1GQMA

The structure of s100a12 in a hexameric form and its proposed role in receptor signalling
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
87
structure length
87
Chain Sequence
TKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antimicrobial protein
molecule keywords CALGRANULIN C
publication title The Structure of S100A12 in a Hexameric Form and its Proposed Role in Receptor Signalling
pubmed doi rcsb
total genus 29
structure length 87
sequence length 87
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2001-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1gqmA00
1WRKA 4AQIA 5PALA 1ALWA 1B8CA 3AKBA 4PHNA 3CGAA 4XJKB 4C0KA 4WRIA 2JPTA 1YUSA 1S5GZ 2M97A 1QX5B 1KWOB 2CTNA 2M1UA 1EJ3A 3FIAA 2GGZA 4GGFA 4YGCB 3TDIA 3VGOA 1SMGA 1S3PA 4MN0A 4C0JA 1L2OC 4NDBA 1A29A 1D1OA 2FOTA 2BKIB 2BE4A 2TN4A 1PRWA 1AP4A 1K2HA 4GGFC 2ZRSA 1BU3A 2O5GA 4DCKA 1MWNA 2VRGA 1YVHA 2JT3A 5KSZA 1MXEA 2NXQA 1CKKA 2MRDA 2EGDA 1XVJA 1TN4A 2KGRA 1RJVA 1NIWA 1JF2A 5TNCA 1NX0A 1FPWA 2G9BA 3VRQA 1XFYO 2GGMA 5HKZA 3SG6A 2QPTA 1DJWA 3AAJA 1AK8A 4NQGA 4QJ4B 4I5KA 2JTTA 1KFUL 2M0RA 2F3YA 2L2EA 1MR8A 2L51A 1K9UA 2OTGC 1J7RA 1M31A 3I5FB 2OS8B 3ZNIA 2KQ6A 3PM8A 4DS7A 2KI6D 1MHOA 3BOWA 2K7DA 3SIBA 1ZUZA 2H61A 1MQ1A 1F4OA 3EVUA 4HRGA 1J7PA 3SG5A 1M63B 3DVEA 4OR9B 4ZCUA 1XFWO 1K93D 2H61C 1GGZA 1G8IA 4MZLA 1FF1A 4ETOA 3RLZA 4NDDA 1DJZA 1M46A 4N1GA 2HQ8A 2PMYA 3VRNA 2EHBA 3PN7B 3CWGA 1YTZC 3D10A 1NX2A 3I5HC 1DJGA 1JUOA 2BBNA 1C7VA 4D1EA 1M45A 4GGNA 1ZACA 1Y1AA 1QJTA 2PVBA 3D0YA 1K9PA 3MSEB 1UUSA 1B47A 4MLWA 5HLOA 3A4UB 4M2OA 5HKYA 1A2XA 1HT9A 2I7AA 1QIWA 1ODBA 2FJUB 3I5GC 1XK4A 2BCBA 3GK4X 3KF9A 1JWDA 3HCMA 1F71A 1IKUA 1SCMB 2JT8A 1DJXA 1BR4B 1SRAA 1UHNA 5B8IB 5D69A 1MUXA 2M49B 2L98A 5AEQA 4N1FA 2LHLA 1XK4C 3VRPA 3OHMB 1S36A 2K8MB 2Q91A 1GJYA 2Y1NA 5CSJA 2BL0C 1J55A 1LA0A 4CFQA 1CLMA 4R1EA 2LVJA 1QVIZ 1SK6D 2KGBC 4N5XA 3FWBA 4GFTA 4DIRA 3JVTC 1U5IA 4WQ2A 3GOFA 2NZ0A 3O6BA 1DF0B 1PVBA 1CNPA 1OZSA 1DJHA 2QACA 4CIDA 1B4CA 1N2DA 2CNPA 1K94A 1SBJA 1NP8A 2MLEC 1DGUA 3VROA 1JBAA 1UHIA 1IWQA 3NSLA 2K2FA 4AOMA 1TNXA 3TDUA 1CLLA 1K90D 2IS9A 2KBIA 2O60A 1CFPA 5F6TA 3M0WA 1NYAA 3FWCA 4ORAB 2JXCA 4MVFA 2R2IA 2JOJA 4PALA 4OV2A 2B1UA 1K9KA 1NX3A 2BE6A 1KK7Z 4NDCA 4QJ5B 3WNXB 2H2KA 2KFHA 3GK2A 3TDZA 1QX7A 4MZJA 1F54A 3CR2A 2V53A 4YI9A 1JC2A 1SL9A 3CS1A 5AERA 4HRHA 1A03A 1NPQA 1VRKA 2EC6B 1CFDA 3BUMB 4GNKB 2FCEA 4YGDB 3TZ1A 1RK9A 2Q4UA 4U8DA 3KPXA 5JOLA 1HQVA 1M39A 3AKAA 5AFPA 3BUXB 4L9MA 1YURA 4PE7A 1YR5A 1QASA 3I5FC 2OS8C 1Y1UA 5ER4X 1JFJA 2I18A 1BMOA 1DT7B 1JSAA 2AUCA 1RTP1 3JTDB 5CSNA 1DMOA 4USLA 1E8AA 1FW4A 4MZKA 2L0PA 5I2QA 1CDLA 2M3WA 1V1FA 2NCPA 1Y1XA 2CXJA 2KBMA 2WORA 4MEWA 1QV1A 2KAXA 1AHRA 3RM1A 1GGWA 1C7WA 1NCZA 1SR6C 2P6BB 1CDPA 2SASA 3OP0A 4JPZB 3IQOA 1BR1B 4OVNF 3O4YA 2PALA 4HSZA 3EVVA 1S1EA 3DF0A 1IGVA 1TCFA 2HF5A 2MA2A 5HYDA 4OCIA 2JXLA 3PN7C 3LL8B 3I5IB 4CLNA 2KYFA 1QATA 1S6IA 2OPOA 1RWYA 4Q04A 1SCVA 4DUQA 1FBVA 1XFZO 4M2PA 5DKQA 3KEVA 1G33A 1UHHA 2LLUA 2DOQA 1UHJA 3F45A 3CTNA 4YI8A 3QRXA 2JWWA 2E30A 4TNCA 2MHHA 2LE9B 4PHKA 4HREE 1CM4A 3SG7A 2LANA 1PALA 3SG2A 4A4CA 1B7TZ 2Y1MA 3LK1A 1AJ5A 1IJ6A 1DJIA 2LVIA 5DKNA 1SNLA 4FTGA 2WCEA 2KQYA 4MRYA 1XFXO 1YX7A 1ALVA 5D7FA 4ICBA 1DJYA 1CMFA 2JNFA 2LMUA 1F55A 3C1VA 4I5NB 2F2OA 1DF0A 1TNPA 4F0ZB 2M8UA 4WQ3A 1IJ5A 1K96A 2K0JA 5K89A 3CLNA 4YGAA 5FYXA 1KFUS 1S5GY 1TRFA 2KI4B 1IH0A 4YBHB 1J7OA 1YRUB 5JJGA 3EKHA 3PFVA 4P2YB 2KNEA 2M9GA 1WY9A 3BQ3A 4PE0A 1LVCD 2WC8A 1KQMB 2PASA 1PULA 2KHNA 1Y0VH 1F4QA 1RROA 3BUWB 2F3ZA 2KYCA 1OOJA 1B1GA 2E6WA 2L5XB 5CSFA 3SIAA 2LLTA 3TUYB 4UPGA 5KU1A 1NSHA 3DD4A 1NCXA 2LCPA 4E68A 2JT0A 3OX5A 4PHJA 1SL7A 3SJSA 2ZFDA 1SY9A 2FCDA 2KAYA 2WOSA 2M7LA 4BY4A 2L4IA 1UP5A 4XJKA 1TTXA 3PSRA 1KFXL 3KHEA 1KSOA 3E3RA 2K7BA 3EVRA 1SKTA 2A4JA 4CFRA 2EC6C 1AVSA 2KFGA 5KTYA 1BF5A 1OMVA 2I2RE 1KWOC 2MLFC 1NUBA 1TIZA 4QJ3B 1TNWA 2JNXA 3HX4A 4PHMA 1IQ3A 2BKHB 1OMDA 1QLSA 1R6PA 2LUXA 1WDCB 4MSPA 1TOPA 1WLMA 3DVJA 3FS7A 5HLVA 1B9AA 3VRRA 1B8RA 3I5GB 2JQ6A 1SYMA 3D0YB 2JC2A 3SG3A 4M2QA 1Q80A 3DVMA 4MRXA 1QXPA 1QIVA 1YUUA 2M1KB 2ZRTA 2HETA 1S26D 3BXKA 3PATA 2AAOA 2L4HA 3SG4A 2LP3A 1X02A 1LA3A 1BJFA 2JZIA 4OKHA 1NWDA 1CDNA 4YGEB 3WHTB 2LHIA 5J3XA 3EK4A 1YVLA 1KK8B 1CM1A 4GUKA 4CPVA 3NSKA 2MAZA 1J1DA 2SCPA 1MXLC 1FI6A 2K61A 3LK0A 1A75B 3JVTB 3I5IC 1WLZA 2KOTA 2JRFA 2ZN8A 1C07A 3A8RA 4JQ0D 1QX2A 2MJWB 3NSOA 1R2UA 2LAPA 1CDMA 1U5IB 2PRUA 2NCOA 1QV0A 2HQWA 1BG1A 1RECA 1OE9B 1V1GA 4PCWA 1BOCA 3NSIA 2HPSA 3EKJA 1XA5A 3KO0A 1W7IB 2ZNDA 2JULA 1QVIY 2K7OA 1AJ4A 2LM5A 3TS5B 1N65A 2ZNEA 2F8PA 1H8BA 4GAOA 1XFVO 1J1EA 4MBEA 4P5OE 4AQJA 3NXAA 1CFCA 1OSAA 1CLBA 3EK7A 3DVKA 5CPVA 2LLSA 2K2AA 3LCPC 1RFJA 4C0LA 1AUIB 1N0YA 1DVIA 2KI4C 1WRLA 2ISDA 4YGBB 1SCMC 2Y4QA 1F8HA 3BUOB 2KI6C 4ZCVA 1PSBA 1L2OB 3CR4X 5I2OA 1XYDA 1KQMC 1XFUO 4FQOA 1EXRA 5ER5A 1ZFSA 1CFFA 1SL8A 3AAKA 4GBAA 1YX8A 1K8UA 3OX6A 4A4BA 1KK7Y 1NX1A 3TUYC 1K95A 2CBLA 5GQQC 2KDHA 3O2PA 3GK1A 1OMRA 4BY5A 1S6JA 2KAVA 4PE4A 5BPJA 1BODA 2JU0A 1KCYA 1KQVA 2F33A 1A4PA 1SR6B 1TCOB 4JWQA 2ZN9A 2LUCA 2WNDA 2NLNA 4IL1A 3LLEA 1QLKA 1OQPA 1JFKA 1IQ5A 1QTXA 1B8LA 3CR5X 3PALA 2LVKA 1SPYA 2CCMA 1W7JB 5I8NA 1XO5A 2CT9A 2OTGB 2ZKMX 1MF8B 2Y5IA 1JF0A 1EH2A 1UHKA 1EG4A 3DF0B 3PLFB 1S6CA 5DKRA 4I5JA 5I2LA 3IF7A 5G08A 3BOWB 1UURA 1WDCC 4DRWA 2COLB 4PDZA 2I94A 2BBMA 3EK8A 2LC5A 1SW8A 1DGVA 2RGIA 4XYNA 1CMGA 2F2PA 2M29A 1NCYA 2WCFA 3BYAA 5HKWA 4YRUA 1CB1A 1ZOTB 1EG3A 2AMIA 1IRJA 5AXIA 1FI5A 1L7ZA 3WXAA 5CSIA 2LMVA 1F70A 1A75A 3I5HB 1J7QA 2LP2A 1KK8C 4ORBB 1UWOA 1DTLA 1PK0D 2LVVA 2LV7A 1OZOA 1LXFC 1BLQA 2D8NA 2JTZA 1EL4A 5AANA 2KSPA 2BCXA 2LMTA 3OB1B 3JTDC 3OB2B 1WRZA 1PVAA 2KFFA 1B7TY 1YUTA 3O78A 2BCAA 2G2BA 1YRTB 1ZMZA 1QS7A 2PSRA 2LNKA 2GV5A 3WHUB 3ZWHA 2L50A 3CZTX 2MBXA 1LKJA 1TNQA 4GPLB 1H4BA 1IG5A 1BT6A 1KSMA 1LINA 1PSRA 2BECA 4ORCB 2WCBA 5IBWA 3H4SE 2BL0B 1Y6WA 3ICBA 3BUNB 3TS5C 4I5LB 1G4YR 3IQQA 3K21A 2M7NA 1CTRA 2K7CA 1GQMA 4PE1A 1KFXS
chains in the Genus database with same CATH superfamily
1WRKA 4AQIA 1OOGA 5PALA 3BFHA 1ALWA 1B8CA 3AKBA 4PHNA 3CGAA 4XJKB 4C0KA 4WRIA 2JPTA 1YUSA 1S5GZ 2M97A 1QX5B 1KWOB 2CTNA 2M1UA 1EJ3A 3FIAA 2GGZA 3R1OA 4GGFA 4YGCB 3VGOA 1ORGA 1SMGA 1S3PA 4MN0A 4C0JA 1L2OC 4NDBA 1A29A 1D1OA 3CDNA 2FOTA 2BKIB 2BE4A 2TN4A 1PRWA 1AP4A 1K2HA 4GGFC 2ZRSA 1BU3A 3CYZA 2O5GA 4DCKA 1MWNA 2VRGA 1YVHA 2JT3A 5KSZA 5HL1A 1MXEA 2NXQA 1CKKA 2MRDA 2EGDA 1XVJA 3PJIA 1TN4A 5D3OA 2KGRA 1RJVA 1NIWA 1JF2A 5TNCA 1NX0A 1FPWA 2G9BA 3VRQA 1XFYO 2GGMA 5HKZA 3SG6A 2QPTA 1DJWA 3AAJA 1AK8A 4NQGA 2YGUA 4I5KA 4QJ4B 2JTTA 1KFUL 2M0RA 2BNXA 2F3YA 2L2EA 1MR8A 2L51A 3TDIA 4INXA 3S0EA 1K9UA 2OTGC 2QEOA 1J7RA 1M31A 3I5FB 2OS8B 3ZNIA 2KQ6A 3PM8A 4DS7A 3RZSA 2KI6D 1MHOA 3BOWA 2K7DA 4FQTA 3SIBA 4KYNA 2WC6A 1ZUZA 3R1VA 2H61A 1MQ1A 1F4OA 3EVUA 4HRGA 1J7PA 3SG5A 1M63B 3DVEA 4OR9B 4ZCUA 2QEBA 1XFWO 3D73A 1K93D 2H61C 2GTEA 1GGZA 1G8IA 4MZLA 1FF1A 4ETOA 3RLZA 3V2LA 1W9ZA 4NDDA 1DJZA 1M46A 4N1GA 2HQ8A 2PMYA 3VRNA 2EHBA 2QEHA 3PN7B 3CWGA 1YTZC 3D10A 1NX2A 3I5HC 1DJGA 1JUOA 2BBNA 1C7VA 4D1EA 3D76A 1M45A 4GGNA 1ZACA 1Y1AA 2ERBA 1QJTA 2PVBA 3D0YA 1K9PA 3MSEB 1UUSA 1B47A 4MLWA 5HLOA 3A4UB 4M2OA 5HKYA 1A2XA 1HT9A 2I7AA 1QIWA 1ODBA 2FJUB 3I5GC 1XK4A 2BCBA 3DYEA 3GK4X 1SSEB 3KF9A 1JWDA 3HCMA 1F71A 1IKUA 1SCMB 2JT8A 1DJXA 1BR4B 1SRAA 1UHNA 5B8IB 5D69A 1MUXA 2M49B 2L98A 5AEQA 4N1FA 2LHLA 1XK4C 3Q8IA 3OHMB 3VRPA 3D77A 1S36A 2WCLA 2K8MB 2Q91A 1GJYA 2Y1NA 5CSJA 2BL0C 1J55A 1LA0A 4CFQA 1CLMA 4R1EA 2LVJA 1QVIZ 1SK6D 2KGBC 4N5XA 3FWBA 4GFTA 4DIRA 3JVTC 1U5IA 4WQ2A 3GOFA 2NZ0A 2WC5A 3O6BA 1DF0B 1PVBA 1CNPA 1OZSA 1DJHA 2QACA 2WCKA 4CIDA 1B4CA 1N2DA 2CNPA 1K94A 1SBJA 1NP8A 2MLEC 1DGUA 4OZDA 3VROA 1JBAA 1UHIA 1IWQA 3NSLA 2K2FA 3L4AA 4AOMA 1TNXA 1TUJA 3TDUA 1CLLA 1K90D 2IS9A 2KBIA 2O60A 3S0GA 1CFPA 5F6TA 3M0WA 1NYAA 3FWCA 4ORAB 2JXCA 4MVFA 2R2IA 2JOJA 4PALA 4OV2A 2B1UA 1K9KA 1NX3A 3N7HA 2BE6A 1KK7Z 1P28A 2L5YA 4NDCA 4QJ5B 3WNXB 2H2KA 2KFHA 3GK2A 3TDZA 1QX7A 4MZJA 1F54A 3CR2A 2V53A 4YI9A 3SS3A 1JC2A 1OOFA 1SL9A 3CS1A 5AERA 4HRHA 1A03A 1NPQA 3OGNA 1VRKA 2EC6B 1CFDA 3BUMB 4GNKB 2FCEA 4YGDB 3TZ1A 1RK9A 2Q4UA 4U8DA 3KPXA 5JOLA 1HQVA 1M39A 3AKAA 5AFPA 3BUXB 4L9MA 1YURA 4PE7A 1YR5A 1QASA 2L2CA 2OS8C 3I5FC 1Y1UA 5ER4X 1JFJA 2I18A 3B88A 1BMOA 1DT7B 1JSAA 2AUCA 1RTP1 3JTDB 5CSNA 1DMOA 4USLA 1E8AA 1FW4A 4MZKA 2L0PA 5I2QA 1CDLA 2M3WA 1V1FA 2NCPA 1Y1XA 2CXJA 2KBMA 2WORA 4MEWA 1QV1A 2KAXA 1AHRA 3D74A 3RM1A 1GGWA 1C7WA 1NCZA 1SR6C 2P6BB 1CDPA 2SASA 3OP0A 4JPZB 3IQOA 1BR1B 4OVNF 3O4YA 2PALA 4HSZA 3EVVA 1S1EA 3DF0A 1IGVA 1TCFA 2HF5A 2MA2A 5HYDA 3FE8A 4OCIA 2JXLA 5DICA 3CZ0A 3PN7C 3LL8B 3I5IB 4CLNA 3BJHA 2KYFA 1QATA 1S6IA 2OPOA 1RWYA 4Q04A 1SCVA 4DUQA 1FBVA 1XFZO 4M2PA 5DKQA 3KEVA 1G33A 1UHHA 2LLUA 2DOQA 1UHJA 3F45A 3CTNA 4YI8A 3QRXA 2JWWA 2QDIA 2E30A 4TNCA 2MHHA 2LE9B 4PHKA 4HREE 3CZ2A 1CM4A 3SG7A 2LANA 1PALA 3SG2A 4A4CA 1B7TZ 2Y1MA 3LK1A 1AJ5A 1IJ6A 1DJIA 2LVIA 5DKNA 1SNLA 3DXLA 4FTGA 2WCEA 1DC1A 2KQYA 4MRYA 1XFXO 1YX7A 1ALVA 5D7FA 5FI2A 4ICBA 1DJYA 1CMFA 2JNFA 2LMUA 1F55A 3C1VA 4I5NB 2F2OA 1DF0A 1TNPA 3O4XA 2H8VA 3VB1A 4F0ZB 2M8UA 1QWVA 4WQ3A 1IJ5A 2KLEA 1K96A 2K0JA 5K89A 3CLNA 2BAPA 3CZ1A 4YGAA 5FYXA 1KFUS 1S5GY 1TRFA 2KI4B 1IH0A 2P70A 1OW4A 4YBHB 1J7OA 1YRUB 5JJGA 3EKHA 3PFVA 4P2YB 2KNEA 2M9GA 1WY9A 3BQ3A 4PE0A 1LVCD 2WC8A 1KQMB 2PASA 1PULA 3BFBA 2KHNA 1Y0VH 1F4QA 1RROA 3BUWB 2F3ZA 2KYCA 1OOJA 1B1GA 3S0FA 2E6WA 2L5XB 5CSFA 3SIAA 2LLTA 3TUYB 4UPGA 5KU1A 3B6XA 1NSHA 3DD4A 1NCXA 2LCPA 2FJYA 4E68A 2JT0A 3OX5A 4PHJA 1SL7A 3SJSA 2ZFDA 1SY9A 2FCDA 2KAYA 2P71A 2WOSA 2M7LA 4BY4A 2L4IA 1UP5A 1OOIX 1Z4HA 1TTXA 3PSRA 1KFXL 3KHEA 4XJKA 1KSOA 3E3RA 2K7BA 3EVRA 1SKTA 2A4JA 4CFRA 2EC6C 1AVSA 2KFGA 5KTYA 3S0BA 1OMVA 2I2RE 1BF5A 1KWOC 2MLFC 1NUBA 1TIZA 4QJ3B 1TNWA 2JNXA 3HX4A 5FI6A 4PHMA 1IQ3A 2BKHB 1OMDA 1QLSA 1R6PA 2LUXA 1WDCB 4MSPA 1TOPA 1WLMA 5FI7A 3DVJA 3FS7A 5HLVA 1B9AA 3VRRA 1B8RA 3I5GB 2JQ6A 1SYMA 3D0YB 2JC2A 3SG3A 4M2QA 1Q80A 3DVMA 4MRXA 2KLDA 1QXPA 1QIVA 1YUUA 2M1KB 2ZRTA 2HETA 1S26D 3BXKA 3PATA 2AAOA 2L4HA 1C3ZA 3SG4A 2LP3A 1X02A 1LA3A 1BJFA 2JZIA 4OKHA 1NWDA 1CDNA 4YGEB 3WHTB 4JD9A 2LHIA 5J3XA 3EK4A 3SS4A 1YVLA 1KK8B 3B86A 4IJ7A 1CM1A 4GUKA 4CPVA 1TWOA 2MAZA 3NSKA 1J1DA 2SCPA 1MXLC 1FI6A 2K61A 3LK0A 1A75B 3JVTB 3I5IC 1WLZA 2KOTA 2JRFA 4JKTA 2ZN8A 1C07A 3A8RA 2PYQA 2QEVA 4JQ0D 1QX2A 2MJWB 3NSOA 1LS8A 1R2UA 1CDMA 2LAPA 1U5IB 2PRUA 2NCOA 2WCHA 1QV0A 2HQWA 1BG1A 1RECA 1OE9B 1V1GA 4PCWA 1BOCA 2WCMA 3NSIA 1IIOA 2HPSA 3EKJA 1XA5A 3KO0A 3PM2A 1Z2CB 1W7IB 1TUZA 2ZNDA 2JULA 3QMEA 1QVIY 2K7OA 1AJ4A 2LM5A 3TS5B 1N65A 2ZNEA 2F8PA 1H8BA 4GAOA 1XFVO 1J1EA 3FE6A 4MBEA 4P5OE 4AQJA 3NXAA 3IVTA 1CFCA 1OSAA 1CLBA 3UNWA 3EK7A 3DVKA 2WCJA 5CPVA 2LLSA 3D78A 2K2AA 3LCPC 1RFJA 4C0LA 3BFAA 1AUIB 1N0YA 1DVIA 4INWA 2KI4C 1WRLA 2PQLA 2ISDA 3FE9A 4YGBB 1SCMC 2Y4QA 3L47A 1F8HA 1T14A 3BUOB 2KI6C 4ZCVA 1PSBA 1L2OB 3CR4X 1DEKA 5I2OA 1XYDA 1KQMC 1XFUO 4FQOA 1EXRA 1DQEA 5ER5A 1ZFSA 1CFFA 1SL8A 3AAKA 4GBAA 1YX8A 1K8UA 3OX6A 3R1PA 4A4BA 1KK7Y 1NX1A 3B7AA 3TUYC 1K95A 2CBLA 5GQQC 2KDHA 3O2PA 3GK1A 1OMRA 3DZTA 1S6JA 1OOHA 2KAVA 4PE4A 4BY5A 2JU0A 5BPJA 1BODA 1KCYA 1KQVA 2F33A 1A4PA 1SR6B 1TCOB 4JWQA 2ZN9A 2LUCA 1GM0A 2WNDA 2NLNA 4IL1A 3LLEA 1QLKA 1OQPA 1JFKA 1IQ5A 1QTXA 3NHIA 1B8LA 3OBVA 3CR5X 3PALA 2LVKA 1SPYA 2CCMA 1W7JB 5I8NA 1XO5A 2CT9A 2KPHA 2OTGB 2ZKMX 1MF8B 2Y5IA 1JF0A 3S0DA 1EH2A 1UHKA 1EG4A 3DF0B 3L4LA 3PLFB 1S6CA 3SS5A 5DKRA 3S0AA 4I5JA 3CABA 5I2LA 3B87A 3IF7A 5G08A 3BOWB 1UURA 1WDCC 1XFRA 2COLB 4PDZA 4DRWA 2I94A 2BBMA 3EK8A 2LC5A 1SW8A 1DGVA 2RGIA 4XYNA 1CMGA 2F2PA 3D75A 2M29A 3EG5B 1NCYA 2WCFA 3BYAA 5HKWA 3R72A 4YRUA 1CB1A 1ZOTB 1EG3A 2AMIA 1IRJA 5AXIA 1FI5A 1L7ZA 3UO9A 3WXAA 2K60A 5CSIA 1C3YA 2LMVA 1F70A 1A75A 3I5HB 1J7QA 2LP2A 1KK8C 4ORBB 1UWOA 1DTLA 1PK0D 2LVVA 2LV7A 1OZOA 1LXFC 1BLQA 2D8NA 4PT1A 2JTZA 3K1EA 3NGVA 1EL4A 5AANA 2KSPA 2BCXA 3NHTA 2LMTA 3OB1B 3JTDC 3OB2B 1WRZA 1PVAA 2KFFA 1B7TY 1YUTA 3O78A 2BCAA 4F7FA 2G2BA 1YRTB 1ZMZA 1QS7A 2PSRA 2LNKA 2GV5A 3WHUB 3ZWHA 2JPOA 2L50A 3CZTX 3DY9A 2MBXA 1LKJA 1TNQA 4GPLB 1H4BA 1IG5A 1BT6A 1KSMA 1LINA 1PSRA 2BECA 4ORCB 2WCBA 5EL2A 3H4SE 5IBWA 2BL0B 1Y6WA 3ICBA 3BUNB 3TS5C 4I5LB 1G4YR 3IQQA 3K21A 1DELA 1CTRA 2M7NA 5I94A 2K7CA 1GQMA 4PE1A 1KFXS
chains in the Genus database with same CATH topology
1WRKA 4AQIA 5PALA 1ALWA 1B8CA 3AKBA 4PHNA 3CGAA 4XJKB 4C0KA 4WRIA 2JPTA 1YUSA 1S5GZ 2M97A 1QX5B 1KWOB 2CTNA 2M1UA 1EJ3A 3FIAA 2GGZA 4GGFA 4YGCB 3TDIA 3VGOA 1SMGA 1S3PA 4MN0A 4C0JA 1L2OC 4NDBA 1A29A 1D1OA 2FOTA 2BKIB 2BE4A 2TN4A 1PRWA 1AP4A 1K2HA 4GGFC 2ZRSA 1BU3A 2O5GA 4DCKA 1MWNA 2VRGA 1YVHA 2JT3A 5KSZA 1MXEA 2NXQA 1CKKA 2MRDA 2EGDA 1XVJA 1TN4A 2KGRA 1RJVA 1NIWA 1JF2A 5TNCA 1NX0A 1FPWA 2G9BA 3VRQA 1XFYO 2GGMA 5HKZA 3SG6A 2QPTA 1DJWA 3AAJA 1AK8A 4NQGA 4QJ4B 4I5KA 2JTTA 1KFUL 2M0RA 2F3YA 2L2EA 1MR8A 2L51A 1K9UA 2OTGC 1J7RA 1M31A 3I5FB 2OS8B 3ZNIA 2KQ6A 3PM8A 4DS7A 2KI6D 1MHOA 3BOWA 2K7DA 3SIBA 1ZUZA 2H61A 1MQ1A 1F4OA 3EVUA 4HRGA 1J7PA 3SG5A 1M63B 3DVEA 4OR9B 4ZCUA 1XFWO 1K93D 2H61C 1GGZA 1G8IA 4MZLA 1FF1A 4ETOA 3RLZA 4NDDA 1DJZA 1M46A 4N1GA 2HQ8A 2PMYA 3VRNA 2EHBA 3PN7B 3CWGA 1YTZC 3D10A 1NX2A 3I5HC 1DJGA 1JUOA 2BBNA 1C7VA 4D1EA 1M45A 4GGNA 1ZACA 1Y1AA 1QJTA 2PVBA 3D0YA 1K9PA 3MSEB 1UUSA 1B47A 4MLWA 5HLOA 3A4UB 4M2OA 5HKYA 1A2XA 1HT9A 2I7AA 1QIWA 1ODBA 2FJUB 3I5GC 1XK4A 2BCBA 3GK4X 3KF9A 1JWDA 3HCMA 1F71A 1IKUA 1SCMB 2JT8A 1DJXA 1BR4B 1SRAA 1UHNA 5B8IB 5D69A 1MUXA 2M49B 2L98A 5AEQA 4N1FA 2LHLA 1XK4C 3VRPA 3OHMB 1S36A 2K8MB 2Q91A 1GJYA 2Y1NA 5CSJA 2BL0C 1J55A 1LA0A 4CFQA 1CLMA 4R1EA 2LVJA 1QVIZ 1SK6D 2KGBC 4N5XA 3FWBA 4GFTA 4DIRA 3JVTC 1U5IA 4WQ2A 3GOFA 2NZ0A 3O6BA 1DF0B 1PVBA 1CNPA 1OZSA 1DJHA 2QACA 4CIDA 1B4CA 1N2DA 2CNPA 1K94A 1SBJA 1NP8A 2MLEC 1DGUA 3VROA 1JBAA 1UHIA 1IWQA 3NSLA 2K2FA 4AOMA 1TNXA 3TDUA 1CLLA 1K90D 2IS9A 2KBIA 2O60A 1CFPA 5F6TA 3M0WA 1NYAA 3FWCA 4ORAB 2JXCA 4MVFA 2R2IA 2JOJA 4PALA 4OV2A 2B1UA 1K9KA 1NX3A 2BE6A 1KK7Z 4NDCA 4QJ5B 3WNXB 2H2KA 2KFHA 3GK2A 3TDZA 1QX7A 4MZJA 1F54A 3CR2A 2V53A 4YI9A 1JC2A 1SL9A 3CS1A 5AERA 4HRHA 1A03A 1NPQA 1VRKA 2EC6B 1CFDA 3BUMB 4GNKB 2FCEA 4YGDB 3TZ1A 1RK9A 2Q4UA 4U8DA 3KPXA 5JOLA 1HQVA 1M39A 3AKAA 5AFPA 3BUXB 4L9MA 1YURA 4PE7A 1YR5A 1QASA 3I5FC 2OS8C 1Y1UA 5ER4X 1JFJA 2I18A 1BMOA 1DT7B 1JSAA 2AUCA 1RTP1 3JTDB 5CSNA 1DMOA 4USLA 1E8AA 1FW4A 4MZKA 2L0PA 5I2QA 1CDLA 2M3WA 1V1FA 2NCPA 1Y1XA 2CXJA 2KBMA 2WORA 4MEWA 1QV1A 2KAXA 1AHRA 3RM1A 1GGWA 1C7WA 1NCZA 1SR6C 2P6BB 1CDPA 2SASA 3OP0A 4JPZB 3IQOA 1BR1B 4OVNF 3O4YA 2PALA 4HSZA 3EVVA 1S1EA 3DF0A 1IGVA 1TCFA 2HF5A 2MA2A 5HYDA 4OCIA 2JXLA 3PN7C 3LL8B 3I5IB 4CLNA 2KYFA 1QATA 1S6IA 2OPOA 1RWYA 4Q04A 1SCVA 4DUQA 1FBVA 1XFZO 4M2PA 5DKQA 3KEVA 1G33A 1UHHA 2LLUA 2DOQA 1UHJA 3F45A 3CTNA 4YI8A 3QRXA 2JWWA 2E30A 4TNCA 2MHHA 2LE9B 4PHKA 4HREE 1CM4A 3SG7A 2LANA 1PALA 3SG2A 4A4CA 1B7TZ 2Y1MA 3LK1A 1AJ5A 1IJ6A 1DJIA 2LVIA 5DKNA 1SNLA 4FTGA 2WCEA 2KQYA 4MRYA 1XFXO 1YX7A 1ALVA 5D7FA 4ICBA 1DJYA 1CMFA 2JNFA 2LMUA 1F55A 3C1VA 4I5NB 2F2OA 1DF0A 1TNPA 4F0ZB 2M8UA 4WQ3A 1IJ5A 1K96A 2K0JA 5K89A 3CLNA 4YGAA 5FYXA 1KFUS 1S5GY 1TRFA 2KI4B 1IH0A 4YBHB 1J7OA 1YRUB 5JJGA 3EKHA 3PFVA 4P2YB 2KNEA 2M9GA 1WY9A 3BQ3A 4PE0A 1LVCD 2WC8A 1KQMB 2PASA 1PULA 2KHNA 1Y0VH 1F4QA 1RROA 3BUWB 2F3ZA 2KYCA 1OOJA 1B1GA 2E6WA 2L5XB 5CSFA 3SIAA 2LLTA 3TUYB 4UPGA 5KU1A 1NSHA 3DD4A 1NCXA 2LCPA 4E68A 2JT0A 3OX5A 4PHJA 1SL7A 3SJSA 2ZFDA 1SY9A 2FCDA 2KAYA 2WOSA 2M7LA 4BY4A 2L4IA 1UP5A 4XJKA 1TTXA 3PSRA 1KFXL 3KHEA 1KSOA 3E3RA 2K7BA 3EVRA 1SKTA 2A4JA 4CFRA 2EC6C 1AVSA 2KFGA 5KTYA 1BF5A 1OMVA 2I2RE 1KWOC 2MLFC 1NUBA 1TIZA 4QJ3B 1TNWA 2JNXA 3HX4A 4PHMA 1IQ3A 2BKHB 1OMDA 1QLSA 1R6PA 2LUXA 1WDCB 4MSPA 1TOPA 1WLMA 3DVJA 3FS7A 5HLVA 1B9AA 3VRRA 1B8RA 3I5GB 2JQ6A 1SYMA 3D0YB 2JC2A 3SG3A 4M2QA 1Q80A 3DVMA 4MRXA 1QXPA 1QIVA 1YUUA 2M1KB 2ZRTA 2HETA 1S26D 3BXKA 3PATA 2AAOA 2L4HA 3SG4A 2LP3A 1X02A 1LA3A 1BJFA 2JZIA 4OKHA 1NWDA 1CDNA 4YGEB 3WHTB 2LHIA 5J3XA 3EK4A 1YVLA 1KK8B 1CM1A 4GUKA 4CPVA 3NSKA 2MAZA 1J1DA 2SCPA 1MXLC 1FI6A 2K61A 3LK0A 1A75B 3JVTB 3I5IC 1WLZA 2KOTA 2JRFA 2ZN8A 1C07A 3A8RA 4JQ0D 1QX2A 2MJWB 3NSOA 1R2UA 2LAPA 1CDMA 1U5IB 2PRUA 2NCOA 1QV0A 2HQWA 1BG1A 1RECA 1OE9B 1V1GA 4PCWA 1BOCA 3NSIA 2HPSA 3EKJA 1XA5A 3KO0A 1W7IB 2ZNDA 2JULA 1QVIY 2K7OA 1AJ4A 2LM5A 3TS5B 1N65A 2ZNEA 2F8PA 1H8BA 4GAOA 1XFVO 1J1EA 4MBEA 4P5OE 4AQJA 3NXAA 1CFCA 1OSAA 1CLBA 3EK7A 3DVKA 5CPVA 2LLSA 2K2AA 3LCPC 1RFJA 4C0LA 1AUIB 1N0YA 1DVIA 2KI4C 1WRLA 2ISDA 4YGBB 1SCMC 2Y4QA 1F8HA 3BUOB 2KI6C 4ZCVA 1PSBA 1L2OB 3CR4X 5I2OA 1XYDA 1KQMC 1XFUO 4FQOA 1EXRA 5ER5A 1ZFSA 1CFFA 1SL8A 3AAKA 4GBAA 1YX8A 1K8UA 3OX6A 4A4BA 1KK7Y 1NX1A 3TUYC 1K95A 2CBLA 5GQQC 2KDHA 3O2PA 3GK1A 1OMRA 4BY5A 1S6JA 2KAVA 4PE4A 5BPJA 1BODA 2JU0A 1KCYA 1KQVA 2F33A 1A4PA 1SR6B 1TCOB 4JWQA 2ZN9A 2LUCA 2WNDA 2NLNA 4IL1A 3LLEA 1QLKA 1OQPA 1JFKA 1IQ5A 1QTXA 1B8LA 3CR5X 3PALA 2LVKA 1SPYA 2CCMA 1W7JB 5I8NA 1XO5A 2CT9A 2OTGB 2ZKMX 1MF8B 2Y5IA 1JF0A 1EH2A 1UHKA 1EG4A 3DF0B 3PLFB 1S6CA 5DKRA 4I5JA 5I2LA 3IF7A 5G08A 3BOWB 1UURA 1WDCC 4DRWA 2COLB 4PDZA 2I94A 2BBMA 3EK8A 2LC5A 1SW8A 1DGVA 2RGIA 4XYNA 1CMGA 2F2PA 2M29A 1NCYA 2WCFA 3BYAA 5HKWA 4YRUA 1CB1A 1ZOTB 1EG3A 2AMIA 1IRJA 5AXIA 1FI5A 1L7ZA 3WXAA 5CSIA 2LMVA 1F70A 1A75A 3I5HB 1J7QA 2LP2A 1KK8C 4ORBB 1UWOA 1DTLA 1PK0D 2LVVA 2LV7A 1OZOA 1LXFC 1BLQA 2D8NA 2JTZA 1EL4A 5AANA 2KSPA 2BCXA 2LMTA 3OB1B 3JTDC 3OB2B 1WRZA 1PVAA 2KFFA 1B7TY 1YUTA 3O78A 2BCAA 2G2BA 1YRTB 1ZMZA 1QS7A 2PSRA 2LNKA 2GV5A 3WHUB 3ZWHA 2L50A 3CZTX 2MBXA 1LKJA 1TNQA 4GPLB 1H4BA 1IG5A 1BT6A 1KSMA 1LINA 1PSRA 2BECA 4ORCB 2WCBA 5IBWA 3H4SE 2BL0B 1Y6WA 3ICBA 3BUNB 3TS5C 4I5LB 1G4YR 3IQQA 3K21A 2M7NA 1CTRA 2K7CA 1GQMA 4PE1A 1KFXS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WRK A;  4AQI A;  5PAL A;  1ALW A;  1B8C A;  3AKB A;  4PHN A;  3CGA A;  4XJK B;  4C0K A;  4WRI A;  2JPT A;  1YUS A;  1S5G Z;  2M97 A;  1QX5 B;  1KWO B;  2CTN A;  2M1U A;  1EJ3 A;  3FIA A;  2GGZ A;  4GGF A;  4YGC B;  3TDI A;  3VGO A;  1SMG A;  1S3P A;  4MN0 A;  4C0J A;  1L2O C;  4NDB A;  1A29 A;  1D1O A;  2FOT A;  2BKI B;  2BE4 A;  2TN4 A;  1PRW A;  1AP4 A;  1K2H A;  4GGF C;  2ZRS A;  1BU3 A;  2O5G A;  4DCK A;  1MWN A;  2VRG A;  1YVH A;  2JT3 A;  5KSZ A;  1MXE A;  2NXQ A;  1CKK A;  2MRD A;  2EGD A;  1XVJ A;  1TN4 A;  2KGR A;  1RJV A;  1NIW A;  1JF2 A;  5TNC A;  1NX0 A;  1FPW A;  2G9B A;  3VRQ A;  1XFY O;  2GGM A;  5HKZ A;  3SG6 A;  2QPT A;  1DJW A;  3AAJ A;  1AK8 A;  4NQG A;  4QJ4 B;  4I5K A;  2JTT A;  1KFU L;  2M0R A;  2F3Y A;  2L2E A;  1MR8 A;  2L51 A;  1K9U A;  2OTG C;  1J7R A;  1M31 A;  3I5F B;  2OS8 B;  3ZNI A;  2KQ6 A;  3PM8 A;  4DS7 A;  2KI6 D;  1MHO A;  3BOW A;  2K7D A;  3SIB A;  1ZUZ A;  2H61 A;  1MQ1 A;  1F4O A;  3EVU A;  4HRG A;  1J7P A;  3SG5 A;  1M63 B;  3DVE A;  4OR9 B;  4ZCU A;  1XFW O;  1K93 D;  2H61 C;  1GGZ A;  1G8I A;  4MZL A;  1FF1 A;  4ETO A;  3RLZ A;  4NDD A;  1DJZ A;  1M46 A;  4N1G A;  2HQ8 A;  2PMY A;  3VRN A;  2EHB A;  3PN7 B;  3CWG A;  1YTZ C;  3D10 A;  1NX2 A;  3I5H C;  1DJG A;  1JUO A;  2BBN A;  1C7V A;  4D1E A;  1M45 A;  4GGN A;  1ZAC A;  1Y1A A;  1QJT A;  2PVB A;  3D0Y A;  1K9P A;  3MSE B;  1UUS A;  1B47 A;  4MLW A;  5HLO A;  3A4U B;  4M2O A;  5HKY A;  1A2X A;  1HT9 A;  2I7A A;  1QIW A;  1ODB A;  2FJU B;  3I5G C;  1XK4 A;  2BCB A;  3GK4 X;  3KF9 A;  1JWD A;  3HCM A;  1F71 A;  1IKU A;  1SCM B;  2JT8 A;  1DJX A;  1BR4 B;  1SRA A;  1UHN A;  5B8I B;  5D69 A;  1MUX A;  2M49 B;  2L98 A;  5AEQ A;  4N1F A;  2LHL A;  1XK4 C;  3VRP A;  3OHM B;  1S36 A;  2K8M B;  2Q91 A;  1GJY A;  2Y1N A;  5CSJ A;  2BL0 C;  1J55 A;  1LA0 A;  4CFQ A;  1CLM A;  4R1E A;  2LVJ A;  1QVI Z;  1SK6 D;  2KGB C;  4N5X A;  3FWB A;  4GFT A;  4DIR A;  3JVT C;  1U5I A;  4WQ2 A;  3GOF A;  2NZ0 A;  3O6B A;  1DF0 B;  1PVB A;  1CNP A;  1OZS A;  1DJH A;  2QAC A;  4CID A;  1B4C A;  1N2D A;  2CNP A;  1K94 A;  1SBJ A;  1NP8 A;  2MLE C;  1DGU A;  3VRO A;  1JBA A;  1UHI A;  1IWQ A;  3NSL A;  2K2F A;  4AOM A;  1TNX A;  3TDU A;  1CLL A;  1K90 D;  2IS9 A;  2KBI A;  2O60 A;  1CFP A;  5F6T A;  3M0W A;  1NYA A;  3FWC A;  4ORA B;  2JXC A;  4MVF A;  2R2I A;  2JOJ A;  4PAL A;  4OV2 A;  2B1U A;  1K9K A;  1NX3 A;  2BE6 A;  1KK7 Z;  4NDC A;  4QJ5 B;  3WNX B;  2H2K A;  2KFH A;  3GK2 A;  3TDZ A;  1QX7 A;  4MZJ A;  1F54 A;  3CR2 A;  2V53 A;  4YI9 A;  1JC2 A;  1SL9 A;  3CS1 A;  5AER A;  4HRH A;  1A03 A;  1NPQ A;  1VRK A;  2EC6 B;  1CFD A;  3BUM B;  4GNK B;  2FCE A;  4YGD B;  3TZ1 A;  1RK9 A;  2Q4U A;  4U8D A;  3KPX A;  5JOL A;  1HQV A;  1M39 A;  3AKA A;  5AFP A;  3BUX B;  4L9M A;  1YUR A;  4PE7 A;  1YR5 A;  1QAS A;  3I5F C;  2OS8 C;  1Y1U A;  5ER4 X;  1JFJ A;  2I18 A;  1BMO A;  1DT7 B;  1JSA A;  2AUC A;  1RTP 1;  3JTD B;  5CSN A;  1DMO A;  4USL A;  1E8A A;  1FW4 A;  4MZK A;  2L0P A;  5I2Q A;  1CDL A;  2M3W A;  1V1F A;  2NCP A;  1Y1X A;  2CXJ A;  2KBM A;  2WOR A;  4MEW A;  1QV1 A;  2KAX A;  1AHR A;  3RM1 A;  1GGW A;  1C7W A;  1NCZ A;  1SR6 C;  2P6B B;  1CDP A;  2SAS A;  3OP0 A;  4JPZ B;  3IQO A;  1BR1 B;  4OVN F;  3O4Y A;  2PAL A;  4HSZ A;  3EVV A;  1S1E A;  3DF0 A;  1IGV A;  1TCF A;  2HF5 A;  2MA2 A;  5HYD A;  4OCI A;  2JXL A;  3PN7 C;  3LL8 B;  3I5I B;  4CLN A;  2KYF A;  1QAT A;  1S6I A;  2OPO A;  1RWY A;  4Q04 A;  1SCV A;  4DUQ A;  1FBV A;  1XFZ O;  4M2P A;  5DKQ A;  3KEV A;  1G33 A;  1UHH A;  2LLU A;  2DOQ A;  1UHJ A;  3F45 A;  3CTN A;  4YI8 A;  3QRX A;  2JWW A;  2E30 A;  4TNC A;  2MHH A;  2LE9 B;  4PHK A;  4HRE E;  1CM4 A;  3SG7 A;  2LAN A;  1PAL A;  3SG2 A;  4A4C A;  1B7T Z;  2Y1M A;  3LK1 A;  1AJ5 A;  1IJ6 A;  1DJI A;  2LVI A;  5DKN A;  1SNL A;  4FTG A;  2WCE A;  2KQY A;  4MRY A;  1XFX O;  1YX7 A;  1ALV A;  5D7F A;  4ICB A;  1DJY A;  1CMF A;  2JNF A;  2LMU A;  1F55 A;  3C1V A;  4I5N B;  2F2O A;  1DF0 A;  1TNP A;  4F0Z B;  2M8U A;  4WQ3 A;  1IJ5 A;  1K96 A;  2K0J A;  5K89 A;  3CLN A;  4YGA A;  5FYX A;  1KFU S;  1S5G Y;  1TRF A;  2KI4 B;  1IH0 A;  4YBH B;  1J7O A;  1YRU B;  5JJG A;  3EKH A;  3PFV A;  4P2Y B;  2KNE A;  2M9G A;  1WY9 A;  3BQ3 A;  4PE0 A;  1LVC D;  2WC8 A;  1KQM B;  2PAS A;  1PUL A;  2KHN A;  1Y0V H;  1F4Q A;  1RRO A;  3BUW B;  2F3Z A;  2KYC A;  1OOJ A;  1B1G A;  2E6W A;  2L5X B;  5CSF A;  3SIA A;  2LLT A;  3TUY B;  4UPG A;  5KU1 A;  1NSH A;  3DD4 A;  1NCX A;  2LCP A;  4E68 A;  2JT0 A;  3OX5 A;  4PHJ A;  1SL7 A;  3SJS A;  2ZFD A;  1SY9 A;  2FCD A;  2KAY A;  2WOS A;  2M7L A;  4BY4 A;  2L4I A;  1UP5 A;  4XJK A;  1TTX A;  3PSR A;  1KFX L;  3KHE A;  1KSO A;  3E3R A;  2K7B A;  3EVR A;  1SKT A;  2A4J A;  4CFR A;  2EC6 C;  1AVS A;  2KFG A;  5KTY A;  1BF5 A;  1OMV A;  2I2R E;  1KWO C;  2MLF C;  1NUB A;  1TIZ A;  4QJ3 B;  1TNW A;  2JNX A;  3HX4 A;  4PHM A;  1IQ3 A;  2BKH B;  1OMD A;  1QLS A;  1R6P A;  2LUX A;  1WDC B;  4MSP A;  1TOP A;  1WLM A;  3DVJ A;  3FS7 A;  5HLV A;  1B9A A;  3VRR A;  1B8R A;  3I5G B;  2JQ6 A;  1SYM A;  3D0Y B;  2JC2 A;  3SG3 A;  4M2Q A;  1Q80 A;  3DVM A;  4MRX A;  1QXP A;  1QIV A;  1YUU A;  2M1K B;  2ZRT A;  2HET A;  1S26 D;  3BXK A;  3PAT A;  2AAO A;  2L4H A;  3SG4 A;  2LP3 A;  1X02 A;  1LA3 A;  1BJF A;  2JZI A;  4OKH A;  1NWD A;  1CDN A;  4YGE B;  3WHT B;  2LHI A;  5J3X A;  3EK4 A;  1YVL A;  1KK8 B;  1CM1 A;  4GUK A;  4CPV A;  3NSK A;  2MAZ A;  1J1D A;  2SCP A;  1MXL C;  1FI6 A;  2K61 A;  3LK0 A;  1A75 B;  3JVT B;  3I5I C;  1WLZ A;  2KOT A;  2JRF A;  2ZN8 A;  1C07 A;  3A8R A;  4JQ0 D;  1QX2 A;  2MJW B;  3NSO A;  1R2U A;  2LAP A;  1CDM A;  1U5I B;  2PRU A;  2NCO A;  1QV0 A;  2HQW A;  1BG1 A;  1REC A;  1OE9 B;  1V1G A;  4PCW A;  1BOC A;  3NSI A;  2HPS A;  3EKJ A;  1XA5 A;  3KO0 A;  1W7I B;  2ZND A;  2JUL A;  1QVI Y;  2K7O A;  1AJ4 A;  2LM5 A;  3TS5 B;  1N65 A;  2ZNE A;  2F8P A;  1H8B A;  4GAO A;  1XFV O;  1J1E A;  4MBE A;  4P5O E;  4AQJ A;  3NXA A;  1CFC A;  1OSA A;  1CLB A;  3EK7 A;  3DVK A;  5CPV A;  2LLS A;  2K2A A;  3LCP C;  1RFJ A;  4C0L A;  1AUI B;  1N0Y A;  1DVI A;  2KI4 C;  1WRL A;  2ISD A;  4YGB B;  1SCM C;  2Y4Q A;  1F8H A;  3BUO B;  2KI6 C;  4ZCV A;  1PSB A;  1L2O B;  3CR4 X;  5I2O A;  1XYD A;  1KQM C;  1XFU O;  4FQO A;  1EXR A;  5ER5 A;  1ZFS A;  1CFF A;  1SL8 A;  3AAK A;  4GBA A;  1YX8 A;  1K8U A;  3OX6 A;  4A4B A;  1KK7 Y;  1NX1 A;  3TUY C;  1K95 A;  2CBL A;  5GQQ C;  2KDH A;  3O2P A;  3GK1 A;  1OMR A;  4BY5 A;  1S6J A;  2KAV A;  4PE4 A;  5BPJ A;  1BOD A;  2JU0 A;  1KCY A;  1KQV A;  2F33 A;  1A4P A;  1SR6 B;  1TCO B;  4JWQ A;  2ZN9 A;  2LUC A;  2WND A;  2NLN A;  4IL1 A;  3LLE A;  1QLK A;  1OQP A;  1JFK A;  1IQ5 A;  1QTX A;  1B8L A;  3CR5 X;  3PAL A;  2LVK A;  1SPY A;  2CCM A;  1W7J B;  5I8N A;  1XO5 A;  2CT9 A;  2OTG B;  2ZKM X;  1MF8 B;  2Y5I A;  1JF0 A;  1EH2 A;  1UHK A;  1EG4 A;  3DF0 B;  3PLF B;  1S6C A;  5DKR A;  4I5J A;  5I2L A;  3IF7 A;  5G08 A;  3BOW B;  1UUR A;  1WDC C;  4DRW A;  2COL B;  4PDZ A;  2I94 A;  2BBM A;  3EK8 A;  2LC5 A;  1SW8 A;  1DGV A;  2RGI A;  4XYN A;  1CMG A;  2F2P A;  2M29 A;  1NCY A;  2WCF A;  3BYA A;  5HKW A;  4YRU A;  1CB1 A;  1ZOT B;  1EG3 A;  2AMI A;  1IRJ A;  5AXI A;  1FI5 A;  1L7Z A;  3WXA A;  5CSI A;  2LMV A;  1F70 A;  1A75 A;  3I5H B;  1J7Q A;  2LP2 A;  1KK8 C;  4ORB B;  1UWO A;  1DTL A;  1PK0 D;  2LVV A;  2LV7 A;  1OZO A;  1LXF C;  1BLQ A;  2D8N A;  2JTZ A;  1EL4 A;  5AAN A;  2KSP A;  2BCX A;  2LMT A;  3OB1 B;  3JTD C;  3OB2 B;  1WRZ A;  1PVA A;  2KFF A;  1B7T Y;  1YUT A;  3O78 A;  2BCA A;  2G2B A;  1YRT B;  1ZMZ A;  1QS7 A;  2PSR A;  2LNK A;  2GV5 A;  3WHU B;  3ZWH A;  2L50 A;  3CZT X;  2MBX A;  1LKJ A;  1TNQ A;  4GPL B;  1H4B A;  1IG5 A;  1BT6 A;  1KSM A;  1LIN A;  1PSR A;  2BEC A;  4ORC B;  2WCB A;  5IBW A;  3H4S E;  2BL0 B;  1Y6W A;  3ICB A;  3BUN B;  3TS5 C;  4I5L B;  1G4Y R;  3IQQ A;  3K21 A;  2M7N A;  1CTR A;  2K7C A;  1GQM A;  4PE1 A;  1KFX S; 
#chains in the Genus database with same CATH topology
 1WRK A;  4AQI A;  1OOG A;  5PAL A;  3BFH A;  1ALW A;  1B8C A;  3AKB A;  4PHN A;  3CGA A;  4XJK B;  4C0K A;  4WRI A;  2JPT A;  1YUS A;  1S5G Z;  2M97 A;  1QX5 B;  1KWO B;  2CTN A;  2M1U A;  1EJ3 A;  3FIA A;  2GGZ A;  3R1O A;  4GGF A;  4YGC B;  3VGO A;  1ORG A;  1SMG A;  1S3P A;  4MN0 A;  4C0J A;  1L2O C;  4NDB A;  1A29 A;  1D1O A;  3CDN A;  2FOT A;  2BKI B;  2BE4 A;  2TN4 A;  1PRW A;  1AP4 A;  1K2H A;  4GGF C;  2ZRS A;  1BU3 A;  3CYZ A;  2O5G A;  4DCK A;  1MWN A;  2VRG A;  1YVH A;  2JT3 A;  5KSZ A;  5HL1 A;  1MXE A;  2NXQ A;  1CKK A;  2MRD A;  2EGD A;  1XVJ A;  3PJI A;  1TN4 A;  5D3O A;  2KGR A;  1RJV A;  1NIW A;  1JF2 A;  5TNC A;  1NX0 A;  1FPW A;  2G9B A;  3VRQ A;  1XFY O;  2GGM A;  5HKZ A;  3SG6 A;  2QPT A;  1DJW A;  3AAJ A;  1AK8 A;  4NQG A;  2YGU A;  4I5K A;  4QJ4 B;  2JTT A;  1KFU L;  2M0R A;  2BNX A;  2F3Y A;  2L2E A;  1MR8 A;  2L51 A;  3TDI A;  4INX A;  3S0E A;  1K9U A;  2OTG C;  2QEO A;  1J7R A;  1M31 A;  3I5F B;  2OS8 B;  3ZNI A;  2KQ6 A;  3PM8 A;  4DS7 A;  3RZS A;  2KI6 D;  1MHO A;  3BOW A;  2K7D A;  4FQT A;  3SIB A;  4KYN A;  2WC6 A;  1ZUZ A;  3R1V A;  2H61 A;  1MQ1 A;  1F4O A;  3EVU A;  4HRG A;  1J7P A;  3SG5 A;  1M63 B;  3DVE A;  4OR9 B;  4ZCU A;  2QEB A;  1XFW O;  3D73 A;  1K93 D;  2H61 C;  2GTE A;  1GGZ A;  1G8I A;  4MZL A;  1FF1 A;  4ETO A;  3RLZ A;  3V2L A;  1W9Z A;  4NDD A;  1DJZ A;  1M46 A;  4N1G A;  2HQ8 A;  2PMY A;  3VRN A;  2EHB A;  2QEH A;  3PN7 B;  3CWG A;  1YTZ C;  3D10 A;  1NX2 A;  3I5H C;  1DJG A;  1JUO A;  2BBN A;  1C7V A;  4D1E A;  3D76 A;  1M45 A;  4GGN A;  1ZAC A;  1Y1A A;  2ERB A;  1QJT A;  2PVB A;  3D0Y A;  1K9P A;  3MSE B;  1UUS A;  1B47 A;  4MLW A;  5HLO A;  3A4U B;  4M2O A;  5HKY A;  1A2X A;  1HT9 A;  2I7A A;  1QIW A;  1ODB A;  2FJU B;  3I5G C;  1XK4 A;  2BCB A;  3DYE A;  3GK4 X;  1SSE B;  3KF9 A;  1JWD A;  3HCM A;  1F71 A;  1IKU A;  1SCM B;  2JT8 A;  1DJX A;  1BR4 B;  1SRA A;  1UHN A;  5B8I B;  5D69 A;  1MUX A;  2M49 B;  2L98 A;  5AEQ A;  4N1F A;  2LHL A;  1XK4 C;  3Q8I A;  3OHM B;  3VRP A;  3D77 A;  1S36 A;  2WCL A;  2K8M B;  2Q91 A;  1GJY A;  2Y1N A;  5CSJ A;  2BL0 C;  1J55 A;  1LA0 A;  4CFQ A;  1CLM A;  4R1E A;  2LVJ A;  1QVI Z;  1SK6 D;  2KGB C;  4N5X A;  3FWB A;  4GFT A;  4DIR A;  3JVT C;  1U5I A;  4WQ2 A;  3GOF A;  2NZ0 A;  2WC5 A;  3O6B A;  1DF0 B;  1PVB A;  1CNP A;  1OZS A;  1DJH A;  2QAC A;  2WCK A;  4CID A;  1B4C A;  1N2D A;  2CNP A;  1K94 A;  1SBJ A;  1NP8 A;  2MLE C;  1DGU A;  4OZD A;  3VRO A;  1JBA A;  1UHI A;  1IWQ A;  3NSL A;  2K2F A;  3L4A A;  4AOM A;  1TNX A;  1TUJ A;  3TDU A;  1CLL A;  1K90 D;  2IS9 A;  2KBI A;  2O60 A;  3S0G A;  1CFP A;  5F6T A;  3M0W A;  1NYA A;  3FWC A;  4ORA B;  2JXC A;  4MVF A;  2R2I A;  2JOJ A;  4PAL A;  4OV2 A;  2B1U A;  1K9K A;  1NX3 A;  3N7H A;  2BE6 A;  1KK7 Z;  1P28 A;  2L5Y A;  4NDC A;  4QJ5 B;  3WNX B;  2H2K A;  2KFH A;  3GK2 A;  3TDZ A;  1QX7 A;  4MZJ A;  1F54 A;  3CR2 A;  2V53 A;  4YI9 A;  3SS3 A;  1JC2 A;  1OOF A;  1SL9 A;  3CS1 A;  5AER A;  4HRH A;  1A03 A;  1NPQ A;  3OGN A;  1VRK A;  2EC6 B;  1CFD A;  3BUM B;  4GNK B;  2FCE A;  4YGD B;  3TZ1 A;  1RK9 A;  2Q4U A;  4U8D A;  3KPX A;  5JOL A;  1HQV A;  1M39 A;  3AKA A;  5AFP A;  3BUX B;  4L9M A;  1YUR A;  4PE7 A;  1YR5 A;  1QAS A;  2L2C A;  2OS8 C;  3I5F C;  1Y1U A;  5ER4 X;  1JFJ A;  2I18 A;  3B88 A;  1BMO A;  1DT7 B;  1JSA A;  2AUC A;  1RTP 1;  3JTD B;  5CSN A;  1DMO A;  4USL A;  1E8A A;  1FW4 A;  4MZK A;  2L0P A;  5I2Q A;  1CDL A;  2M3W A;  1V1F A;  2NCP A;  1Y1X A;  2CXJ A;  2KBM A;  2WOR A;  4MEW A;  1QV1 A;  2KAX A;  1AHR A;  3D74 A;  3RM1 A;  1GGW A;  1C7W A;  1NCZ A;  1SR6 C;  2P6B B;  1CDP A;  2SAS A;  3OP0 A;  4JPZ B;  3IQO A;  1BR1 B;  4OVN F;  3O4Y A;  2PAL A;  4HSZ A;  3EVV A;  1S1E A;  3DF0 A;  1IGV A;  1TCF A;  2HF5 A;  2MA2 A;  5HYD A;  3FE8 A;  4OCI A;  2JXL A;  5DIC A;  3CZ0 A;  3PN7 C;  3LL8 B;  3I5I B;  4CLN A;  3BJH A;  2KYF A;  1QAT A;  1S6I A;  2OPO A;  1RWY A;  4Q04 A;  1SCV A;  4DUQ A;  1FBV A;  1XFZ O;  4M2P A;  5DKQ A;  3KEV A;  1G33 A;  1UHH A;  2LLU A;  2DOQ A;  1UHJ A;  3F45 A;  3CTN A;  4YI8 A;  3QRX A;  2JWW A;  2QDI A;  2E30 A;  4TNC A;  2MHH A;  2LE9 B;  4PHK A;  4HRE E;  3CZ2 A;  1CM4 A;  3SG7 A;  2LAN A;  1PAL A;  3SG2 A;  4A4C A;  1B7T Z;  2Y1M A;  3LK1 A;  1AJ5 A;  1IJ6 A;  1DJI A;  2LVI A;  5DKN A;  1SNL A;  3DXL A;  4FTG A;  2WCE A;  1DC1 A;  2KQY A;  4MRY A;  1XFX O;  1YX7 A;  1ALV A;  5D7F A;  5FI2 A;  4ICB A;  1DJY A;  1CMF A;  2JNF A;  2LMU A;  1F55 A;  3C1V A;  4I5N B;  2F2O A;  1DF0 A;  1TNP A;  3O4X A;  2H8V A;  3VB1 A;  4F0Z B;  2M8U A;  1QWV A;  4WQ3 A;  1IJ5 A;  2KLE A;  1K96 A;  2K0J A;  5K89 A;  3CLN A;  2BAP A;  3CZ1 A;  4YGA A;  5FYX A;  1KFU S;  1S5G Y;  1TRF A;  2KI4 B;  1IH0 A;  2P70 A;  1OW4 A;  4YBH B;  1J7O A;  1YRU B;  5JJG A;  3EKH A;  3PFV A;  4P2Y B;  2KNE A;  2M9G A;  1WY9 A;  3BQ3 A;  4PE0 A;  1LVC D;  2WC8 A;  1KQM B;  2PAS A;  1PUL A;  3BFB A;  2KHN A;  1Y0V H;  1F4Q A;  1RRO A;  3BUW B;  2F3Z A;  2KYC A;  1OOJ A;  1B1G A;  3S0F A;  2E6W A;  2L5X B;  5CSF A;  3SIA A;  2LLT A;  3TUY B;  4UPG A;  5KU1 A;  3B6X A;  1NSH A;  3DD4 A;  1NCX A;  2LCP A;  2FJY A;  4E68 A;  2JT0 A;  3OX5 A;  4PHJ A;  1SL7 A;  3SJS A;  2ZFD A;  1SY9 A;  2FCD A;  2KAY A;  2P71 A;  2WOS A;  2M7L A;  4BY4 A;  2L4I A;  1UP5 A;  1OOI X;  1Z4H A;  1TTX A;  3PSR A;  1KFX L;  3KHE A;  4XJK A;  1KSO A;  3E3R A;  2K7B A;  3EVR A;  1SKT A;  2A4J A;  4CFR A;  2EC6 C;  1AVS A;  2KFG A;  5KTY A;  3S0B A;  1OMV A;  2I2R E;  1BF5 A;  1KWO C;  2MLF C;  1NUB A;  1TIZ A;  4QJ3 B;  1TNW A;  2JNX A;  3HX4 A;  5FI6 A;  4PHM A;  1IQ3 A;  2BKH B;  1OMD A;  1QLS A;  1R6P A;  2LUX A;  1WDC B;  4MSP A;  1TOP A;  1WLM A;  5FI7 A;  3DVJ A;  3FS7 A;  5HLV A;  1B9A A;  3VRR A;  1B8R A;  3I5G B;  2JQ6 A;  1SYM A;  3D0Y B;  2JC2 A;  3SG3 A;  4M2Q A;  1Q80 A;  3DVM A;  4MRX A;  2KLD A;  1QXP A;  1QIV A;  1YUU A;  2M1K B;  2ZRT A;  2HET A;  1S26 D;  3BXK A;  3PAT A;  2AAO A;  2L4H A;  1C3Z A;  3SG4 A;  2LP3 A;  1X02 A;  1LA3 A;  1BJF A;  2JZI A;  4OKH A;  1NWD A;  1CDN A;  4YGE B;  3WHT B;  4JD9 A;  2LHI A;  5J3X A;  3EK4 A;  3SS4 A;  1YVL A;  1KK8 B;  3B86 A;  4IJ7 A;  1CM1 A;  4GUK A;  4CPV A;  1TWO A;  2MAZ A;  3NSK A;  1J1D A;  2SCP A;  1MXL C;  1FI6 A;  2K61 A;  3LK0 A;  1A75 B;  3JVT B;  3I5I C;  1WLZ A;  2KOT A;  2JRF A;  4JKT A;  2ZN8 A;  1C07 A;  3A8R A;  2PYQ A;  2QEV A;  4JQ0 D;  1QX2 A;  2MJW B;  3NSO A;  1LS8 A;  1R2U A;  1CDM A;  2LAP A;  1U5I B;  2PRU A;  2NCO A;  2WCH A;  1QV0 A;  2HQW A;  1BG1 A;  1REC A;  1OE9 B;  1V1G A;  4PCW A;  1BOC A;  2WCM A;  3NSI A;  1IIO A;  2HPS A;  3EKJ A;  1XA5 A;  3KO0 A;  3PM2 A;  1Z2C B;  1W7I B;  1TUZ A;  2ZND A;  2JUL A;  3QME A;  1QVI Y;  2K7O A;  1AJ4 A;  2LM5 A;  3TS5 B;  1N65 A;  2ZNE A;  2F8P A;  1H8B A;  4GAO A;  1XFV O;  1J1E A;  3FE6 A;  4MBE A;  4P5O E;  4AQJ A;  3NXA A;  3IVT A;  1CFC A;  1OSA A;  1CLB A;  3UNW A;  3EK7 A;  3DVK A;  2WCJ A;  5CPV A;  2LLS A;  3D78 A;  2K2A A;  3LCP C;  1RFJ A;  4C0L A;  3BFA A;  1AUI B;  1N0Y A;  1DVI A;  4INW A;  2KI4 C;  1WRL A;  2PQL A;  2ISD A;  3FE9 A;  4YGB B;  1SCM C;  2Y4Q A;  3L47 A;  1F8H A;  1T14 A;  3BUO B;  2KI6 C;  4ZCV A;  1PSB A;  1L2O B;  3CR4 X;  1DEK A;  5I2O A;  1XYD A;  1KQM C;  1XFU O;  4FQO A;  1EXR A;  1DQE A;  5ER5 A;  1ZFS A;  1CFF A;  1SL8 A;  3AAK A;  4GBA A;  1YX8 A;  1K8U A;  3OX6 A;  3R1P A;  4A4B A;  1KK7 Y;  1NX1 A;  3B7A A;  3TUY C;  1K95 A;  2CBL A;  5GQQ C;  2KDH A;  3O2P A;  3GK1 A;  1OMR A;  3DZT A;  1S6J A;  1OOH A;  2KAV A;  4PE4 A;  4BY5 A;  2JU0 A;  5BPJ A;  1BOD A;  1KCY A;  1KQV A;  2F33 A;  1A4P A;  1SR6 B;  1TCO B;  4JWQ A;  2ZN9 A;  2LUC A;  1GM0 A;  2WND A;  2NLN A;  4IL1 A;  3LLE A;  1QLK A;  1OQP A;  1JFK A;  1IQ5 A;  1QTX A;  3NHI A;  1B8L A;  3OBV A;  3CR5 X;  3PAL A;  2LVK A;  1SPY A;  2CCM A;  1W7J B;  5I8N A;  1XO5 A;  2CT9 A;  2KPH A;  2OTG B;  2ZKM X;  1MF8 B;  2Y5I A;  1JF0 A;  3S0D A;  1EH2 A;  1UHK A;  1EG4 A;  3DF0 B;  3L4L A;  3PLF B;  1S6C A;  3SS5 A;  5DKR A;  3S0A A;  4I5J A;  3CAB A;  5I2L A;  3B87 A;  3IF7 A;  5G08 A;  3BOW B;  1UUR A;  1WDC C;  1XFR A;  2COL B;  4PDZ A;  4DRW A;  2I94 A;  2BBM A;  3EK8 A;  2LC5 A;  1SW8 A;  1DGV A;  2RGI A;  4XYN A;  1CMG A;  2F2P A;  3D75 A;  2M29 A;  3EG5 B;  1NCY A;  2WCF A;  3BYA A;  5HKW A;  3R72 A;  4YRU A;  1CB1 A;  1ZOT B;  1EG3 A;  2AMI A;  1IRJ A;  5AXI A;  1FI5 A;  1L7Z A;  3UO9 A;  3WXA A;  2K60 A;  5CSI A;  1C3Y A;  2LMV A;  1F70 A;  1A75 A;  3I5H B;  1J7Q A;  2LP2 A;  1KK8 C;  4ORB B;  1UWO A;  1DTL A;  1PK0 D;  2LVV A;  2LV7 A;  1OZO A;  1LXF C;  1BLQ A;  2D8N A;  4PT1 A;  2JTZ A;  3K1E A;  3NGV A;  1EL4 A;  5AAN A;  2KSP A;  2BCX A;  3NHT A;  2LMT A;  3OB1 B;  3JTD C;  3OB2 B;  1WRZ A;  1PVA A;  2KFF A;  1B7T Y;  1YUT A;  3O78 A;  2BCA A;  4F7F A;  2G2B A;  1YRT B;  1ZMZ A;  1QS7 A;  2PSR A;  2LNK A;  2GV5 A;  3WHU B;  3ZWH A;  2JPO A;  2L50 A;  3CZT X;  3DY9 A;  2MBX A;  1LKJ A;  1TNQ A;  4GPL B;  1H4B A;  1IG5 A;  1BT6 A;  1KSM A;  1LIN A;  1PSR A;  2BEC A;  4ORC B;  2WCB A;  5EL2 A;  3H4S E;  5IBW A;  2BL0 B;  1Y6W A;  3ICB A;  3BUN B;  3TS5 C;  4I5L B;  1G4Y R;  3IQQ A;  3K21 A;  1DEL A;  1CTR A;  2M7N A;  5I94 A;  2K7C A;  1GQM A;  4PE1 A;  1KFX S; 
#chains in the Genus database with same CATH homology
 1WRK A;  4AQI A;  5PAL A;  1ALW A;  1B8C A;  3AKB A;  4PHN A;  3CGA A;  4XJK B;  4C0K A;  4WRI A;  2JPT A;  1YUS A;  1S5G Z;  2M97 A;  1QX5 B;  1KWO B;  2CTN A;  2M1U A;  1EJ3 A;  3FIA A;  2GGZ A;  4GGF A;  4YGC B;  3TDI A;  3VGO A;  1SMG A;  1S3P A;  4MN0 A;  4C0J A;  1L2O C;  4NDB A;  1A29 A;  1D1O A;  2FOT A;  2BKI B;  2BE4 A;  2TN4 A;  1PRW A;  1AP4 A;  1K2H A;  4GGF C;  2ZRS A;  1BU3 A;  2O5G A;  4DCK A;  1MWN A;  2VRG A;  1YVH A;  2JT3 A;  5KSZ A;  1MXE A;  2NXQ A;  1CKK A;  2MRD A;  2EGD A;  1XVJ A;  1TN4 A;  2KGR A;  1RJV A;  1NIW A;  1JF2 A;  5TNC A;  1NX0 A;  1FPW A;  2G9B A;  3VRQ A;  1XFY O;  2GGM A;  5HKZ A;  3SG6 A;  2QPT A;  1DJW A;  3AAJ A;  1AK8 A;  4NQG A;  4QJ4 B;  4I5K A;  2JTT A;  1KFU L;  2M0R A;  2F3Y A;  2L2E A;  1MR8 A;  2L51 A;  1K9U A;  2OTG C;  1J7R A;  1M31 A;  3I5F B;  2OS8 B;  3ZNI A;  2KQ6 A;  3PM8 A;  4DS7 A;  2KI6 D;  1MHO A;  3BOW A;  2K7D A;  3SIB A;  1ZUZ A;  2H61 A;  1MQ1 A;  1F4O A;  3EVU A;  4HRG A;  1J7P A;  3SG5 A;  1M63 B;  3DVE A;  4OR9 B;  4ZCU A;  1XFW O;  1K93 D;  2H61 C;  1GGZ A;  1G8I A;  4MZL A;  1FF1 A;  4ETO A;  3RLZ A;  4NDD A;  1DJZ A;  1M46 A;  4N1G A;  2HQ8 A;  2PMY A;  3VRN A;  2EHB A;  3PN7 B;  3CWG A;  1YTZ C;  3D10 A;  1NX2 A;  3I5H C;  1DJG A;  1JUO A;  2BBN A;  1C7V A;  4D1E A;  1M45 A;  4GGN A;  1ZAC A;  1Y1A A;  1QJT A;  2PVB A;  3D0Y A;  1K9P A;  3MSE B;  1UUS A;  1B47 A;  4MLW A;  5HLO A;  3A4U B;  4M2O A;  5HKY A;  1A2X A;  1HT9 A;  2I7A A;  1QIW A;  1ODB A;  2FJU B;  3I5G C;  1XK4 A;  2BCB A;  3GK4 X;  3KF9 A;  1JWD A;  3HCM A;  1F71 A;  1IKU A;  1SCM B;  2JT8 A;  1DJX A;  1BR4 B;  1SRA A;  1UHN A;  5B8I B;  5D69 A;  1MUX A;  2M49 B;  2L98 A;  5AEQ A;  4N1F A;  2LHL A;  1XK4 C;  3VRP A;  3OHM B;  1S36 A;  2K8M B;  2Q91 A;  1GJY A;  2Y1N A;  5CSJ A;  2BL0 C;  1J55 A;  1LA0 A;  4CFQ A;  1CLM A;  4R1E A;  2LVJ A;  1QVI Z;  1SK6 D;  2KGB C;  4N5X A;  3FWB A;  4GFT A;  4DIR A;  3JVT C;  1U5I A;  4WQ2 A;  3GOF A;  2NZ0 A;  3O6B A;  1DF0 B;  1PVB A;  1CNP A;  1OZS A;  1DJH A;  2QAC A;  4CID A;  1B4C A;  1N2D A;  2CNP A;  1K94 A;  1SBJ A;  1NP8 A;  2MLE C;  1DGU A;  3VRO A;  1JBA A;  1UHI A;  1IWQ A;  3NSL A;  2K2F A;  4AOM A;  1TNX A;  3TDU A;  1CLL A;  1K90 D;  2IS9 A;  2KBI A;  2O60 A;  1CFP A;  5F6T A;  3M0W A;  1NYA A;  3FWC A;  4ORA B;  2JXC A;  4MVF A;  2R2I A;  2JOJ A;  4PAL A;  4OV2 A;  2B1U A;  1K9K A;  1NX3 A;  2BE6 A;  1KK7 Z;  4NDC A;  4QJ5 B;  3WNX B;  2H2K A;  2KFH A;  3GK2 A;  3TDZ A;  1QX7 A;  4MZJ A;  1F54 A;  3CR2 A;  2V53 A;  4YI9 A;  1JC2 A;  1SL9 A;  3CS1 A;  5AER A;  4HRH A;  1A03 A;  1NPQ A;  1VRK A;  2EC6 B;  1CFD A;  3BUM B;  4GNK B;  2FCE A;  4YGD B;  3TZ1 A;  1RK9 A;  2Q4U A;  4U8D A;  3KPX A;  5JOL A;  1HQV A;  1M39 A;  3AKA A;  5AFP A;  3BUX B;  4L9M A;  1YUR A;  4PE7 A;  1YR5 A;  1QAS A;  3I5F C;  2OS8 C;  1Y1U A;  5ER4 X;  1JFJ A;  2I18 A;  1BMO A;  1DT7 B;  1JSA A;  2AUC A;  1RTP 1;  3JTD B;  5CSN A;  1DMO A;  4USL A;  1E8A A;  1FW4 A;  4MZK A;  2L0P A;  5I2Q A;  1CDL A;  2M3W A;  1V1F A;  2NCP A;  1Y1X A;  2CXJ A;  2KBM A;  2WOR A;  4MEW A;  1QV1 A;  2KAX A;  1AHR A;  3RM1 A;  1GGW A;  1C7W A;  1NCZ A;  1SR6 C;  2P6B B;  1CDP A;  2SAS A;  3OP0 A;  4JPZ B;  3IQO A;  1BR1 B;  4OVN F;  3O4Y A;  2PAL A;  4HSZ A;  3EVV A;  1S1E A;  3DF0 A;  1IGV A;  1TCF A;  2HF5 A;  2MA2 A;  5HYD A;  4OCI A;  2JXL A;  3PN7 C;  3LL8 B;  3I5I B;  4CLN A;  2KYF A;  1QAT A;  1S6I A;  2OPO A;  1RWY A;  4Q04 A;  1SCV A;  4DUQ A;  1FBV A;  1XFZ O;  4M2P A;  5DKQ A;  3KEV A;  1G33 A;  1UHH A;  2LLU A;  2DOQ A;  1UHJ A;  3F45 A;  3CTN A;  4YI8 A;  3QRX A;  2JWW A;  2E30 A;  4TNC A;  2MHH A;  2LE9 B;  4PHK A;  4HRE E;  1CM4 A;  3SG7 A;  2LAN A;  1PAL A;  3SG2 A;  4A4C A;  1B7T Z;  2Y1M A;  3LK1 A;  1AJ5 A;  1IJ6 A;  1DJI A;  2LVI A;  5DKN A;  1SNL A;  4FTG A;  2WCE A;  2KQY A;  4MRY A;  1XFX O;  1YX7 A;  1ALV A;  5D7F A;  4ICB A;  1DJY A;  1CMF A;  2JNF A;  2LMU A;  1F55 A;  3C1V A;  4I5N B;  2F2O A;  1DF0 A;  1TNP A;  4F0Z B;  2M8U A;  4WQ3 A;  1IJ5 A;  1K96 A;  2K0J A;  5K89 A;  3CLN A;  4YGA A;  5FYX A;  1KFU S;  1S5G Y;  1TRF A;  2KI4 B;  1IH0 A;  4YBH B;  1J7O A;  1YRU B;  5JJG A;  3EKH A;  3PFV A;  4P2Y B;  2KNE A;  2M9G A;  1WY9 A;  3BQ3 A;  4PE0 A;  1LVC D;  2WC8 A;  1KQM B;  2PAS A;  1PUL A;  2KHN A;  1Y0V H;  1F4Q A;  1RRO A;  3BUW B;  2F3Z A;  2KYC A;  1OOJ A;  1B1G A;  2E6W A;  2L5X B;  5CSF A;  3SIA A;  2LLT A;  3TUY B;  4UPG A;  5KU1 A;  1NSH A;  3DD4 A;  1NCX A;  2LCP A;  4E68 A;  2JT0 A;  3OX5 A;  4PHJ A;  1SL7 A;  3SJS A;  2ZFD A;  1SY9 A;  2FCD A;  2KAY A;  2WOS A;  2M7L A;  4BY4 A;  2L4I A;  1UP5 A;  4XJK A;  1TTX A;  3PSR A;  1KFX L;  3KHE A;  1KSO A;  3E3R A;  2K7B A;  3EVR A;  1SKT A;  2A4J A;  4CFR A;  2EC6 C;  1AVS A;  2KFG A;  5KTY A;  1BF5 A;  1OMV A;  2I2R E;  1KWO C;  2MLF C;  1NUB A;  1TIZ A;  4QJ3 B;  1TNW A;  2JNX A;  3HX4 A;  4PHM A;  1IQ3 A;  2BKH B;  1OMD A;  1QLS A;  1R6P A;  2LUX A;  1WDC B;  4MSP A;  1TOP A;  1WLM A;  3DVJ A;  3FS7 A;  5HLV A;  1B9A A;  3VRR A;  1B8R A;  3I5G B;  2JQ6 A;  1SYM A;  3D0Y B;  2JC2 A;  3SG3 A;  4M2Q A;  1Q80 A;  3DVM A;  4MRX A;  1QXP A;  1QIV A;  1YUU A;  2M1K B;  2ZRT A;  2HET A;  1S26 D;  3BXK A;  3PAT A;  2AAO A;  2L4H A;  3SG4 A;  2LP3 A;  1X02 A;  1LA3 A;  1BJF A;  2JZI A;  4OKH A;  1NWD A;  1CDN A;  4YGE B;  3WHT B;  2LHI A;  5J3X A;  3EK4 A;  1YVL A;  1KK8 B;  1CM1 A;  4GUK A;  4CPV A;  3NSK A;  2MAZ A;  1J1D A;  2SCP A;  1MXL C;  1FI6 A;  2K61 A;  3LK0 A;  1A75 B;  3JVT B;  3I5I C;  1WLZ A;  2KOT A;  2JRF A;  2ZN8 A;  1C07 A;  3A8R A;  4JQ0 D;  1QX2 A;  2MJW B;  3NSO A;  1R2U A;  2LAP A;  1CDM A;  1U5I B;  2PRU A;  2NCO A;  1QV0 A;  2HQW A;  1BG1 A;  1REC A;  1OE9 B;  1V1G A;  4PCW A;  1BOC A;  3NSI A;  2HPS A;  3EKJ A;  1XA5 A;  3KO0 A;  1W7I B;  2ZND A;  2JUL A;  1QVI Y;  2K7O A;  1AJ4 A;  2LM5 A;  3TS5 B;  1N65 A;  2ZNE A;  2F8P A;  1H8B A;  4GAO A;  1XFV O;  1J1E A;  4MBE A;  4P5O E;  4AQJ A;  3NXA A;  1CFC A;  1OSA A;  1CLB A;  3EK7 A;  3DVK A;  5CPV A;  2LLS A;  2K2A A;  3LCP C;  1RFJ A;  4C0L A;  1AUI B;  1N0Y A;  1DVI A;  2KI4 C;  1WRL A;  2ISD A;  4YGB B;  1SCM C;  2Y4Q A;  1F8H A;  3BUO B;  2KI6 C;  4ZCV A;  1PSB A;  1L2O B;  3CR4 X;  5I2O A;  1XYD A;  1KQM C;  1XFU O;  4FQO A;  1EXR A;  5ER5 A;  1ZFS A;  1CFF A;  1SL8 A;  3AAK A;  4GBA A;  1YX8 A;  1K8U A;  3OX6 A;  4A4B A;  1KK7 Y;  1NX1 A;  3TUY C;  1K95 A;  2CBL A;  5GQQ C;  2KDH A;  3O2P A;  3GK1 A;  1OMR A;  4BY5 A;  1S6J A;  2KAV A;  4PE4 A;  5BPJ A;  1BOD A;  2JU0 A;  1KCY A;  1KQV A;  2F33 A;  1A4P A;  1SR6 B;  1TCO B;  4JWQ A;  2ZN9 A;  2LUC A;  2WND A;  2NLN A;  4IL1 A;  3LLE A;  1QLK A;  1OQP A;  1JFK A;  1IQ5 A;  1QTX A;  1B8L A;  3CR5 X;  3PAL A;  2LVK A;  1SPY A;  2CCM A;  1W7J B;  5I8N A;  1XO5 A;  2CT9 A;  2OTG B;  2ZKM X;  1MF8 B;  2Y5I A;  1JF0 A;  1EH2 A;  1UHK A;  1EG4 A;  3DF0 B;  3PLF B;  1S6C A;  5DKR A;  4I5J A;  5I2L A;  3IF7 A;  5G08 A;  3BOW B;  1UUR A;  1WDC C;  4DRW A;  2COL B;  4PDZ A;  2I94 A;  2BBM A;  3EK8 A;  2LC5 A;  1SW8 A;  1DGV A;  2RGI A;  4XYN A;  1CMG A;  2F2P A;  2M29 A;  1NCY A;  2WCF A;  3BYA A;  5HKW A;  4YRU A;  1CB1 A;  1ZOT B;  1EG3 A;  2AMI A;  1IRJ A;  5AXI A;  1FI5 A;  1L7Z A;  3WXA A;  5CSI A;  2LMV A;  1F70 A;  1A75 A;  3I5H B;  1J7Q A;  2LP2 A;  1KK8 C;  4ORB B;  1UWO A;  1DTL A;  1PK0 D;  2LVV A;  2LV7 A;  1OZO A;  1LXF C;  1BLQ A;  2D8N A;  2JTZ A;  1EL4 A;  5AAN A;  2KSP A;  2BCX A;  2LMT A;  3OB1 B;  3JTD C;  3OB2 B;  1WRZ A;  1PVA A;  2KFF A;  1B7T Y;  1YUT A;  3O78 A;  2BCA A;  2G2B A;  1YRT B;  1ZMZ A;  1QS7 A;  2PSR A;  2LNK A;  2GV5 A;  3WHU B;  3ZWH A;  2L50 A;  3CZT X;  2MBX A;  1LKJ A;  1TNQ A;  4GPL B;  1H4B A;  1IG5 A;  1BT6 A;  1KSM A;  1LIN A;  1PSR A;  2BEC A;  4ORC B;  2WCB A;  5IBW A;  3H4S E;  2BL0 B;  1Y6W A;  3ICB A;  3BUN B;  3TS5 C;  4I5L B;  1G4Y R;  3IQQ A;  3K21 A;  2M7N A;  1CTR A;  2K7C A;  1GQM A;  4PE1 A;  1KFX S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...