1GQMA

The structure of s100a12 in a hexameric form and its proposed role in receptor signalling
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
87
structure length
87
Chain Sequence
TKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CALGRANULIN C
publication title The Structure of S100A12 in a Hexameric Form and its Proposed Role in Receptor Signalling
pubmed doi rcsb
molecule tags Antimicrobial protein
total genus 29
structure length 87
sequence length 87
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2001-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1gqmA00
2E6WA 3EK4A 2KYCA 1NWDA 1BR1B 4ZCUA 1PSRA 2QPTA 5FYXA 4XJKB 1UP5A 1JWDA 4OCIA 2FOTA 5KTYA 1SL9A 2K7DA 1WRZA 3VROA 2KHNA 2NCOA 2ZN9A 3CR4X 4IL1A 3PLFB 1G8IA 1LXFC 2OPOA 4MN0A 2LMVA 2GGZA 3FIAA 3TDZA 1DF0A 2KI6D 1X02A 3PN7C 2PRUA 4PE1A 4YGBB 1E8AA 2KAXA 2KDHA 2WCEA 1U5IA 4MRXA 2TN4A 1W7JB 4BY4A 3F45A 4XYNA 3O2PA 2VRGA 2ZNEA 5CSFA 3EVRA 2H61C 2Y1NA 1QATA 3D0YA 1EXRA 2EC6C 2MJWB 5HYDA 1DMOA 1GGWA 1TNQA 3SIAA 2KQ6A 2NZ0A 1RK9A 1M63B 2BKHB 3EK7A 4MZLA 2G9BA 2LVIA 3SG5A 1K2HA 1A75A 2L5XB 1ZOTB 4GNKB 2LLTA 1CMGA 2JXLA 1K9KA 1QX2A 2MHHA 4HRHA 3ICBA 2EHBA 5JJGA 1Y0VH 1C07A 4FTGA 1CKKA 3BOWB 1UHIA 4UPGA 1CNPA 1F70A 1YRUB 2WORA 1MXLC 2PSRA 1AP4A 2OS8C 1NP8A 2F3YA 1KWOB 1QV1A 2BKIB 3C1VA 3PSRA 2BECA 1BU3A 1N65A 1TTXA 1GQMA 1AVSA 3I5GC 1QVIZ 3CR5X 1Y6WA 3JTDC 1KK8B 1A4PA 2I2RE 2LVJA 2CTNA 1JF0A 2JNXA 5DKQA 4DUQA 4C0JA 3EVVA 2M9GA 5J3XA 1CLLA 3JVTC 2LC5A 3K21A 1WLZA 3CZTX 4MSPA 4USLA 3BXKA 1PSBA 2EGDA 3HX4A 1MR8A 4CLNA 3BUOB 2JT0A 4YI9A 1QTXA 2K7OA 4NQGA 3EK8A 1RWYA 1PVAA 4ORCB 3SG4A 1B1GA 4M2OA 3SJSA 5B8IB 1SCMB 2JULA 4R1EA 1LINA 3RLZA 5AERA 2JTZA 1KFXS 2NXQA 3VRNA 1TIZA 4I5LB 2BL0C 2LLUA 3CWGA 1Q80A 3A8RA 2LLSA 4YGEB 4MEWA 4ZCVA 1QX7A 1YX7A 2KFHA 4DRWA 5I8NA 1J7RA 3PFVA 1NUBA 2M1KB 1ZMZA 2A4JA 1L2OC 1F71A 1QX5B 2KSPA 4I5JA 4PE0A 4GUKA 2KI6C 1RFJA 1OMRA 2LE9B 4WQ3A 5HKZA 1KQMB 1SKTA 1YX8A 3D0YB 1ALVA 1MF8B 3SIBA 4JQ0D 1J7OA 3DVMA 1UWOA 1XK4C 1WLMA 1N0YA 5GQQC 2CXJA 2R2IA 2ISDA 1BODA 1MQ1A 1WDCB 4PE4A 1A03A 4N1FA 5D69A 4PHMA 1CFFA 1H8BA 1DJZA 1B8CA 2QACA 5HLOA 2LMUA 1DJIA 1XA5A 2PALA 2LVVA 4PDZA 1K9PA 1CDPA 2KI4B 1KSMA 2P6BB 2AAOA 3HCMA 3SG7A 1KFUS 3O78A 1IJ5A 1PULA 4WQ2A 1TN4A 2M7LA 1GGZA 3LL8B 4GGFC 3BUNB 1XFWO 2LHIA 2F2OA 1QJTA 1PVBA 4YGCB 1D1OA 2WCFA 2SCPA 1Y1XA 1CFDA 1QLKA 1XVJA 3OB2B 5F6TA 4CIDA 1RROA 1BMOA 2HQWA 1KSOA 2KBMA 2LP3A 2E30A 1SY9A 1OOJA 3IF7A 1CLMA 1JUOA 1BJFA 2PVBA 3KEVA 4N5XA 1CM1A 4YGAA 1B7TZ 1N2DA 2WC8A 3MSEB 1PK0D 3EKHA 1IKUA 1OQPA 1KWOC 2ZNDA 4P5OE 3VRRA 4MZKA 1AJ5A 1EH2A 2L98A 1F4QA 3FWCA 1BOCA 1S6JA 1KK8C 3CTNA 2GGMA 3ZNIA 2M49B 2I7AA 3PALA 4ICBA 4MVFA 2ZRSA 1BF5A 1JFJA 2F8PA 2WOSA 1G33A 4HRGA 4DS7A 3AKAA 4YGDB 4F0ZB 1SBJA 2Q91A 1MXEA 3AAJA 5AFPA 2PMYA 1S26D 1XO5A 3D10A 4U8DA 2LUCA 2M0RA 2BBMA 3BUWB 4CPVA 2HF5A 1XYDA 1SNLA 3FWBA 1NCYA 2LHLA 4AOMA 1SCMC 1Y1AA 4HSZA 2IS9A 4A4CA 5ER5A 1XFUO 1XFVO 2KGBC 1DJYA 2I18A 2Y1MA 4YBHB 5IBWA 1DJGA 1OSAA 2JU0A 3NSLA 2KNEA 5ER4X 4Q04A 1CFPA 2ZFDA 3I5IB 5JOLA 1SPYA 2Q4UA 2JQ6A 3NSOA 3BQ3A 5CSIA 4A4BA 2K0JA 1MUXA 3WNXB 1QIVA 4I5NB 3I5FB 4XJKA 5HKWA 3CLNA 3O6BA 4MZJA 3OP0A 1KQMC 1QASA 3VRPA 4OKHA 1MHOA 1A2XA 2KFFA 1K95A 2K7BA 3OB1B 1IJ6A 1XK4A 5DKNA 1TNWA 1J55A 2JOJA 2MLFC 1S5GY 2Y4QA 2K7CA 1JBAA 1R2UA 1EL4A 1F55A 2KYFA 4GBAA 4CFRA 3ZWHA 1B4CA 1F4OA 1HQVA 1LA3A 2O60A 1JSAA 5I2LA 2JC2A 1TRFA 2K2AA 1J7PA 1DF0B 1S36A 2KI4C 3BYAA 1QXPA 4N1GA 1XFZO 3TUYB 2HETA 1IQ5A 4HREE 1ZACA 1CTRA 1U5IB 2PASA 1OZOA 2L4HA 4GGFA 4AQIA 1TOPA 4TNCA 3AKBA 4ETOA 3A4UB 1L7ZA 2JWWA 2JT8A 1IH0A 1KQVA 1FI6A 1DGVA 4GAOA 1SYMA 4JPZB 3PATA 4DCKA 3LK1A 1NSHA 1NIWA 1HT9A 1TNPA 3DF0A 1S1EA 3I5HB 4MLWA 4E68A 1F54A 1FF1A 4NDBA 1A75B 1JF2A 1RJVA 2CT9A 2LM5A 2Y5IA 3BOWA 1TNXA 1NCZA 3KF9A 1KFXL 2OTGB 1SR6B 1IWQA 1XFYO 1ZUZA 1S5GZ 1BR4B 1K96A 2KOTA 3NXAA 2COLB 2L0PA 1FBVA 1CDLA 2H61A 1WRLA 5G08A 2LV7A 3TS5B 2GV5A 3O4YA 2BCAA 2JTTA 1YRTB 1PALA 1AHRA 2F2PA 4PHNA 3DD4A 2JRFA 1S6IA 5HLVA 1S6CA 4NDDA 1YTZC 5AANA 4WRIA 3DVJA 1UURA 3GOFA 1K93D 1NCXA 2RGIA 1FI5A 1NX2A 2NCPA 5I2QA 1YUTA 1QS7A 4JWQA 4OVNF 5AEQA 2O5GA 2LVKA 1AK8A 1RECA 3KPXA 1JC2A 4QJ5B 5HKYA 2MAZA 1UUSA 1VRKA 1IQ3A 1UHNA 2HQ8A 2JNFA 3TZ1A 3LLEA 1TCFA 2L50A 1C7WA 3AAKA 1IG5A 1IGVA 5TNCA 1KFUL 1BG1A 1G4YR 1ODBA 4FQOA 2MRDA 1M39A 2D8NA 4ORBB 1CDMA 3QRXA 4QJ3B 1K90D 1YVHA 2BE6A 1SW8A 2K8MB 3I5IC 1QIWA 4AQJA 4PE7A 1SL8A 1YURA 4C0KA 1QVIY 2HPSA 1K9UA 1LVCD 3GK2A 3GK1A 2FJUB 1W7IB 1CLBA 3OX6A 2BCXA 4PALA 3I5FC 4YRUA 2BBNA 3EVUA 1OZSA 1M45A 4BY5A 4DIRA 2V53A 1KK7Y 4MBEA 1YVLA 3CS1A 3KHEA 3H4SE 3SG3A 2M29A 1S3PA 2KGRA 5K89A 1DJWA 2M3WA 3BUXB 1WRKA 1RTP1 3DVKA 4YI8A 2LP2A 1J1DA 1FW4A 2KFGA 3BUMB 3SG2A 3LCPC 3IQQA 1OMVA 5DKRA 2KAVA 1UHJA 3OX5A 1QV0A 4M2QA 5CSJA 1SMGA 3DF0B 3PN7B 4GPLB 2F3ZA 3WHUB 1YUSA 1SL7A 3TUYC 2KQYA 3PM8A 5I2OA 5BPJA 1NX0A 2AMIA 2ZKMX 2FCDA 5KSZA 1CB1A 2CBLA 2K61A 1EG3A 1Y1UA 4C0LA 3KO0A 4L9MA 4QJ4B 1CDNA 2LCPA 1NX3A 2M1UA 1PRWA 2FCEA 2EC6B 1QLSA 3VGOA 1J7QA 2L51A 2BCBA 4M2PA 2F33A 2WNDA 1BLQA 1V1FA 2LUXA 3NSKA 4PHJA 1UHHA 2JT3A 1FPWA 1M31A 1DJHA 1WDCC 5CSNA 3VRQA 1C7VA 3I5HC 1KK7Z 1LA0A 5AXIA 1ZFSA 1B8LA 1B9AA 1YUUA 3EKJA 2BE4A 4CFQA 2WCBA 4NDCA 1DVIA 1EJ3A 2OTGC 1SR6C 2G2BA 4PCWA 1F8HA 1H4BA 1SCVA 1NX1A 3E3RA 3OHMB 1ALWA 1M46A 1XFXO 4MRYA 1DTLA 2KAYA 2OS8B 3FS7A 1GJYA 1B47A 1OE9B 2L4IA 3TDUA 3TS5C 2M7NA 1IRJA 1UHKA 1A29A 1K8UA 1SRAA 3I5GB 4I5KA 2ZRTA 3JTDB 3NSIA 1MWNA 1NYAA 2JPTA 4ORAB 2LAPA 2NLNA 1CFCA 2KBIA 1JFKA 5PALA 1KCYA 2CNPA 2H2KA 3GK4X 1DJXA 1YR5A 2DOQA 1AJ4A 3JVTB 4OR9B 4PHKA 2B1UA 3LK0A 4P2YB 2M97A 4GFTA 2MA2A 2LNKA 1CM4A 3WHTB 3WXAA 1V1GA 3TDIA 5CPVA 3SG6A 1DGUA 1R6PA 2ZN8A 1NPQA 5KU1A 1WY9A 2AUCA 1B7TY 2JXCA 1AUIB 1OMDA 1B8RA 5D7FA 2SASA 2M8UA 3CGAA 3RM1A 1SK6D 2BL0B 3M0WA 1TCOB 4OV2A 2CCMA 1K94A 1LKJA 1DT7B 2MLEC 3CR2A 3IQOA 1J1EA 2LANA 2L2EA 2K2FA 3DVEA 2I94A 1CMFA 2MBXA 2JZIA 1BT6A 4GGNA 1L2OB 1EG4A 2LMTA 4D1EA
chains in the Genus database with same CATH superfamily
2E6WA 1OOFA 3B86A 3EK4A 2KYCA 1NWDA 1BR1B 4ZCUA 1PSRA 2QPTA 5FYXA 4XJKB 1UP5A 1JWDA 4OCIA 2FOTA 5KTYA 1ORGA 1SL9A 2K7DA 1WRZA 4JD9A 3VROA 2KHNA 2NCOA 2ZN9A 3CR4X 3DZTA 4IL1A 2JPOA 3PLFB 3R1OA 1G8IA 1LXFC 2OPOA 4MN0A 2BNXA 2LMVA 2GGZA 3FIAA 3TDZA 1DF0A 2KI6D 1X02A 3PN7C 2PRUA 3D77A 4PE1A 4YGBB 1E8AA 2KAXA 2KDHA 2WCEA 1U5IA 4MRXA 2P71A 2TN4A 1W7JB 4BY4A 3F45A 4XYNA 3O2PA 2VRGA 2ZNEA 2WCMA 5CSFA 3EVRA 2WC5A 2H61C 2Y1NA 1QATA 3D0YA 1EXRA 2EC6C 2MJWB 5HYDA 3S0FA 1DMOA 1GGWA 1TNQA 3SIAA 2KQ6A 2NZ0A 1RK9A 1M63B 2BKHB 3EK7A 4MZLA 2G9BA 2LVIA 3SG5A 3FE9A 2PYQA 1K2HA 1A75A 2L5XB 1ZOTB 4GNKB 2LLTA 1CMGA 2JXLA 1K9KA 1QX2A 2MHHA 4HRHA 1LS8A 3ICBA 3OBVA 3D74A 2EHBA 5JJGA 1Y0VH 1C07A 4FTGA 1CKKA 3BOWB 1UHIA 4UPGA 1CNPA 1F70A 1YRUB 2WORA 1MXLC 2PSRA 1AP4A 2BAPA 1NP8A 2F3YA 2OS8C 1KWOB 1QV1A 1GM0A 2BKIB 3C1VA 3PSRA 2BECA 3K1EA 3SS5A 1XFRA 1BU3A 1N65A 1TTXA 1GQMA 1AVSA 3I5GC 1QVIZ 3CR5X 1Y6WA 3JTDC 3NHTA 1KK8B 1A4PA 2I2RE 4PT1A 2LVJA 5FI6A 2CTNA 1JF0A 2JNXA 5DKQA 3N7HA 4DUQA 4C0JA 3EVVA 2M9GA 5J3XA 1CLLA 3JVTC 2LC5A 3K21A 1WLZA 3CZTX 4MSPA 4USLA 3BXKA 1PSBA 2EGDA 3HX4A 1MR8A 4CLNA 3BUOB 2JT0A 4YI9A 1QTXA 2K7OA 4NQGA 3BJHA 3EK8A 1RWYA 3D78A 1PVAA 4ORCB 3SG4A 1B1GA 4M2OA 3SJSA 5B8IB 1SCMB 2JULA 4R1EA 1LINA 3RLZA 5AERA 2JTZA 1KFXS 2NXQA 1C3YA 2QDIA 3VRNA 1TIZA 4I5LB 2BL0C 2LLUA 3CWGA 1Q80A 3A8RA 3O4XA 2LLSA 4YGEB 4MEWA 4ZCVA 1QX7A 1YX7A 2KFHA 2WC6A 4DRWA 5I8NA 1J7RA 3PFVA 1NUBA 2M1KB 1ZMZA 2A4JA 1DELA 1L2OC 3VB1A 1F71A 1QX5B 1OOHA 2KSPA 2QEHA 4I5JA 4PE0A 4GUKA 2KI6C 1RFJA 1OMRA 2LE9B 1C3ZA 4WQ3A 1KQMB 5HKZA 1SKTA 4OZDA 1YX8A 2ERBA 2KPHA 1ALVA 1MF8B 3D0YB 3SIBA 3CYZA 1OW4A 1SSEB 4JQ0D 1J7OA 3DVMA 1UWOA 3L4LA 1XK4C 1WLMA 1N0YA 5GQQC 2CXJA 2R2IA 2ISDA 1BODA 1MQ1A 1WDCB 4PE4A 1A03A 3CZ1A 4N1FA 5D69A 2L5YA 4PHMA 1CFFA 1DJZA 1H8BA 1B8CA 2QACA 5HLOA 2LMUA 1DJIA 1XA5A 2PALA 2LVVA 4PDZA 1K9PA 1CDPA 2KI4B 1KSMA 2P6BB 2AAOA 3HCMA 3SG7A 1KFUS 3O78A 3SS4A 1IJ5A 1PULA 4WQ2A 1TN4A 2M7LA 1GGZA 3LL8B 4GGFC 3BUNB 1XFWO 2LHIA 2F2OA 1QJTA 1PVBA 4YGCB 1D1OA 3QMEA 2WCFA 2SCPA 1Y1XA 1CFDA 1QLKA 1XVJA 3OB2B 5F6TA 4CIDA 1RROA 1BMOA 2HQWA 3S0BA 1KSOA 2KBMA 2LP3A 2E30A 1SY9A 1OOJA 3IF7A 4INXA 1CLMA 1JUOA 1BJFA 2PVBA 3KEVA 4N5XA 1CM1A 4YGAA 1B7TZ 2WCJA 1N2DA 2WC8A 3MSEB 1PK0D 3EKHA 1IKUA 1OQPA 1KWOC 2ZNDA 4P5OE 5EL2A 3VRRA 4MZKA 1AJ5A 1EH2A 2L98A 1F4QA 3FWCA 1BOCA 1S6JA 3Q8IA 1KK8C 3CTNA 2GGMA 3ZNIA 2M49B 2I7AA 3PALA 4ICBA 4MVFA 2ZRSA 1BF5A 1JFJA 2F8PA 2WOSA 1G33A 4HRGA 4DS7A 2QEBA 3AKAA 4YGDB 4F0ZB 1SBJA 2Q91A 1MXEA 3AAJA 5AFPA 2PMYA 1S26D 1XO5A 3D10A 4U8DA 2LUCA 2M0RA 2BBMA 3BUWB 4CPVA 3CZ0A 2HF5A 1XYDA 1SNLA 3FWBA 1NCYA 2LHLA 4AOMA 1SCMC 1Y1AA 4HSZA 2IS9A 1P28A 4A4CA 1DQEA 5ER5A 1TUJA 1XFUO 1XFVO 2KGBC 1DJYA 2I18A 2Y1MA 3NGVA 4YBHB 5IBWA 1DJGA 1OSAA 2JU0A 3NSLA 2KNEA 3FE6A 5ER4X 4Q04A 1CFPA 2ZFDA 3I5IB 5JOLA 1SPYA 2Q4UA 2JQ6A 3NSOA 3BQ3A 5CSIA 4A4BA 2K0JA 1MUXA 2P70A 3WNXB 1QIVA 4I5NB 3I5FB 4XJKA 5HKWA 3CLNA 3O6BA 1DEKA 1TUZA 3OP0A 1KQMC 1QASA 4MZJA 3VRPA 3B88A 1MHOA 4JKTA 4OKHA 1A2XA 2KFFA 1K95A 1OOGA 1Z4HA 2K7BA 3OB1B 1DC1A 1IJ6A 1XK4A 5DKNA 1TNWA 1J55A 2JOJA 2MLFC 1S5GY 2K60A 2K7CA 2Y4QA 3NXAA 1JBAA 1R2UA 1EL4A 1F55A 2KYFA 4GBAA 4CFRA 3ZWHA 1B4CA 1F4OA 1HQVA 1LA3A 2O60A 3OGNA 5I2LA 1JSAA 2JC2A 1TRFA 2K2AA 1J7PA 1DF0B 1S36A 2KI4C 3BYAA 1QXPA 4N1GA 1XFZO 3TUYB 3L4AA 2HETA 1IQ5A 4HREE 1ZACA 1CTRA 2KLDA 1U5IB 2PASA 1OZOA 2L4HA 4GGFA 4AQIA 1TOPA 4TNCA 3AKBA 4ETOA 3A4UB 1L7ZA 2JWWA 2JT8A 1IH0A 1KQVA 1FI6A 1DGVA 4GAOA 1SYMA 4JPZB 3PATA 4DCKA 3LK1A 1NSHA 4KYNA 1NIWA 3PM2A 1HT9A 1TNPA 3DF0A 1S1EA 3I5HB 4MLWA 4E68A 1F54A 1FF1A 4NDBA 1A75B 2L2CA 1JF2A 1RJVA 2CT9A 2LM5A 2Y5IA 3BOWA 1TNXA 1NCZA 3KF9A 1KFXL 2OTGB 1SR6B 1IWQA 1XFYO 1ZUZA 1S5GZ 1BR4B 1K96A 2KOTA 3DXLA 3DY9A 3V2LA 1Z2CB 2COLB 2L0PA 1FBVA 1CDLA 2H61A 1WRLA 5G08A 2LV7A 3TS5B 2GV5A 3O4YA 2BCAA 1QWVA 1YRTB 2JTTA 3DYEA 3FE8A 1PALA 1AHRA 2F2PA 4PHNA 3DD4A 2JRFA 1S6IA 5HLVA 1S6CA 4NDDA 1YTZC 3IVTA 4WRIA 5AANA 3DVJA 1UURA 3GOFA 3D76A 3CZ2A 1K93D 5HL1A 1NCXA 2YGUA 2RGIA 1FI5A 1NX2A 2NCPA 3NHIA 5I2QA 1YUTA 1QS7A 3RZSA 4JWQA 4OVNF 5AEQA 2O5GA 2LVKA 1OOIX 1RECA 3BFBA 3KPXA 3L47A 3PJIA 1AK8A 1JC2A 4QJ5B 1IIOA 3S0EA 5HKYA 2WCKA 2MAZA 1UUSA 1VRKA 4FQTA 1UHNA 1IQ3A 2HQ8A 2JNFA 3TZ1A 3LLEA 3R72A 1TCFA 2KLEA 2L50A 1C7WA 3AAKA 1IG5A 1IGVA 5TNCA 1KFUL 1BG1A 1G4YR 1ODBA 4FQOA 2MRDA 1M39A 2D8NA 4ORBB 1CDMA 3QRXA 4QJ3B 1K90D 1YVHA 2BE6A 1SW8A 2K8MB 3I5IC 1QIWA 4AQJA 4PE7A 1SL8A 1YURA 4C0KA 1QVIY 2HPSA 1K9UA 1LVCD 3GK2A 3GK1A 2FJUB 1W7IB 1CLBA 3OX6A 2BCXA 4PALA 3D73A 4INWA 3I5FC 4YRUA 3B87A 2BBNA 2H8VA 1OZSA 1M45A 3EVUA 3CDNA 4BY5A 2V53A 4DIRA 1KK7Y 4IJ7A 1YVLA 3CS1A 4MBEA 3KHEA 3H4SE 3SG3A 5DICA 3EG5B 2M29A 1S3PA 2FJYA 2KGRA 5K89A 1DJWA 2M3WA 3BUXB 3CABA 1WRKA 1T14A 1RTP1 3DVKA 4YI8A 2LP2A 1J1DA 1FW4A 2KFGA 3BUMB 3SG2A 3LCPC 3IQQA 1OMVA 5DKRA 2KAVA 2QEVA 1UHJA 3OX5A 1QV0A 4M2QA 5CSJA 1SMGA 3DF0B 3PN7B 4GPLB 2F3ZA 2PQLA 3WHUB 1YUSA 1SL7A 3TUYC 5FI7A 2KQYA 3PM8A 5I2OA 5BPJA 1NX0A 2AMIA 2ZKMX 2FCDA 5KSZA 1CB1A 2CBLA 2K61A 1EG3A 1Y1UA 4C0LA 3KO0A 4L9MA 4QJ4B 1CDNA 2LCPA 1NX3A 2M1UA 1PRWA 2FCEA 2EC6B 1QLSA 3VGOA 1J7QA 2L51A 2BCBA 4M2PA 2F33A 2WNDA 5D3OA 2GTEA 1BLQA 1V1FA 2LUXA 3NSKA 2WCHA 1UHHA 4PHJA 4F7FA 2JT3A 1FPWA 1M31A 1DJHA 1WDCC 5CSNA 3VRQA 1C7VA 3I5HC 1KK7Z 1LA0A 5AXIA 1ZFSA 1B8LA 1B9AA 1YUUA 3EKJA 2BE4A 4CFQA 2WCBA 4NDCA 1DVIA 1EJ3A 1W9ZA 2OTGC 1SR6C 2G2BA 4PCWA 1F8HA 1H4BA 1SCVA 1NX1A 3E3RA 3OHMB 1ALWA 1M46A 1XFXO 4MRYA 1DTLA 2KAYA 2OS8B 3FS7A 1GJYA 1B47A 1OE9B 2L4IA 3TDUA 3TS5C 2M7NA 1IRJA 1UHKA 1A29A 1K8UA 1SRAA 3I5GB 4I5KA 2ZRTA 3JTDB 3NSIA 1MWNA 1NYAA 2QEOA 3S0AA 2JPTA 4ORAB 2LAPA 3R1VA 1TWOA 2NLNA 1CFCA 2KBIA 1JFKA 5PALA 1KCYA 2CNPA 2H2KA 3D75A 3GK4X 1DJXA 1YR5A 2DOQA 1AJ4A 3UNWA 3JVTB 4OR9B 4PHKA 3BFAA 2B1UA 3LK0A 4P2YB 2M97A 4GFTA 2MA2A 2LNKA 1CM4A 3WHTB 3WXAA 1V1GA 3B6XA 5FI2A 3B7AA 3R1PA 5CPVA 3TDIA 3SG6A 1DGUA 1R6PA 2ZN8A 1NPQA 3BFHA 3S0GA 5I94A 5KU1A 1WY9A 2AUCA 1B7TY 2JXCA 1AUIB 1OMDA 1B8RA 5D7FA 2SASA 2M8UA 3CGAA 3RM1A 3S0DA 1SK6D 2BL0B 3M0WA 1TCOB 4OV2A 2CCMA 1K94A 1LKJA 1DT7B 2MLEC 3CR2A 3IQOA 1J1EA 2LANA 2L2EA 2K2FA 3DVEA 2I94A 1CMFA 3UO9A 2MBXA 2JZIA 1BT6A 4GGNA 1L2OB 1EG4A 2WCLA 3SS3A 2LMTA 4D1EA
chains in the Genus database with same CATH topology
2E6WA 3EK4A 2KYCA 1NWDA 1BR1B 4ZCUA 1PSRA 2QPTA 5FYXA 4XJKB 1UP5A 1JWDA 4OCIA 2FOTA 5KTYA 1SL9A 2K7DA 1WRZA 3VROA 2KHNA 2NCOA 2ZN9A 3CR4X 4IL1A 3PLFB 1G8IA 1LXFC 2OPOA 4MN0A 2LMVA 2GGZA 3FIAA 3TDZA 1DF0A 2KI6D 1X02A 3PN7C 2PRUA 4PE1A 4YGBB 1E8AA 2KAXA 2KDHA 2WCEA 1U5IA 4MRXA 2TN4A 1W7JB 4BY4A 3F45A 4XYNA 3O2PA 2VRGA 2ZNEA 5CSFA 3EVRA 2H61C 2Y1NA 1QATA 3D0YA 1EXRA 2EC6C 2MJWB 5HYDA 1DMOA 1GGWA 1TNQA 3SIAA 2KQ6A 2NZ0A 1RK9A 1M63B 2BKHB 3EK7A 4MZLA 2G9BA 2LVIA 3SG5A 1K2HA 1A75A 2L5XB 1ZOTB 4GNKB 2LLTA 1CMGA 2JXLA 1K9KA 1QX2A 2MHHA 4HRHA 3ICBA 2EHBA 5JJGA 1Y0VH 1C07A 4FTGA 1CKKA 3BOWB 1UHIA 4UPGA 1CNPA 1F70A 1YRUB 2WORA 1MXLC 2PSRA 1AP4A 2OS8C 1NP8A 2F3YA 1KWOB 1QV1A 2BKIB 3C1VA 3PSRA 2BECA 1BU3A 1N65A 1TTXA 1GQMA 1AVSA 3I5GC 1QVIZ 3CR5X 1Y6WA 3JTDC 1KK8B 1A4PA 2I2RE 2LVJA 2CTNA 1JF0A 2JNXA 5DKQA 4DUQA 4C0JA 3EVVA 2M9GA 5J3XA 1CLLA 3JVTC 2LC5A 3K21A 1WLZA 3CZTX 4MSPA 4USLA 3BXKA 1PSBA 2EGDA 3HX4A 1MR8A 4CLNA 3BUOB 2JT0A 4YI9A 1QTXA 2K7OA 4NQGA 3EK8A 1RWYA 1PVAA 4ORCB 3SG4A 1B1GA 4M2OA 3SJSA 5B8IB 1SCMB 2JULA 4R1EA 1LINA 3RLZA 5AERA 2JTZA 1KFXS 2NXQA 3VRNA 1TIZA 4I5LB 2BL0C 2LLUA 3CWGA 1Q80A 3A8RA 2LLSA 4YGEB 4MEWA 4ZCVA 1QX7A 1YX7A 2KFHA 4DRWA 5I8NA 1J7RA 3PFVA 1NUBA 2M1KB 1ZMZA 2A4JA 1L2OC 1F71A 1QX5B 2KSPA 4I5JA 4PE0A 4GUKA 2KI6C 1RFJA 1OMRA 2LE9B 4WQ3A 5HKZA 1KQMB 1SKTA 1YX8A 3D0YB 1ALVA 1MF8B 3SIBA 4JQ0D 1J7OA 3DVMA 1UWOA 1XK4C 1WLMA 1N0YA 5GQQC 2CXJA 2R2IA 2ISDA 1BODA 1MQ1A 1WDCB 4PE4A 1A03A 4N1FA 5D69A 4PHMA 1CFFA 1H8BA 1DJZA 1B8CA 2QACA 5HLOA 2LMUA 1DJIA 1XA5A 2PALA 2LVVA 4PDZA 1K9PA 1CDPA 2KI4B 1KSMA 2P6BB 2AAOA 3HCMA 3SG7A 1KFUS 3O78A 1IJ5A 1PULA 4WQ2A 1TN4A 2M7LA 1GGZA 3LL8B 4GGFC 3BUNB 1XFWO 2LHIA 2F2OA 1QJTA 1PVBA 4YGCB 1D1OA 2WCFA 2SCPA 1Y1XA 1CFDA 1QLKA 1XVJA 3OB2B 5F6TA 4CIDA 1RROA 1BMOA 2HQWA 1KSOA 2KBMA 2LP3A 2E30A 1SY9A 1OOJA 3IF7A 1CLMA 1JUOA 1BJFA 2PVBA 3KEVA 4N5XA 1CM1A 4YGAA 1B7TZ 1N2DA 2WC8A 3MSEB 1PK0D 3EKHA 1IKUA 1OQPA 1KWOC 2ZNDA 4P5OE 3VRRA 4MZKA 1AJ5A 1EH2A 2L98A 1F4QA 3FWCA 1BOCA 1S6JA 1KK8C 3CTNA 2GGMA 3ZNIA 2M49B 2I7AA 3PALA 4ICBA 4MVFA 2ZRSA 1BF5A 1JFJA 2F8PA 2WOSA 1G33A 4HRGA 4DS7A 3AKAA 4YGDB 4F0ZB 1SBJA 2Q91A 1MXEA 3AAJA 5AFPA 2PMYA 1S26D 1XO5A 3D10A 4U8DA 2LUCA 2M0RA 2BBMA 3BUWB 4CPVA 2HF5A 1XYDA 1SNLA 3FWBA 1NCYA 2LHLA 4AOMA 1SCMC 1Y1AA 4HSZA 2IS9A 4A4CA 5ER5A 1XFUO 1XFVO 2KGBC 1DJYA 2I18A 2Y1MA 4YBHB 5IBWA 1DJGA 1OSAA 2JU0A 3NSLA 2KNEA 5ER4X 4Q04A 1CFPA 2ZFDA 3I5IB 5JOLA 1SPYA 2Q4UA 2JQ6A 3NSOA 3BQ3A 5CSIA 4A4BA 2K0JA 1MUXA 3WNXB 1QIVA 4I5NB 3I5FB 4XJKA 5HKWA 3CLNA 3O6BA 4MZJA 3OP0A 1KQMC 1QASA 3VRPA 4OKHA 1MHOA 1A2XA 2KFFA 1K95A 2K7BA 3OB1B 1IJ6A 1XK4A 5DKNA 1TNWA 1J55A 2JOJA 2MLFC 1S5GY 2Y4QA 2K7CA 1JBAA 1R2UA 1EL4A 1F55A 2KYFA 4GBAA 4CFRA 3ZWHA 1B4CA 1F4OA 1HQVA 1LA3A 2O60A 1JSAA 5I2LA 2JC2A 1TRFA 2K2AA 1J7PA 1DF0B 1S36A 2KI4C 3BYAA 1QXPA 4N1GA 1XFZO 3TUYB 2HETA 1IQ5A 4HREE 1ZACA 1CTRA 1U5IB 2PASA 1OZOA 2L4HA 4GGFA 4AQIA 1TOPA 4TNCA 3AKBA 4ETOA 3A4UB 1L7ZA 2JWWA 2JT8A 1IH0A 1KQVA 1FI6A 1DGVA 4GAOA 1SYMA 4JPZB 3PATA 4DCKA 3LK1A 1NSHA 1NIWA 1HT9A 1TNPA 3DF0A 1S1EA 3I5HB 4MLWA 4E68A 1F54A 1FF1A 4NDBA 1A75B 1JF2A 1RJVA 2CT9A 2LM5A 2Y5IA 3BOWA 1TNXA 1NCZA 3KF9A 1KFXL 2OTGB 1SR6B 1IWQA 1XFYO 1ZUZA 1S5GZ 1BR4B 1K96A 2KOTA 3NXAA 2COLB 2L0PA 1FBVA 1CDLA 2H61A 1WRLA 5G08A 2LV7A 3TS5B 2GV5A 3O4YA 2BCAA 2JTTA 1YRTB 1PALA 1AHRA 2F2PA 4PHNA 3DD4A 2JRFA 1S6IA 5HLVA 1S6CA 4NDDA 1YTZC 5AANA 4WRIA 3DVJA 1UURA 3GOFA 1K93D 1NCXA 2RGIA 1FI5A 1NX2A 2NCPA 5I2QA 1YUTA 1QS7A 4JWQA 4OVNF 5AEQA 2O5GA 2LVKA 1AK8A 1RECA 3KPXA 1JC2A 4QJ5B 5HKYA 2MAZA 1UUSA 1VRKA 1IQ3A 1UHNA 2HQ8A 2JNFA 3TZ1A 3LLEA 1TCFA 2L50A 1C7WA 3AAKA 1IG5A 1IGVA 5TNCA 1KFUL 1BG1A 1G4YR 1ODBA 4FQOA 2MRDA 1M39A 2D8NA 4ORBB 1CDMA 3QRXA 4QJ3B 1K90D 1YVHA 2BE6A 1SW8A 2K8MB 3I5IC 1QIWA 4AQJA 4PE7A 1SL8A 1YURA 4C0KA 1QVIY 2HPSA 1K9UA 1LVCD 3GK2A 3GK1A 2FJUB 1W7IB 1CLBA 3OX6A 2BCXA 4PALA 3I5FC 4YRUA 2BBNA 3EVUA 1OZSA 1M45A 4BY5A 4DIRA 2V53A 1KK7Y 4MBEA 1YVLA 3CS1A 3KHEA 3H4SE 3SG3A 2M29A 1S3PA 2KGRA 5K89A 1DJWA 2M3WA 3BUXB 1WRKA 1RTP1 3DVKA 4YI8A 2LP2A 1J1DA 1FW4A 2KFGA 3BUMB 3SG2A 3LCPC 3IQQA 1OMVA 5DKRA 2KAVA 1UHJA 3OX5A 1QV0A 4M2QA 5CSJA 1SMGA 3DF0B 3PN7B 4GPLB 2F3ZA 3WHUB 1YUSA 1SL7A 3TUYC 2KQYA 3PM8A 5I2OA 5BPJA 1NX0A 2AMIA 2ZKMX 2FCDA 5KSZA 1CB1A 2CBLA 2K61A 1EG3A 1Y1UA 4C0LA 3KO0A 4L9MA 4QJ4B 1CDNA 2LCPA 1NX3A 2M1UA 1PRWA 2FCEA 2EC6B 1QLSA 3VGOA 1J7QA 2L51A 2BCBA 4M2PA 2F33A 2WNDA 1BLQA 1V1FA 2LUXA 3NSKA 4PHJA 1UHHA 2JT3A 1FPWA 1M31A 1DJHA 1WDCC 5CSNA 3VRQA 1C7VA 3I5HC 1KK7Z 1LA0A 5AXIA 1ZFSA 1B8LA 1B9AA 1YUUA 3EKJA 2BE4A 4CFQA 2WCBA 4NDCA 1DVIA 1EJ3A 2OTGC 1SR6C 2G2BA 4PCWA 1F8HA 1H4BA 1SCVA 1NX1A 3E3RA 3OHMB 1ALWA 1M46A 1XFXO 4MRYA 1DTLA 2KAYA 2OS8B 3FS7A 1GJYA 1B47A 1OE9B 2L4IA 3TDUA 3TS5C 2M7NA 1IRJA 1UHKA 1A29A 1K8UA 1SRAA 3I5GB 4I5KA 2ZRTA 3JTDB 3NSIA 1MWNA 1NYAA 2JPTA 4ORAB 2LAPA 2NLNA 1CFCA 2KBIA 1JFKA 5PALA 1KCYA 2CNPA 2H2KA 3GK4X 1DJXA 1YR5A 2DOQA 1AJ4A 3JVTB 4OR9B 4PHKA 2B1UA 3LK0A 4P2YB 2M97A 4GFTA 2MA2A 2LNKA 1CM4A 3WHTB 3WXAA 1V1GA 3TDIA 5CPVA 3SG6A 1DGUA 1R6PA 2ZN8A 1NPQA 5KU1A 1WY9A 2AUCA 1B7TY 2JXCA 1AUIB 1OMDA 1B8RA 5D7FA 2SASA 2M8UA 3CGAA 3RM1A 1SK6D 2BL0B 3M0WA 1TCOB 4OV2A 2CCMA 1K94A 1LKJA 1DT7B 2MLEC 3CR2A 3IQOA 1J1EA 2LANA 2L2EA 2K2FA 3DVEA 2I94A 1CMFA 2MBXA 2JZIA 1BT6A 4GGNA 1L2OB 1EG4A 2LMTA 4D1EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E6W A;  3EK4 A;  2KYC A;  1NWD A;  1BR1 B;  4ZCU A;  1PSR A;  2QPT A;  5FYX A;  4XJK B;  1UP5 A;  1JWD A;  4OCI A;  2FOT A;  5KTY A;  1SL9 A;  2K7D A;  1WRZ A;  3VRO A;  2KHN A;  2NCO A;  2ZN9 A;  3CR4 X;  4IL1 A;  3PLF B;  1G8I A;  1LXF C;  2OPO A;  4MN0 A;  2LMV A;  2GGZ A;  3FIA A;  3TDZ A;  1DF0 A;  2KI6 D;  1X02 A;  3PN7 C;  2PRU A;  4PE1 A;  4YGB B;  1E8A A;  2KAX A;  2KDH A;  2WCE A;  1U5I A;  4MRX A;  2TN4 A;  1W7J B;  4BY4 A;  3F45 A;  4XYN A;  3O2P A;  2VRG A;  2ZNE A;  5CSF A;  3EVR A;  2H61 C;  2Y1N A;  1QAT A;  3D0Y A;  1EXR A;  2EC6 C;  2MJW B;  5HYD A;  1DMO A;  1GGW A;  1TNQ A;  3SIA A;  2KQ6 A;  2NZ0 A;  1RK9 A;  1M63 B;  2BKH B;  3EK7 A;  4MZL A;  2G9B A;  2LVI A;  3SG5 A;  1K2H A;  1A75 A;  2L5X B;  1ZOT B;  4GNK B;  2LLT A;  1CMG A;  2JXL A;  1K9K A;  1QX2 A;  2MHH A;  4HRH A;  3ICB A;  2EHB A;  5JJG A;  1Y0V H;  1C07 A;  4FTG A;  1CKK A;  3BOW B;  1UHI A;  4UPG A;  1CNP A;  1F70 A;  1YRU B;  2WOR A;  1MXL C;  2PSR A;  1AP4 A;  2OS8 C;  1NP8 A;  2F3Y A;  1KWO B;  1QV1 A;  2BKI B;  3C1V A;  3PSR A;  2BEC A;  1BU3 A;  1N65 A;  1TTX A;  1GQM A;  1AVS A;  3I5G C;  1QVI Z;  3CR5 X;  1Y6W A;  3JTD C;  1KK8 B;  1A4P A;  2I2R E;  2LVJ A;  2CTN A;  1JF0 A;  2JNX A;  5DKQ A;  4DUQ A;  4C0J A;  3EVV A;  2M9G A;  5J3X A;  1CLL A;  3JVT C;  2LC5 A;  3K21 A;  1WLZ A;  3CZT X;  4MSP A;  4USL A;  3BXK A;  1PSB A;  2EGD A;  3HX4 A;  1MR8 A;  4CLN A;  3BUO B;  2JT0 A;  4YI9 A;  1QTX A;  2K7O A;  4NQG A;  3EK8 A;  1RWY A;  1PVA A;  4ORC B;  3SG4 A;  1B1G A;  4M2O A;  3SJS A;  5B8I B;  1SCM B;  2JUL A;  4R1E A;  1LIN A;  3RLZ A;  5AER A;  2JTZ A;  1KFX S;  2NXQ A;  3VRN A;  1TIZ A;  4I5L B;  2BL0 C;  2LLU A;  3CWG A;  1Q80 A;  3A8R A;  2LLS A;  4YGE B;  4MEW A;  4ZCV A;  1QX7 A;  1YX7 A;  2KFH A;  4DRW A;  5I8N A;  1J7R A;  3PFV A;  1NUB A;  2M1K B;  1ZMZ A;  2A4J A;  1L2O C;  1F71 A;  1QX5 B;  2KSP A;  4I5J A;  4PE0 A;  4GUK A;  2KI6 C;  1RFJ A;  1OMR A;  2LE9 B;  4WQ3 A;  5HKZ A;  1KQM B;  1SKT A;  1YX8 A;  3D0Y B;  1ALV A;  1MF8 B;  3SIB A;  4JQ0 D;  1J7O A;  3DVM A;  1UWO A;  1XK4 C;  1WLM A;  1N0Y A;  5GQQ C;  2CXJ A;  2R2I A;  2ISD A;  1BOD A;  1MQ1 A;  1WDC B;  4PE4 A;  1A03 A;  4N1F A;  5D69 A;  4PHM A;  1CFF A;  1H8B A;  1DJZ A;  1B8C A;  2QAC A;  5HLO A;  2LMU A;  1DJI A;  1XA5 A;  2PAL A;  2LVV A;  4PDZ A;  1K9P A;  1CDP A;  2KI4 B;  1KSM A;  2P6B B;  2AAO A;  3HCM A;  3SG7 A;  1KFU S;  3O78 A;  1IJ5 A;  1PUL A;  4WQ2 A;  1TN4 A;  2M7L A;  1GGZ A;  3LL8 B;  4GGF C;  3BUN B;  1XFW O;  2LHI A;  2F2O A;  1QJT A;  1PVB A;  4YGC B;  1D1O A;  2WCF A;  2SCP A;  1Y1X A;  1CFD A;  1QLK A;  1XVJ A;  3OB2 B;  5F6T A;  4CID A;  1RRO A;  1BMO A;  2HQW A;  1KSO A;  2KBM A;  2LP3 A;  2E30 A;  1SY9 A;  1OOJ A;  3IF7 A;  1CLM A;  1JUO A;  1BJF A;  2PVB A;  3KEV A;  4N5X A;  1CM1 A;  4YGA A;  1B7T Z;  1N2D A;  2WC8 A;  3MSE B;  1PK0 D;  3EKH A;  1IKU A;  1OQP A;  1KWO C;  2ZND A;  4P5O E;  3VRR A;  4MZK A;  1AJ5 A;  1EH2 A;  2L98 A;  1F4Q A;  3FWC A;  1BOC A;  1S6J A;  1KK8 C;  3CTN A;  2GGM A;  3ZNI A;  2M49 B;  2I7A A;  3PAL A;  4ICB A;  4MVF A;  2ZRS A;  1BF5 A;  1JFJ A;  2F8P A;  2WOS A;  1G33 A;  4HRG A;  4DS7 A;  3AKA A;  4YGD B;  4F0Z B;  1SBJ A;  2Q91 A;  1MXE A;  3AAJ A;  5AFP A;  2PMY A;  1S26 D;  1XO5 A;  3D10 A;  4U8D A;  2LUC A;  2M0R A;  2BBM A;  3BUW B;  4CPV A;  2HF5 A;  1XYD A;  1SNL A;  3FWB A;  1NCY A;  2LHL A;  4AOM A;  1SCM C;  1Y1A A;  4HSZ A;  2IS9 A;  4A4C A;  5ER5 A;  1XFU O;  1XFV O;  2KGB C;  1DJY A;  2I18 A;  2Y1M A;  4YBH B;  5IBW A;  1DJG A;  1OSA A;  2JU0 A;  3NSL A;  2KNE A;  5ER4 X;  4Q04 A;  1CFP A;  2ZFD A;  3I5I B;  5JOL A;  1SPY A;  2Q4U A;  2JQ6 A;  3NSO A;  3BQ3 A;  5CSI A;  4A4B A;  2K0J A;  1MUX A;  3WNX B;  1QIV A;  4I5N B;  3I5F B;  4XJK A;  5HKW A;  3CLN A;  3O6B A;  4MZJ A;  3OP0 A;  1KQM C;  1QAS A;  3VRP A;  4OKH A;  1MHO A;  1A2X A;  2KFF A;  1K95 A;  2K7B A;  3OB1 B;  1IJ6 A;  1XK4 A;  5DKN A;  1TNW A;  1J55 A;  2JOJ A;  2MLF C;  1S5G Y;  2Y4Q A;  2K7C A;  1JBA A;  1R2U A;  1EL4 A;  1F55 A;  2KYF A;  4GBA A;  4CFR A;  3ZWH A;  1B4C A;  1F4O A;  1HQV A;  1LA3 A;  2O60 A;  1JSA A;  5I2L A;  2JC2 A;  1TRF A;  2K2A A;  1J7P A;  1DF0 B;  1S36 A;  2KI4 C;  3BYA A;  1QXP A;  4N1G A;  1XFZ O;  3TUY B;  2HET A;  1IQ5 A;  4HRE E;  1ZAC A;  1CTR A;  1U5I B;  2PAS A;  1OZO A;  2L4H A;  4GGF A;  4AQI A;  1TOP A;  4TNC A;  3AKB A;  4ETO A;  3A4U B;  1L7Z A;  2JWW A;  2JT8 A;  1IH0 A;  1KQV A;  1FI6 A;  1DGV A;  4GAO A;  1SYM A;  4JPZ B;  3PAT A;  4DCK A;  3LK1 A;  1NSH A;  1NIW A;  1HT9 A;  1TNP A;  3DF0 A;  1S1E A;  3I5H B;  4MLW A;  4E68 A;  1F54 A;  1FF1 A;  4NDB A;  1A75 B;  1JF2 A;  1RJV A;  2CT9 A;  2LM5 A;  2Y5I A;  3BOW A;  1TNX A;  1NCZ A;  3KF9 A;  1KFX L;  2OTG B;  1SR6 B;  1IWQ A;  1XFY O;  1ZUZ A;  1S5G Z;  1BR4 B;  1K96 A;  2KOT A;  3NXA A;  2COL B;  2L0P A;  1FBV A;  1CDL A;  2H61 A;  1WRL A;  5G08 A;  2LV7 A;  3TS5 B;  2GV5 A;  3O4Y A;  2BCA A;  2JTT A;  1YRT B;  1PAL A;  1AHR A;  2F2P A;  4PHN A;  3DD4 A;  2JRF A;  1S6I A;  5HLV A;  1S6C A;  4NDD A;  1YTZ C;  5AAN A;  4WRI A;  3DVJ A;  1UUR A;  3GOF A;  1K93 D;  1NCX A;  2RGI A;  1FI5 A;  1NX2 A;  2NCP A;  5I2Q A;  1YUT A;  1QS7 A;  4JWQ A;  4OVN F;  5AEQ A;  2O5G A;  2LVK A;  1AK8 A;  1REC A;  3KPX A;  1JC2 A;  4QJ5 B;  5HKY A;  2MAZ A;  1UUS A;  1VRK A;  1IQ3 A;  1UHN A;  2HQ8 A;  2JNF A;  3TZ1 A;  3LLE A;  1TCF A;  2L50 A;  1C7W A;  3AAK A;  1IG5 A;  1IGV A;  5TNC A;  1KFU L;  1BG1 A;  1G4Y R;  1ODB A;  4FQO A;  2MRD A;  1M39 A;  2D8N A;  4ORB B;  1CDM A;  3QRX A;  4QJ3 B;  1K90 D;  1YVH A;  2BE6 A;  1SW8 A;  2K8M B;  3I5I C;  1QIW A;  4AQJ A;  4PE7 A;  1SL8 A;  1YUR A;  4C0K A;  1QVI Y;  2HPS A;  1K9U A;  1LVC D;  3GK2 A;  3GK1 A;  2FJU B;  1W7I B;  1CLB A;  3OX6 A;  2BCX A;  4PAL A;  3I5F C;  4YRU A;  2BBN A;  3EVU A;  1OZS A;  1M45 A;  4BY5 A;  4DIR A;  2V53 A;  1KK7 Y;  4MBE A;  1YVL A;  3CS1 A;  3KHE A;  3H4S E;  3SG3 A;  2M29 A;  1S3P A;  2KGR A;  5K89 A;  1DJW A;  2M3W A;  3BUX B;  1WRK A;  1RTP 1;  3DVK A;  4YI8 A;  2LP2 A;  1J1D A;  1FW4 A;  2KFG A;  3BUM B;  3SG2 A;  3LCP C;  3IQQ A;  1OMV A;  5DKR A;  2KAV A;  1UHJ A;  3OX5 A;  1QV0 A;  4M2Q A;  5CSJ A;  1SMG A;  3DF0 B;  3PN7 B;  4GPL B;  2F3Z A;  3WHU B;  1YUS A;  1SL7 A;  3TUY C;  2KQY A;  3PM8 A;  5I2O A;  5BPJ A;  1NX0 A;  2AMI A;  2ZKM X;  2FCD A;  5KSZ A;  1CB1 A;  2CBL A;  2K61 A;  1EG3 A;  1Y1U A;  4C0L A;  3KO0 A;  4L9M A;  4QJ4 B;  1CDN A;  2LCP A;  1NX3 A;  2M1U A;  1PRW A;  2FCE A;  2EC6 B;  1QLS A;  3VGO A;  1J7Q A;  2L51 A;  2BCB A;  4M2P A;  2F33 A;  2WND A;  1BLQ A;  1V1F A;  2LUX A;  3NSK A;  4PHJ A;  1UHH A;  2JT3 A;  1FPW A;  1M31 A;  1DJH A;  1WDC C;  5CSN A;  3VRQ A;  1C7V A;  3I5H C;  1KK7 Z;  1LA0 A;  5AXI A;  1ZFS A;  1B8L A;  1B9A A;  1YUU A;  3EKJ A;  2BE4 A;  4CFQ A;  2WCB A;  4NDC A;  1DVI A;  1EJ3 A;  2OTG C;  1SR6 C;  2G2B A;  4PCW A;  1F8H A;  1H4B A;  1SCV A;  1NX1 A;  3E3R A;  3OHM B;  1ALW A;  1M46 A;  1XFX O;  4MRY A;  1DTL A;  2KAY A;  2OS8 B;  3FS7 A;  1GJY A;  1B47 A;  1OE9 B;  2L4I A;  3TDU A;  3TS5 C;  2M7N A;  1IRJ A;  1UHK A;  1A29 A;  1K8U A;  1SRA A;  3I5G B;  4I5K A;  2ZRT A;  3JTD B;  3NSI A;  1MWN A;  1NYA A;  2JPT A;  4ORA B;  2LAP A;  2NLN A;  1CFC A;  2KBI A;  1JFK A;  5PAL A;  1KCY A;  2CNP A;  2H2K A;  3GK4 X;  1DJX A;  1YR5 A;  2DOQ A;  1AJ4 A;  3JVT B;  4OR9 B;  4PHK A;  2B1U A;  3LK0 A;  4P2Y B;  2M97 A;  4GFT A;  2MA2 A;  2LNK A;  1CM4 A;  3WHT B;  3WXA A;  1V1G A;  3TDI A;  5CPV A;  3SG6 A;  1DGU A;  1R6P A;  2ZN8 A;  1NPQ A;  5KU1 A;  1WY9 A;  2AUC A;  1B7T Y;  2JXC A;  1AUI B;  1OMD A;  1B8R A;  5D7F A;  2SAS A;  2M8U A;  3CGA A;  3RM1 A;  1SK6 D;  2BL0 B;  3M0W A;  1TCO B;  4OV2 A;  2CCM A;  1K94 A;  1LKJ A;  1DT7 B;  2MLE C;  3CR2 A;  3IQO A;  1J1E A;  2LAN A;  2L2E A;  2K2F A;  3DVE A;  2I94 A;  1CMF A;  2MBX A;  2JZI A;  1BT6 A;  4GGN A;  1L2O B;  1EG4 A;  2LMT A;  4D1E A; 
#chains in the Genus database with same CATH topology
 2E6W A;  1OOF A;  3B86 A;  3EK4 A;  2KYC A;  1NWD A;  1BR1 B;  4ZCU A;  1PSR A;  2QPT A;  5FYX A;  4XJK B;  1UP5 A;  1JWD A;  4OCI A;  2FOT A;  5KTY A;  1ORG A;  1SL9 A;  2K7D A;  1WRZ A;  4JD9 A;  3VRO A;  2KHN A;  2NCO A;  2ZN9 A;  3CR4 X;  3DZT A;  4IL1 A;  2JPO A;  3PLF B;  3R1O A;  1G8I A;  1LXF C;  2OPO A;  4MN0 A;  2BNX A;  2LMV A;  2GGZ A;  3FIA A;  3TDZ A;  1DF0 A;  2KI6 D;  1X02 A;  3PN7 C;  2PRU A;  3D77 A;  4PE1 A;  4YGB B;  1E8A A;  2KAX A;  2KDH A;  2WCE A;  1U5I A;  4MRX A;  2P71 A;  2TN4 A;  1W7J B;  4BY4 A;  3F45 A;  4XYN A;  3O2P A;  2VRG A;  2ZNE A;  2WCM A;  5CSF A;  3EVR A;  2WC5 A;  2H61 C;  2Y1N A;  1QAT A;  3D0Y A;  1EXR A;  2EC6 C;  2MJW B;  5HYD A;  3S0F A;  1DMO A;  1GGW A;  1TNQ A;  3SIA A;  2KQ6 A;  2NZ0 A;  1RK9 A;  1M63 B;  2BKH B;  3EK7 A;  4MZL A;  2G9B A;  2LVI A;  3SG5 A;  3FE9 A;  2PYQ A;  1K2H A;  1A75 A;  2L5X B;  1ZOT B;  4GNK B;  2LLT A;  1CMG A;  2JXL A;  1K9K A;  1QX2 A;  2MHH A;  4HRH A;  1LS8 A;  3ICB A;  3OBV A;  3D74 A;  2EHB A;  5JJG A;  1Y0V H;  1C07 A;  4FTG A;  1CKK A;  3BOW B;  1UHI A;  4UPG A;  1CNP A;  1F70 A;  1YRU B;  2WOR A;  1MXL C;  2PSR A;  1AP4 A;  2BAP A;  1NP8 A;  2F3Y A;  2OS8 C;  1KWO B;  1QV1 A;  1GM0 A;  2BKI B;  3C1V A;  3PSR A;  2BEC A;  3K1E A;  3SS5 A;  1XFR A;  1BU3 A;  1N65 A;  1TTX A;  1GQM A;  1AVS A;  3I5G C;  1QVI Z;  3CR5 X;  1Y6W A;  3JTD C;  3NHT A;  1KK8 B;  1A4P A;  2I2R E;  4PT1 A;  2LVJ A;  5FI6 A;  2CTN A;  1JF0 A;  2JNX A;  5DKQ A;  3N7H A;  4DUQ A;  4C0J A;  3EVV A;  2M9G A;  5J3X A;  1CLL A;  3JVT C;  2LC5 A;  3K21 A;  1WLZ A;  3CZT X;  4MSP A;  4USL A;  3BXK A;  1PSB A;  2EGD A;  3HX4 A;  1MR8 A;  4CLN A;  3BUO B;  2JT0 A;  4YI9 A;  1QTX A;  2K7O A;  4NQG A;  3BJH A;  3EK8 A;  1RWY A;  3D78 A;  1PVA A;  4ORC B;  3SG4 A;  1B1G A;  4M2O A;  3SJS A;  5B8I B;  1SCM B;  2JUL A;  4R1E A;  1LIN A;  3RLZ A;  5AER A;  2JTZ A;  1KFX S;  2NXQ A;  1C3Y A;  2QDI A;  3VRN A;  1TIZ A;  4I5L B;  2BL0 C;  2LLU A;  3CWG A;  1Q80 A;  3A8R A;  3O4X A;  2LLS A;  4YGE B;  4MEW A;  4ZCV A;  1QX7 A;  1YX7 A;  2KFH A;  2WC6 A;  4DRW A;  5I8N A;  1J7R A;  3PFV A;  1NUB A;  2M1K B;  1ZMZ A;  2A4J A;  1DEL A;  1L2O C;  3VB1 A;  1F71 A;  1QX5 B;  1OOH A;  2KSP A;  2QEH A;  4I5J A;  4PE0 A;  4GUK A;  2KI6 C;  1RFJ A;  1OMR A;  2LE9 B;  1C3Z A;  4WQ3 A;  1KQM B;  5HKZ A;  1SKT A;  4OZD A;  1YX8 A;  2ERB A;  2KPH A;  1ALV A;  1MF8 B;  3D0Y B;  3SIB A;  3CYZ A;  1OW4 A;  1SSE B;  4JQ0 D;  1J7O A;  3DVM A;  1UWO A;  3L4L A;  1XK4 C;  1WLM A;  1N0Y A;  5GQQ C;  2CXJ A;  2R2I A;  2ISD A;  1BOD A;  1MQ1 A;  1WDC B;  4PE4 A;  1A03 A;  3CZ1 A;  4N1F A;  5D69 A;  2L5Y A;  4PHM A;  1CFF A;  1DJZ A;  1H8B A;  1B8C A;  2QAC A;  5HLO A;  2LMU A;  1DJI A;  1XA5 A;  2PAL A;  2LVV A;  4PDZ A;  1K9P A;  1CDP A;  2KI4 B;  1KSM A;  2P6B B;  2AAO A;  3HCM A;  3SG7 A;  1KFU S;  3O78 A;  3SS4 A;  1IJ5 A;  1PUL A;  4WQ2 A;  1TN4 A;  2M7L A;  1GGZ A;  3LL8 B;  4GGF C;  3BUN B;  1XFW O;  2LHI A;  2F2O A;  1QJT A;  1PVB A;  4YGC B;  1D1O A;  3QME A;  2WCF A;  2SCP A;  1Y1X A;  1CFD A;  1QLK A;  1XVJ A;  3OB2 B;  5F6T A;  4CID A;  1RRO A;  1BMO A;  2HQW A;  3S0B A;  1KSO A;  2KBM A;  2LP3 A;  2E30 A;  1SY9 A;  1OOJ A;  3IF7 A;  4INX A;  1CLM A;  1JUO A;  1BJF A;  2PVB A;  3KEV A;  4N5X A;  1CM1 A;  4YGA A;  1B7T Z;  2WCJ A;  1N2D A;  2WC8 A;  3MSE B;  1PK0 D;  3EKH A;  1IKU A;  1OQP A;  1KWO C;  2ZND A;  4P5O E;  5EL2 A;  3VRR A;  4MZK A;  1AJ5 A;  1EH2 A;  2L98 A;  1F4Q A;  3FWC A;  1BOC A;  1S6J A;  3Q8I A;  1KK8 C;  3CTN A;  2GGM A;  3ZNI A;  2M49 B;  2I7A A;  3PAL A;  4ICB A;  4MVF A;  2ZRS A;  1BF5 A;  1JFJ A;  2F8P A;  2WOS A;  1G33 A;  4HRG A;  4DS7 A;  2QEB A;  3AKA A;  4YGD B;  4F0Z B;  1SBJ A;  2Q91 A;  1MXE A;  3AAJ A;  5AFP A;  2PMY A;  1S26 D;  1XO5 A;  3D10 A;  4U8D A;  2LUC A;  2M0R A;  2BBM A;  3BUW B;  4CPV A;  3CZ0 A;  2HF5 A;  1XYD A;  1SNL A;  3FWB A;  1NCY A;  2LHL A;  4AOM A;  1SCM C;  1Y1A A;  4HSZ A;  2IS9 A;  1P28 A;  4A4C A;  1DQE A;  5ER5 A;  1TUJ A;  1XFU O;  1XFV O;  2KGB C;  1DJY A;  2I18 A;  2Y1M A;  3NGV A;  4YBH B;  5IBW A;  1DJG A;  1OSA A;  2JU0 A;  3NSL A;  2KNE A;  3FE6 A;  5ER4 X;  4Q04 A;  1CFP A;  2ZFD A;  3I5I B;  5JOL A;  1SPY A;  2Q4U A;  2JQ6 A;  3NSO A;  3BQ3 A;  5CSI A;  4A4B A;  2K0J A;  1MUX A;  2P70 A;  3WNX B;  1QIV A;  4I5N B;  3I5F B;  4XJK A;  5HKW A;  3CLN A;  3O6B A;  1DEK A;  1TUZ A;  3OP0 A;  1KQM C;  1QAS A;  4MZJ A;  3VRP A;  3B88 A;  1MHO A;  4JKT A;  4OKH A;  1A2X A;  2KFF A;  1K95 A;  1OOG A;  1Z4H A;  2K7B A;  3OB1 B;  1DC1 A;  1IJ6 A;  1XK4 A;  5DKN A;  1TNW A;  1J55 A;  2JOJ A;  2MLF C;  1S5G Y;  2K60 A;  2K7C A;  2Y4Q A;  3NXA A;  1JBA A;  1R2U A;  1EL4 A;  1F55 A;  2KYF A;  4GBA A;  4CFR A;  3ZWH A;  1B4C A;  1F4O A;  1HQV A;  1LA3 A;  2O60 A;  3OGN A;  5I2L A;  1JSA A;  2JC2 A;  1TRF A;  2K2A A;  1J7P A;  1DF0 B;  1S36 A;  2KI4 C;  3BYA A;  1QXP A;  4N1G A;  1XFZ O;  3TUY B;  3L4A A;  2HET A;  1IQ5 A;  4HRE E;  1ZAC A;  1CTR A;  2KLD A;  1U5I B;  2PAS A;  1OZO A;  2L4H A;  4GGF A;  4AQI A;  1TOP A;  4TNC A;  3AKB A;  4ETO A;  3A4U B;  1L7Z A;  2JWW A;  2JT8 A;  1IH0 A;  1KQV A;  1FI6 A;  1DGV A;  4GAO A;  1SYM A;  4JPZ B;  3PAT A;  4DCK A;  3LK1 A;  1NSH A;  4KYN A;  1NIW A;  3PM2 A;  1HT9 A;  1TNP A;  3DF0 A;  1S1E A;  3I5H B;  4MLW A;  4E68 A;  1F54 A;  1FF1 A;  4NDB A;  1A75 B;  2L2C A;  1JF2 A;  1RJV A;  2CT9 A;  2LM5 A;  2Y5I A;  3BOW A;  1TNX A;  1NCZ A;  3KF9 A;  1KFX L;  2OTG B;  1SR6 B;  1IWQ A;  1XFY O;  1ZUZ A;  1S5G Z;  1BR4 B;  1K96 A;  2KOT A;  3DXL A;  3DY9 A;  3V2L A;  1Z2C B;  2COL B;  2L0P A;  1FBV A;  1CDL A;  2H61 A;  1WRL A;  5G08 A;  2LV7 A;  3TS5 B;  2GV5 A;  3O4Y A;  2BCA A;  1QWV A;  1YRT B;  2JTT A;  3DYE A;  3FE8 A;  1PAL A;  1AHR A;  2F2P A;  4PHN A;  3DD4 A;  2JRF A;  1S6I A;  5HLV A;  1S6C A;  4NDD A;  1YTZ C;  3IVT A;  4WRI A;  5AAN A;  3DVJ A;  1UUR A;  3GOF A;  3D76 A;  3CZ2 A;  1K93 D;  5HL1 A;  1NCX A;  2YGU A;  2RGI A;  1FI5 A;  1NX2 A;  2NCP A;  3NHI A;  5I2Q A;  1YUT A;  1QS7 A;  3RZS A;  4JWQ A;  4OVN F;  5AEQ A;  2O5G A;  2LVK A;  1OOI X;  1REC A;  3BFB A;  3KPX A;  3L47 A;  3PJI A;  1AK8 A;  1JC2 A;  4QJ5 B;  1IIO A;  3S0E A;  5HKY A;  2WCK A;  2MAZ A;  1UUS A;  1VRK A;  4FQT A;  1UHN A;  1IQ3 A;  2HQ8 A;  2JNF A;  3TZ1 A;  3LLE A;  3R72 A;  1TCF A;  2KLE A;  2L50 A;  1C7W A;  3AAK A;  1IG5 A;  1IGV A;  5TNC A;  1KFU L;  1BG1 A;  1G4Y R;  1ODB A;  4FQO A;  2MRD A;  1M39 A;  2D8N A;  4ORB B;  1CDM A;  3QRX A;  4QJ3 B;  1K90 D;  1YVH A;  2BE6 A;  1SW8 A;  2K8M B;  3I5I C;  1QIW A;  4AQJ A;  4PE7 A;  1SL8 A;  1YUR A;  4C0K A;  1QVI Y;  2HPS A;  1K9U A;  1LVC D;  3GK2 A;  3GK1 A;  2FJU B;  1W7I B;  1CLB A;  3OX6 A;  2BCX A;  4PAL A;  3D73 A;  4INW A;  3I5F C;  4YRU A;  3B87 A;  2BBN A;  2H8V A;  1OZS A;  1M45 A;  3EVU A;  3CDN A;  4BY5 A;  2V53 A;  4DIR A;  1KK7 Y;  4IJ7 A;  1YVL A;  3CS1 A;  4MBE A;  3KHE A;  3H4S E;  3SG3 A;  5DIC A;  3EG5 B;  2M29 A;  1S3P A;  2FJY A;  2KGR A;  5K89 A;  1DJW A;  2M3W A;  3BUX B;  3CAB A;  1WRK A;  1T14 A;  1RTP 1;  3DVK A;  4YI8 A;  2LP2 A;  1J1D A;  1FW4 A;  2KFG A;  3BUM B;  3SG2 A;  3LCP C;  3IQQ A;  1OMV A;  5DKR A;  2KAV A;  2QEV A;  1UHJ A;  3OX5 A;  1QV0 A;  4M2Q A;  5CSJ A;  1SMG A;  3DF0 B;  3PN7 B;  4GPL B;  2F3Z A;  2PQL A;  3WHU B;  1YUS A;  1SL7 A;  3TUY C;  5FI7 A;  2KQY A;  3PM8 A;  5I2O A;  5BPJ A;  1NX0 A;  2AMI A;  2ZKM X;  2FCD A;  5KSZ A;  1CB1 A;  2CBL A;  2K61 A;  1EG3 A;  1Y1U A;  4C0L A;  3KO0 A;  4L9M A;  4QJ4 B;  1CDN A;  2LCP A;  1NX3 A;  2M1U A;  1PRW A;  2FCE A;  2EC6 B;  1QLS A;  3VGO A;  1J7Q A;  2L51 A;  2BCB A;  4M2P A;  2F33 A;  2WND A;  5D3O A;  2GTE A;  1BLQ A;  1V1F A;  2LUX A;  3NSK A;  2WCH A;  1UHH A;  4PHJ A;  4F7F A;  2JT3 A;  1FPW A;  1M31 A;  1DJH A;  1WDC C;  5CSN A;  3VRQ A;  1C7V A;  3I5H C;  1KK7 Z;  1LA0 A;  5AXI A;  1ZFS A;  1B8L A;  1B9A A;  1YUU A;  3EKJ A;  2BE4 A;  4CFQ A;  2WCB A;  4NDC A;  1DVI A;  1EJ3 A;  1W9Z A;  2OTG C;  1SR6 C;  2G2B A;  4PCW A;  1F8H A;  1H4B A;  1SCV A;  1NX1 A;  3E3R A;  3OHM B;  1ALW A;  1M46 A;  1XFX O;  4MRY A;  1DTL A;  2KAY A;  2OS8 B;  3FS7 A;  1GJY A;  1B47 A;  1OE9 B;  2L4I A;  3TDU A;  3TS5 C;  2M7N A;  1IRJ A;  1UHK A;  1A29 A;  1K8U A;  1SRA A;  3I5G B;  4I5K A;  2ZRT A;  3JTD B;  3NSI A;  1MWN A;  1NYA A;  2QEO A;  3S0A A;  2JPT A;  4ORA B;  2LAP A;  3R1V A;  1TWO A;  2NLN A;  1CFC A;  2KBI A;  1JFK A;  5PAL A;  1KCY A;  2CNP A;  2H2K A;  3D75 A;  3GK4 X;  1DJX A;  1YR5 A;  2DOQ A;  1AJ4 A;  3UNW A;  3JVT B;  4OR9 B;  4PHK A;  3BFA A;  2B1U A;  3LK0 A;  4P2Y B;  2M97 A;  4GFT A;  2MA2 A;  2LNK A;  1CM4 A;  3WHT B;  3WXA A;  1V1G A;  3B6X A;  5FI2 A;  3B7A A;  3R1P A;  5CPV A;  3TDI A;  3SG6 A;  1DGU A;  1R6P A;  2ZN8 A;  1NPQ A;  3BFH A;  3S0G A;  5I94 A;  5KU1 A;  1WY9 A;  2AUC A;  1B7T Y;  2JXC A;  1AUI B;  1OMD A;  1B8R A;  5D7F A;  2SAS A;  2M8U A;  3CGA A;  3RM1 A;  3S0D A;  1SK6 D;  2BL0 B;  3M0W A;  1TCO B;  4OV2 A;  2CCM A;  1K94 A;  1LKJ A;  1DT7 B;  2MLE C;  3CR2 A;  3IQO A;  1J1E A;  2LAN A;  2L2E A;  2K2F A;  3DVE A;  2I94 A;  1CMF A;  3UO9 A;  2MBX A;  2JZI A;  1BT6 A;  4GGN A;  1L2O B;  1EG4 A;  2WCL A;  3SS3 A;  2LMT A;  4D1E A; 
#chains in the Genus database with same CATH homology
 2E6W A;  3EK4 A;  2KYC A;  1NWD A;  1BR1 B;  4ZCU A;  1PSR A;  2QPT A;  5FYX A;  4XJK B;  1UP5 A;  1JWD A;  4OCI A;  2FOT A;  5KTY A;  1SL9 A;  2K7D A;  1WRZ A;  3VRO A;  2KHN A;  2NCO A;  2ZN9 A;  3CR4 X;  4IL1 A;  3PLF B;  1G8I A;  1LXF C;  2OPO A;  4MN0 A;  2LMV A;  2GGZ A;  3FIA A;  3TDZ A;  1DF0 A;  2KI6 D;  1X02 A;  3PN7 C;  2PRU A;  4PE1 A;  4YGB B;  1E8A A;  2KAX A;  2KDH A;  2WCE A;  1U5I A;  4MRX A;  2TN4 A;  1W7J B;  4BY4 A;  3F45 A;  4XYN A;  3O2P A;  2VRG A;  2ZNE A;  5CSF A;  3EVR A;  2H61 C;  2Y1N A;  1QAT A;  3D0Y A;  1EXR A;  2EC6 C;  2MJW B;  5HYD A;  1DMO A;  1GGW A;  1TNQ A;  3SIA A;  2KQ6 A;  2NZ0 A;  1RK9 A;  1M63 B;  2BKH B;  3EK7 A;  4MZL A;  2G9B A;  2LVI A;  3SG5 A;  1K2H A;  1A75 A;  2L5X B;  1ZOT B;  4GNK B;  2LLT A;  1CMG A;  2JXL A;  1K9K A;  1QX2 A;  2MHH A;  4HRH A;  3ICB A;  2EHB A;  5JJG A;  1Y0V H;  1C07 A;  4FTG A;  1CKK A;  3BOW B;  1UHI A;  4UPG A;  1CNP A;  1F70 A;  1YRU B;  2WOR A;  1MXL C;  2PSR A;  1AP4 A;  2OS8 C;  1NP8 A;  2F3Y A;  1KWO B;  1QV1 A;  2BKI B;  3C1V A;  3PSR A;  2BEC A;  1BU3 A;  1N65 A;  1TTX A;  1GQM A;  1AVS A;  3I5G C;  1QVI Z;  3CR5 X;  1Y6W A;  3JTD C;  1KK8 B;  1A4P A;  2I2R E;  2LVJ A;  2CTN A;  1JF0 A;  2JNX A;  5DKQ A;  4DUQ A;  4C0J A;  3EVV A;  2M9G A;  5J3X A;  1CLL A;  3JVT C;  2LC5 A;  3K21 A;  1WLZ A;  3CZT X;  4MSP A;  4USL A;  3BXK A;  1PSB A;  2EGD A;  3HX4 A;  1MR8 A;  4CLN A;  3BUO B;  2JT0 A;  4YI9 A;  1QTX A;  2K7O A;  4NQG A;  3EK8 A;  1RWY A;  1PVA A;  4ORC B;  3SG4 A;  1B1G A;  4M2O A;  3SJS A;  5B8I B;  1SCM B;  2JUL A;  4R1E A;  1LIN A;  3RLZ A;  5AER A;  2JTZ A;  1KFX S;  2NXQ A;  3VRN A;  1TIZ A;  4I5L B;  2BL0 C;  2LLU A;  3CWG A;  1Q80 A;  3A8R A;  2LLS A;  4YGE B;  4MEW A;  4ZCV A;  1QX7 A;  1YX7 A;  2KFH A;  4DRW A;  5I8N A;  1J7R A;  3PFV A;  1NUB A;  2M1K B;  1ZMZ A;  2A4J A;  1L2O C;  1F71 A;  1QX5 B;  2KSP A;  4I5J A;  4PE0 A;  4GUK A;  2KI6 C;  1RFJ A;  1OMR A;  2LE9 B;  4WQ3 A;  5HKZ A;  1KQM B;  1SKT A;  1YX8 A;  3D0Y B;  1ALV A;  1MF8 B;  3SIB A;  4JQ0 D;  1J7O A;  3DVM A;  1UWO A;  1XK4 C;  1WLM A;  1N0Y A;  5GQQ C;  2CXJ A;  2R2I A;  2ISD A;  1BOD A;  1MQ1 A;  1WDC B;  4PE4 A;  1A03 A;  4N1F A;  5D69 A;  4PHM A;  1CFF A;  1H8B A;  1DJZ A;  1B8C A;  2QAC A;  5HLO A;  2LMU A;  1DJI A;  1XA5 A;  2PAL A;  2LVV A;  4PDZ A;  1K9P A;  1CDP A;  2KI4 B;  1KSM A;  2P6B B;  2AAO A;  3HCM A;  3SG7 A;  1KFU S;  3O78 A;  1IJ5 A;  1PUL A;  4WQ2 A;  1TN4 A;  2M7L A;  1GGZ A;  3LL8 B;  4GGF C;  3BUN B;  1XFW O;  2LHI A;  2F2O A;  1QJT A;  1PVB A;  4YGC B;  1D1O A;  2WCF A;  2SCP A;  1Y1X A;  1CFD A;  1QLK A;  1XVJ A;  3OB2 B;  5F6T A;  4CID A;  1RRO A;  1BMO A;  2HQW A;  1KSO A;  2KBM A;  2LP3 A;  2E30 A;  1SY9 A;  1OOJ A;  3IF7 A;  1CLM A;  1JUO A;  1BJF A;  2PVB A;  3KEV A;  4N5X A;  1CM1 A;  4YGA A;  1B7T Z;  1N2D A;  2WC8 A;  3MSE B;  1PK0 D;  3EKH A;  1IKU A;  1OQP A;  1KWO C;  2ZND A;  4P5O E;  3VRR A;  4MZK A;  1AJ5 A;  1EH2 A;  2L98 A;  1F4Q A;  3FWC A;  1BOC A;  1S6J A;  1KK8 C;  3CTN A;  2GGM A;  3ZNI A;  2M49 B;  2I7A A;  3PAL A;  4ICB A;  4MVF A;  2ZRS A;  1BF5 A;  1JFJ A;  2F8P A;  2WOS A;  1G33 A;  4HRG A;  4DS7 A;  3AKA A;  4YGD B;  4F0Z B;  1SBJ A;  2Q91 A;  1MXE A;  3AAJ A;  5AFP A;  2PMY A;  1S26 D;  1XO5 A;  3D10 A;  4U8D A;  2LUC A;  2M0R A;  2BBM A;  3BUW B;  4CPV A;  2HF5 A;  1XYD A;  1SNL A;  3FWB A;  1NCY A;  2LHL A;  4AOM A;  1SCM C;  1Y1A A;  4HSZ A;  2IS9 A;  4A4C A;  5ER5 A;  1XFU O;  1XFV O;  2KGB C;  1DJY A;  2I18 A;  2Y1M A;  4YBH B;  5IBW A;  1DJG A;  1OSA A;  2JU0 A;  3NSL A;  2KNE A;  5ER4 X;  4Q04 A;  1CFP A;  2ZFD A;  3I5I B;  5JOL A;  1SPY A;  2Q4U A;  2JQ6 A;  3NSO A;  3BQ3 A;  5CSI A;  4A4B A;  2K0J A;  1MUX A;  3WNX B;  1QIV A;  4I5N B;  3I5F B;  4XJK A;  5HKW A;  3CLN A;  3O6B A;  4MZJ A;  3OP0 A;  1KQM C;  1QAS A;  3VRP A;  4OKH A;  1MHO A;  1A2X A;  2KFF A;  1K95 A;  2K7B A;  3OB1 B;  1IJ6 A;  1XK4 A;  5DKN A;  1TNW A;  1J55 A;  2JOJ A;  2MLF C;  1S5G Y;  2Y4Q A;  2K7C A;  1JBA A;  1R2U A;  1EL4 A;  1F55 A;  2KYF A;  4GBA A;  4CFR A;  3ZWH A;  1B4C A;  1F4O A;  1HQV A;  1LA3 A;  2O60 A;  1JSA A;  5I2L A;  2JC2 A;  1TRF A;  2K2A A;  1J7P A;  1DF0 B;  1S36 A;  2KI4 C;  3BYA A;  1QXP A;  4N1G A;  1XFZ O;  3TUY B;  2HET A;  1IQ5 A;  4HRE E;  1ZAC A;  1CTR A;  1U5I B;  2PAS A;  1OZO A;  2L4H A;  4GGF A;  4AQI A;  1TOP A;  4TNC A;  3AKB A;  4ETO A;  3A4U B;  1L7Z A;  2JWW A;  2JT8 A;  1IH0 A;  1KQV A;  1FI6 A;  1DGV A;  4GAO A;  1SYM A;  4JPZ B;  3PAT A;  4DCK A;  3LK1 A;  1NSH A;  1NIW A;  1HT9 A;  1TNP A;  3DF0 A;  1S1E A;  3I5H B;  4MLW A;  4E68 A;  1F54 A;  1FF1 A;  4NDB A;  1A75 B;  1JF2 A;  1RJV A;  2CT9 A;  2LM5 A;  2Y5I A;  3BOW A;  1TNX A;  1NCZ A;  3KF9 A;  1KFX L;  2OTG B;  1SR6 B;  1IWQ A;  1XFY O;  1ZUZ A;  1S5G Z;  1BR4 B;  1K96 A;  2KOT A;  3NXA A;  2COL B;  2L0P A;  1FBV A;  1CDL A;  2H61 A;  1WRL A;  5G08 A;  2LV7 A;  3TS5 B;  2GV5 A;  3O4Y A;  2BCA A;  2JTT A;  1YRT B;  1PAL A;  1AHR A;  2F2P A;  4PHN A;  3DD4 A;  2JRF A;  1S6I A;  5HLV A;  1S6C A;  4NDD A;  1YTZ C;  5AAN A;  4WRI A;  3DVJ A;  1UUR A;  3GOF A;  1K93 D;  1NCX A;  2RGI A;  1FI5 A;  1NX2 A;  2NCP A;  5I2Q A;  1YUT A;  1QS7 A;  4JWQ A;  4OVN F;  5AEQ A;  2O5G A;  2LVK A;  1AK8 A;  1REC A;  3KPX A;  1JC2 A;  4QJ5 B;  5HKY A;  2MAZ A;  1UUS A;  1VRK A;  1IQ3 A;  1UHN A;  2HQ8 A;  2JNF A;  3TZ1 A;  3LLE A;  1TCF A;  2L50 A;  1C7W A;  3AAK A;  1IG5 A;  1IGV A;  5TNC A;  1KFU L;  1BG1 A;  1G4Y R;  1ODB A;  4FQO A;  2MRD A;  1M39 A;  2D8N A;  4ORB B;  1CDM A;  3QRX A;  4QJ3 B;  1K90 D;  1YVH A;  2BE6 A;  1SW8 A;  2K8M B;  3I5I C;  1QIW A;  4AQJ A;  4PE7 A;  1SL8 A;  1YUR A;  4C0K A;  1QVI Y;  2HPS A;  1K9U A;  1LVC D;  3GK2 A;  3GK1 A;  2FJU B;  1W7I B;  1CLB A;  3OX6 A;  2BCX A;  4PAL A;  3I5F C;  4YRU A;  2BBN A;  3EVU A;  1OZS A;  1M45 A;  4BY5 A;  4DIR A;  2V53 A;  1KK7 Y;  4MBE A;  1YVL A;  3CS1 A;  3KHE A;  3H4S E;  3SG3 A;  2M29 A;  1S3P A;  2KGR A;  5K89 A;  1DJW A;  2M3W A;  3BUX B;  1WRK A;  1RTP 1;  3DVK A;  4YI8 A;  2LP2 A;  1J1D A;  1FW4 A;  2KFG A;  3BUM B;  3SG2 A;  3LCP C;  3IQQ A;  1OMV A;  5DKR A;  2KAV A;  1UHJ A;  3OX5 A;  1QV0 A;  4M2Q A;  5CSJ A;  1SMG A;  3DF0 B;  3PN7 B;  4GPL B;  2F3Z A;  3WHU B;  1YUS A;  1SL7 A;  3TUY C;  2KQY A;  3PM8 A;  5I2O A;  5BPJ A;  1NX0 A;  2AMI A;  2ZKM X;  2FCD A;  5KSZ A;  1CB1 A;  2CBL A;  2K61 A;  1EG3 A;  1Y1U A;  4C0L A;  3KO0 A;  4L9M A;  4QJ4 B;  1CDN A;  2LCP A;  1NX3 A;  2M1U A;  1PRW A;  2FCE A;  2EC6 B;  1QLS A;  3VGO A;  1J7Q A;  2L51 A;  2BCB A;  4M2P A;  2F33 A;  2WND A;  1BLQ A;  1V1F A;  2LUX A;  3NSK A;  4PHJ A;  1UHH A;  2JT3 A;  1FPW A;  1M31 A;  1DJH A;  1WDC C;  5CSN A;  3VRQ A;  1C7V A;  3I5H C;  1KK7 Z;  1LA0 A;  5AXI A;  1ZFS A;  1B8L A;  1B9A A;  1YUU A;  3EKJ A;  2BE4 A;  4CFQ A;  2WCB A;  4NDC A;  1DVI A;  1EJ3 A;  2OTG C;  1SR6 C;  2G2B A;  4PCW A;  1F8H A;  1H4B A;  1SCV A;  1NX1 A;  3E3R A;  3OHM B;  1ALW A;  1M46 A;  1XFX O;  4MRY A;  1DTL A;  2KAY A;  2OS8 B;  3FS7 A;  1GJY A;  1B47 A;  1OE9 B;  2L4I A;  3TDU A;  3TS5 C;  2M7N A;  1IRJ A;  1UHK A;  1A29 A;  1K8U A;  1SRA A;  3I5G B;  4I5K A;  2ZRT A;  3JTD B;  3NSI A;  1MWN A;  1NYA A;  2JPT A;  4ORA B;  2LAP A;  2NLN A;  1CFC A;  2KBI A;  1JFK A;  5PAL A;  1KCY A;  2CNP A;  2H2K A;  3GK4 X;  1DJX A;  1YR5 A;  2DOQ A;  1AJ4 A;  3JVT B;  4OR9 B;  4PHK A;  2B1U A;  3LK0 A;  4P2Y B;  2M97 A;  4GFT A;  2MA2 A;  2LNK A;  1CM4 A;  3WHT B;  3WXA A;  1V1G A;  3TDI A;  5CPV A;  3SG6 A;  1DGU A;  1R6P A;  2ZN8 A;  1NPQ A;  5KU1 A;  1WY9 A;  2AUC A;  1B7T Y;  2JXC A;  1AUI B;  1OMD A;  1B8R A;  5D7F A;  2SAS A;  2M8U A;  3CGA A;  3RM1 A;  1SK6 D;  2BL0 B;  3M0W A;  1TCO B;  4OV2 A;  2CCM A;  1K94 A;  1LKJ A;  1DT7 B;  2MLE C;  3CR2 A;  3IQO A;  1J1E A;  2LAN A;  2L2E A;  2K2F A;  3DVE A;  2I94 A;  1CMF A;  2MBX A;  2JZI A;  1BT6 A;  4GGN A;  1L2O B;  1EG4 A;  2LMT A;  4D1E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...