2LVIA

Solution structure of apo-phl p 7
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
77
structure length
77
Chain Sequence
ADDMERIFKRFDTNGDGKISLSELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFNEFISFCNANPGLMKDVAKVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polcalcin Phl p 7
publication title Solution structures of polcalcin Phl p 7 in three ligation states: Apo-, hemi-Mg(2+) -bound, and fully Ca(2+) -bound.
pubmed doi rcsb
source organism Phleum pratense
molecule tags Allergen
total genus 6
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2012-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2lviA00
2K7OA 2GGMA 1YVLA 3H4SE 1KFXS 1ALVA 1CDLA 2M8UA 1AHRA 3CR5X 3KPXA 1EL4A 1BODA 1QVIY 2KAYA 1NCYA 3PALA 4YRUA 2M97A 1K94A 1S6CA 3GK4X 1QX5B 4NQGA 2F33A 1JF0A 4MZJA 5CSJA 4YGCB 4YGBB 1N65A 4PHMA 4CFRA 1XVJA 3VROA 4IL1A 2LLUA 5I2OA 5HLVA 2KI4B 2OTGC 1SCMB 1HT9A 1U5IA 1FBVA 2EHBA 3JVTB 5ER4X 3I5IB 3JTDB 4QJ4B 5G08A 3CGAA 1K9PA 2KAXA 2O5GA 2P6BB 2PMYA 4PCWA 1QLSA 4PE1A 3VRQA 3MSEB 4MRXA 2FCEA 1Y6WA 1YURA 1R2UA 4PE4A 1RROA 1NX1A 3PSRA 2HQWA 1B8LA 1ODBA 4MEWA 1MF8B 2KGRA 3SG7A 4MLWA 2JQ6A 1S26D 3DVEA 2PASA 2JOJA 3DD4A 1X02A 2QACA 2ISDA 2LLTA 3JTDC 1B8RA 1ZUZA 3DF0A 2H61C 2Q91A 2TN4A 2ZRTA 3IQQA 3PN7B 5DKRA 3PM8A 1OQPA 5CSIA 2H2KA 1IKUA 2MA2A 1YX8A 1JUOA 1LVCD 2M7NA 5TNCA 1PSRA 1MWNA 2HQ8A 2JT3A 2PVBA 4HRGA 3VRRA 4YGAA 1K9KA 3TS5C 4WRIA 3I5HC 2LHLA 2F8PA 1YVHA 5CSNA 3DVMA 3IQOA 2KFGA 3NXAA 1LA3A 1BU3A 1UHIA 4DCKA 1CLLA 2KGBC 1C7VA 2HF5A 2K0JA 2KBMA 1CMFA 1UHJA 3D0YB 4I5JA 2F3ZA 1LKJA 1C07A 2KI6C 4ETOA 4P5OE 2PSRA 1JWDA 1LXFC 5I2LA 4A4CA 1OE9B 4ORAB 1MHOA 1KWOB 1DMOA 3BUOB 1DGVA 1PRWA 2K7DA 1F4OA 2L0PA 1KSMA 1KK8B 3EVRA 3A4UB 2Y5IA 1XFWO 3HCMA 1LINA 1XFYO 4QJ3B 3CZTX 1KQVA 2BCBA 1AVSA 3NSIA 4C0KA 4C0LA 1UHHA 1NYAA 4A4BA 2KSPA 2ZRSA 1J7OA 1GJYA 3CLNA 1G33A 3I5FC 1UWOA 1S5GZ 3TZ1A 1B47A 4GGFA 2KAVA 3O6BA 1G4YR 1FI6A 1TNQA 2MBXA 3EKHA 3WHUB 1QIWA 5CPVA 3FWCA 1DVIA 1YX7A 2ZN8A 1BR1B 2JRFA 3BOWB 4GPLB 5D7FA 3WXAA 1BLQA 1ZOTB 1LA0A 5AANA 2Y4QA 1KQMC 2KFFA 2LMTA 4PHJA 2LE9B 3A8RA 1CFFA 3KO0A 4GNKB 2WC8A 1PALA 2CNPA 5IBWA 1FI5A 2CBLA 4XJKB 2AMIA 2PRUA 2M3WA 3RLZA 1Y1AA 5HLOA 1MQ1A 1FF1A 3TDZA 1CFCA 1Y1UA 1AK8A 2CXJA 1BG1A 4CLNA 1UP5A 1OMRA 2MHHA 4AOMA 1SBJA 2OPOA 2COLB 1K96A 1PULA 1NX3A 2LVKA 3ZWHA 3FWBA 1G8IA 3FIAA 3D0YA 4M2OA 1IGVA 1XK4C 2KDHA 1YUUA 4USLA 1WRLA 1RK9A 2BL0B 3EKJA 1K9UA 1EG3A 4YI9A 1DJYA 1MR8A 1SKTA 1D1OA 2JNXA 2FJUB 1TCOB 1CKKA 1ALWA 1RWYA 3DVKA 1TIZA 1DJHA 3AAJA 4N1FA 4BY5A 1AP4A 2KOTA 1IH0A 2KI4C 1Y0VH 2G9BA 1SCMC 2F2OA 1DJGA 5JJGA 2D8NA 2BE4A 3JVTC 4MBEA 4PALA 1DTLA 2LNKA 4N1GA 2NCPA 3I5IC 3KEVA 1V1GA 3O78A 3PATA 5PALA 1QATA 1JC2A 5D69A 5HKWA 5I8NA 3TDIA 4C0JA 4CPVA 1OZSA 2LM5A 1C7WA 4GGFC 2ZN9A 5I2QA 2SCPA 1ZMZA 1A2XA 2KNEA 1J1EA 2CTNA 3CR2A 1UHNA 4PHKA 1S5GY 3BYAA 1PVBA 1DJXA 2OS8B 1KSOA 1JSAA 1SL9A 1QX2A 1CM1A 3CWGA 1SY9A 4JWQA 2I94A 2LUXA 2NCOA 2FCDA 2ZNDA 1GQMA 4M2QA 2JT0A 3GOFA 4P2YB 1B4CA 2K7CA 3EK8A 3PN7C 4Q04A 5KSZA 3I5GB 1CFPA 4OR9B 2LMUA 4NDCA 2V53A 3BUWB 1UURA 3LL8B 1TOPA 2BCAA 5BPJA 3LCPC 2KQ6A 4GBAA 2E6WA 3ICBA 1A03A 3VRNA 5AERA 2B1UA 2DOQA 1XYDA 2JPTA 1J7PA 1M46A 1NX2A 4WQ2A 4XJKA 1B7TZ 1XK4A 5CSFA 1SL7A 1NUBA 1A4PA 1QLKA 3EK7A 1R6PA 1QS7A 3OB1B 4OVNF 2RGIA 1GGWA 2LV7A 2JXCA 3OX6A 3TUYB 1CLBA 1AJ4A 1SR6B 2AUCA 2JULA 4CIDA 1F54A 1V1FA 3FS7A 2QPTA 1KFUL 1N0YA 3OHMB 1OZOA 3WHTB 2M49B 2I2RE 2LVIA 2Q4UA 1UHKA 4N5XA 2EC6B 5AFPA 1JBAA 4DIRA 1QV1A 1K90D 2JC2A 3SJSA 1SNLA 2L98A 1M39A 3LK0A 1TNPA 1OSAA 3SG5A 4F0ZB 1U5IB 1XFVO 2M9GA 1KWOC 2WORA 1JFJA 1BJFA 2KQYA 1L7ZA 1DGUA 2LUCA 2A4JA 1L2OB 1MUXA 3DVJA 4MN0A 1WLMA 4AQJA 1DJZA 1KK8C 1RTP1 2EC6C 5AEQA 4ORCB 3VGOA 1FPWA 2BBMA 2BKHB 2Y1NA 1B8CA 2Y1MA 2O60A 1W7IB 4BY4A 4TNCA 1BMOA 1WDCB 4MZKA 1K93D 1J1DA 3F45A 3CR4X 3HX4A 3PFVA 1BT6A 1CFDA 1IQ5A 3D10A 1SK6D 1QX7A 2CT9A 3EK4A 3LK1A 2L2EA 5ER5A 4PHNA 1J7QA 1CDPA 1IWQA 3VRPA 2KFHA 4FQOA 2WCEA 1NCXA 1EH2A 1SCVA 4GFTA 1NPQA 3O4YA 4PE7A 1E8AA 3SG3A 2M0RA 2L51A 2JNFA 2JXLA 1NWDA 2ZNEA 4MZLA 1K8UA 4ZCVA 5HKZA 1EXRA 1KFXL 1RJVA 3E3RA 4AQIA 2BBNA 3SG6A 1FW4A 2JZIA 2K2FA 1B1GA 3CTNA 2L5XB 4I5KA 1W7JB 1MXLC 4UPGA 1MXEA 1XFUO 2L50A 2MAZA 1B7TY 2JTTA 2MRDA 2OTGB 1B9AA 3BUXB 2F2PA 1F4QA 1GGZA 4QJ5B 4GUKA 2LANA 1QJTA 4YBHB 1F8HA 2LP3A 4I5LB 1H8BA 4YI8A 1S6IA 5DKQA 4YGDB 4NDBA 1SL8A 2LHIA 4R1EA 1UUSA 1WRKA 3OB2B 4HREE 1F71A 1NCZA 2BL0C 1PVAA 1KCYA 2CCMA 2WOSA 1IRJA 1PK0D 4OKHA 1ZFSA 2K7BA 4DS7A 1S1EA 2JU0A 4E68A 1H4BA 4FTGA 1TN4A 2E30A 1TTXA 3C1VA 1M45A 4D1EA 2KYCA 1AJ5A 1TCFA 2LCPA 4JQ0D 5KTYA 2MLFC 3GK2A 4NDDA 5B8IB 1WY9A 2WCBA 2ZFDA 3TDUA 2HPSA 4OV2A 2LAPA 2BECA 2GV5A 1YRUB 4ORBB 1F70A 2M29A 1IG5A 1TRFA 3GK1A 2K8MB 2I18A 4OCIA 5KU1A 3TS5B 1KK7Y 1YRTB 2NZ0A 4CFQA 3I5HB 1J7RA 2HETA 3CS1A 1TNXA 1DF0B 1YR5A 3BOWA 1QIVA 4MSPA 3BQ3A 3NSOA 2IS9A 1A75B 2LP2A 1SRAA 4ICBA 2EGDA 1PSBA 1DJIA 4L9MA 3AAKA 1CDMA 2OS8C 4HSZA 5HYDA 4MRYA 1F55A 1M31A 4XYNA 1VRKA 1NX0A 2LLSA 1SMGA 1CDNA 1EJ3A 4U8DA 2BKIB 2NXQA 4YGEB 2LVJA 3I5GC 1QVIZ 4ZCUA 1IJ5A 2KHNA 3EVUA 1N2DA 3AKBA 5JOLA 1ZACA 2LC5A 5DKNA 1WLZA 1SW8A 2MJWB 5K89A 2L4HA 1S6JA 1NIWA 5HKYA 3NSLA 1Q80A 2PALA 1SPYA 1HQVA 3BUNB 2SASA 1EG4A 1WRZA 2MLEC 5FYXA 3KHEA 3TUYC 2WCFA 3WNXB 2LVVA 1SR6C 1Y1XA 2FOTA 4PDZA 4WQ3A 2KYFA 3O2PA 4GGNA 1KFUS 4I5NB 2JTZA 1YUTA 2M1KB 1S3PA 5AXIA 1XO5A 1M63B 1DT7B 1CNPA 1K2HA 3SG2A 2AAOA 3QRXA 1XFZO 1QTXA 2L4IA 1BR4B 3I5FB 4DUQA 1SYMA 1JF2A 1KK7Z 4GAOA 3EVVA 3SG4A 3PLFB 1YTZC 2LMVA 3BXKA 1K95A 1CMGA 1CB1A 1A29A 3SIBA 1YUSA 2M1UA 1XA5A 3M0WA 3ZNIA 3DF0B 1OMVA 1L2OC 4JPZB 1BOCA 2G2BA 2BE6A 2ZKMX 1J55A 3OX5A 2KI6D 1IJ6A 1QASA 2BCXA 2H61A 2M7LA 1OMDA 3K21A 1KQMB 4DRWA 1XFXO 2I7AA 2K2AA 4PE0A 1OOJA 2GGZA 1TNWA 3BUMB 1JFKA 2KBIA 1WDCC 2NLNA 1NP8A 2JT8A 5GQQC 1CM4A 2JWWA 3AKAA 1S36A 2WNDA 2F3YA 3NSKA 1DF0A 1DJWA 1QXPA 3SIAA 1IQ3A 2K61A 1RECA 3OP0A 4M2PA 5J3XA 1CTRA 1RFJA 4MVFA 1A75A 3IF7A 2VRGA 3LLEA 3KF9A 5F6TA 2R2IA 1AUIB 1QV0A 1BF5A 4HRHA 3RM1A 1NSHA 1CLMA
chains in the Genus database with same CATH superfamily
2K7OA 2GGMA 3D74A 1DC1A 1YVLA 3H4SE 1KFXS 1ALVA 1CDLA 2M8UA 1AHRA 3CR5X 3KPXA 1EL4A 1BODA 1QVIY 2KAYA 3BFAA 1NCYA 3PALA 4YRUA 3CZ1A 2M97A 1K94A 1S6CA 3GK4X 1QX5B 4NQGA 3D77A 2F33A 1OOFA 3FE8A 1JF0A 4MZJA 5CSJA 4YGCB 1XFRA 4YGBB 1LS8A 1N65A 4PHMA 3EG5B 4CFRA 1XVJA 3S0DA 3VROA 4IL1A 2LLUA 5I2OA 1TUZA 5HLVA 2KI4B 2OTGC 1SCMB 1HT9A 1U5IA 1FBVA 2EHBA 3DZTA 3JVTB 5ER4X 3I5IB 3JTDB 4QJ4B 5G08A 2L2CA 1K9PA 3CGAA 3CYZA 2KAXA 2O5GA 2P6BB 2PMYA 4PCWA 1QLSA 4PE1A 5FI2A 3VRQA 3MSEB 4JKTA 4MRXA 2FCEA 1Y6WA 1YURA 1R2UA 4PE4A 1RROA 1NX1A 3PSRA 2HQWA 1B8LA 1ODBA 2K60A 4MEWA 1MF8B 2KGRA 3SG7A 4MLWA 2JQ6A 1S26D 3DVEA 2PASA 2JOJA 4INWA 3DD4A 1X02A 2QACA 2ISDA 2LLTA 3JTDC 1B8RA 1ORGA 1ZUZA 2H61C 3DF0A 2Q91A 2TN4A 3SS5A 2ZRTA 3O4XA 3PJIA 3IQQA 3PN7B 5DKRA 3PM8A 1OQPA 5CSIA 2H2KA 1IKUA 2MA2A 1OOIX 1YX8A 1JUOA 1LVCD 2M7NA 5TNCA 1PSRA 1MWNA 2HQ8A 2JT3A 2PVBA 4HRGA 5FI7A 3VRRA 3CABA 4YGAA 1K9KA 3TS5C 4WRIA 3I5HC 2WCKA 3CDNA 2LHLA 2F8PA 1YVHA 1IIOA 5CSNA 3BFBA 3DVMA 3IQOA 2BNXA 3IVTA 2KFGA 3NXAA 1LA3A 1BU3A 1UHIA 4DCKA 1CLLA 3D73A 2KGBC 1C7VA 2HF5A 2K0JA 2KBMA 1CMFA 1UHJA 3D0YB 2QEOA 4I5JA 2F3ZA 1LKJA 3SS3A 1C07A 3R1OA 2KI6C 4ETOA 4P5OE 2PSRA 1JWDA 1LXFC 5I2LA 4A4CA 1OE9B 4ORAB 1MHOA 1KWOB 1DMOA 3BUOB 1SSEB 1DGVA 1PRWA 2K7DA 1F4OA 2L0PA 1KSMA 1KK8B 3EVRA 3A4UB 2Y5IA 3NHIA 1XFWO 3L4LA 3HCMA 5D3OA 1LINA 1DELA 1XFYO 4QJ3B 3CZTX 1KQVA 2BCBA 1AVSA 3NSIA 4C0KA 4C0LA 1UHHA 1NYAA 4A4BA 2KSPA 2ZRSA 1J7OA 1GJYA 3OBVA 3CLNA 1G33A 3I5FC 1UWOA 1S5GZ 3RZSA 3TZ1A 1B47A 4GGFA 2KAVA 3O6BA 1G4YR 1FI6A 4IJ7A 1TNQA 2MBXA 3EKHA 3WHUB 1QIWA 5CPVA 3FWCA 1DVIA 1YX7A 2ZN8A 1BR1B 2JRFA 3BOWB 1C3ZA 4GPLB 5D7FA 3S0GA 3WXAA 1BLQA 1ZOTB 1LA0A 5AANA 2Y4QA 1KQMC 1Z2CB 3BFHA 2KFFA 2LMTA 4PHJA 2LE9B 3A8RA 1CFFA 3KO0A 4GNKB 2WC8A 4JD9A 1PALA 2CNPA 5IBWA 2QEVA 1FI5A 2CBLA 3FE9A 4XJKB 2AMIA 2PRUA 2M3WA 3RLZA 1DQEA 1Y1AA 2QDIA 5HLOA 1MQ1A 2WC5A 1FF1A 3S0EA 3Q8IA 1OOHA 3TDZA 1CFCA 1Y1UA 1AK8A 2CXJA 1BG1A 4CLNA 1UP5A 1OMRA 2MHHA 3UNWA 4AOMA 1SBJA 2OPOA 2COLB 1K96A 1PULA 1NX3A 2LVKA 3L4AA 3ZWHA 3FWBA 1G8IA 3FIAA 3D0YA 4M2OA 1IGVA 2QEHA 3B6XA 1XK4C 2KDHA 1YUUA 3DXLA 4USLA 1WRLA 1RK9A 2BL0B 3B87A 3EKJA 1K9UA 1EG3A 4YI9A 1DJYA 1MR8A 1SKTA 1D1OA 2JNXA 2FJUB 1TCOB 1CKKA 1ALWA 1RWYA 3DVKA 1TIZA 1DJHA 3AAJA 4N1FA 4BY5A 1AP4A 2KOTA 1IH0A 2KI4C 1Y0VH 2G9BA 1SCMC 2F2OA 1DJGA 3B86A 5JJGA 2D8NA 2BE4A 3JVTC 4MBEA 4PALA 1DTLA 2LNKA 4N1GA 2NCPA 3I5IC 3KEVA 1V1GA 3O78A 3S0AA 3PATA 5PALA 1QATA 1JC2A 5D69A 5HKWA 5I8NA 3TDIA 4C0JA 4CPVA 1OZSA 2LM5A 1TUJA 3L47A 1C7WA 4GGFC 2ZN9A 5I2QA 2SCPA 1ZMZA 3CZ0A 1A2XA 2KNEA 1J1EA 2L5YA 2CTNA 3CR2A 1UHNA 4PHKA 1S5GY 3BYAA 1PVBA 1DJXA 2OS8B 5EL2A 1KSOA 1JSAA 3SS4A 1SL9A 1QX2A 1CM1A 3CWGA 1SY9A 4JWQA 2I94A 2LUXA 2NCOA 2FCDA 2ZNDA 1GQMA 4M2QA 2JT0A 3GOFA 4P2YB 1B4CA 2K7CA 3EK8A 3PN7C 4Q04A 5KSZA 3I5GB 1CFPA 4OR9B 2LMUA 4NDCA 2V53A 3BUWB 1UURA 3LL8B 1TOPA 2BCAA 5BPJA 3LCPC 2KQ6A 4GBAA 2E6WA 3ICBA 1A03A 3VRNA 5AERA 2B1UA 2DOQA 1XYDA 3R72A 2JPTA 4F7FA 1J7PA 2P70A 1M46A 1NX2A 4WQ2A 4XJKA 4FQTA 1B7TZ 3B88A 1XK4A 3OGNA 5CSFA 1SL7A 1NUBA 1A4PA 1QLKA 3EK7A 1R6PA 1QS7A 3OB1B 4OVNF 2RGIA 1GGWA 2LV7A 2JXCA 3N7HA 3OX6A 3TUYB 1CLBA 1AJ4A 1SR6B 2AUCA 2JULA 4CIDA 1F54A 1V1FA 3FS7A 2QPTA 1KFUL 1N0YA 3OHMB 1OZOA 3WHTB 2M49B 2I2RE 2LVIA 2Q4UA 1UHKA 4N5XA 2EC6B 5AFPA 1JBAA 4DIRA 1QV1A 1K90D 2JC2A 3SJSA 1GM0A 1SNLA 2L98A 1M39A 3LK0A 1TNPA 1OSAA 2KLDA 3SG5A 4F0ZB 1U5IB 1XFVO 2M9GA 1KWOC 2WORA 1JFJA 3NGVA 1BJFA 2KQYA 1L7ZA 1DGUA 2LUCA 3UO9A 2A4JA 1L2OB 1MUXA 3DVJA 4MN0A 1WLMA 4AQJA 1DJZA 1KK8C 1RTP1 2EC6C 5AEQA 4ORCB 3VGOA 3PM2A 1FPWA 2BBMA 2BKHB 2Y1NA 1B8CA 2Y1MA 2O60A 1W7IB 4BY4A 4TNCA 1BMOA 1WDCB 4MZKA 1T14A 1K93D 1J1DA 3F45A 3CR4X 3HX4A 3PFVA 1BT6A 1CFDA 2WCMA 1IQ5A 4OZDA 3D10A 1SK6D 1QX7A 2CT9A 3EK4A 3LK1A 3S0BA 2L2EA 5ER5A 4PHNA 1J7QA 1CDPA 1IWQA 3VRPA 2KFHA 4FQOA 2WCEA 1NCXA 1EH2A 1SCVA 4GFTA 1NPQA 3O4YA 2KLEA 4PE7A 1E8AA 3D75A 3SG3A 2M0RA 2L51A 2JNFA 2JXLA 1NWDA 2JPOA 2ZNEA 4MZLA 5HL1A 1K8UA 4ZCVA 5HKZA 1EXRA 1KFXL 1RJVA 2H8VA 3E3RA 4AQIA 2BBNA 3R1PA 4INXA 3SG6A 1FW4A 2JZIA 3S0FA 2K2FA 1B1GA 3CTNA 2L5XB 4I5KA 3R1VA 1W7JB 1MXLC 4UPGA 1MXEA 1XFUO 2L50A 2MAZA 1B7TY 2JTTA 2MRDA 2OTGB 1B9AA 3BUXB 3FE6A 2F2PA 1F4QA 1GGZA 4QJ5B 4GUKA 2LANA 1W9ZA 1QJTA 2WCJA 4YBHB 1F8HA 3BJHA 2LP3A 4I5LB 5I94A 4YI8A 1H8BA 1S6IA 5DKQA 4YGDB 4NDBA 1SL8A 2LHIA 4R1EA 1UUSA 1WRKA 3OB2B 4HREE 1F71A 1NCZA 2BL0C 1PVAA 1KCYA 2CCMA 2WOSA 1IRJA 1PK0D 4OKHA 1ZFSA 2K7BA 2WC6A 1S1EA 2JU0A 4DS7A 4E68A 1H4BA 4FTGA 1TN4A 2E30A 1TTXA 3C1VA 5DICA 1M45A 4D1EA 2PYQA 2KYCA 1AJ5A 1TCFA 2LCPA 3QMEA 4JQ0D 2MLFC 3GK2A 4NDDA 5B8IB 1WY9A 2WCBA 2ZFDA 3DY9A 3TDUA 2HPSA 4OV2A 2LAPA 2BECA 2GV5A 1YRUB 3B7AA 4ORBB 1F70A 3D76A 2M29A 1IG5A 1TRFA 3GK1A 5KTYA 2K8MB 2I18A 4OCIA 5KU1A 3TS5B 3V2LA 1KK7Y 1YRTB 2NZ0A 3K1EA 4CFQA 3I5HB 1J7RA 2HETA 3CS1A 1TNXA 1DF0B 1YR5A 3BOWA 1OW4A 1QIVA 4MSPA 3BQ3A 3D78A 3NSOA 2IS9A 1A75B 2LP2A 1C3YA 1SRAA 4ICBA 2EGDA 1PSBA 1DJIA 4L9MA 3AAKA 1CDMA 2OS8C 4HSZA 2P71A 5HYDA 4MRYA 1F55A 1M31A 4XYNA 1VRKA 1NX0A 2LLSA 1SMGA 1CDNA 1EJ3A 4KYNA 4U8DA 2BKIB 2NXQA 2YGUA 4YGEB 1OOGA 2LVJA 3I5GC 1QVIZ 4ZCUA 1IJ5A 2KHNA 3EVUA 1N2DA 3AKBA 5JOLA 1ZACA 1DEKA 2LC5A 5DKNA 1WLZA 1SW8A 2MJWB 5K89A 2L4HA 1S6JA 1NIWA 5HKYA 3NSLA 1Q80A 2WCHA 2PALA 1SPYA 1HQVA 3BUNB 2SASA 1EG4A 1WRZA 2GTEA 2MLEC 1P28A 5FYXA 3KHEA 3TUYC 2WCFA 3WNXB 2LVVA 1SR6C 1Y1XA 2FOTA 4PDZA 4WQ3A 2KYFA 3O2PA 4GGNA 1KFUS 4I5NB 2ERBA 2KPHA 2JTZA 1YUTA 2M1KB 1S3PA 5AXIA 1XO5A 1M63B 1DT7B 1CNPA 1K2HA 3SG2A 2AAOA 3QRXA 1XFZO 1QTXA 2L4IA 1BR4B 3I5FB 2QEBA 1SYMA 1JF2A 1KK7Z 4GAOA 3EVVA 3SG4A 3PLFB 4DUQA 1YTZC 2LMVA 3BXKA 1K95A 1CMGA 1CB1A 1A29A 5FI6A 3SIBA 1YUSA 2M1UA 2PQLA 1XA5A 3M0WA 3ZNIA 3DF0B 1OMVA 3VB1A 1L2OC 2FJYA 4JPZB 1BOCA 2G2BA 2BE6A 2ZKMX 1J55A 3OX5A 2KI6D 1IJ6A 1QASA 2BCXA 2H61A 2M7LA 1OMDA 3K21A 1KQMB 4DRWA 1XFXO 4PT1A 1QWVA 2I7AA 2K2AA 4PE0A 1OOJA 2GGZA 1TNWA 3BUMB 1JFKA 2KBIA 1WDCC 2NLNA 1NP8A 2JT8A 2BAPA 2WCLA 5GQQC 1CM4A 2JWWA 3AKAA 1S36A 2WNDA 2F3YA 3NSKA 1DF0A 1DJWA 1QXPA 3NHTA 3SIAA 1IQ3A 2K61A 1RECA 3OP0A 4M2PA 5J3XA 1CTRA 1RFJA 4MVFA 1A75A 3IF7A 3CZ2A 2VRGA 3LLEA 3KF9A 5F6TA 2R2IA 1AUIB 1QV0A 1TWOA 1Z4HA 1BF5A 4HRHA 3DYEA 3RM1A 1NSHA 1CLMA
chains in the Genus database with same CATH topology
2K7OA 2GGMA 1YVLA 3H4SE 1KFXS 1ALVA 1CDLA 2M8UA 1AHRA 3CR5X 3KPXA 1EL4A 1BODA 1QVIY 2KAYA 1NCYA 3PALA 4YRUA 2M97A 1K94A 1S6CA 3GK4X 1QX5B 4NQGA 2F33A 1JF0A 4MZJA 5CSJA 4YGCB 4YGBB 1N65A 4PHMA 4CFRA 1XVJA 3VROA 4IL1A 2LLUA 5I2OA 5HLVA 2KI4B 2OTGC 1SCMB 1HT9A 1U5IA 1FBVA 2EHBA 3JVTB 5ER4X 3I5IB 3JTDB 4QJ4B 5G08A 3CGAA 1K9PA 2KAXA 2O5GA 2P6BB 2PMYA 4PCWA 1QLSA 4PE1A 3VRQA 3MSEB 4MRXA 2FCEA 1Y6WA 1YURA 1R2UA 4PE4A 1RROA 1NX1A 3PSRA 2HQWA 1B8LA 1ODBA 4MEWA 1MF8B 2KGRA 3SG7A 4MLWA 2JQ6A 1S26D 3DVEA 2PASA 2JOJA 3DD4A 1X02A 2QACA 2ISDA 2LLTA 3JTDC 1B8RA 1ZUZA 3DF0A 2H61C 2Q91A 2TN4A 2ZRTA 3IQQA 3PN7B 5DKRA 3PM8A 1OQPA 5CSIA 2H2KA 1IKUA 2MA2A 1YX8A 1JUOA 1LVCD 2M7NA 5TNCA 1PSRA 1MWNA 2HQ8A 2JT3A 2PVBA 4HRGA 3VRRA 4YGAA 1K9KA 3TS5C 4WRIA 3I5HC 2LHLA 2F8PA 1YVHA 5CSNA 3DVMA 3IQOA 2KFGA 3NXAA 1LA3A 1BU3A 1UHIA 4DCKA 1CLLA 2KGBC 1C7VA 2HF5A 2K0JA 2KBMA 1CMFA 1UHJA 3D0YB 4I5JA 2F3ZA 1LKJA 1C07A 2KI6C 4ETOA 4P5OE 2PSRA 1JWDA 1LXFC 5I2LA 4A4CA 1OE9B 4ORAB 1MHOA 1KWOB 1DMOA 3BUOB 1DGVA 1PRWA 2K7DA 1F4OA 2L0PA 1KSMA 1KK8B 3EVRA 3A4UB 2Y5IA 1XFWO 3HCMA 1LINA 1XFYO 4QJ3B 3CZTX 1KQVA 2BCBA 1AVSA 3NSIA 4C0KA 4C0LA 1UHHA 1NYAA 4A4BA 2KSPA 2ZRSA 1J7OA 1GJYA 3CLNA 1G33A 3I5FC 1UWOA 1S5GZ 3TZ1A 1B47A 4GGFA 2KAVA 3O6BA 1G4YR 1FI6A 1TNQA 2MBXA 3EKHA 3WHUB 1QIWA 5CPVA 3FWCA 1DVIA 1YX7A 2ZN8A 1BR1B 2JRFA 3BOWB 4GPLB 5D7FA 3WXAA 1BLQA 1ZOTB 1LA0A 5AANA 2Y4QA 1KQMC 2KFFA 2LMTA 4PHJA 2LE9B 3A8RA 1CFFA 3KO0A 4GNKB 2WC8A 1PALA 2CNPA 5IBWA 1FI5A 2CBLA 4XJKB 2AMIA 2PRUA 2M3WA 3RLZA 1Y1AA 5HLOA 1MQ1A 1FF1A 3TDZA 1CFCA 1Y1UA 1AK8A 2CXJA 1BG1A 4CLNA 1UP5A 1OMRA 2MHHA 4AOMA 1SBJA 2OPOA 2COLB 1K96A 1PULA 1NX3A 2LVKA 3ZWHA 3FWBA 1G8IA 3FIAA 3D0YA 4M2OA 1IGVA 1XK4C 2KDHA 1YUUA 4USLA 1WRLA 1RK9A 2BL0B 3EKJA 1K9UA 1EG3A 4YI9A 1DJYA 1MR8A 1SKTA 1D1OA 2JNXA 2FJUB 1TCOB 1CKKA 1ALWA 1RWYA 3DVKA 1TIZA 1DJHA 3AAJA 4N1FA 4BY5A 1AP4A 2KOTA 1IH0A 2KI4C 1Y0VH 2G9BA 1SCMC 2F2OA 1DJGA 5JJGA 2D8NA 2BE4A 3JVTC 4MBEA 4PALA 1DTLA 2LNKA 4N1GA 2NCPA 3I5IC 3KEVA 1V1GA 3O78A 3PATA 5PALA 1QATA 1JC2A 5D69A 5HKWA 5I8NA 3TDIA 4C0JA 4CPVA 1OZSA 2LM5A 1C7WA 4GGFC 2ZN9A 5I2QA 2SCPA 1ZMZA 1A2XA 2KNEA 1J1EA 2CTNA 3CR2A 1UHNA 4PHKA 1S5GY 3BYAA 1PVBA 1DJXA 2OS8B 1KSOA 1JSAA 1SL9A 1QX2A 1CM1A 3CWGA 1SY9A 4JWQA 2I94A 2LUXA 2NCOA 2FCDA 2ZNDA 1GQMA 4M2QA 2JT0A 3GOFA 4P2YB 1B4CA 2K7CA 3EK8A 3PN7C 4Q04A 5KSZA 3I5GB 1CFPA 4OR9B 2LMUA 4NDCA 2V53A 3BUWB 1UURA 3LL8B 1TOPA 2BCAA 5BPJA 3LCPC 2KQ6A 4GBAA 2E6WA 3ICBA 1A03A 3VRNA 5AERA 2B1UA 2DOQA 1XYDA 2JPTA 1J7PA 1M46A 1NX2A 4WQ2A 4XJKA 1B7TZ 1XK4A 5CSFA 1SL7A 1NUBA 1A4PA 1QLKA 3EK7A 1R6PA 1QS7A 3OB1B 4OVNF 2RGIA 1GGWA 2LV7A 2JXCA 3OX6A 3TUYB 1CLBA 1AJ4A 1SR6B 2AUCA 2JULA 4CIDA 1F54A 1V1FA 3FS7A 2QPTA 1KFUL 1N0YA 3OHMB 1OZOA 3WHTB 2M49B 2I2RE 2LVIA 2Q4UA 1UHKA 4N5XA 2EC6B 5AFPA 1JBAA 4DIRA 1QV1A 1K90D 2JC2A 3SJSA 1SNLA 2L98A 1M39A 3LK0A 1TNPA 1OSAA 3SG5A 4F0ZB 1U5IB 1XFVO 2M9GA 1KWOC 2WORA 1JFJA 1BJFA 2KQYA 1L7ZA 1DGUA 2LUCA 2A4JA 1L2OB 1MUXA 3DVJA 4MN0A 1WLMA 4AQJA 1DJZA 1KK8C 1RTP1 2EC6C 5AEQA 4ORCB 3VGOA 1FPWA 2BBMA 2BKHB 2Y1NA 1B8CA 2Y1MA 2O60A 1W7IB 4BY4A 4TNCA 1BMOA 1WDCB 4MZKA 1K93D 1J1DA 3F45A 3CR4X 3HX4A 3PFVA 1BT6A 1CFDA 1IQ5A 3D10A 1SK6D 1QX7A 2CT9A 3EK4A 3LK1A 2L2EA 5ER5A 4PHNA 1J7QA 1CDPA 1IWQA 3VRPA 2KFHA 4FQOA 2WCEA 1NCXA 1EH2A 1SCVA 4GFTA 1NPQA 3O4YA 4PE7A 1E8AA 3SG3A 2M0RA 2L51A 2JNFA 2JXLA 1NWDA 2ZNEA 4MZLA 1K8UA 4ZCVA 5HKZA 1EXRA 1KFXL 1RJVA 3E3RA 4AQIA 2BBNA 3SG6A 1FW4A 2JZIA 2K2FA 1B1GA 3CTNA 2L5XB 4I5KA 1W7JB 1MXLC 4UPGA 1MXEA 1XFUO 2L50A 2MAZA 1B7TY 2JTTA 2MRDA 2OTGB 1B9AA 3BUXB 2F2PA 1F4QA 1GGZA 4QJ5B 4GUKA 2LANA 1QJTA 4YBHB 1F8HA 2LP3A 4I5LB 1H8BA 4YI8A 1S6IA 5DKQA 4YGDB 4NDBA 1SL8A 2LHIA 4R1EA 1UUSA 1WRKA 3OB2B 4HREE 1F71A 1NCZA 2BL0C 1PVAA 1KCYA 2CCMA 2WOSA 1IRJA 1PK0D 4OKHA 1ZFSA 2K7BA 4DS7A 1S1EA 2JU0A 4E68A 1H4BA 4FTGA 1TN4A 2E30A 1TTXA 3C1VA 1M45A 4D1EA 2KYCA 1AJ5A 1TCFA 2LCPA 4JQ0D 5KTYA 2MLFC 3GK2A 4NDDA 5B8IB 1WY9A 2WCBA 2ZFDA 3TDUA 2HPSA 4OV2A 2LAPA 2BECA 2GV5A 1YRUB 4ORBB 1F70A 2M29A 1IG5A 1TRFA 3GK1A 2K8MB 2I18A 4OCIA 5KU1A 3TS5B 1KK7Y 1YRTB 2NZ0A 4CFQA 3I5HB 1J7RA 2HETA 3CS1A 1TNXA 1DF0B 1YR5A 3BOWA 1QIVA 4MSPA 3BQ3A 3NSOA 2IS9A 1A75B 2LP2A 1SRAA 4ICBA 2EGDA 1PSBA 1DJIA 4L9MA 3AAKA 1CDMA 2OS8C 4HSZA 5HYDA 4MRYA 1F55A 1M31A 4XYNA 1VRKA 1NX0A 2LLSA 1SMGA 1CDNA 1EJ3A 4U8DA 2BKIB 2NXQA 4YGEB 2LVJA 3I5GC 1QVIZ 4ZCUA 1IJ5A 2KHNA 3EVUA 1N2DA 3AKBA 5JOLA 1ZACA 2LC5A 5DKNA 1WLZA 1SW8A 2MJWB 5K89A 2L4HA 1S6JA 1NIWA 5HKYA 3NSLA 1Q80A 2PALA 1SPYA 1HQVA 3BUNB 2SASA 1EG4A 1WRZA 2MLEC 5FYXA 3KHEA 3TUYC 2WCFA 3WNXB 2LVVA 1SR6C 1Y1XA 2FOTA 4PDZA 4WQ3A 2KYFA 3O2PA 4GGNA 1KFUS 4I5NB 2JTZA 1YUTA 2M1KB 1S3PA 5AXIA 1XO5A 1M63B 1DT7B 1CNPA 1K2HA 3SG2A 2AAOA 3QRXA 1XFZO 1QTXA 2L4IA 1BR4B 3I5FB 4DUQA 1SYMA 1JF2A 1KK7Z 4GAOA 3EVVA 3SG4A 3PLFB 1YTZC 2LMVA 3BXKA 1K95A 1CMGA 1CB1A 1A29A 3SIBA 1YUSA 2M1UA 1XA5A 3M0WA 3ZNIA 3DF0B 1OMVA 1L2OC 4JPZB 1BOCA 2G2BA 2BE6A 2ZKMX 1J55A 3OX5A 2KI6D 1IJ6A 1QASA 2BCXA 2H61A 2M7LA 1OMDA 3K21A 1KQMB 4DRWA 1XFXO 2I7AA 2K2AA 4PE0A 1OOJA 2GGZA 1TNWA 3BUMB 1JFKA 2KBIA 1WDCC 2NLNA 1NP8A 2JT8A 5GQQC 1CM4A 2JWWA 3AKAA 1S36A 2WNDA 2F3YA 3NSKA 1DF0A 1DJWA 1QXPA 3SIAA 1IQ3A 2K61A 1RECA 3OP0A 4M2PA 5J3XA 1CTRA 1RFJA 4MVFA 1A75A 3IF7A 2VRGA 3LLEA 3KF9A 5F6TA 2R2IA 1AUIB 1QV0A 1BF5A 4HRHA 3RM1A 1NSHA 1CLMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K7O A;  2GGM A;  1YVL A;  3H4S E;  1KFX S;  1ALV A;  1CDL A;  2M8U A;  1AHR A;  3CR5 X;  3KPX A;  1EL4 A;  1BOD A;  1QVI Y;  2KAY A;  1NCY A;  3PAL A;  4YRU A;  2M97 A;  1K94 A;  1S6C A;  3GK4 X;  1QX5 B;  4NQG A;  2F33 A;  1JF0 A;  4MZJ A;  5CSJ A;  4YGC B;  4YGB B;  1N65 A;  4PHM A;  4CFR A;  1XVJ A;  3VRO A;  4IL1 A;  2LLU A;  5I2O A;  5HLV A;  2KI4 B;  2OTG C;  1SCM B;  1HT9 A;  1U5I A;  1FBV A;  2EHB A;  3JVT B;  5ER4 X;  3I5I B;  3JTD B;  4QJ4 B;  5G08 A;  3CGA A;  1K9P A;  2KAX A;  2O5G A;  2P6B B;  2PMY A;  4PCW A;  1QLS A;  4PE1 A;  3VRQ A;  3MSE B;  4MRX A;  2FCE A;  1Y6W A;  1YUR A;  1R2U A;  4PE4 A;  1RRO A;  1NX1 A;  3PSR A;  2HQW A;  1B8L A;  1ODB A;  4MEW A;  1MF8 B;  2KGR A;  3SG7 A;  4MLW A;  2JQ6 A;  1S26 D;  3DVE A;  2PAS A;  2JOJ A;  3DD4 A;  1X02 A;  2QAC A;  2ISD A;  2LLT A;  3JTD C;  1B8R A;  1ZUZ A;  3DF0 A;  2H61 C;  2Q91 A;  2TN4 A;  2ZRT A;  3IQQ A;  3PN7 B;  5DKR A;  3PM8 A;  1OQP A;  5CSI A;  2H2K A;  1IKU A;  2MA2 A;  1YX8 A;  1JUO A;  1LVC D;  2M7N A;  5TNC A;  1PSR A;  1MWN A;  2HQ8 A;  2JT3 A;  2PVB A;  4HRG A;  3VRR A;  4YGA A;  1K9K A;  3TS5 C;  4WRI A;  3I5H C;  2LHL A;  2F8P A;  1YVH A;  5CSN A;  3DVM A;  3IQO A;  2KFG A;  3NXA A;  1LA3 A;  1BU3 A;  1UHI A;  4DCK A;  1CLL A;  2KGB C;  1C7V A;  2HF5 A;  2K0J A;  2KBM A;  1CMF A;  1UHJ A;  3D0Y B;  4I5J A;  2F3Z A;  1LKJ A;  1C07 A;  2KI6 C;  4ETO A;  4P5O E;  2PSR A;  1JWD A;  1LXF C;  5I2L A;  4A4C A;  1OE9 B;  4ORA B;  1MHO A;  1KWO B;  1DMO A;  3BUO B;  1DGV A;  1PRW A;  2K7D A;  1F4O A;  2L0P A;  1KSM A;  1KK8 B;  3EVR A;  3A4U B;  2Y5I A;  1XFW O;  3HCM A;  1LIN A;  1XFY O;  4QJ3 B;  3CZT X;  1KQV A;  2BCB A;  1AVS A;  3NSI A;  4C0K A;  4C0L A;  1UHH A;  1NYA A;  4A4B A;  2KSP A;  2ZRS A;  1J7O A;  1GJY A;  3CLN A;  1G33 A;  3I5F C;  1UWO A;  1S5G Z;  3TZ1 A;  1B47 A;  4GGF A;  2KAV A;  3O6B A;  1G4Y R;  1FI6 A;  1TNQ A;  2MBX A;  3EKH A;  3WHU B;  1QIW A;  5CPV A;  3FWC A;  1DVI A;  1YX7 A;  2ZN8 A;  1BR1 B;  2JRF A;  3BOW B;  4GPL B;  5D7F A;  3WXA A;  1BLQ A;  1ZOT B;  1LA0 A;  5AAN A;  2Y4Q A;  1KQM C;  2KFF A;  2LMT A;  4PHJ A;  2LE9 B;  3A8R A;  1CFF A;  3KO0 A;  4GNK B;  2WC8 A;  1PAL A;  2CNP A;  5IBW A;  1FI5 A;  2CBL A;  4XJK B;  2AMI A;  2PRU A;  2M3W A;  3RLZ A;  1Y1A A;  5HLO A;  1MQ1 A;  1FF1 A;  3TDZ A;  1CFC A;  1Y1U A;  1AK8 A;  2CXJ A;  1BG1 A;  4CLN A;  1UP5 A;  1OMR A;  2MHH A;  4AOM A;  1SBJ A;  2OPO A;  2COL B;  1K96 A;  1PUL A;  1NX3 A;  2LVK A;  3ZWH A;  3FWB A;  1G8I A;  3FIA A;  3D0Y A;  4M2O A;  1IGV A;  1XK4 C;  2KDH A;  1YUU A;  4USL A;  1WRL A;  1RK9 A;  2BL0 B;  3EKJ A;  1K9U A;  1EG3 A;  4YI9 A;  1DJY A;  1MR8 A;  1SKT A;  1D1O A;  2JNX A;  2FJU B;  1TCO B;  1CKK A;  1ALW A;  1RWY A;  3DVK A;  1TIZ A;  1DJH A;  3AAJ A;  4N1F A;  4BY5 A;  1AP4 A;  2KOT A;  1IH0 A;  2KI4 C;  1Y0V H;  2G9B A;  1SCM C;  2F2O A;  1DJG A;  5JJG A;  2D8N A;  2BE4 A;  3JVT C;  4MBE A;  4PAL A;  1DTL A;  2LNK A;  4N1G A;  2NCP A;  3I5I C;  3KEV A;  1V1G A;  3O78 A;  3PAT A;  5PAL A;  1QAT A;  1JC2 A;  5D69 A;  5HKW A;  5I8N A;  3TDI A;  4C0J A;  4CPV A;  1OZS A;  2LM5 A;  1C7W A;  4GGF C;  2ZN9 A;  5I2Q A;  2SCP A;  1ZMZ A;  1A2X A;  2KNE A;  1J1E A;  2CTN A;  3CR2 A;  1UHN A;  4PHK A;  1S5G Y;  3BYA A;  1PVB A;  1DJX A;  2OS8 B;  1KSO A;  1JSA A;  1SL9 A;  1QX2 A;  1CM1 A;  3CWG A;  1SY9 A;  4JWQ A;  2I94 A;  2LUX A;  2NCO A;  2FCD A;  2ZND A;  1GQM A;  4M2Q A;  2JT0 A;  3GOF A;  4P2Y B;  1B4C A;  2K7C A;  3EK8 A;  3PN7 C;  4Q04 A;  5KSZ A;  3I5G B;  1CFP A;  4OR9 B;  2LMU A;  4NDC A;  2V53 A;  3BUW B;  1UUR A;  3LL8 B;  1TOP A;  2BCA A;  5BPJ A;  3LCP C;  2KQ6 A;  4GBA A;  2E6W A;  3ICB A;  1A03 A;  3VRN A;  5AER A;  2B1U A;  2DOQ A;  1XYD A;  2JPT A;  1J7P A;  1M46 A;  1NX2 A;  4WQ2 A;  4XJK A;  1B7T Z;  1XK4 A;  5CSF A;  1SL7 A;  1NUB A;  1A4P A;  1QLK A;  3EK7 A;  1R6P A;  1QS7 A;  3OB1 B;  4OVN F;  2RGI A;  1GGW A;  2LV7 A;  2JXC A;  3OX6 A;  3TUY B;  1CLB A;  1AJ4 A;  1SR6 B;  2AUC A;  2JUL A;  4CID A;  1F54 A;  1V1F A;  3FS7 A;  2QPT A;  1KFU L;  1N0Y A;  3OHM B;  1OZO A;  3WHT B;  2M49 B;  2I2R E;  2LVI A;  2Q4U A;  1UHK A;  4N5X A;  2EC6 B;  5AFP A;  1JBA A;  4DIR A;  1QV1 A;  1K90 D;  2JC2 A;  3SJS A;  1SNL A;  2L98 A;  1M39 A;  3LK0 A;  1TNP A;  1OSA A;  3SG5 A;  4F0Z B;  1U5I B;  1XFV O;  2M9G A;  1KWO C;  2WOR A;  1JFJ A;  1BJF A;  2KQY A;  1L7Z A;  1DGU A;  2LUC A;  2A4J A;  1L2O B;  1MUX A;  3DVJ A;  4MN0 A;  1WLM A;  4AQJ A;  1DJZ A;  1KK8 C;  1RTP 1;  2EC6 C;  5AEQ A;  4ORC B;  3VGO A;  1FPW A;  2BBM A;  2BKH B;  2Y1N A;  1B8C A;  2Y1M A;  2O60 A;  1W7I B;  4BY4 A;  4TNC A;  1BMO A;  1WDC B;  4MZK A;  1K93 D;  1J1D A;  3F45 A;  3CR4 X;  3HX4 A;  3PFV A;  1BT6 A;  1CFD A;  1IQ5 A;  3D10 A;  1SK6 D;  1QX7 A;  2CT9 A;  3EK4 A;  3LK1 A;  2L2E A;  5ER5 A;  4PHN A;  1J7Q A;  1CDP A;  1IWQ A;  3VRP A;  2KFH A;  4FQO A;  2WCE A;  1NCX A;  1EH2 A;  1SCV A;  4GFT A;  1NPQ A;  3O4Y A;  4PE7 A;  1E8A A;  3SG3 A;  2M0R A;  2L51 A;  2JNF A;  2JXL A;  1NWD A;  2ZNE A;  4MZL A;  1K8U A;  4ZCV A;  5HKZ A;  1EXR A;  1KFX L;  1RJV A;  3E3R A;  4AQI A;  2BBN A;  3SG6 A;  1FW4 A;  2JZI A;  2K2F A;  1B1G A;  3CTN A;  2L5X B;  4I5K A;  1W7J B;  1MXL C;  4UPG A;  1MXE A;  1XFU O;  2L50 A;  2MAZ A;  1B7T Y;  2JTT A;  2MRD A;  2OTG B;  1B9A A;  3BUX B;  2F2P A;  1F4Q A;  1GGZ A;  4QJ5 B;  4GUK A;  2LAN A;  1QJT A;  4YBH B;  1F8H A;  2LP3 A;  4I5L B;  1H8B A;  4YI8 A;  1S6I A;  5DKQ A;  4YGD B;  4NDB A;  1SL8 A;  2LHI A;  4R1E A;  1UUS A;  1WRK A;  3OB2 B;  4HRE E;  1F71 A;  1NCZ A;  2BL0 C;  1PVA A;  1KCY A;  2CCM A;  2WOS A;  1IRJ A;  1PK0 D;  4OKH A;  1ZFS A;  2K7B A;  4DS7 A;  1S1E A;  2JU0 A;  4E68 A;  1H4B A;  4FTG A;  1TN4 A;  2E30 A;  1TTX A;  3C1V A;  1M45 A;  4D1E A;  2KYC A;  1AJ5 A;  1TCF A;  2LCP A;  4JQ0 D;  5KTY A;  2MLF C;  3GK2 A;  4NDD A;  5B8I B;  1WY9 A;  2WCB A;  2ZFD A;  3TDU A;  2HPS A;  4OV2 A;  2LAP A;  2BEC A;  2GV5 A;  1YRU B;  4ORB B;  1F70 A;  2M29 A;  1IG5 A;  1TRF A;  3GK1 A;  2K8M B;  2I18 A;  4OCI A;  5KU1 A;  3TS5 B;  1KK7 Y;  1YRT B;  2NZ0 A;  4CFQ A;  3I5H B;  1J7R A;  2HET A;  3CS1 A;  1TNX A;  1DF0 B;  1YR5 A;  3BOW A;  1QIV A;  4MSP A;  3BQ3 A;  3NSO A;  2IS9 A;  1A75 B;  2LP2 A;  1SRA A;  4ICB A;  2EGD A;  1PSB A;  1DJI A;  4L9M A;  3AAK A;  1CDM A;  2OS8 C;  4HSZ A;  5HYD A;  4MRY A;  1F55 A;  1M31 A;  4XYN A;  1VRK A;  1NX0 A;  2LLS A;  1SMG A;  1CDN A;  1EJ3 A;  4U8D A;  2BKI B;  2NXQ A;  4YGE B;  2LVJ A;  3I5G C;  1QVI Z;  4ZCU A;  1IJ5 A;  2KHN A;  3EVU A;  1N2D A;  3AKB A;  5JOL A;  1ZAC A;  2LC5 A;  5DKN A;  1WLZ A;  1SW8 A;  2MJW B;  5K89 A;  2L4H A;  1S6J A;  1NIW A;  5HKY A;  3NSL A;  1Q80 A;  2PAL A;  1SPY A;  1HQV A;  3BUN B;  2SAS A;  1EG4 A;  1WRZ A;  2MLE C;  5FYX A;  3KHE A;  3TUY C;  2WCF A;  3WNX B;  2LVV A;  1SR6 C;  1Y1X A;  2FOT A;  4PDZ A;  4WQ3 A;  2KYF A;  3O2P A;  4GGN A;  1KFU S;  4I5N B;  2JTZ A;  1YUT A;  2M1K B;  1S3P A;  5AXI A;  1XO5 A;  1M63 B;  1DT7 B;  1CNP A;  1K2H A;  3SG2 A;  2AAO A;  3QRX A;  1XFZ O;  1QTX A;  2L4I A;  1BR4 B;  3I5F B;  4DUQ A;  1SYM A;  1JF2 A;  1KK7 Z;  4GAO A;  3EVV A;  3SG4 A;  3PLF B;  1YTZ C;  2LMV A;  3BXK A;  1K95 A;  1CMG A;  1CB1 A;  1A29 A;  3SIB A;  1YUS A;  2M1U A;  1XA5 A;  3M0W A;  3ZNI A;  3DF0 B;  1OMV A;  1L2O C;  4JPZ B;  1BOC A;  2G2B A;  2BE6 A;  2ZKM X;  1J55 A;  3OX5 A;  2KI6 D;  1IJ6 A;  1QAS A;  2BCX A;  2H61 A;  2M7L A;  1OMD A;  3K21 A;  1KQM B;  4DRW A;  1XFX O;  2I7A A;  2K2A A;  4PE0 A;  1OOJ A;  2GGZ A;  1TNW A;  3BUM B;  1JFK A;  2KBI A;  1WDC C;  2NLN A;  1NP8 A;  2JT8 A;  5GQQ C;  1CM4 A;  2JWW A;  3AKA A;  1S36 A;  2WND A;  2F3Y A;  3NSK A;  1DF0 A;  1DJW A;  1QXP A;  3SIA A;  1IQ3 A;  2K61 A;  1REC A;  3OP0 A;  4M2P A;  5J3X A;  1CTR A;  1RFJ A;  4MVF A;  1A75 A;  3IF7 A;  2VRG A;  3LLE A;  3KF9 A;  5F6T A;  2R2I A;  1AUI B;  1QV0 A;  1BF5 A;  4HRH A;  3RM1 A;  1NSH A;  1CLM A; 
#chains in the Genus database with same CATH topology
 2K7O A;  2GGM A;  3D74 A;  1DC1 A;  1YVL A;  3H4S E;  1KFX S;  1ALV A;  1CDL A;  2M8U A;  1AHR A;  3CR5 X;  3KPX A;  1EL4 A;  1BOD A;  1QVI Y;  2KAY A;  3BFA A;  1NCY A;  3PAL A;  4YRU A;  3CZ1 A;  2M97 A;  1K94 A;  1S6C A;  3GK4 X;  1QX5 B;  4NQG A;  3D77 A;  2F33 A;  1OOF A;  3FE8 A;  1JF0 A;  4MZJ A;  5CSJ A;  4YGC B;  1XFR A;  4YGB B;  1LS8 A;  1N65 A;  4PHM A;  3EG5 B;  4CFR A;  1XVJ A;  3S0D A;  3VRO A;  4IL1 A;  2LLU A;  5I2O A;  1TUZ A;  5HLV A;  2KI4 B;  2OTG C;  1SCM B;  1HT9 A;  1U5I A;  1FBV A;  2EHB A;  3DZT A;  3JVT B;  5ER4 X;  3I5I B;  3JTD B;  4QJ4 B;  5G08 A;  2L2C A;  1K9P A;  3CGA A;  3CYZ A;  2KAX A;  2O5G A;  2P6B B;  2PMY A;  4PCW A;  1QLS A;  4PE1 A;  5FI2 A;  3VRQ A;  3MSE B;  4JKT A;  4MRX A;  2FCE A;  1Y6W A;  1YUR A;  1R2U A;  4PE4 A;  1RRO A;  1NX1 A;  3PSR A;  2HQW A;  1B8L A;  1ODB A;  2K60 A;  4MEW A;  1MF8 B;  2KGR A;  3SG7 A;  4MLW A;  2JQ6 A;  1S26 D;  3DVE A;  2PAS A;  2JOJ A;  4INW A;  3DD4 A;  1X02 A;  2QAC A;  2ISD A;  2LLT A;  3JTD C;  1B8R A;  1ORG A;  1ZUZ A;  2H61 C;  3DF0 A;  2Q91 A;  2TN4 A;  3SS5 A;  2ZRT A;  3O4X A;  3PJI A;  3IQQ A;  3PN7 B;  5DKR A;  3PM8 A;  1OQP A;  5CSI A;  2H2K A;  1IKU A;  2MA2 A;  1OOI X;  1YX8 A;  1JUO A;  1LVC D;  2M7N A;  5TNC A;  1PSR A;  1MWN A;  2HQ8 A;  2JT3 A;  2PVB A;  4HRG A;  5FI7 A;  3VRR A;  3CAB A;  4YGA A;  1K9K A;  3TS5 C;  4WRI A;  3I5H C;  2WCK A;  3CDN A;  2LHL A;  2F8P A;  1YVH A;  1IIO A;  5CSN A;  3BFB A;  3DVM A;  3IQO A;  2BNX A;  3IVT A;  2KFG A;  3NXA A;  1LA3 A;  1BU3 A;  1UHI A;  4DCK A;  1CLL A;  3D73 A;  2KGB C;  1C7V A;  2HF5 A;  2K0J A;  2KBM A;  1CMF A;  1UHJ A;  3D0Y B;  2QEO A;  4I5J A;  2F3Z A;  1LKJ A;  3SS3 A;  1C07 A;  3R1O A;  2KI6 C;  4ETO A;  4P5O E;  2PSR A;  1JWD A;  1LXF C;  5I2L A;  4A4C A;  1OE9 B;  4ORA B;  1MHO A;  1KWO B;  1DMO A;  3BUO B;  1SSE B;  1DGV A;  1PRW A;  2K7D A;  1F4O A;  2L0P A;  1KSM A;  1KK8 B;  3EVR A;  3A4U B;  2Y5I A;  3NHI A;  1XFW O;  3L4L A;  3HCM A;  5D3O A;  1LIN A;  1DEL A;  1XFY O;  4QJ3 B;  3CZT X;  1KQV A;  2BCB A;  1AVS A;  3NSI A;  4C0K A;  4C0L A;  1UHH A;  1NYA A;  4A4B A;  2KSP A;  2ZRS A;  1J7O A;  1GJY A;  3OBV A;  3CLN A;  1G33 A;  3I5F C;  1UWO A;  1S5G Z;  3RZS A;  3TZ1 A;  1B47 A;  4GGF A;  2KAV A;  3O6B A;  1G4Y R;  1FI6 A;  4IJ7 A;  1TNQ A;  2MBX A;  3EKH A;  3WHU B;  1QIW A;  5CPV A;  3FWC A;  1DVI A;  1YX7 A;  2ZN8 A;  1BR1 B;  2JRF A;  3BOW B;  1C3Z A;  4GPL B;  5D7F A;  3S0G A;  3WXA A;  1BLQ A;  1ZOT B;  1LA0 A;  5AAN A;  2Y4Q A;  1KQM C;  1Z2C B;  3BFH A;  2KFF A;  2LMT A;  4PHJ A;  2LE9 B;  3A8R A;  1CFF A;  3KO0 A;  4GNK B;  2WC8 A;  4JD9 A;  1PAL A;  2CNP A;  5IBW A;  2QEV A;  1FI5 A;  2CBL A;  3FE9 A;  4XJK B;  2AMI A;  2PRU A;  2M3W A;  3RLZ A;  1DQE A;  1Y1A A;  2QDI A;  5HLO A;  1MQ1 A;  2WC5 A;  1FF1 A;  3S0E A;  3Q8I A;  1OOH A;  3TDZ A;  1CFC A;  1Y1U A;  1AK8 A;  2CXJ A;  1BG1 A;  4CLN A;  1UP5 A;  1OMR A;  2MHH A;  3UNW A;  4AOM A;  1SBJ A;  2OPO A;  2COL B;  1K96 A;  1PUL A;  1NX3 A;  2LVK A;  3L4A A;  3ZWH A;  3FWB A;  1G8I A;  3FIA A;  3D0Y A;  4M2O A;  1IGV A;  2QEH A;  3B6X A;  1XK4 C;  2KDH A;  1YUU A;  3DXL A;  4USL A;  1WRL A;  1RK9 A;  2BL0 B;  3B87 A;  3EKJ A;  1K9U A;  1EG3 A;  4YI9 A;  1DJY A;  1MR8 A;  1SKT A;  1D1O A;  2JNX A;  2FJU B;  1TCO B;  1CKK A;  1ALW A;  1RWY A;  3DVK A;  1TIZ A;  1DJH A;  3AAJ A;  4N1F A;  4BY5 A;  1AP4 A;  2KOT A;  1IH0 A;  2KI4 C;  1Y0V H;  2G9B A;  1SCM C;  2F2O A;  1DJG A;  3B86 A;  5JJG A;  2D8N A;  2BE4 A;  3JVT C;  4MBE A;  4PAL A;  1DTL A;  2LNK A;  4N1G A;  2NCP A;  3I5I C;  3KEV A;  1V1G A;  3O78 A;  3S0A A;  3PAT A;  5PAL A;  1QAT A;  1JC2 A;  5D69 A;  5HKW A;  5I8N A;  3TDI A;  4C0J A;  4CPV A;  1OZS A;  2LM5 A;  1TUJ A;  3L47 A;  1C7W A;  4GGF C;  2ZN9 A;  5I2Q A;  2SCP A;  1ZMZ A;  3CZ0 A;  1A2X A;  2KNE A;  1J1E A;  2L5Y A;  2CTN A;  3CR2 A;  1UHN A;  4PHK A;  1S5G Y;  3BYA A;  1PVB A;  1DJX A;  2OS8 B;  5EL2 A;  1KSO A;  1JSA A;  3SS4 A;  1SL9 A;  1QX2 A;  1CM1 A;  3CWG A;  1SY9 A;  4JWQ A;  2I94 A;  2LUX A;  2NCO A;  2FCD A;  2ZND A;  1GQM A;  4M2Q A;  2JT0 A;  3GOF A;  4P2Y B;  1B4C A;  2K7C A;  3EK8 A;  3PN7 C;  4Q04 A;  5KSZ A;  3I5G B;  1CFP A;  4OR9 B;  2LMU A;  4NDC A;  2V53 A;  3BUW B;  1UUR A;  3LL8 B;  1TOP A;  2BCA A;  5BPJ A;  3LCP C;  2KQ6 A;  4GBA A;  2E6W A;  3ICB A;  1A03 A;  3VRN A;  5AER A;  2B1U A;  2DOQ A;  1XYD A;  3R72 A;  2JPT A;  4F7F A;  1J7P A;  2P70 A;  1M46 A;  1NX2 A;  4WQ2 A;  4XJK A;  4FQT A;  1B7T Z;  3B88 A;  1XK4 A;  3OGN A;  5CSF A;  1SL7 A;  1NUB A;  1A4P A;  1QLK A;  3EK7 A;  1R6P A;  1QS7 A;  3OB1 B;  4OVN F;  2RGI A;  1GGW A;  2LV7 A;  2JXC A;  3N7H A;  3OX6 A;  3TUY B;  1CLB A;  1AJ4 A;  1SR6 B;  2AUC A;  2JUL A;  4CID A;  1F54 A;  1V1F A;  3FS7 A;  2QPT A;  1KFU L;  1N0Y A;  3OHM B;  1OZO A;  3WHT B;  2M49 B;  2I2R E;  2LVI A;  2Q4U A;  1UHK A;  4N5X A;  2EC6 B;  5AFP A;  1JBA A;  4DIR A;  1QV1 A;  1K90 D;  2JC2 A;  3SJS A;  1GM0 A;  1SNL A;  2L98 A;  1M39 A;  3LK0 A;  1TNP A;  1OSA A;  2KLD A;  3SG5 A;  4F0Z B;  1U5I B;  1XFV O;  2M9G A;  1KWO C;  2WOR A;  1JFJ A;  3NGV A;  1BJF A;  2KQY A;  1L7Z A;  1DGU A;  2LUC A;  3UO9 A;  2A4J A;  1L2O B;  1MUX A;  3DVJ A;  4MN0 A;  1WLM A;  4AQJ A;  1DJZ A;  1KK8 C;  1RTP 1;  2EC6 C;  5AEQ A;  4ORC B;  3VGO A;  3PM2 A;  1FPW A;  2BBM A;  2BKH B;  2Y1N A;  1B8C A;  2Y1M A;  2O60 A;  1W7I B;  4BY4 A;  4TNC A;  1BMO A;  1WDC B;  4MZK A;  1T14 A;  1K93 D;  1J1D A;  3F45 A;  3CR4 X;  3HX4 A;  3PFV A;  1BT6 A;  1CFD A;  2WCM A;  1IQ5 A;  4OZD A;  3D10 A;  1SK6 D;  1QX7 A;  2CT9 A;  3EK4 A;  3LK1 A;  3S0B A;  2L2E A;  5ER5 A;  4PHN A;  1J7Q A;  1CDP A;  1IWQ A;  3VRP A;  2KFH A;  4FQO A;  2WCE A;  1NCX A;  1EH2 A;  1SCV A;  4GFT A;  1NPQ A;  3O4Y A;  2KLE A;  4PE7 A;  1E8A A;  3D75 A;  3SG3 A;  2M0R A;  2L51 A;  2JNF A;  2JXL A;  1NWD A;  2JPO A;  2ZNE A;  4MZL A;  5HL1 A;  1K8U A;  4ZCV A;  5HKZ A;  1EXR A;  1KFX L;  1RJV A;  2H8V A;  3E3R A;  4AQI A;  2BBN A;  3R1P A;  4INX A;  3SG6 A;  1FW4 A;  2JZI A;  3S0F A;  2K2F A;  1B1G A;  3CTN A;  2L5X B;  4I5K A;  3R1V A;  1W7J B;  1MXL C;  4UPG A;  1MXE A;  1XFU O;  2L50 A;  2MAZ A;  1B7T Y;  2JTT A;  2MRD A;  2OTG B;  1B9A A;  3BUX B;  3FE6 A;  2F2P A;  1F4Q A;  1GGZ A;  4QJ5 B;  4GUK A;  2LAN A;  1W9Z A;  1QJT A;  2WCJ A;  4YBH B;  1F8H A;  3BJH A;  2LP3 A;  4I5L B;  5I94 A;  4YI8 A;  1H8B A;  1S6I A;  5DKQ A;  4YGD B;  4NDB A;  1SL8 A;  2LHI A;  4R1E A;  1UUS A;  1WRK A;  3OB2 B;  4HRE E;  1F71 A;  1NCZ A;  2BL0 C;  1PVA A;  1KCY A;  2CCM A;  2WOS A;  1IRJ A;  1PK0 D;  4OKH A;  1ZFS A;  2K7B A;  2WC6 A;  1S1E A;  2JU0 A;  4DS7 A;  4E68 A;  1H4B A;  4FTG A;  1TN4 A;  2E30 A;  1TTX A;  3C1V A;  5DIC A;  1M45 A;  4D1E A;  2PYQ A;  2KYC A;  1AJ5 A;  1TCF A;  2LCP A;  3QME A;  4JQ0 D;  2MLF C;  3GK2 A;  4NDD A;  5B8I B;  1WY9 A;  2WCB A;  2ZFD A;  3DY9 A;  3TDU A;  2HPS A;  4OV2 A;  2LAP A;  2BEC A;  2GV5 A;  1YRU B;  3B7A A;  4ORB B;  1F70 A;  3D76 A;  2M29 A;  1IG5 A;  1TRF A;  3GK1 A;  5KTY A;  2K8M B;  2I18 A;  4OCI A;  5KU1 A;  3TS5 B;  3V2L A;  1KK7 Y;  1YRT B;  2NZ0 A;  3K1E A;  4CFQ A;  3I5H B;  1J7R A;  2HET A;  3CS1 A;  1TNX A;  1DF0 B;  1YR5 A;  3BOW A;  1OW4 A;  1QIV A;  4MSP A;  3BQ3 A;  3D78 A;  3NSO A;  2IS9 A;  1A75 B;  2LP2 A;  1C3Y A;  1SRA A;  4ICB A;  2EGD A;  1PSB A;  1DJI A;  4L9M A;  3AAK A;  1CDM A;  2OS8 C;  4HSZ A;  2P71 A;  5HYD A;  4MRY A;  1F55 A;  1M31 A;  4XYN A;  1VRK A;  1NX0 A;  2LLS A;  1SMG A;  1CDN A;  1EJ3 A;  4KYN A;  4U8D A;  2BKI B;  2NXQ A;  2YGU A;  4YGE B;  1OOG A;  2LVJ A;  3I5G C;  1QVI Z;  4ZCU A;  1IJ5 A;  2KHN A;  3EVU A;  1N2D A;  3AKB A;  5JOL A;  1ZAC A;  1DEK A;  2LC5 A;  5DKN A;  1WLZ A;  1SW8 A;  2MJW B;  5K89 A;  2L4H A;  1S6J A;  1NIW A;  5HKY A;  3NSL A;  1Q80 A;  2WCH A;  2PAL A;  1SPY A;  1HQV A;  3BUN B;  2SAS A;  1EG4 A;  1WRZ A;  2GTE A;  2MLE C;  1P28 A;  5FYX A;  3KHE A;  3TUY C;  2WCF A;  3WNX B;  2LVV A;  1SR6 C;  1Y1X A;  2FOT A;  4PDZ A;  4WQ3 A;  2KYF A;  3O2P A;  4GGN A;  1KFU S;  4I5N B;  2ERB A;  2KPH A;  2JTZ A;  1YUT A;  2M1K B;  1S3P A;  5AXI A;  1XO5 A;  1M63 B;  1DT7 B;  1CNP A;  1K2H A;  3SG2 A;  2AAO A;  3QRX A;  1XFZ O;  1QTX A;  2L4I A;  1BR4 B;  3I5F B;  2QEB A;  1SYM A;  1JF2 A;  1KK7 Z;  4GAO A;  3EVV A;  3SG4 A;  3PLF B;  4DUQ A;  1YTZ C;  2LMV A;  3BXK A;  1K95 A;  1CMG A;  1CB1 A;  1A29 A;  5FI6 A;  3SIB A;  1YUS A;  2M1U A;  2PQL A;  1XA5 A;  3M0W A;  3ZNI A;  3DF0 B;  1OMV A;  3VB1 A;  1L2O C;  2FJY A;  4JPZ B;  1BOC A;  2G2B A;  2BE6 A;  2ZKM X;  1J55 A;  3OX5 A;  2KI6 D;  1IJ6 A;  1QAS A;  2BCX A;  2H61 A;  2M7L A;  1OMD A;  3K21 A;  1KQM B;  4DRW A;  1XFX O;  4PT1 A;  1QWV A;  2I7A A;  2K2A A;  4PE0 A;  1OOJ A;  2GGZ A;  1TNW A;  3BUM B;  1JFK A;  2KBI A;  1WDC C;  2NLN A;  1NP8 A;  2JT8 A;  2BAP A;  2WCL A;  5GQQ C;  1CM4 A;  2JWW A;  3AKA A;  1S36 A;  2WND A;  2F3Y A;  3NSK A;  1DF0 A;  1DJW A;  1QXP A;  3NHT A;  3SIA A;  1IQ3 A;  2K61 A;  1REC A;  3OP0 A;  4M2P A;  5J3X A;  1CTR A;  1RFJ A;  4MVF A;  1A75 A;  3IF7 A;  3CZ2 A;  2VRG A;  3LLE A;  3KF9 A;  5F6T A;  2R2I A;  1AUI B;  1QV0 A;  1TWO A;  1Z4H A;  1BF5 A;  4HRH A;  3DYE A;  3RM1 A;  1NSH A;  1CLM A; 
#chains in the Genus database with same CATH homology
 2K7O A;  2GGM A;  1YVL A;  3H4S E;  1KFX S;  1ALV A;  1CDL A;  2M8U A;  1AHR A;  3CR5 X;  3KPX A;  1EL4 A;  1BOD A;  1QVI Y;  2KAY A;  1NCY A;  3PAL A;  4YRU A;  2M97 A;  1K94 A;  1S6C A;  3GK4 X;  1QX5 B;  4NQG A;  2F33 A;  1JF0 A;  4MZJ A;  5CSJ A;  4YGC B;  4YGB B;  1N65 A;  4PHM A;  4CFR A;  1XVJ A;  3VRO A;  4IL1 A;  2LLU A;  5I2O A;  5HLV A;  2KI4 B;  2OTG C;  1SCM B;  1HT9 A;  1U5I A;  1FBV A;  2EHB A;  3JVT B;  5ER4 X;  3I5I B;  3JTD B;  4QJ4 B;  5G08 A;  3CGA A;  1K9P A;  2KAX A;  2O5G A;  2P6B B;  2PMY A;  4PCW A;  1QLS A;  4PE1 A;  3VRQ A;  3MSE B;  4MRX A;  2FCE A;  1Y6W A;  1YUR A;  1R2U A;  4PE4 A;  1RRO A;  1NX1 A;  3PSR A;  2HQW A;  1B8L A;  1ODB A;  4MEW A;  1MF8 B;  2KGR A;  3SG7 A;  4MLW A;  2JQ6 A;  1S26 D;  3DVE A;  2PAS A;  2JOJ A;  3DD4 A;  1X02 A;  2QAC A;  2ISD A;  2LLT A;  3JTD C;  1B8R A;  1ZUZ A;  3DF0 A;  2H61 C;  2Q91 A;  2TN4 A;  2ZRT A;  3IQQ A;  3PN7 B;  5DKR A;  3PM8 A;  1OQP A;  5CSI A;  2H2K A;  1IKU A;  2MA2 A;  1YX8 A;  1JUO A;  1LVC D;  2M7N A;  5TNC A;  1PSR A;  1MWN A;  2HQ8 A;  2JT3 A;  2PVB A;  4HRG A;  3VRR A;  4YGA A;  1K9K A;  3TS5 C;  4WRI A;  3I5H C;  2LHL A;  2F8P A;  1YVH A;  5CSN A;  3DVM A;  3IQO A;  2KFG A;  3NXA A;  1LA3 A;  1BU3 A;  1UHI A;  4DCK A;  1CLL A;  2KGB C;  1C7V A;  2HF5 A;  2K0J A;  2KBM A;  1CMF A;  1UHJ A;  3D0Y B;  4I5J A;  2F3Z A;  1LKJ A;  1C07 A;  2KI6 C;  4ETO A;  4P5O E;  2PSR A;  1JWD A;  1LXF C;  5I2L A;  4A4C A;  1OE9 B;  4ORA B;  1MHO A;  1KWO B;  1DMO A;  3BUO B;  1DGV A;  1PRW A;  2K7D A;  1F4O A;  2L0P A;  1KSM A;  1KK8 B;  3EVR A;  3A4U B;  2Y5I A;  1XFW O;  3HCM A;  1LIN A;  1XFY O;  4QJ3 B;  3CZT X;  1KQV A;  2BCB A;  1AVS A;  3NSI A;  4C0K A;  4C0L A;  1UHH A;  1NYA A;  4A4B A;  2KSP A;  2ZRS A;  1J7O A;  1GJY A;  3CLN A;  1G33 A;  3I5F C;  1UWO A;  1S5G Z;  3TZ1 A;  1B47 A;  4GGF A;  2KAV A;  3O6B A;  1G4Y R;  1FI6 A;  1TNQ A;  2MBX A;  3EKH A;  3WHU B;  1QIW A;  5CPV A;  3FWC A;  1DVI A;  1YX7 A;  2ZN8 A;  1BR1 B;  2JRF A;  3BOW B;  4GPL B;  5D7F A;  3WXA A;  1BLQ A;  1ZOT B;  1LA0 A;  5AAN A;  2Y4Q A;  1KQM C;  2KFF A;  2LMT A;  4PHJ A;  2LE9 B;  3A8R A;  1CFF A;  3KO0 A;  4GNK B;  2WC8 A;  1PAL A;  2CNP A;  5IBW A;  1FI5 A;  2CBL A;  4XJK B;  2AMI A;  2PRU A;  2M3W A;  3RLZ A;  1Y1A A;  5HLO A;  1MQ1 A;  1FF1 A;  3TDZ A;  1CFC A;  1Y1U A;  1AK8 A;  2CXJ A;  1BG1 A;  4CLN A;  1UP5 A;  1OMR A;  2MHH A;  4AOM A;  1SBJ A;  2OPO A;  2COL B;  1K96 A;  1PUL A;  1NX3 A;  2LVK A;  3ZWH A;  3FWB A;  1G8I A;  3FIA A;  3D0Y A;  4M2O A;  1IGV A;  1XK4 C;  2KDH A;  1YUU A;  4USL A;  1WRL A;  1RK9 A;  2BL0 B;  3EKJ A;  1K9U A;  1EG3 A;  4YI9 A;  1DJY A;  1MR8 A;  1SKT A;  1D1O A;  2JNX A;  2FJU B;  1TCO B;  1CKK A;  1ALW A;  1RWY A;  3DVK A;  1TIZ A;  1DJH A;  3AAJ A;  4N1F A;  4BY5 A;  1AP4 A;  2KOT A;  1IH0 A;  2KI4 C;  1Y0V H;  2G9B A;  1SCM C;  2F2O A;  1DJG A;  5JJG A;  2D8N A;  2BE4 A;  3JVT C;  4MBE A;  4PAL A;  1DTL A;  2LNK A;  4N1G A;  2NCP A;  3I5I C;  3KEV A;  1V1G A;  3O78 A;  3PAT A;  5PAL A;  1QAT A;  1JC2 A;  5D69 A;  5HKW A;  5I8N A;  3TDI A;  4C0J A;  4CPV A;  1OZS A;  2LM5 A;  1C7W A;  4GGF C;  2ZN9 A;  5I2Q A;  2SCP A;  1ZMZ A;  1A2X A;  2KNE A;  1J1E A;  2CTN A;  3CR2 A;  1UHN A;  4PHK A;  1S5G Y;  3BYA A;  1PVB A;  1DJX A;  2OS8 B;  1KSO A;  1JSA A;  1SL9 A;  1QX2 A;  1CM1 A;  3CWG A;  1SY9 A;  4JWQ A;  2I94 A;  2LUX A;  2NCO A;  2FCD A;  2ZND A;  1GQM A;  4M2Q A;  2JT0 A;  3GOF A;  4P2Y B;  1B4C A;  2K7C A;  3EK8 A;  3PN7 C;  4Q04 A;  5KSZ A;  3I5G B;  1CFP A;  4OR9 B;  2LMU A;  4NDC A;  2V53 A;  3BUW B;  1UUR A;  3LL8 B;  1TOP A;  2BCA A;  5BPJ A;  3LCP C;  2KQ6 A;  4GBA A;  2E6W A;  3ICB A;  1A03 A;  3VRN A;  5AER A;  2B1U A;  2DOQ A;  1XYD A;  2JPT A;  1J7P A;  1M46 A;  1NX2 A;  4WQ2 A;  4XJK A;  1B7T Z;  1XK4 A;  5CSF A;  1SL7 A;  1NUB A;  1A4P A;  1QLK A;  3EK7 A;  1R6P A;  1QS7 A;  3OB1 B;  4OVN F;  2RGI A;  1GGW A;  2LV7 A;  2JXC A;  3OX6 A;  3TUY B;  1CLB A;  1AJ4 A;  1SR6 B;  2AUC A;  2JUL A;  4CID A;  1F54 A;  1V1F A;  3FS7 A;  2QPT A;  1KFU L;  1N0Y A;  3OHM B;  1OZO A;  3WHT B;  2M49 B;  2I2R E;  2LVI A;  2Q4U A;  1UHK A;  4N5X A;  2EC6 B;  5AFP A;  1JBA A;  4DIR A;  1QV1 A;  1K90 D;  2JC2 A;  3SJS A;  1SNL A;  2L98 A;  1M39 A;  3LK0 A;  1TNP A;  1OSA A;  3SG5 A;  4F0Z B;  1U5I B;  1XFV O;  2M9G A;  1KWO C;  2WOR A;  1JFJ A;  1BJF A;  2KQY A;  1L7Z A;  1DGU A;  2LUC A;  2A4J A;  1L2O B;  1MUX A;  3DVJ A;  4MN0 A;  1WLM A;  4AQJ A;  1DJZ A;  1KK8 C;  1RTP 1;  2EC6 C;  5AEQ A;  4ORC B;  3VGO A;  1FPW A;  2BBM A;  2BKH B;  2Y1N A;  1B8C A;  2Y1M A;  2O60 A;  1W7I B;  4BY4 A;  4TNC A;  1BMO A;  1WDC B;  4MZK A;  1K93 D;  1J1D A;  3F45 A;  3CR4 X;  3HX4 A;  3PFV A;  1BT6 A;  1CFD A;  1IQ5 A;  3D10 A;  1SK6 D;  1QX7 A;  2CT9 A;  3EK4 A;  3LK1 A;  2L2E A;  5ER5 A;  4PHN A;  1J7Q A;  1CDP A;  1IWQ A;  3VRP A;  2KFH A;  4FQO A;  2WCE A;  1NCX A;  1EH2 A;  1SCV A;  4GFT A;  1NPQ A;  3O4Y A;  4PE7 A;  1E8A A;  3SG3 A;  2M0R A;  2L51 A;  2JNF A;  2JXL A;  1NWD A;  2ZNE A;  4MZL A;  1K8U A;  4ZCV A;  5HKZ A;  1EXR A;  1KFX L;  1RJV A;  3E3R A;  4AQI A;  2BBN A;  3SG6 A;  1FW4 A;  2JZI A;  2K2F A;  1B1G A;  3CTN A;  2L5X B;  4I5K A;  1W7J B;  1MXL C;  4UPG A;  1MXE A;  1XFU O;  2L50 A;  2MAZ A;  1B7T Y;  2JTT A;  2MRD A;  2OTG B;  1B9A A;  3BUX B;  2F2P A;  1F4Q A;  1GGZ A;  4QJ5 B;  4GUK A;  2LAN A;  1QJT A;  4YBH B;  1F8H A;  2LP3 A;  4I5L B;  1H8B A;  4YI8 A;  1S6I A;  5DKQ A;  4YGD B;  4NDB A;  1SL8 A;  2LHI A;  4R1E A;  1UUS A;  1WRK A;  3OB2 B;  4HRE E;  1F71 A;  1NCZ A;  2BL0 C;  1PVA A;  1KCY A;  2CCM A;  2WOS A;  1IRJ A;  1PK0 D;  4OKH A;  1ZFS A;  2K7B A;  4DS7 A;  1S1E A;  2JU0 A;  4E68 A;  1H4B A;  4FTG A;  1TN4 A;  2E30 A;  1TTX A;  3C1V A;  1M45 A;  4D1E A;  2KYC A;  1AJ5 A;  1TCF A;  2LCP A;  4JQ0 D;  5KTY A;  2MLF C;  3GK2 A;  4NDD A;  5B8I B;  1WY9 A;  2WCB A;  2ZFD A;  3TDU A;  2HPS A;  4OV2 A;  2LAP A;  2BEC A;  2GV5 A;  1YRU B;  4ORB B;  1F70 A;  2M29 A;  1IG5 A;  1TRF A;  3GK1 A;  2K8M B;  2I18 A;  4OCI A;  5KU1 A;  3TS5 B;  1KK7 Y;  1YRT B;  2NZ0 A;  4CFQ A;  3I5H B;  1J7R A;  2HET A;  3CS1 A;  1TNX A;  1DF0 B;  1YR5 A;  3BOW A;  1QIV A;  4MSP A;  3BQ3 A;  3NSO A;  2IS9 A;  1A75 B;  2LP2 A;  1SRA A;  4ICB A;  2EGD A;  1PSB A;  1DJI A;  4L9M A;  3AAK A;  1CDM A;  2OS8 C;  4HSZ A;  5HYD A;  4MRY A;  1F55 A;  1M31 A;  4XYN A;  1VRK A;  1NX0 A;  2LLS A;  1SMG A;  1CDN A;  1EJ3 A;  4U8D A;  2BKI B;  2NXQ A;  4YGE B;  2LVJ A;  3I5G C;  1QVI Z;  4ZCU A;  1IJ5 A;  2KHN A;  3EVU A;  1N2D A;  3AKB A;  5JOL A;  1ZAC A;  2LC5 A;  5DKN A;  1WLZ A;  1SW8 A;  2MJW B;  5K89 A;  2L4H A;  1S6J A;  1NIW A;  5HKY A;  3NSL A;  1Q80 A;  2PAL A;  1SPY A;  1HQV A;  3BUN B;  2SAS A;  1EG4 A;  1WRZ A;  2MLE C;  5FYX A;  3KHE A;  3TUY C;  2WCF A;  3WNX B;  2LVV A;  1SR6 C;  1Y1X A;  2FOT A;  4PDZ A;  4WQ3 A;  2KYF A;  3O2P A;  4GGN A;  1KFU S;  4I5N B;  2JTZ A;  1YUT A;  2M1K B;  1S3P A;  5AXI A;  1XO5 A;  1M63 B;  1DT7 B;  1CNP A;  1K2H A;  3SG2 A;  2AAO A;  3QRX A;  1XFZ O;  1QTX A;  2L4I A;  1BR4 B;  3I5F B;  4DUQ A;  1SYM A;  1JF2 A;  1KK7 Z;  4GAO A;  3EVV A;  3SG4 A;  3PLF B;  1YTZ C;  2LMV A;  3BXK A;  1K95 A;  1CMG A;  1CB1 A;  1A29 A;  3SIB A;  1YUS A;  2M1U A;  1XA5 A;  3M0W A;  3ZNI A;  3DF0 B;  1OMV A;  1L2O C;  4JPZ B;  1BOC A;  2G2B A;  2BE6 A;  2ZKM X;  1J55 A;  3OX5 A;  2KI6 D;  1IJ6 A;  1QAS A;  2BCX A;  2H61 A;  2M7L A;  1OMD A;  3K21 A;  1KQM B;  4DRW A;  1XFX O;  2I7A A;  2K2A A;  4PE0 A;  1OOJ A;  2GGZ A;  1TNW A;  3BUM B;  1JFK A;  2KBI A;  1WDC C;  2NLN A;  1NP8 A;  2JT8 A;  5GQQ C;  1CM4 A;  2JWW A;  3AKA A;  1S36 A;  2WND A;  2F3Y A;  3NSK A;  1DF0 A;  1DJW A;  1QXP A;  3SIA A;  1IQ3 A;  2K61 A;  1REC A;  3OP0 A;  4M2P A;  5J3X A;  1CTR A;  1RFJ A;  4MVF A;  1A75 A;  3IF7 A;  2VRG A;  3LLE A;  3KF9 A;  5F6T A;  2R2I A;  1AUI B;  1QV0 A;  1BF5 A;  4HRH A;  3RM1 A;  1NSH A;  1CLM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...