4QJ4B 1C7VA 2L2EA 2L5XB 2MBXA 3PN7B 1TTXA 1CKKA 1M46A 1FBVA 1QLKA 3BUWB 3A8RA 4CLNA 1KK7Y 5DKRA 1AP4A 3FS7A 3SG2A 2KFFA 1CTRA 1AUIB 3TUYB 4HRHA 1A2XA 1OSAA 4DS7A 1S6IA 2MLFC 5AERA 2K2AA 1NCXA 1YUTA 1KK8B 1F71A 1Y1AA 3TDZA 4YGBB 3EK4A 3CWGA 1KQMC 3OHMB 4E68A 1NPQA 2LCPA 2OTGC 2JXCA 1KFUL 2M3WA 3SIBA 4ZCVA 3WHTB 1SL8A 3CR2A 3I5IB 1UWOA 1G8IA 4UPGA 3SG7A 2MHHA 1CB1A 1XFUO 1K95A 4WRIA 3BOWA 2M1KB 1DTLA 3PM8A 1CMGA 1M31A 1UP5A 4PE4A 1FI6A 3JTDC 2CCMA 2G2BA 1J7RA 1DGUA 1PULA 1Q80A 3BUOB 4YGEB 3ICBA 3OP0A 1TNWA 3D0YB 1LXFC 2M0RA 3BXKA 1S36A 2KNEA 2Y4QA 5CPVA 1BR1B 1LVCD 5HKZA 1JC2A 1DJHA 5BPJA 3HX4A 3BYAA 4A4BA 1SMGA 4CFQA 5DKQA 4GGFC 1DJWA 1MR8A 1V1GA 1PALA 1J7OA 1AHRA 4CIDA 3RM1A 1TNXA 1F4OA 1KSOA 3BUNB 1KQMB 4FQOA 2JZIA 2M1UA 1F8HA 4P2YB 3WNXB 1IH0A 2OTGB 3DVMA 5CSIA 3AKAA 4YGDB 2K61A 5GQQC 2LMUA 3EVVA 1WDCC 1PSRA 1OE9B 4DUQA 1B1GA 1N2DA 2JWWA 1DGVA 2JNFA 1DF0B 1SKTA 1CFCA 1R6PA 1JFKA 3VRRA 4PCWA 1JBAA 1K90D 1D1OA 1B8LA 1CDPA 1KWOC 3GK1A 3JTDB 2K7DA 1KFUS 1K9UA 4JWQA 1K9KA 1BLQA 1K2HA 4PHMA 1U5IB 1CDLA 2LE9B 2M7LA 3O2PA 5K89A 1EH2A 1Y6WA 1NIWA 1TNQA 2KI4C 4OV2A 3CTNA 2PMYA 1M45A 1ZUZA 3CLNA 4XJKA 1TOPA 3I5HC 3VRQA 2LMTA 5KTYA 1TNPA 1DJXA 1W7JB 1YUSA 5AXIA 2BKIB 4C0LA 2WCFA 3QRXA 1CLMA 2F8PA 1VRKA 2TN4A 4HSZA 4GAOA 1QASA 1AJ5A 2JC2A 3BQ3A 1WDCB 1OMRA 3GK2A 1QIVA 1QX7A 2KAVA 1DVIA 2WORA 1ZMZA 3RLZA 1L7ZA 3IQQA 2LUCA 2ZN9A 2MRDA 1XFWO 2CBLA 3KO0A 2JRFA 2JPTA 2PRUA 4MZJA 3SG5A 2ZN8A 2MAZA 4ORCB 1CFFA 2NZ0A 1B8RA 3AAJA 1CM1A 1XO5A 2L50A 4PE0A 2H61C 2KBMA 4MRXA 5B8IB 1MF8B 2KAYA 3VGOA 4L9MA 5TNCA 2E6WA 2L4IA 5PALA 2KFHA 1JUOA 1M63B 4BY5A 2KBIA 4USLA 4YI9A 2KI4B 1RK9A 3OX6A 4GGNA 2KOTA 1EXRA 5AFPA 3CR5X 1RWYA 3LCPC 3I5HB 3DD4A 2JU0A 5ER4X 3OB1B 2L4HA 4NQGA 3KF9A 1WRLA 3PLFB 1UHKA 2K7CA 1S1EA 1JF2A 1V1FA 1J1DA 1SRAA 1FPWA 2I2RE 2Y1NA 2BBMA 2QACA 5I8NA 1KQVA 5IBWA 2OS8C 1DJGA 5DKNA 2ZRSA 1UHIA 1XVJA 4ORAB 1LINA 2AMIA 4PHKA 2M8UA 1F4QA 2KFGA 1XA5A 3TS5C 1AJ4A 3WHUB 1K8UA 3BUXB 4OR9B 1HT9A 2NCOA 4D1EA 1KCYA 1SCMC 1UHNA 1XFXO 3DVEA 1K93D 4I5KA 3ZNIA 1JWDA 1QV0A 1XFYO 3EVUA 3FIAA 1WRZA 5ER5A 2SASA 2GV5A 1ALWA 3EKHA 3LK0A 1RROA 3TDIA 3PSRA 1OZOA 1RECA 5F6TA 4I5LB 1NWDA 4ORBB 1UHHA 2L51A 3NSIA 4TNCA 3E3RA 4MN0A 1G4YR 2F33A 3IQOA 5HLOA 3TZ1A 1AVSA 1G33A 1YR5A 2ZNDA 2GGMA 2OS8B 1IRJA 2LANA 3A4UB 3PATA 5HKYA 1QJTA 4ZCUA 1FW4A 4A4CA 2Y5IA 3SG4A 4WQ3A 3TDUA 1JFJA 1GJYA 1Y1XA 1UURA 3O78A 1NX2A 1ZOTB 5I2OA 2JT0A 1KFXL 2O5GA 3TS5B 1PVBA 2E30A 2KSPA 3GK4X 4XJKB 4HRGA 1B7TZ 2LVIA 4MZLA 1SR6C 2A4JA 3CZTX 2IS9A 2K8MB 2KQ6A 1QS7A 1BG1A 1SCMB 4MLWA 3SIAA 5CSNA 4U8DA 3SJSA 3NXAA 1CM4A 2CT9A 2BECA 1FI5A 1PSBA 2GGZA 4N1FA 2LHLA 2BCBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YGA A;  1TCO B;  1YVL A;  2KI6 C;  1S6J A;  4PE1 A;  4ETO A;  2WOS A;  4OCI A;  1W7I B;  1XFV O;  4NDC A;  2BKH B;  1C7W A;  5D7F A;  1SNL A;  2JT8 A;  3FWB A;  1DJZ A;  1QIW A;  3LLE A;  1CDM A;  2PAS A;  3D0Y A;  3MSE B;  1SK6 D;  2EGD A;  1SCV A;  2LP3 A;  4AQJ A;  1NYA A;  1R2U A;  4AQI A;  1BMO A;  1J1E A;  1F70 A;  1UUS A;  4DIR A;  1JF0 A;  1YX7 A;  2EHB A;  5AAN A;  1OOJ A;  2KDH A;  1C07 A;  4QJ3 B;  1QAT A;  1CLB A;  3ZWH A;  1YX8 A;  1SYM A;  3K21 A;  2BL0 C;  1MHO A;  1SR6 B;  5KSZ A;  1QTX A;  2KI6 D;  1Y1U A;  2PVB A;  1E8A A;  2JQ6 A;  1B9A A;  5G08 A;  1ALV A;  2BE6 A;  1RJV A;  1WY9 A;  1EL4 A;  2D8N A;  3EK7 A;  2L0P A;  2B1U A;  2KGB C;  1ZFS A;  2V53 A;  4MBE A;  4GUK A;  3VRN A;  1EG3 A;  4WQ2 A;  2JTZ A;  1KWO B;  1KFX S;  1QX2 A;  2LLT A;  4GBA A;  4PHN A;  4MEW A;  1CDN A;  2HQW A;  2OPO A;  1BT6 A;  1DF0 A;  1IG5 A;  1MXE A;  2LMV A;  2HET A;  4MSP A;  2HPS A;  1EJ3 A;  1RFJ A;  2I94 A;  1YUR A;  2NLN A;  1LKJ A;  1AK8 A;  4GFT A;  5D69 A;  3TUY C;  3EVR A;  3PFV A;  1BOD A;  4PE7 A;  1ZAC A;  3KPX A;  3H4S E;  4DCK A;  2ZNE A;  1IQ5 A;  2LVK A;  1MXL C;  1NP8 A;  4N5X A;  1HQV A;  1H4B A;  1U5I A;  4PAL A;  5JOL A;  3BOW B;  4MVF A;  4C0K A;  3F45 A;  1DMO A;  1L2O C;  2Y1M A;  1S6C A;  3PAL A;  3LL8 B;  2M49 B;  3FWC A;  4GGF A;  4Q04 A;  3DF0 A;  1WRK A;  2BL0 B;  1SL9 A;  4C0J A;  2G9B A;  4NDD A;  3SG6 A;  3CGA A;  1TCF A;  2MA2 A;  5HYD A;  3I5G C;  1RTP 1;  4I5N B;  1X02 A;  1J55 A;  1CNP A;  1B47 A;  2WND A;  1YRT B;  4CFR A;  4XYN A;  2LVV A;  5CSF A;  1CFD A;  1BJF A;  4JQ0 D;  1BR4 B;  1NUB A;  1SW8 A;  1QVI Z;  2F2O A;  2COL B;  1QLS A;  1QX5 B;  2HF5 A;  2NCP A;  1K96 A;  1F54 A;  1JSA A;  2LNK A;  2MJW B;  2JT3 A;  2P6B B;  5HLV A;  1A75 A;  4M2P A;  1IGV A;  4AOM A;  1NX0 A;  1K9P A;  1UHJ A;  4F0Z B;  1H8B A;  2CTN A;  1TN4 A;  2RGI A;  3DVJ A;  2F2P A;  5KU1 A;  1KK7 Z;  4GNK B;  1PRW A;  1A03 A;  5I2Q A;  1XFZ O;  2K2F A;  5FYX A;  3O6B A;  1NSH A;  1L2O B;  3JVT C;  1YRU B;  3D10 A;  2KYC A;  1OZS A;  2QPT A;  1IJ5 A;  1J7Q A;  1M39 A;  1SY9 A;  1IKU A;  2NXQ A;  1B7T Y;  1YTZ C;  2K7O A;  2FOT A;  2KYF A;  2MLE C;  2LV7 A;  2L98 A;  2O60 A;  3I5G B;  3GOF A;  1DJI A;  4CPV A;  1CMF A;  2LAP A;  4YGC B;  5JJG A;  4IL1 A;  4HRE E;  3OB2 B;  2LC5 A;  1EG4 A;  1OMD A;  2SCP A;  2ZRT A;  4I5J A;  3CS1 A;  1XK4 A;  3NSL A;  1MUX A;  2H2K A;  1LA3 A;  4MRY A;  2K0J A;  2LHI A;  2ZKM X;  4PDZ A;  5I2L A;  1QXP A;  2WCB A;  1SPY A;  1B4C A;  1IQ3 A;  4ICB A;  1SL7 A;  1YVH A;  1OMV A;  1TRF A;  2H61 A;  3AAK A;  3NSK A;  2WCE A;  1BF5 A;  4MZK A;  1PVA A;  3CR4 X;  4BY4 A;  2FJU B;  2KHN A;  3C1V A;  1TIZ A;  4QJ5 B;  2JNX A;  2KAX A;  1N65 A;  3VRO A;  2JXL A;  2FCD A;  2M29 A;  3I5F C;  1NCZ A;  2F3Y A;  4N1G A;  1A29 A;  3JVT B;  3WXA A;  4M2O A;  2EC6 C;  2FCE A;  1OQP A;  3EK8 A;  4FTG A;  3SG3 A;  1XYD A;  2K7B A;  1CLL A;  2JUL A;  3DVK A;  2LVJ A;  1KSM A;  1GQM A;  2Q4U A;  3LK1 A;  4GPL B;  2M97 A;  1Y0V H;  5J3X A;  1K94 A;  2BE4 A;  1ODB A;  1YUU A;  2R2I A;  4YI8 A;  1F55 A;  1J7P A;  1IJ6 A;  2JTT A;  5AEQ A;  4YRU A;  2LUX A;  3HCM A;  3DF0 B;  3OX5 A;  2ISD A;  2AUC A;  2CNP A;  3PN7 C;  2BBN A;  1S5G Y;  1PK0 D;  2M7N A;  4OVN F;  2DOQ A;  3M0W A;  2KQY A;  2KGR A;  2I7A A;  2M9G A;  1N0Y A;  1IWQ A;  1MQ1 A;  1NCY A;  2LLU A;  3EKJ A;  1DJY A;  1NX3 A;  4OKH A;  4R1E A;  3O4Y A;  3KEV A;  2LP2 A;  3I5F B;  1BU3 A;  2VRG A;  1S5G Z;  2BCX A;  1GGZ A;  1KK8 C;  3BUM B;  4PHJ A;  2JOJ A;  3NSO A;  1B8C A;  1XK4 C;  2EC6 B;  1GGW A;  2Q91 A;  2ZFD A;  2BCA A;  4DRW A;  1S3P A;  2LM5 A;  1A75 B;  2F3Z A;  2AAO A;  2PAL A;  3VRP A;  3I5I C;  5HKW A;  1SBJ A;  1FF1 A;  3AKB A;  2LLS A;  1S26 D;  2HQ8 A;  2WC8 A;  1A4P A;  5CSJ A;  1DT7 B;  1MWN A;  1QVI Y;  3IF7 A;  2CXJ A;  2PSR A;  2I18 A;  1CFP A;  4JPZ B;  4M2Q A;  1WLZ A;  4NDB A;  1WLM A;  1QV1 A;  1BOC A;  1LA0 A;  4P5O E;  3KHE A;  1NX1 A;  4YBH B;  4QJ4 B;  1C7V A;  2L2E A;  2L5X B;  2MBX A;  3PN7 B;  1TTX A;  1CKK A;  1M46 A;  1FBV A;  1QLK A;  3BUW B;  3A8R A;  4CLN A;  1KK7 Y;  5DKR A;  1AP4 A;  3FS7 A;  3SG2 A;  2KFF A;  1CTR A;  1AUI B;  3TUY B;  4HRH A;  1A2X A;  1OSA A;  4DS7 A;  1S6I A;  2MLF C;  5AER A;  2K2A A;  1NCX A;  1YUT A;  1KK8 B;  1F71 A;  1Y1A A;  3TDZ A;  4YGB B;  3EK4 A;  3CWG A;  1KQM C;  3OHM B;  4E68 A;  1NPQ A;  2LCP A;  2OTG C;  2JXC A;  1KFU L;  2M3W A;  3SIB A;  4ZCV A;  3WHT B;  1SL8 A;  3CR2 A;  3I5I B;  1UWO A;  1G8I A;  4UPG A;  3SG7 A;  2MHH A;  1CB1 A;  1XFU O;  1K95 A;  4WRI A;  3BOW A;  2M1K B;  1DTL A;  3PM8 A;  1CMG A;  1M31 A;  1UP5 A;  4PE4 A;  1FI6 A;  3JTD C;  2CCM A;  2G2B A;  1J7R A;  1DGU A;  1PUL A;  1Q80 A;  3BUO B;  4YGE B;  3ICB A;  3OP0 A;  1TNW A;  3D0Y B;  1LXF C;  2M0R A;  3BXK A;  1S36 A;  2KNE A;  2Y4Q A;  5CPV A;  1BR1 B;  1LVC D;  5HKZ A;  1JC2 A;  1DJH A;  5BPJ A;  3HX4 A;  3BYA A;  4A4B A;  1SMG A;  4CFQ A;  5DKQ A;  4GGF C;  1DJW A;  1MR8 A;  1V1G A;  1PAL A;  1J7O A;  1AHR A;  4CID A;  3RM1 A;  1TNX A;  1F4O A;  1KSO A;  3BUN B;  1KQM B;  4FQO A;  2JZI A;  2M1U A;  1F8H A;  4P2Y B;  3WNX B;  1IH0 A;  2OTG B;  3DVM A;  5CSI A;  3AKA A;  4YGD B;  2K61 A;  5GQQ C;  2LMU A;  3EVV A;  1WDC C;  1PSR A;  1OE9 B;  4DUQ A;  1B1G A;  1N2D A;  2JWW A;  1DGV A;  2JNF A;  1DF0 B;  1SKT A;  1CFC A;  1R6P A;  1JFK A;  3VRR A;  4PCW A;  1JBA A;  1K90 D;  1D1O A;  1B8L A;  1CDP A;  1KWO C;  3GK1 A;  3JTD B;  2K7D A;  1KFU S;  1K9U A;  4JWQ A;  1K9K A;  1BLQ A;  1K2H A;  4PHM A;  1U5I B;  1CDL A;  2LE9 B;  2M7L A;  3O2P A;  5K89 A;  1EH2 A;  1Y6W A;  1NIW A;  1TNQ A;  2KI4 C;  4OV2 A;  3CTN A;  2PMY A;  1M45 A;  1ZUZ A;  3CLN A;  4XJK A;  1TOP A;  3I5H C;  3VRQ A;  2LMT A;  5KTY A;  1TNP A;  1DJX A;  1W7J B;  1YUS A;  5AXI A;  2BKI B;  4C0L A;  2WCF A;  3QRX A;  1CLM A;  2F8P A;  1VRK A;  2TN4 A;  4HSZ A;  4GAO A;  1QAS A;  1AJ5 A;  2JC2 A;  3BQ3 A;  1WDC B;  1OMR A;  3GK2 A;  1QIV A;  1QX7 A;  2KAV A;  1DVI A;  2WOR A;  1ZMZ A;  3RLZ A;  1L7Z A;  3IQQ A;  2LUC A;  2ZN9 A;  2MRD A;  1XFW O;  2CBL A;  3KO0 A;  2JRF A;  2JPT A;  2PRU A;  4MZJ A;  3SG5 A;  2ZN8 A;  2MAZ A;  4ORC B;  1CFF A;  2NZ0 A;  1B8R A;  3AAJ A;  1CM1 A;  1XO5 A;  2L50 A;  4PE0 A;  2H61 C;  2KBM A;  4MRX A;  5B8I B;  1MF8 B;  2KAY A;  3VGO A;  4L9M A;  5TNC A;  2E6W A;  2L4I A;  5PAL A;  2KFH A;  1JUO A;  1M63 B;  4BY5 A;  2KBI A;  4USL A;  4YI9 A;  2KI4 B;  1RK9 A;  3OX6 A;  4GGN A;  2KOT A;  1EXR A;  5AFP A;  3CR5 X;  1RWY A;  3LCP C;  3I5H B;  3DD4 A;  2JU0 A;  5ER4 X;  3OB1 B;  2L4H A;  4NQG A;  3KF9 A;  1WRL A;  3PLF B;  1UHK A;  2K7C A;  1S1E A;  1JF2 A;  1V1F A;  1J1D A;  1SRA A;  1FPW A;  2I2R E;  2Y1N A;  2BBM A;  2QAC A;  5I8N A;  1KQV A;  5IBW A;  2OS8 C;  1DJG A;  5DKN A;  2ZRS A;  1UHI A;  1XVJ A;  4ORA B;  1LIN A;  2AMI A;  4PHK A;  2M8U A;  1F4Q A;  2KFG A;  1XA5 A;  3TS5 C;  1AJ4 A;  3WHU B;  1K8U A;  3BUX B;  4OR9 B;  1HT9 A;  2NCO A;  4D1E A;  1KCY A;  1SCM C;  1UHN A;  1XFX O;  3DVE A;  1K93 D;  4I5K A;  3ZNI A;  1JWD A;  1QV0 A;  1XFY O;  3EVU A;  3FIA A;  1WRZ A;  5ER5 A;  2SAS A;  2GV5 A;  1ALW A;  3EKH A;  3LK0 A;  1RRO A;  3TDI A;  3PSR A;  1OZO A;  1REC A;  5F6T A;  4I5L B;  1NWD A;  4ORB B;  1UHH A;  2L51 A;  3NSI A;  4TNC A;  3E3R A;  4MN0 A;  1G4Y R;  2F33 A;  3IQO A;  5HLO A;  3TZ1 A;  1AVS A;  1G33 A;  1YR5 A;  2ZND A;  2GGM A;  2OS8 B;  1IRJ A;  2LAN A;  3A4U B;  3PAT A;  5HKY A;  1QJT A;  4ZCU A;  1FW4 A;  4A4C A;  2Y5I A;  3SG4 A;  4WQ3 A;  3TDU A;  1JFJ A;  1GJY A;  1Y1X A;  1UUR A;  3O78 A;  1NX2 A;  1ZOT B;  5I2O A;  2JT0 A;  1KFX L;  2O5G A;  3TS5 B;  1PVB A;  2E30 A;  2KSP A;  3GK4 X;  4XJK B;  4HRG A;  1B7T Z;  2LVI A;  4MZL A;  1SR6 C;  2A4J A;  3CZT X;  2IS9 A;  2K8M B;  2KQ6 A;  1QS7 A;  1BG1 A;  1SCM B;  4MLW A;  3SIA A;  5CSN A;  4U8D A;  3SJS A;  3NXA A;  1CM4 A;  2CT9 A;  2BEC A;  1FI5 A;  1PSB A;  2GGZ A;  4N1F A;  2LHL A;  2BCB A; 
#chains in the Genus database with same CATH topology
 4YGA A;  1TCO B;  1YVL A;  2KI6 C;  1S6J A;  3R1P A;  4PE1 A;  4ETO A;  2WOS A;  4OCI A;  1W7I B;  1XFV O;  3R1V A;  4NDC A;  2WCJ A;  2BKH B;  1C7W A;  5D7F A;  1SNL A;  2JT8 A;  3FWB A;  1DJZ A;  1QIW A;  3PM2 A;  3LLE A;  3D76 A;  1CDM A;  2PAS A;  3D0Y A;  3MSE B;  1SK6 D;  2EGD A;  1SCV A;  2LP3 A;  4AQJ A;  1NYA A;  1R2U A;  4AQI A;  1BMO A;  1J1E A;  1F70 A;  1UUS A;  4DIR A;  1JF0 A;  1YX7 A;  2EHB A;  5AAN A;  1OOJ A;  2KDH A;  1C07 A;  4QJ3 B;  1QAT A;  1CLB A;  3ZWH A;  1YX8 A;  1SYM A;  3K21 A;  2BL0 C;  1MHO A;  2QEV A;  1SR6 B;  5KSZ A;  1QTX A;  2KI6 D;  1Y1U A;  2PVB A;  3CDN A;  1E8A A;  2JQ6 A;  1B9A A;  5G08 A;  1ALV A;  2BE6 A;  1RJV A;  1WY9 A;  1EL4 A;  2D8N A;  3EK7 A;  2L0P A;  5FI6 A;  2B1U A;  2KGB C;  1ZFS A;  2V53 A;  4MBE A;  4GUK A;  3VRN A;  1EG3 A;  4WQ2 A;  2JTZ A;  1KWO B;  1KFX S;  1QX2 A;  2LLT A;  4GBA A;  2P71 A;  4PHN A;  4MEW A;  1CDN A;  2HQW A;  2OPO A;  5DIC A;  3BFH A;  1BT6 A;  1DF0 A;  1IG5 A;  1MXE A;  2LMV A;  2HET A;  4MSP A;  2HPS A;  1EJ3 A;  1RFJ A;  2I94 A;  1YUR A;  2NLN A;  1LKJ A;  1AK8 A;  4GFT A;  5D69 A;  3TUY C;  3EVR A;  3PFV A;  1BOD A;  4PE7 A;  1ZAC A;  3KPX A;  3H4S E;  4DCK A;  2ZNE A;  1IQ5 A;  3CZ1 A;  2LVK A;  1ORG A;  1MXL C;  1GM0 A;  1NP8 A;  2WCL A;  4N5X A;  1HQV A;  1H4B A;  1U5I A;  4PAL A;  5JOL A;  3BOW B;  3B6X A;  4MVF A;  4C0K A;  3F45 A;  1DMO A;  1L2O C;  2Y1M A;  1S6C A;  2WCM A;  3PAL A;  3LL8 B;  2M49 B;  3NHI A;  5FI2 A;  3FWC A;  4GGF A;  4Q04 A;  3DF0 A;  1WRK A;  2BL0 B;  1SL9 A;  4C0J A;  2G9B A;  4NDD A;  3SG6 A;  3CGA A;  1TCF A;  2MA2 A;  5HYD A;  3I5G C;  1RTP 1;  4I5N B;  1X02 A;  1J55 A;  3L4A A;  1B47 A;  2WND A;  1YRT B;  4CFR A;  1CNP A;  4XYN A;  2LVV A;  5CSF A;  1CFD A;  1BJF A;  4JQ0 D;  1BR4 B;  1NUB A;  1SW8 A;  1QVI Z;  2F2O A;  2COL B;  3R1O A;  1QLS A;  3B7A A;  1QX5 B;  2HF5 A;  2NCP A;  3O4X A;  1K96 A;  1F54 A;  1DEK A;  1JSA A;  2LNK A;  2MJW B;  2JT3 A;  2P6B B;  5HLV A;  1A75 A;  4M2P A;  3N7H A;  1IGV A;  4AOM A;  3D73 A;  1NX0 A;  3SS3 A;  1K9P A;  1UHJ A;  4F0Z B;  1H8B A;  2CTN A;  1TN4 A;  2RGI A;  3DVJ A;  2F2P A;  5KU1 A;  1KK7 Z;  4GNK B;  1PRW A;  1A03 A;  5I2Q A;  1XFZ O;  2K2F A;  5FYX A;  3O6B A;  2K60 A;  1NSH A;  1L2O B;  3JVT C;  1YRU B;  3D10 A;  1OOG A;  2KYC A;  3D78 A;  1OZS A;  2QPT A;  3VB1 A;  1IJ5 A;  1J7Q A;  1M39 A;  1SY9 A;  1IKU A;  2BAP A;  2NXQ A;  1B7T Y;  1YTZ C;  3K1E A;  2K7O A;  2FOT A;  2KYF A;  2MLE C;  2LV7 A;  2L2C A;  2L98 A;  2O60 A;  3I5G B;  3GOF A;  1DJI A;  4CPV A;  1CMF A;  2LAP A;  4YGC B;  5JJG A;  4IL1 A;  4HRE E;  2QEB A;  3OB2 B;  2LC5 A;  1EG4 A;  1OMD A;  2SCP A;  2ZRT A;  3OBV A;  1TWO A;  2KPH A;  4I5J A;  3CS1 A;  1XK4 A;  3NSL A;  1MUX A;  2H2K A;  1LA3 A;  3RZS A;  4MRY A;  2K0J A;  2LHI A;  2ZKM X;  4PDZ A;  5I2L A;  1QXP A;  1Z4H A;  2WCB A;  1SPY A;  1B4C A;  2H8V A;  1IQ3 A;  3S0B A;  4ICB A;  1SL7 A;  1YVH A;  1OMV A;  1Z2C B;  1TRF A;  2H61 A;  3AAK A;  3NSK A;  2WCE A;  1BF5 A;  3DYE A;  4MZK A;  4PT1 A;  1PVA A;  3CR4 X;  4BY4 A;  2FJU B;  2KHN A;  3C1V A;  1TIZ A;  4QJ5 B;  2JNX A;  2KAX A;  1N65 A;  1DEL A;  2JXL A;  2FCD A;  2M29 A;  3B87 A;  1NCZ A;  2F3Y A;  3I5F C;  1A29 A;  3JVT B;  3NGV A;  3WXA A;  3S0F A;  4M2O A;  2EC6 C;  2FCE A;  1OQP A;  3EK8 A;  4FTG A;  3SG3 A;  1XYD A;  2K7B A;  1CLL A;  2JUL A;  3DVK A;  2LVJ A;  1KSM A;  1GQM A;  3D77 A;  2Q4U A;  3LK1 A;  3BJH A;  4GPL B;  2L5Y A;  2M97 A;  1Y0V H;  5J3X A;  1K94 A;  3S0D A;  2BE4 A;  1ODB A;  1YUU A;  2R2I A;  4YI8 A;  1F55 A;  1J7P A;  3L4L A;  1IJ6 A;  5HL1 A;  4FQT A;  5FI7 A;  3CZ2 A;  1SSE B;  2JTT A;  3CZ0 A;  5AEQ A;  4YRU A;  2LUX A;  3HCM A;  3DF0 B;  3OX5 A;  2ISD A;  1TUZ A;  2AUC A;  2CNP A;  2GTE A;  2WCK A;  2BBN A;  3PN7 C;  1S5G Y;  1PK0 D;  2M7N A;  4OVN F;  2DOQ A;  3M0W A;  2KQY A;  2KGR A;  2I7A A;  2M9G A;  1N0Y A;  1IWQ A;  1MQ1 A;  1NCY A;  2LLU A;  3EKJ A;  1DJY A;  1NX3 A;  4INX A;  4OKH A;  4R1E A;  3O4Y A;  3KEV A;  2LP2 A;  3I5F B;  1BU3 A;  2VRG A;  1S5G Z;  2BCX A;  1GGZ A;  1KK8 C;  3BUM B;  4PHJ A;  2JOJ A;  3NSO A;  1B8C A;  1XK4 C;  2EC6 B;  1GGW A;  2Q91 A;  2KLD A;  2ZFD A;  2BCA A;  3UNW A;  4DRW A;  1S3P A;  2LM5 A;  1A75 B;  3OGN A;  2F3Z A;  2AAO A;  2PAL A;  3S0G A;  3VRP A;  3I5I C;  5HKW A;  1SBJ A;  3FE9 A;  1OOI X;  1FF1 A;  3AKB A;  2LLS A;  1P28 A;  4OZD A;  1S26 D;  2HQ8 A;  2WC8 A;  1A4P A;  5CSJ A;  1DT7 B;  1MWN A;  1QVI Y;  3IF7 A;  2CXJ A;  2PSR A;  2I18 A;  1CFP A;  4JPZ B;  4M2Q A;  1WLZ A;  4NDB A;  1WLM A;  1QV1 A;  1BOC A;  1LA0 A;  2YGU A;  4P5O E;  1C3Z A;  3D74 A;  1NX1 A;  3KHE A;  4YBH B;  4QJ4 B;  2L2E A;  2L5X B;  2MBX A;  3PN7 B;  1TTX A;  1C7V A;  1CKK A;  1M46 A;  1FBV A;  1QLK A;  3BUW B;  3A8R A;  4CLN A;  1KK7 Y;  5DKR A;  1AP4 A;  3FS7 A;  3SG2 A;  2KFF A;  3SS4 A;  1CTR A;  1AUI B;  3TUY B;  4HRH A;  1A2X A;  1OSA A;  4DS7 A;  1S6I A;  2MLF C;  5AER A;  2K2A A;  1YUT A;  1NCX A;  1KK8 B;  1W9Z A;  1Y1A A;  1F71 A;  3TDZ A;  4YGB B;  3EK4 A;  3CWG A;  1KQM C;  3OHM B;  3DXL A;  3FE6 A;  2KLE A;  4E68 A;  1NPQ A;  2LCP A;  2OTG C;  2JXC A;  1KFU L;  2WC5 A;  2M3W A;  3SIB A;  4ZCV A;  3WHT B;  1SL8 A;  3CR2 A;  3I5I B;  1UWO A;  3DZT A;  4IJ7 A;  1G8I A;  4UPG A;  3SG7 A;  2MHH A;  1CB1 A;  1XFU O;  1K95 A;  4WRI A;  3BOW A;  2M1K B;  1DTL A;  3PM8 A;  1CMG A;  1M31 A;  1UP5 A;  3D75 A;  4PE4 A;  2P70 A;  1FI6 A;  3JTD C;  3PJI A;  3FE8 A;  2CCM A;  2G2B A;  1J7R A;  1DGU A;  1PUL A;  1Q80 A;  3BUO B;  4YGE B;  3ICB A;  3OP0 A;  1TNW A;  3D0Y B;  1LXF C;  2M0R A;  3VRO A;  3BXK A;  1S36 A;  4JD9 A;  2KNE A;  2PQL A;  2Y4Q A;  3NHT A;  5CPV A;  1BR1 B;  1LVC D;  5HKZ A;  1JC2 A;  1DJH A;  5BPJ A;  3HX4 A;  3BYA A;  4A4B A;  1SMG A;  4CFQ A;  5DKQ A;  4GGF C;  1DJW A;  1MR8 A;  1DC1 A;  1V1G A;  1PAL A;  1J7O A;  1AHR A;  4CID A;  3RM1 A;  3S0A A;  2ERB A;  1TNX A;  1F4O A;  1KSO A;  3BUN B;  3R72 A;  1KQM B;  4FQO A;  2JZI A;  2M1U A;  1F8H A;  4F7F A;  4P2Y B;  1DQE A;  3WNX B;  1IH0 A;  2OTG B;  3DVM A;  5CSI A;  3AKA A;  4YGD B;  2K61 A;  5GQQ C;  2LMU A;  3EVV A;  1WDC C;  1PSR A;  1OE9 B;  4DUQ A;  1B1G A;  1N2D A;  2JWW A;  1DGV A;  2QDI A;  2JNF A;  1DF0 B;  1SKT A;  1CFC A;  1R6P A;  1JFK A;  3VRR A;  4PCW A;  1JBA A;  1K90 D;  1D1O A;  1B8L A;  1CDP A;  1KWO C;  3GK1 A;  3JTD B;  2K7D A;  1KFU S;  3BFB A;  1K9U A;  4JWQ A;  1K9K A;  1BLQ A;  1K2H A;  4PHM A;  1U5I B;  1CDL A;  2LE9 B;  3B86 A;  3O2P A;  4INW A;  2M7L A;  5K89 A;  1EH2 A;  1Y6W A;  1NIW A;  1TNQ A;  2KI4 C;  4OV2 A;  3CTN A;  2PMY A;  1M45 A;  1ZUZ A;  3CLN A;  3EG5 B;  3Q8I A;  4XJK A;  1TOP A;  3I5H C;  3VRQ A;  2LMT A;  1OOF A;  5KTY A;  5EL2 A;  1TNP A;  1DJX A;  1W7J B;  1YUS A;  4JKT A;  5AXI A;  2BKI B;  2WC6 A;  4C0L A;  2WCF A;  3QRX A;  1CLM A;  2F8P A;  1VRK A;  2TN4 A;  3BFA A;  1IIO A;  4HSZ A;  4GAO A;  1QAS A;  1AJ5 A;  2FJY A;  2JC2 A;  3BQ3 A;  1WDC B;  2QEH A;  1OMR A;  3SS5 A;  3GK2 A;  1QIV A;  2BNX A;  1QX7 A;  2KAV A;  1DVI A;  2WOR A;  1ZMZ A;  3RLZ A;  1L7Z A;  3IQQ A;  2LUC A;  2ZN9 A;  2MRD A;  1XFW O;  2CBL A;  2WCH A;  2JRF A;  3KO0 A;  2JPT A;  3CAB A;  2PRU A;  4MZJ A;  3SG5 A;  2ZN8 A;  2MAZ A;  4ORC B;  1CFF A;  5I94 A;  2NZ0 A;  1B8R A;  3AAJ A;  1CM1 A;  1XO5 A;  2L50 A;  3IVT A;  4PE0 A;  2H61 C;  5D3O A;  2KBM A;  4MRX A;  5B8I B;  1MF8 B;  1C3Y A;  2KAY A;  3VGO A;  4L9M A;  5TNC A;  2E6W A;  3S0E A;  1T14 A;  2L4I A;  5PAL A;  2KFH A;  1JUO A;  1M63 B;  4BY5 A;  2KBI A;  4USL A;  4YI9 A;  2KI4 B;  1RK9 A;  3OX6 A;  4GGN A;  2KOT A;  1EXR A;  5AFP A;  3CR5 X;  1RWY A;  3LCP C;  3I5H B;  3DD4 A;  2JU0 A;  4KYN A;  5ER4 X;  3OB1 B;  2L4H A;  4N1G A;  4NQG A;  3KF9 A;  1WRL A;  3PLF B;  1UHK A;  2K7C A;  1S1E A;  1JF2 A;  1V1F A;  1J1D A;  1SRA A;  1FPW A;  2I2R E;  2Y1N A;  2BBM A;  2QAC A;  5I8N A;  1KQV A;  5IBW A;  2OS8 C;  1DJG A;  5DKN A;  2ZRS A;  1UHI A;  1XVJ A;  4ORA B;  1LIN A;  2AMI A;  4PHK A;  2M8U A;  2PYQ A;  3DY9 A;  1F4Q A;  2KFG A;  1XA5 A;  2JPO A;  3TS5 C;  1AJ4 A;  3WHU B;  3UO9 A;  1K8U A;  3BUX B;  3QME A;  1HT9 A;  4OR9 B;  2NCO A;  3V2L A;  4D1E A;  1KCY A;  1SCM C;  1UHN A;  1XFX O;  3DVE A;  1K93 D;  4I5K A;  3ZNI A;  1JWD A;  1QV0 A;  1XFY O;  3EVU A;  3FIA A;  1WRZ A;  5ER5 A;  2QEO A;  2SAS A;  2GV5 A;  1ALW A;  3EKH A;  3LK0 A;  1RRO A;  3TDI A;  3PSR A;  1OZO A;  1REC A;  5F6T A;  4I5L B;  1NWD A;  4ORB B;  1UHH A;  2L51 A;  3NSI A;  4TNC A;  3E3R A;  4MN0 A;  1G4Y R;  2F33 A;  3IQO A;  5HLO A;  1LS8 A;  1AVS A;  1G33 A;  3B88 A;  1YR5 A;  3TZ1 A;  2ZND A;  2GGM A;  2OS8 B;  1OOH A;  1IRJ A;  2LAN A;  3A4U B;  3PAT A;  5HKY A;  1QJT A;  4ZCU A;  1FW4 A;  4A4C A;  2Y5I A;  3SG4 A;  3L47 A;  4WQ3 A;  3TDU A;  1JFJ A;  1TUJ A;  1GJY A;  1Y1X A;  1UUR A;  3O78 A;  1NX2 A;  1ZOT B;  5I2O A;  2JT0 A;  1KFX L;  2O5G A;  3TS5 B;  1PVB A;  2E30 A;  2KSP A;  3GK4 X;  4XJK B;  3CYZ A;  4HRG A;  1B7T Z;  1OW4 A;  2LVI A;  4MZL A;  1SR6 C;  2A4J A;  3CZT X;  1XFR A;  2IS9 A;  2K8M B;  2KQ6 A;  1QS7 A;  1BG1 A;  1SCM B;  1QWV A;  4MLW A;  3SIA A;  5CSN A;  4U8D A;  3SJS A;  3NXA A;  1CM4 A;  2CT9 A;  2BEC A;  1FI5 A;  1PSB A;  2GGZ A;  4N1F A;  2LHL A;  2BCB A; 
#chains in the Genus database with same CATH homology
 4YGA A;  1TCO B;  1YVL A;  2KI6 C;  1S6J A;  4PE1 A;  4ETO A;  2WOS A;  4OCI A;  1W7I B;  1XFV O;  4NDC A;  2BKH B;  1C7W A;  5D7F A;  1SNL A;  2JT8 A;  3FWB A;  1DJZ A;  1QIW A;  3LLE A;  1CDM A;  2PAS A;  3D0Y A;  3MSE B;  1SK6 D;  2EGD A;  1SCV A;  2LP3 A;  4AQJ A;  1NYA A;  1R2U A;  4AQI A;  1BMO A;  1J1E A;  1F70 A;  1UUS A;  4DIR A;  1JF0 A;  1YX7 A;  2EHB A;  5AAN A;  1OOJ A;  2KDH A;  1C07 A;  4QJ3 B;  1QAT A;  1CLB A;  3ZWH A;  1YX8 A;  1SYM A;  3K21 A;  2BL0 C;  1MHO A;  1SR6 B;  5KSZ A;  1QTX A;  2KI6 D;  1Y1U A;  2PVB A;  1E8A A;  2JQ6 A;  1B9A A;  5G08 A;  1ALV A;  2BE6 A;  1RJV A;  1WY9 A;  1EL4 A;  2D8N A;  3EK7 A;  2L0P A;  2B1U A;  2KGB C;  1ZFS A;  2V53 A;  4MBE A;  4GUK A;  3VRN A;  1EG3 A;  4WQ2 A;  2JTZ A;  1KWO B;  1KFX S;  1QX2 A;  2LLT A;  4GBA A;  4PHN A;  4MEW A;  1CDN A;  2HQW A;  2OPO A;  1BT6 A;  1DF0 A;  1IG5 A;  1MXE A;  2LMV A;  2HET A;  4MSP A;  2HPS A;  1EJ3 A;  1RFJ A;  2I94 A;  1YUR A;  2NLN A;  1LKJ A;  1AK8 A;  4GFT A;  5D69 A;  3TUY C;  3EVR A;  3PFV A;  1BOD A;  4PE7 A;  1ZAC A;  3KPX A;  3H4S E;  4DCK A;  2ZNE A;  1IQ5 A;  2LVK A;  1MXL C;  1NP8 A;  4N5X A;  1HQV A;  1H4B A;  1U5I A;  4PAL A;  5JOL A;  3BOW B;  4MVF A;  4C0K A;  3F45 A;  1DMO A;  1L2O C;  2Y1M A;  1S6C A;  3PAL A;  3LL8 B;  2M49 B;  3FWC A;  4GGF A;  4Q04 A;  3DF0 A;  1WRK A;  2BL0 B;  1SL9 A;  4C0J A;  2G9B A;  4NDD A;  3SG6 A;  3CGA A;  1TCF A;  2MA2 A;  5HYD A;  3I5G C;  1RTP 1;  4I5N B;  1X02 A;  1J55 A;  1CNP A;  1B47 A;  2WND A;  1YRT B;  4CFR A;  4XYN A;  2LVV A;  5CSF A;  1CFD A;  1BJF A;  4JQ0 D;  1BR4 B;  1NUB A;  1SW8 A;  1QVI Z;  2F2O A;  2COL B;  1QLS A;  1QX5 B;  2HF5 A;  2NCP A;  1K96 A;  1F54 A;  1JSA A;  2LNK A;  2MJW B;  2JT3 A;  2P6B B;  5HLV A;  1A75 A;  4M2P A;  1IGV A;  4AOM A;  1NX0 A;  1K9P A;  1UHJ A;  4F0Z B;  1H8B A;  2CTN A;  1TN4 A;  2RGI A;  3DVJ A;  2F2P A;  5KU1 A;  1KK7 Z;  4GNK B;  1PRW A;  1A03 A;  5I2Q A;  1XFZ O;  2K2F A;  5FYX A;  3O6B A;  1NSH A;  1L2O B;  3JVT C;  1YRU B;  3D10 A;  2KYC A;  1OZS A;  2QPT A;  1IJ5 A;  1J7Q A;  1M39 A;  1SY9 A;  1IKU A;  2NXQ A;  1B7T Y;  1YTZ C;  2K7O A;  2FOT A;  2KYF A;  2MLE C;  2LV7 A;  2L98 A;  2O60 A;  3I5G B;  3GOF A;  1DJI A;  4CPV A;  1CMF A;  2LAP A;  4YGC B;  5JJG A;  4IL1 A;  4HRE E;  3OB2 B;  2LC5 A;  1EG4 A;  1OMD A;  2SCP A;  2ZRT A;  4I5J A;  3CS1 A;  1XK4 A;  3NSL A;  1MUX A;  2H2K A;  1LA3 A;  4MRY A;  2K0J A;  2LHI A;  2ZKM X;  4PDZ A;  5I2L A;  1QXP A;  2WCB A;  1SPY A;  1B4C A;  1IQ3 A;  4ICB A;  1SL7 A;  1YVH A;  1OMV A;  1TRF A;  2H61 A;  3AAK A;  3NSK A;  2WCE A;  1BF5 A;  4MZK A;  1PVA A;  3CR4 X;  4BY4 A;  2FJU B;  2KHN A;  3C1V A;  1TIZ A;  4QJ5 B;  2JNX A;  2KAX A;  1N65 A;  3VRO A;  2JXL A;  2FCD A;  2M29 A;  3I5F C;  1NCZ A;  2F3Y A;  4N1G A;  1A29 A;  3JVT B;  3WXA A;  4M2O A;  2EC6 C;  2FCE A;  1OQP A;  3EK8 A;  4FTG A;  3SG3 A;  1XYD A;  2K7B A;  1CLL A;  2JUL A;  3DVK A;  2LVJ A;  1KSM A;  1GQM A;  2Q4U A;  3LK1 A;  4GPL B;  2M97 A;  1Y0V H;  5J3X A;  1K94 A;  2BE4 A;  1ODB A;  1YUU A;  2R2I A;  4YI8 A;  1F55 A;  1J7P A;  1IJ6 A;  2JTT A;  5AEQ A;  4YRU A;  2LUX A;  3HCM A;  3DF0 B;  3OX5 A;  2ISD A;  2AUC A;  2CNP A;  3PN7 C;  2BBN A;  1S5G Y;  1PK0 D;  2M7N A;  4OVN F;  2DOQ A;  3M0W A;  2KQY A;  2KGR A;  2I7A A;  2M9G A;  1N0Y A;  1IWQ A;  1MQ1 A;  1NCY A;  2LLU A;  3EKJ A;  1DJY A;  1NX3 A;  4OKH A;  4R1E A;  3O4Y A;  3KEV A;  2LP2 A;  3I5F B;  1BU3 A;  2VRG A;  1S5G Z;  2BCX A;  1GGZ A;  1KK8 C;  3BUM B;  4PHJ A;  2JOJ A;  3NSO A;  1B8C A;  1XK4 C;  2EC6 B;  1GGW A;  2Q91 A;  2ZFD A;  2BCA A;  4DRW A;  1S3P A;  2LM5 A;  1A75 B;  2F3Z A;  2AAO A;  2PAL A;  3VRP A;  3I5I C;  5HKW A;  1SBJ A;  1FF1 A;  3AKB A;  2LLS A;  1S26 D;  2HQ8 A;  2WC8 A;  1A4P A;  5CSJ A;  1DT7 B;  1MWN A;  1QVI Y;  3IF7 A;  2CXJ A;  2PSR A;  2I18 A;  1CFP A;  4JPZ B;  4M2Q A;  1WLZ A;  4NDB A;  1WLM A;  1QV1 A;  1BOC A;  1LA0 A;  4P5O E;  3KHE A;  1NX1 A;  4YBH B;  4QJ4 B;  1C7V A;  2L2E A;  2L5X B;  2MBX A;  3PN7 B;  1TTX A;  1CKK A;  1M46 A;  1FBV A;  1QLK A;  3BUW B;  3A8R A;  4CLN A;  1KK7 Y;  5DKR A;  1AP4 A;  3FS7 A;  3SG2 A;  2KFF A;  1CTR A;  1AUI B;  3TUY B;  4HRH A;  1A2X A;  1OSA A;  4DS7 A;  1S6I A;  2MLF C;  5AER A;  2K2A A;  1NCX A;  1YUT A;  1KK8 B;  1F71 A;  1Y1A A;  3TDZ A;  4YGB B;  3EK4 A;  3CWG A;  1KQM C;  3OHM B;  4E68 A;  1NPQ A;  2LCP A;  2OTG C;  2JXC A;  1KFU L;  2M3W A;  3SIB A;  4ZCV A;  3WHT B;  1SL8 A;  3CR2 A;  3I5I B;  1UWO A;  1G8I A;  4UPG A;  3SG7 A;  2MHH A;  1CB1 A;  1XFU O;  1K95 A;  4WRI A;  3BOW A;  2M1K B;  1DTL A;  3PM8 A;  1CMG A;  1M31 A;  1UP5 A;  4PE4 A;  1FI6 A;  3JTD C;  2CCM A;  2G2B A;  1J7R A;  1DGU A;  1PUL A;  1Q80 A;  3BUO B;  4YGE B;  3ICB A;  3OP0 A;  1TNW A;  3D0Y B;  1LXF C;  2M0R A;  3BXK A;  1S36 A;  2KNE A;  2Y4Q A;  5CPV A;  1BR1 B;  1LVC D;  5HKZ A;  1JC2 A;  1DJH A;  5BPJ A;  3HX4 A;  3BYA A;  4A4B A;  1SMG A;  4CFQ A;  5DKQ A;  4GGF C;  1DJW A;  1MR8 A;  1V1G A;  1PAL A;  1J7O A;  1AHR A;  4CID A;  3RM1 A;  1TNX A;  1F4O A;  1KSO A;  3BUN B;  1KQM B;  4FQO A;  2JZI A;  2M1U A;  1F8H A;  4P2Y B;  3WNX B;  1IH0 A;  2OTG B;  3DVM A;  5CSI A;  3AKA A;  4YGD B;  2K61 A;  5GQQ C;  2LMU A;  3EVV A;  1WDC C;  1PSR A;  1OE9 B;  4DUQ A;  1B1G A;  1N2D A;  2JWW A;  1DGV A;  2JNF A;  1DF0 B;  1SKT A;  1CFC A;  1R6P A;  1JFK A;  3VRR A;  4PCW A;  1JBA A;  1K90 D;  1D1O A;  1B8L A;  1CDP A;  1KWO C;  3GK1 A;  3JTD B;  2K7D A;  1KFU S;  1K9U A;  4JWQ A;  1K9K A;  1BLQ A;  1K2H A;  4PHM A;  1U5I B;  1CDL A;  2LE9 B;  2M7L A;  3O2P A;  5K89 A;  1EH2 A;  1Y6W A;  1NIW A;  1TNQ A;  2KI4 C;  4OV2 A;  3CTN A;  2PMY A;  1M45 A;  1ZUZ A;  3CLN A;  4XJK A;  1TOP A;  3I5H C;  3VRQ A;  2LMT A;  5KTY A;  1TNP A;  1DJX A;  1W7J B;  1YUS A;  5AXI A;  2BKI B;  4C0L A;  2WCF A;  3QRX A;  1CLM A;  2F8P A;  1VRK A;  2TN4 A;  4HSZ A;  4GAO A;  1QAS A;  1AJ5 A;  2JC2 A;  3BQ3 A;  1WDC B;  1OMR A;  3GK2 A;  1QIV A;  1QX7 A;  2KAV A;  1DVI A;  2WOR A;  1ZMZ A;  3RLZ A;  1L7Z A;  3IQQ A;  2LUC A;  2ZN9 A;  2MRD A;  1XFW O;  2CBL A;  3KO0 A;  2JRF A;  2JPT A;  2PRU A;  4MZJ A;  3SG5 A;  2ZN8 A;  2MAZ A;  4ORC B;  1CFF A;  2NZ0 A;  1B8R A;  3AAJ A;  1CM1 A;  1XO5 A;  2L50 A;  4PE0 A;  2H61 C;  2KBM A;  4MRX A;  5B8I B;  1MF8 B;  2KAY A;  3VGO A;  4L9M A;  5TNC A;  2E6W A;  2L4I A;  5PAL A;  2KFH A;  1JUO A;  1M63 B;  4BY5 A;  2KBI A;  4USL A;  4YI9 A;  2KI4 B;  1RK9 A;  3OX6 A;  4GGN A;  2KOT A;  1EXR A;  5AFP A;  3CR5 X;  1RWY A;  3LCP C;  3I5H B;  3DD4 A;  2JU0 A;  5ER4 X;  3OB1 B;  2L4H A;  4NQG A;  3KF9 A;  1WRL A;  3PLF B;  1UHK A;  2K7C A;  1S1E A;  1JF2 A;  1V1F A;  1J1D A;  1SRA A;  1FPW A;  2I2R E;  2Y1N A;  2BBM A;  2QAC A;  5I8N A;  1KQV A;  5IBW A;  2OS8 C;  1DJG A;  5DKN A;  2ZRS A;  1UHI A;  1XVJ A;  4ORA B;  1LIN A;  2AMI A;  4PHK A;  2M8U A;  1F4Q A;  2KFG A;  1XA5 A;  3TS5 C;  1AJ4 A;  3WHU B;  1K8U A;  3BUX B;  4OR9 B;  1HT9 A;  2NCO A;  4D1E A;  1KCY A;  1SCM C;  1UHN A;  1XFX O;  3DVE A;  1K93 D;  4I5K A;  3ZNI A;  1JWD A;  1QV0 A;  1XFY O;  3EVU A;  3FIA A;  1WRZ A;  5ER5 A;  2SAS A;  2GV5 A;  1ALW A;  3EKH A;  3LK0 A;  1RRO A;  3TDI A;  3PSR A;  1OZO A;  1REC A;  5F6T A;  4I5L B;  1NWD A;  4ORB B;  1UHH A;  2L51 A;  3NSI A;  4TNC A;  3E3R A;  4MN0 A;  1G4Y R;  2F33 A;  3IQO A;  5HLO A;  3TZ1 A;  1AVS A;  1G33 A;  1YR5 A;  2ZND A;  2GGM A;  2OS8 B;  1IRJ A;  2LAN A;  3A4U B;  3PAT A;  5HKY A;  1QJT A;  4ZCU A;  1FW4 A;  4A4C A;  2Y5I A;  3SG4 A;  4WQ3 A;  3TDU A;  1JFJ A;  1GJY A;  1Y1X A;  1UUR A;  3O78 A;  1NX2 A;  1ZOT B;  5I2O A;  2JT0 A;  1KFX L;  2O5G A;  3TS5 B;  1PVB A;  2E30 A;  2KSP A;  3GK4 X;  4XJK B;  4HRG A;  1B7T Z;  2LVI A;  4MZL A;  1SR6 C;  2A4J A;  3CZT X;  2IS9 A;  2K8M B;  2KQ6 A;  1QS7 A;  1BG1 A;  1SCM B;  4MLW A;  3SIA A;  5CSN A;  4U8D A;  3SJS A;  3NXA A;  1CM4 A;  2CT9 A;  2BEC A;  1FI5 A;  1PSB A;  2GGZ A;  4N1F A;  2LHL A;  2BCB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...