1GQMA

The structure of s100a12 in a hexameric form and its proposed role in receptor signalling
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
87
structure length
87
Chain Sequence
TKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CALGRANULIN C
publication title The Structure of S100A12 in a Hexameric Form and its Proposed Role in Receptor Signalling
pubmed doi rcsb
molecule tags Antimicrobial protein
total genus 29
structure length 87
sequence length 87
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2001-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1gqmA00
1CDMA 3NSIA 2WOSA 1N0YA 3E3RA 1TRFA 4PE7A 5DKNA 5I2LA 3NXAA 4PHJA 2BCXA 5JOLA 4F0ZB 1IKUA 4Q04A 2LP2A 2MBXA 2OTGB 1TTXA 4C0JA 1DF0A 2KYCA 1MUXA 3A8RA 3ZNIA 3TUYC 1B7TY 4ORAB 1XVJA 1UHKA 5HYDA 4QJ4B 4PE1A 2LVJA 1QIVA 3TDIA 3CLNA 1GJYA 1PVAA 5DKQA 4OV2A 3I5HB 1GGWA 1SYMA 1YUTA 1PVBA 2LMTA 3PM8A 1KSMA 2L98A 1CFFA 5DKRA 1QXPA 1YURA 3IF7A 1NWDA 4NDDA 4AOMA 1H8BA 3BUOB 2L4IA 1LA0A 1ZMZA 4MRYA 2LUXA 1RJVA 4XJKA 1UHIA 1F4QA 2M1KB 1SMGA 3LK0A 1SL8A 1CKKA 3KPXA 1AUIB 1BR4B 2BKHB 1SNLA 2JTZA 2JNXA 4HRHA 2QPTA 1J55A 1NP8A 1BR1B 1NX2A 1FI5A 3JTDC 5B8IB 1WRKA 4I5LB 4NDCA 1BLQA 2LNKA 1F71A 2TN4A 1XK4C 1BMOA 1NUBA 2WCFA 2LHLA 1BU3A 2WCEA 5CSFA 4WQ3A 5FYXA 1NX3A 3NSOA 1CDNA 1CMFA 3SIBA 1K2HA 3BUNB 4JQ0D 3EK8A 3BQ3A 1TNPA 2KI4B 2FCDA 3OB1B 3WHTB 1AJ4A 1PULA 3KF9A 5J3XA 3VRRA 1XFWO 4CIDA 3O2PA 2PSRA 1B8CA 2IS9A 4YGCB 1BJFA 5AFPA 3RLZA 3DF0B 2VRGA 2Y5IA 3EVVA 2HPSA 2BE6A 3LK1A 1J7PA 1KFUL 3D0YB 2PRUA 1UHNA 2CCMA 5KTYA 3OB2B 1C7VA 1U5IA 1SR6C 2I94A 1IQ3A 1YUSA 1KK8B 1KK7Y 1YUUA 4N1FA 1CB1A 1JF0A 4AQJA 3OHMB 4MZJA 1M31A 3GK1A 4UPGA 3A4UB 1XYDA 2OS8C 2K0JA 1MWNA 1SCMC 2L0PA 2L50A 2LLSA 2QACA 1OZSA 1XFUO 2CT9A 1MXLC 3F45A 2M1UA 3HX4A 1RWYA 3EKJA 4YGDB 5K89A 3OX5A 5HKYA 3BXKA 2NCPA 3MSEB 1NCZA 2I7AA 2KI6D 1QVIZ 1QS7A 4GNKB 2KQ6A 4CFRA 2ZN9A 2E30A 2ZNEA 3D10A 2F3ZA 1EG3A 2JXLA 1M63B 2I2RE 2LVVA 2GGMA 4MBEA 1LKJA 1QX7A 1NX1A 2G2BA 2Q91A 1WRLA 3EKHA 1CDLA 2LP3A 2JNFA 2Y4QA 1L2OB 1DJIA 1L7ZA 1Y0VH 1J7RA 1TIZA 1YVHA 4XJKB 4MLWA 1LVCD 1OSAA 1SCVA 1YX8A 1DJYA 2KI6C 2F3YA 4I5KA 4YGEB 1TNXA 4PHNA 3O4YA 3FIAA 1S3PA 2LHIA 2LM5A 1EJ3A 3EK4A 4OCIA 1F8HA 1OOJA 2JT8A 3K21A 4DIRA 1NX0A 2EC6C 1RECA 2MRDA 1K94A 1K8UA 1DJXA 5HKZA 2KNEA 1SY9A 2K7OA 2O5GA 2LANA 4GGFC 1WDCB 3DVMA 4P2YB 1A75A 1G8IA 3DVJA 3FWBA 2Q4UA 4MRXA 3QRXA 1NCXA 1XFVO 2JPTA 1BT6A 2AAOA 2FCEA 3FWCA 4L9MA 3AKBA 2F33A 1QIWA 3BUXB 4GGNA 4PHMA 2WCBA 2LMUA 4DS7A 1NIWA 2HQ8A 4OVNF 1B8RA 5CSNA 5I8NA 1B7TZ 3GK2A 2KBMA 2NCOA 2R2IA 3SG3A 1RTP1 1F70A 2KFFA 2M29A 5HLVA 1K9KA 4FTGA 3VRNA 3TZ1A 4PHKA 3VRQA 3JVTB 1S5GZ 1F4OA 2E6WA 1OE9B 2M9GA 1IJ5A 1PSBA 1M39A 1ZFSA 2FJUB 1K9UA 2O60A 3CR4X 3I5IC 3LLEA 4M2OA 5AANA 3SG4A 3SG7A 2JT3A 1XK4A 2B1UA 1DJWA 2LAPA 1DTLA 1MXEA 1CLLA 2RGIA 3WNXB 1KQMB 1B8LA 2OTGC 1DJHA 2LUCA 2D8NA 5G08A 2MLFC 3NSKA 1TN4A 1QV1A 1U5IB 1J7OA 4N5XA 3IQOA 4OR9B 4JPZB 1WLMA 3DVKA 1OMRA 4M2PA 1JSAA 1A2XA 3I5HC 3O6BA 1CTRA 3PN7B 5TNCA 1CLMA 1JC2A 3TDUA 3EK7A 1AVSA 2KAXA 2M7LA 1WDCC 2LLTA 4AQIA 2F2PA 2V53A 1ZUZA 1QTXA 2BL0B 2GV5A 2KDHA 1PK0D 1PRWA 2LMVA 4MEWA 4MVFA 3H4SE 1WY9A 3TS5B 1AHRA 5CPVA 1OQPA 1FPWA 1JUOA 2I18A 1MHOA 1WLZA 3I5FB 1EL4A 2M97A 4PDZA 2K7CA 3EVUA 3CS1A 1Y1XA 1FBVA 2Y1MA 2PVBA 2F2OA 1QV0A 3PLFB 1XFZO 4CLNA 2BCBA 1NYAA 4OKHA 5AXIA 5AEQA 1JBAA 1DJGA 1WRZA 2KYFA 1KWOB 2P6BB 4PCWA 1A4PA 1DJZA 1UP5A 2EHBA 3PATA 1IRJA 1K95A 3VGOA 1B4CA 2AMIA 1IH0A 1KFXL 2CTNA 4GFTA 1SKTA 1JFKA 1TCFA 5I2OA 2BCAA 1DF0B 1G4YR 1CFDA 1F54A 1YRUB 2LVKA 2PMYA 4N1GA 3TUYB 1CFCA 1K90D 2SCPA 2WC8A 4IL1A 2PALA 4P5OE 4YRUA 2KBIA 1QVIY 2BBNA 1ZACA 2A4JA 4A4CA 1XFXO 3AAJA 4TNCA 2MLEC 5ER4X 5ER5A 1OMDA 2KI4C 3NSLA 4C0KA 2HQWA 2ZFDA 4E68A 4XYNA 2BKIB 1GQMA 5AERA 3GOFA 4I5JA 1KCYA 3LCPC 1A75B 4MN0A 4CPVA 2ZN8A 2M49B 1CM4A 1SRAA 2BL0C 4HRGA 1A03A 2JRFA 1C07A 2KAVA 2K7BA 1B1GA 2H61C 4A4BA 2BE4A 3FS7A 1KQVA 1N2DA 3CZTX 4D1EA 3I5FC 3D0YA 3BYAA 3I5GB 5JJGA 4WRIA 2M7NA 1M46A 4MZKA 1IG5A 3KO0A 3SG5A 1J1DA 1CLBA 1NPQA 1ODBA 1BG1A 1Y1UA 2K2FA 4FQOA 1KK8C 4ETOA 1MQ1A 5CSJA 2OPOA 4HSZA 2KGRA 4C0LA 2KOTA 1OMVA 1CM1A 3IQQA 4YI9A 4YI8A 1KWOC 2FOTA 2KFGA 1J1EA 4GGFA 1SK6D 2COLB 3DD4A 1B9AA 2K61A 1QLKA 1PSRA 2M0RA 1LXFC 2KAYA 1UUSA 2JC2A 2L4HA 1LINA 1RK9A 1ALWA 1V1FA 5BPJA 4U8DA 2JQ6A 4DUQA 1QJTA 2L51A 1PALA 5D7FA 3SJSA 1BF5A 3OX6A 4GAOA 3CGAA 4M2QA 2K7DA 4ICBA 3ZWHA 4CFQA 4DRWA 1Y6WA 2Y1NA 5KU1A 2M8UA 5PALA 3OP0A 1FF1A 2H2KA 1J7QA 4DCKA 3LL8B 1DVIA 3BUWB 4HREE 2HETA 1IWQA 1S5GY 4BY4A 3BOWA 2MHHA 2G9BA 2ZRTA 2JULA 2KQYA 2MAZA 2NXQA 1IJ6A 1DGVA 4ZCVA 1Y1AA 1L2OC 1GGZA 2ZKMX 3HCMA 1IQ5A 1ALVA 1FW4A 2GGZA 1EXRA 2JT0A 2MJWB 1S26D 2EGDA 3I5GC 3C1VA 4PE4A 4WQ2A 4QJ5B 1CNPA 2HF5A 2WORA 1NCYA 1S6IA 2JZIA 1SR6B 1RFJA 1YRTB 1QATA 2L2EA 4PE0A 2DOQA 1D1OA 1UHHA 1TCOB 1S6JA 3M0WA 4ORBB 5D69A 4ZCUA 5KSZA 1ZOTB 2KFHA 1BODA 2NZ0A 5IBWA 1QX2A 2OS8B 3BUMB 3VRPA 4I5NB 1SCMB 1SBJA 2BECA 1XFYO 3VROA 1KFUS 1SL9A 1G33A 1BOCA 3EVRA 2CXJA 1SPYA 1VRKA 1R6PA 4YGAA 1TNQA 1R2UA 2CBLA 1CFPA 2MA2A 1K9PA 1W7JB 1SW8A 2SASA 1A29A 2LE9B 2K8MB 1MR8A 1NSHA 3ICBA 5CSIA 1S6CA 2ZRSA 1YX7A 1CMGA 1EH2A 1XO5A 1DGUA 4YGBB 1QASA 1KFXS 1OZOA 3RM1A 1DMOA 1QX5B 4GBAA 3SIAA 2L5XB 2PASA 1F55A 5F6TA 1UURA 3KEVA 1TOPA 1X02A 3JVTC 2AUCA 1M45A 1UHJA 3PALA 3DVEA 4GUKA 2LLUA 1HT9A 4PALA 2NLNA 1DT7B 3O78A 2JOJA 2JWWA 2CNPA 4MZLA 1AK8A 2K2AA 1KQMC 2JTTA 1K93D 2LC5A 3PFVA 4USLA 3CR5X 2WNDA 1JF2A 4NQGA 1MF8B 1W7IB 1KK7Z 1B47A 2EC6B 1S1EA 1HQVA 1E8AA 3CR2A 5I2QA 1JWDA 1UWOA 2BBMA 3AAKA 1H4BA 1FI6A 4ORCB 4YBHB 3PN7C 1RROA 2LV7A 4R1EA 1SL7A 4MSPA 3GK4X 3KHEA 1C7WA 1V1GA 2KSPA 4GPLB 1K96A 1CDPA 2JU0A 2LCPA 2F8PA 4JWQA 1AP4A 3PSRA 1IGVA 1KSOA 2H61A 1YTZC 3DF0A 2KHNA 4NDBA 3TS5C 4BY5A 1Q80A 2M3WA 1AJ5A 3TDZA 1EG4A 1N65A 3WHUB 1TNWA 1LA3A 4QJ3B 3CTNA 5GQQC 2ISDA 2KGBC 3CWGA 3SG6A 2ZNDA 1S36A 5HLOA 5HKWA 1YR5A 1YVLA 3AKAA 1JFJA 2JXCA 3BOWB 1QLSA 3SG2A 3JTDB 2LVIA 3I5IB 3WXAA 1XA5A
chains in the Genus database with same CATH superfamily
1CDMA 3NSIA 2WOSA 1N0YA 3E3RA 1TRFA 4PE7A 5DKNA 3R1OA 3NXAA 4PHJA 5I2LA 2BCXA 5JOLA 4F0ZB 1IKUA 4Q04A 2LP2A 2MBXA 2OTGB 1TTXA 4C0JA 1DF0A 2KYCA 1GM0A 1MUXA 3A8RA 3ZNIA 3TUYC 1Z4HA 1B7TY 4ORAB 1XVJA 1UHKA 2KLDA 4INXA 4QJ4B 4PE1A 5HYDA 2LVJA 1QIVA 3TDIA 3B87A 3CLNA 1GJYA 1PVAA 5DKQA 4OV2A 3I5HB 1GGWA 2FJYA 1SYMA 3N7HA 1YUTA 1PVBA 3B6XA 1P28A 2LMTA 3PM8A 1KSMA 2L98A 1CFFA 5DKRA 1QXPA 1YURA 3IF7A 5I94A 1NWDA 4NDDA 4AOMA 1H8BA 1XFRA 3BUOB 2L4IA 1LA0A 3B86A 3OBVA 3CZ0A 1ZMZA 3D77A 2LUXA 4MRYA 3Q8IA 1RJVA 4XJKA 1UHIA 1F4QA 3VB1A 2M1KB 1SMGA 2L2CA 3LK0A 1SL8A 1CKKA 3KPXA 1AUIB 3BJHA 1BR4B 2BKHB 1SNLA 3R1VA 3SS5A 2JTZA 2JNXA 4HRHA 2QPTA 1J55A 3UNWA 1NP8A 1BR1B 1NX2A 1FI5A 1DC1A 3D73A 3JTDC 5B8IB 1WRKA 4I5LB 4NDCA 1BLQA 2LNKA 1F71A 2TN4A 1XK4C 1OOIX 1BMOA 1NUBA 2PYQA 2WCFA 4IJ7A 2LHLA 1BU3A 2WCEA 5CSFA 4JKTA 4PT1A 4WQ3A 5FYXA 1NX3A 3NSOA 1CDNA 1CMFA 3SIBA 1K2HA 3BUNB 4JQ0D 3O4XA 3EK8A 3BQ3A 1TNPA 2KI4B 2FCDA 3OB1B 3WHTB 1AJ4A 1PULA 1SSEB 3KF9A 5J3XA 3VRRA 1XFWO 4CIDA 1QWVA 3O2PA 2PSRA 1B8CA 2IS9A 4YGCB 2BAPA 1BJFA 5AFPA 3RLZA 3DF0B 2VRGA 2Y5IA 3FE9A 3EVVA 3S0GA 2HPSA 2BE6A 3LK1A 3NHTA 1J7PA 1KFUL 3D0YB 2PRUA 3BFHA 1UHNA 2CCMA 3DXLA 5KTYA 3OB2B 1C7VA 3D76A 1U5IA 1SR6C 2I94A 2L5YA 1YUSA 1IQ3A 1KK8B 1KK7Y 1YUUA 4N1FA 1CB1A 1JF0A 5HL1A 4AQJA 3OHMB 4MZJA 1M31A 1Z2CB 3GK1A 4UPGA 3A4UB 4OZDA 1XYDA 2OS8C 2K0JA 1MWNA 4FQTA 1SCMC 2L0PA 2L50A 2LLSA 2QACA 1OZSA 1IIOA 1XFUO 2CT9A 1MXLC 2WCMA 3F45A 2M1UA 3HX4A 3CDNA 1RWYA 3EKJA 1W9ZA 4YGDB 5K89A 3OX5A 5HKYA 3BXKA 2NCPA 3MSEB 1NCZA 2I7AA 2KI6D 1QVIZ 1QS7A 4GNKB 2KQ6A 4CFRA 2ZN9A 2E30A 2ZNEA 3D10A 2F3ZA 2BNXA 1EG3A 3L4AA 2JXLA 1M63B 2I2RE 2LVVA 2GGMA 4JD9A 4MBEA 3CZ2A 1LKJA 3BFBA 1QX7A 1NX1A 2G2BA 2Q91A 1WRLA 3EKHA 1CDLA 2LP3A 2JNFA 2Y4QA 1L2OB 1DJIA 1L7ZA 1Y0VH 1J7RA 1TIZA 1YVHA 4XJKB 4MLWA 1LVCD 1OSAA 1SCVA 1YX8A 2ERBA 1DJYA 2KI6C 3EG5B 2F3YA 4I5KA 4YGEB 1TNXA 4PHNA 3O4YA 3FIAA 3SS3A 1S3PA 2LHIA 2LM5A 1EJ3A 3EK4A 4OCIA 1F8HA 1OOJA 2WCHA 2JT8A 3K21A 4DIRA 1NX0A 2EC6C 5FI2A 1RECA 2MRDA 1K94A 1K8UA 1DJXA 5HKZA 1LS8A 2KNEA 1SY9A 2K7OA 2O5GA 2LANA 4GGFC 1WDCB 3DVMA 4P2YB 1A75A 1G8IA 3DVJA 3FWBA 1OOGA 2Q4UA 3QRXA 4MRXA 1NCXA 1XFVO 2JPTA 1BT6A 2AAOA 2FCEA 3FWCA 4L9MA 3L47A 3AKBA 2F33A 1QIWA 3BUXB 4GGNA 4PHMA 2WCBA 2LMUA 4DS7A 1NIWA 2HQ8A 4OVNF 1B8RA 5CSNA 5I8NA 1B7TZ 2H8VA 3GK2A 2KBMA 2NCOA 2R2IA 2P71A 3SG3A 1RTP1 1F70A 5EL2A 2KFFA 2M29A 5HLVA 1K9KA 4FTGA 3VRNA 3TZ1A 2JPOA 4PHKA 3VRQA 3JVTB 1S5GZ 1F4OA 2E6WA 1OE9B 2M9GA 1IJ5A 1PSBA 1M39A 1ZFSA 2FJUB 1K9UA 2O60A 3CR4X 3I5IC 3L4LA 3LLEA 4M2OA 5AANA 3SG4A 2JT3A 3SG7A 1XK4A 2B1UA 1DJWA 2LAPA 1DQEA 1DTLA 3CYZA 1MXEA 1CLLA 3B88A 2RGIA 3WNXB 1OOHA 1KQMB 1B8LA 2OTGC 1DJHA 2LUCA 2D8NA 3S0EA 5G08A 2MLFC 3NSKA 1TN4A 1QV1A 1U5IB 1J7OA 4N5XA 2YGUA 3IQOA 4OR9B 2PQLA 4JPZB 1WLMA 3DVKA 1OMRA 4M2PA 1JSAA 1A2XA 3I5HC 3O6BA 1CTRA 3PN7B 5TNCA 1CLMA 1JC2A 3TDUA 3EK7A 1AVSA 2KAXA 2M7LA 1WDCC 2LLTA 3CZ1A 2F2PA 4AQIA 2V53A 1ZUZA 1QTXA 2BL0B 2GV5A 2KDHA 5D3OA 1PK0D 1PRWA 2LMVA 4MEWA 4MVFA 3H4SE 1WY9A 3TS5B 1TUZA 3DY9A 1AHRA 5CPVA 1OQPA 1FPWA 1JUOA 2I18A 1MHOA 1WLZA 3I5FB 3RZSA 1EL4A 2M97A 4PDZA 2K7CA 3EVUA 3CS1A 1Y1XA 3S0DA 1FBVA 2Y1MA 3S0FA 2PVBA 2F2OA 1QV0A 3PLFB 1XFZO 4CLNA 2BCBA 2WC6A 1NYAA 4OKHA 5AXIA 5AEQA 1JBAA 1DJGA 1WRZA 2KYFA 1KWOB 2P6BB 4PCWA 1A4PA 1DJZA 1UP5A 3S0AA 2EHBA 3PATA 1IRJA 1K95A 3VGOA 1B4CA 2AMIA 1IH0A 1KFXL 2CTNA 4GFTA 1SKTA 2QEBA 1JFKA 1TCFA 5I2OA 2BCAA 1DF0B 1G4YR 1CFDA 1F54A 1YRUB 2LVKA 2PMYA 4N1GA 3TUYB 1CFCA 1K90D 2SCPA 2WC8A 4IL1A 2PALA 4P5OE 4YRUA 2KBIA 1QVIY 2BBNA 3R72A 1ZACA 2A4JA 4KYNA 4A4CA 1XFXO 3AAJA 4TNCA 2MLEC 5ER4X 5ER5A 1OMDA 2KI4C 1ORGA 3NSLA 4C0KA 2HQWA 2ZFDA 4E68A 3S0BA 4XYNA 2BKIB 1GQMA 5AERA 3GOFA 3PJIA 4I5JA 1KCYA 3FE8A 3LCPC 1A75B 3OGNA 4F7FA 4MN0A 4CPVA 2ZN8A 2M49B 1CM4A 1SRAA 2BL0C 4HRGA 1A03A 2JRFA 1C07A 2KAVA 3NHIA 2K7BA 1B1GA 2H61C 4A4BA 2BE4A 3FS7A 1KQVA 1N2DA 2WCJA 3CZTX 3PM2A 3I5FC 3D0YA 3BYAA 4D1EA 3I5GB 5JJGA 4WRIA 2M7NA 1M46A 4MZKA 1IG5A 3KO0A 3K1EA 1J1DA 3SG5A 1CLBA 1NPQA 1ODBA 1BG1A 1Y1UA 2K2FA 4FQOA 1KK8C 4ETOA 1MQ1A 5CSJA 3R1PA 2OPOA 4HSZA 2KGRA 4C0LA 2KOTA 1OMVA 1CM1A 3IQQA 4YI9A 4YI8A 1KWOC 2FOTA 2KFGA 1J1EA 4GGFA 1SK6D 2COLB 3DD4A 1B9AA 2K61A 1QLKA 1CNPA 1PSRA 1TWOA 2M0RA 1LXFC 2KAYA 1UUSA 2JC2A 2L4HA 1LINA 1RK9A 1ALWA 1V1FA 5BPJA 4U8DA 3NGVA 2JQ6A 4DUQA 1QJTA 2L51A 1PALA 2QEOA 3CABA 5D7FA 3SJSA 1BF5A 3OX6A 4GAOA 3CGAA 4M2QA 2K7DA 4ICBA 3ZWHA 4CFQA 4DRWA 1DELA 1Y6WA 2Y1NA 5KU1A 2M8UA 5PALA 3OP0A 1FF1A 2H2KA 1J7QA 4DCKA 2K60A 3LL8B 1DVIA 2P70A 3BUWB 4HREE 2HETA 1IWQA 1S5GY 4BY4A 3BOWA 1T14A 2G9BA 2MHHA 2ZRTA 2KPHA 2JULA 2KQYA 2MAZA 2NXQA 2QEVA 1IJ6A 1DGVA 4ZCVA 1Y1AA 1L2OC 1GGZA 2ZKMX 2KLEA 3HCMA 1IQ5A 2WC5A 1ALVA 1FW4A 2GGZA 1EXRA 2JT0A 2MJWB 1S26D 2EGDA 3I5GC 3C1VA 3D78A 4PE4A 4WQ2A 3UO9A 2HF5A 2WORA 1NCYA 1S6IA 2JZIA 4QJ5B 1SR6B 1RFJA 1YRTB 1QATA 2L2EA 4PE0A 2DOQA 1D1OA 1UHHA 1TCOB 1S6JA 3M0WA 4ORBB 5D69A 4ZCUA 5KSZA 3BFAA 1ZOTB 2KFHA 2QEHA 2NZ0A 5IBWA 1BODA 1QX2A 2OS8B 3BUMB 3V2LA 4I5NB 3VRPA 1SCMB 1SBJA 2BECA 1C3ZA 1XFYO 3VROA 1KFUS 1SL9A 1G33A 1BOCA 3EVRA 2CXJA 1SPYA 1VRKA 1R6PA 5DICA 4YGAA 1TNQA 1R2UA 2CBLA 1CFPA 3DYEA 2MA2A 1K9PA 1W7JB 3IVTA 1SW8A 2SASA 1A29A 2LE9B 2K8MB 1MR8A 1NSHA 3ICBA 5CSIA 1S6CA 2ZRSA 1YX7A 3FE6A 1DEKA 1CMGA 2QDIA 1EH2A 1TUJA 1XO5A 2WCKA 1DGUA 4YGBB 2GTEA 1QASA 1KFXS 1OZOA 3RM1A 1DMOA 1QX5B 4GBAA 3SIAA 2L5XB 2PASA 1F55A 5F6TA 1UURA 3KEVA 1TOPA 1X02A 3JVTC 3QMEA 2AUCA 1M45A 3B7AA 1UHJA 3PALA 3DVEA 4GUKA 2LLUA 1HT9A 4PALA 2NLNA 1DT7B 3O78A 2JOJA 2JWWA 2CNPA 1C3YA 4MZLA 3DZTA 1AK8A 2K2AA 1KQMC 2JTTA 1K93D 2LC5A 3PFVA 4USLA 3CR5X 2WNDA 1JF2A 1OOFA 4NQGA 3SS4A 1MF8B 1W7IB 1KK7Z 1B47A 2EC6B 1S1EA 1HQVA 1E8AA 3CR2A 5I2QA 1JWDA 1UWOA 2BBMA 3AAKA 1H4BA 1FI6A 4ORCB 4YBHB 5FI7A 3PN7C 1RROA 2LV7A 4R1EA 1SL7A 4MSPA 3GK4X 4INWA 3KHEA 1C7WA 1V1GA 2KSPA 1OW4A 4GPLB 1K96A 1CDPA 2JU0A 2LCPA 2F8PA 4JWQA 1AP4A 3PSRA 1IGVA 1KSOA 2H61A 1YTZC 3DF0A 2KHNA 4NDBA 3TS5C 4BY5A 3D74A 1Q80A 2M3WA 1AJ5A 3TDZA 1EG4A 3D75A 1N65A 3WHUB 1TNWA 1LA3A 4QJ3B 3CTNA 5GQQC 2ISDA 2KGBC 3CWGA 3SG6A 2ZNDA 1S36A 5HLOA 5HKWA 1YR5A 1YVLA 3AKAA 1JFJA 2JXCA 2WCLA 3BOWB 1QLSA 3SG2A 3JTDB 2LVIA 3I5IB 5FI6A 3WXAA 1XA5A
chains in the Genus database with same CATH topology
1CDMA 3NSIA 2WOSA 1N0YA 3E3RA 1TRFA 4PE7A 5DKNA 5I2LA 3NXAA 4PHJA 2BCXA 5JOLA 4F0ZB 1IKUA 4Q04A 2LP2A 2MBXA 2OTGB 1TTXA 4C0JA 1DF0A 2KYCA 1MUXA 3A8RA 3ZNIA 3TUYC 1B7TY 4ORAB 1XVJA 1UHKA 5HYDA 4QJ4B 4PE1A 2LVJA 1QIVA 3TDIA 3CLNA 1GJYA 1PVAA 5DKQA 4OV2A 3I5HB 1GGWA 1SYMA 1YUTA 1PVBA 2LMTA 3PM8A 1KSMA 2L98A 1CFFA 5DKRA 1QXPA 1YURA 3IF7A 1NWDA 4NDDA 4AOMA 1H8BA 3BUOB 2L4IA 1LA0A 1ZMZA 4MRYA 2LUXA 1RJVA 4XJKA 1UHIA 1F4QA 2M1KB 1SMGA 3LK0A 1SL8A 1CKKA 3KPXA 1AUIB 1BR4B 2BKHB 1SNLA 2JTZA 2JNXA 4HRHA 2QPTA 1J55A 1NP8A 1BR1B 1NX2A 1FI5A 3JTDC 5B8IB 1WRKA 4I5LB 4NDCA 1BLQA 2LNKA 1F71A 2TN4A 1XK4C 1BMOA 1NUBA 2WCFA 2LHLA 1BU3A 2WCEA 5CSFA 4WQ3A 5FYXA 1NX3A 3NSOA 1CDNA 1CMFA 3SIBA 1K2HA 3BUNB 4JQ0D 3EK8A 3BQ3A 1TNPA 2KI4B 2FCDA 3OB1B 3WHTB 1AJ4A 1PULA 3KF9A 5J3XA 3VRRA 1XFWO 4CIDA 3O2PA 2PSRA 1B8CA 2IS9A 4YGCB 1BJFA 5AFPA 3RLZA 3DF0B 2VRGA 2Y5IA 3EVVA 2HPSA 2BE6A 3LK1A 1J7PA 1KFUL 3D0YB 2PRUA 1UHNA 2CCMA 5KTYA 3OB2B 1C7VA 1U5IA 1SR6C 2I94A 1IQ3A 1YUSA 1KK8B 1KK7Y 1YUUA 4N1FA 1CB1A 1JF0A 4AQJA 3OHMB 4MZJA 1M31A 3GK1A 4UPGA 3A4UB 1XYDA 2OS8C 2K0JA 1MWNA 1SCMC 2L0PA 2L50A 2LLSA 2QACA 1OZSA 1XFUO 2CT9A 1MXLC 3F45A 2M1UA 3HX4A 1RWYA 3EKJA 4YGDB 5K89A 3OX5A 5HKYA 3BXKA 2NCPA 3MSEB 1NCZA 2I7AA 2KI6D 1QVIZ 1QS7A 4GNKB 2KQ6A 4CFRA 2ZN9A 2E30A 2ZNEA 3D10A 2F3ZA 1EG3A 2JXLA 1M63B 2I2RE 2LVVA 2GGMA 4MBEA 1LKJA 1QX7A 1NX1A 2G2BA 2Q91A 1WRLA 3EKHA 1CDLA 2LP3A 2JNFA 2Y4QA 1L2OB 1DJIA 1L7ZA 1Y0VH 1J7RA 1TIZA 1YVHA 4XJKB 4MLWA 1LVCD 1OSAA 1SCVA 1YX8A 1DJYA 2KI6C 2F3YA 4I5KA 4YGEB 1TNXA 4PHNA 3O4YA 3FIAA 1S3PA 2LHIA 2LM5A 1EJ3A 3EK4A 4OCIA 1F8HA 1OOJA 2JT8A 3K21A 4DIRA 1NX0A 2EC6C 1RECA 2MRDA 1K94A 1K8UA 1DJXA 5HKZA 2KNEA 1SY9A 2K7OA 2O5GA 2LANA 4GGFC 1WDCB 3DVMA 4P2YB 1A75A 1G8IA 3DVJA 3FWBA 2Q4UA 4MRXA 3QRXA 1NCXA 1XFVO 2JPTA 1BT6A 2AAOA 2FCEA 3FWCA 4L9MA 3AKBA 2F33A 1QIWA 3BUXB 4GGNA 4PHMA 2WCBA 2LMUA 4DS7A 1NIWA 2HQ8A 4OVNF 1B8RA 5CSNA 5I8NA 1B7TZ 3GK2A 2KBMA 2NCOA 2R2IA 3SG3A 1RTP1 1F70A 2KFFA 2M29A 5HLVA 1K9KA 4FTGA 3VRNA 3TZ1A 4PHKA 3VRQA 3JVTB 1S5GZ 1F4OA 2E6WA 1OE9B 2M9GA 1IJ5A 1PSBA 1M39A 1ZFSA 2FJUB 1K9UA 2O60A 3CR4X 3I5IC 3LLEA 4M2OA 5AANA 3SG4A 3SG7A 2JT3A 1XK4A 2B1UA 1DJWA 2LAPA 1DTLA 1MXEA 1CLLA 2RGIA 3WNXB 1KQMB 1B8LA 2OTGC 1DJHA 2LUCA 2D8NA 5G08A 2MLFC 3NSKA 1TN4A 1QV1A 1U5IB 1J7OA 4N5XA 3IQOA 4OR9B 4JPZB 1WLMA 3DVKA 1OMRA 4M2PA 1JSAA 1A2XA 3I5HC 3O6BA 1CTRA 3PN7B 5TNCA 1CLMA 1JC2A 3TDUA 3EK7A 1AVSA 2KAXA 2M7LA 1WDCC 2LLTA 4AQIA 2F2PA 2V53A 1ZUZA 1QTXA 2BL0B 2GV5A 2KDHA 1PK0D 1PRWA 2LMVA 4MEWA 4MVFA 3H4SE 1WY9A 3TS5B 1AHRA 5CPVA 1OQPA 1FPWA 1JUOA 2I18A 1MHOA 1WLZA 3I5FB 1EL4A 2M97A 4PDZA 2K7CA 3EVUA 3CS1A 1Y1XA 1FBVA 2Y1MA 2PVBA 2F2OA 1QV0A 3PLFB 1XFZO 4CLNA 2BCBA 1NYAA 4OKHA 5AXIA 5AEQA 1JBAA 1DJGA 1WRZA 2KYFA 1KWOB 2P6BB 4PCWA 1A4PA 1DJZA 1UP5A 2EHBA 3PATA 1IRJA 1K95A 3VGOA 1B4CA 2AMIA 1IH0A 1KFXL 2CTNA 4GFTA 1SKTA 1JFKA 1TCFA 5I2OA 2BCAA 1DF0B 1G4YR 1CFDA 1F54A 1YRUB 2LVKA 2PMYA 4N1GA 3TUYB 1CFCA 1K90D 2SCPA 2WC8A 4IL1A 2PALA 4P5OE 4YRUA 2KBIA 1QVIY 2BBNA 1ZACA 2A4JA 4A4CA 1XFXO 3AAJA 4TNCA 2MLEC 5ER4X 5ER5A 1OMDA 2KI4C 3NSLA 4C0KA 2HQWA 2ZFDA 4E68A 4XYNA 2BKIB 1GQMA 5AERA 3GOFA 4I5JA 1KCYA 3LCPC 1A75B 4MN0A 4CPVA 2ZN8A 2M49B 1CM4A 1SRAA 2BL0C 4HRGA 1A03A 2JRFA 1C07A 2KAVA 2K7BA 1B1GA 2H61C 4A4BA 2BE4A 3FS7A 1KQVA 1N2DA 3CZTX 4D1EA 3I5FC 3D0YA 3BYAA 3I5GB 5JJGA 4WRIA 2M7NA 1M46A 4MZKA 1IG5A 3KO0A 3SG5A 1J1DA 1CLBA 1NPQA 1ODBA 1BG1A 1Y1UA 2K2FA 4FQOA 1KK8C 4ETOA 1MQ1A 5CSJA 2OPOA 4HSZA 2KGRA 4C0LA 2KOTA 1OMVA 1CM1A 3IQQA 4YI9A 4YI8A 1KWOC 2FOTA 2KFGA 1J1EA 4GGFA 1SK6D 2COLB 3DD4A 1B9AA 2K61A 1QLKA 1PSRA 2M0RA 1LXFC 2KAYA 1UUSA 2JC2A 2L4HA 1LINA 1RK9A 1ALWA 1V1FA 5BPJA 4U8DA 2JQ6A 4DUQA 1QJTA 2L51A 1PALA 5D7FA 3SJSA 1BF5A 3OX6A 4GAOA 3CGAA 4M2QA 2K7DA 4ICBA 3ZWHA 4CFQA 4DRWA 1Y6WA 2Y1NA 5KU1A 2M8UA 5PALA 3OP0A 1FF1A 2H2KA 1J7QA 4DCKA 3LL8B 1DVIA 3BUWB 4HREE 2HETA 1IWQA 1S5GY 4BY4A 3BOWA 2MHHA 2G9BA 2ZRTA 2JULA 2KQYA 2MAZA 2NXQA 1IJ6A 1DGVA 4ZCVA 1Y1AA 1L2OC 1GGZA 2ZKMX 3HCMA 1IQ5A 1ALVA 1FW4A 2GGZA 1EXRA 2JT0A 2MJWB 1S26D 2EGDA 3I5GC 3C1VA 4PE4A 4WQ2A 4QJ5B 1CNPA 2HF5A 2WORA 1NCYA 1S6IA 2JZIA 1SR6B 1RFJA 1YRTB 1QATA 2L2EA 4PE0A 2DOQA 1D1OA 1UHHA 1TCOB 1S6JA 3M0WA 4ORBB 5D69A 4ZCUA 5KSZA 1ZOTB 2KFHA 1BODA 2NZ0A 5IBWA 1QX2A 2OS8B 3BUMB 3VRPA 4I5NB 1SCMB 1SBJA 2BECA 1XFYO 3VROA 1KFUS 1SL9A 1G33A 1BOCA 3EVRA 2CXJA 1SPYA 1VRKA 1R6PA 4YGAA 1TNQA 1R2UA 2CBLA 1CFPA 2MA2A 1K9PA 1W7JB 1SW8A 2SASA 1A29A 2LE9B 2K8MB 1MR8A 1NSHA 3ICBA 5CSIA 1S6CA 2ZRSA 1YX7A 1CMGA 1EH2A 1XO5A 1DGUA 4YGBB 1QASA 1KFXS 1OZOA 3RM1A 1DMOA 1QX5B 4GBAA 3SIAA 2L5XB 2PASA 1F55A 5F6TA 1UURA 3KEVA 1TOPA 1X02A 3JVTC 2AUCA 1M45A 1UHJA 3PALA 3DVEA 4GUKA 2LLUA 1HT9A 4PALA 2NLNA 1DT7B 3O78A 2JOJA 2JWWA 2CNPA 4MZLA 1AK8A 2K2AA 1KQMC 2JTTA 1K93D 2LC5A 3PFVA 4USLA 3CR5X 2WNDA 1JF2A 4NQGA 1MF8B 1W7IB 1KK7Z 1B47A 2EC6B 1S1EA 1HQVA 1E8AA 3CR2A 5I2QA 1JWDA 1UWOA 2BBMA 3AAKA 1H4BA 1FI6A 4ORCB 4YBHB 3PN7C 1RROA 2LV7A 4R1EA 1SL7A 4MSPA 3GK4X 3KHEA 1C7WA 1V1GA 2KSPA 4GPLB 1K96A 1CDPA 2JU0A 2LCPA 2F8PA 4JWQA 1AP4A 3PSRA 1IGVA 1KSOA 2H61A 1YTZC 3DF0A 2KHNA 4NDBA 3TS5C 4BY5A 1Q80A 2M3WA 1AJ5A 3TDZA 1EG4A 1N65A 3WHUB 1TNWA 1LA3A 4QJ3B 3CTNA 5GQQC 2ISDA 2KGBC 3CWGA 3SG6A 2ZNDA 1S36A 5HLOA 5HKWA 1YR5A 1YVLA 3AKAA 1JFJA 2JXCA 3BOWB 1QLSA 3SG2A 3JTDB 2LVIA 3I5IB 3WXAA 1XA5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CDM A;  3NSI A;  2WOS A;  1N0Y A;  3E3R A;  1TRF A;  4PE7 A;  5DKN A;  5I2L A;  3NXA A;  4PHJ A;  2BCX A;  5JOL A;  4F0Z B;  1IKU A;  4Q04 A;  2LP2 A;  2MBX A;  2OTG B;  1TTX A;  4C0J A;  1DF0 A;  2KYC A;  1MUX A;  3A8R A;  3ZNI A;  3TUY C;  1B7T Y;  4ORA B;  1XVJ A;  1UHK A;  5HYD A;  4QJ4 B;  4PE1 A;  2LVJ A;  1QIV A;  3TDI A;  3CLN A;  1GJY A;  1PVA A;  5DKQ A;  4OV2 A;  3I5H B;  1GGW A;  1SYM A;  1YUT A;  1PVB A;  2LMT A;  3PM8 A;  1KSM A;  2L98 A;  1CFF A;  5DKR A;  1QXP A;  1YUR A;  3IF7 A;  1NWD A;  4NDD A;  4AOM A;  1H8B A;  3BUO B;  2L4I A;  1LA0 A;  1ZMZ A;  4MRY A;  2LUX A;  1RJV A;  4XJK A;  1UHI A;  1F4Q A;  2M1K B;  1SMG A;  3LK0 A;  1SL8 A;  1CKK A;  3KPX A;  1AUI B;  1BR4 B;  2BKH B;  1SNL A;  2JTZ A;  2JNX A;  4HRH A;  2QPT A;  1J55 A;  1NP8 A;  1BR1 B;  1NX2 A;  1FI5 A;  3JTD C;  5B8I B;  1WRK A;  4I5L B;  4NDC A;  1BLQ A;  2LNK A;  1F71 A;  2TN4 A;  1XK4 C;  1BMO A;  1NUB A;  2WCF A;  2LHL A;  1BU3 A;  2WCE A;  5CSF A;  4WQ3 A;  5FYX A;  1NX3 A;  3NSO A;  1CDN A;  1CMF A;  3SIB A;  1K2H A;  3BUN B;  4JQ0 D;  3EK8 A;  3BQ3 A;  1TNP A;  2KI4 B;  2FCD A;  3OB1 B;  3WHT B;  1AJ4 A;  1PUL A;  3KF9 A;  5J3X A;  3VRR A;  1XFW O;  4CID A;  3O2P A;  2PSR A;  1B8C A;  2IS9 A;  4YGC B;  1BJF A;  5AFP A;  3RLZ A;  3DF0 B;  2VRG A;  2Y5I A;  3EVV A;  2HPS A;  2BE6 A;  3LK1 A;  1J7P A;  1KFU L;  3D0Y B;  2PRU A;  1UHN A;  2CCM A;  5KTY A;  3OB2 B;  1C7V A;  1U5I A;  1SR6 C;  2I94 A;  1IQ3 A;  1YUS A;  1KK8 B;  1KK7 Y;  1YUU A;  4N1F A;  1CB1 A;  1JF0 A;  4AQJ A;  3OHM B;  4MZJ A;  1M31 A;  3GK1 A;  4UPG A;  3A4U B;  1XYD A;  2OS8 C;  2K0J A;  1MWN A;  1SCM C;  2L0P A;  2L50 A;  2LLS A;  2QAC A;  1OZS A;  1XFU O;  2CT9 A;  1MXL C;  3F45 A;  2M1U A;  3HX4 A;  1RWY A;  3EKJ A;  4YGD B;  5K89 A;  3OX5 A;  5HKY A;  3BXK A;  2NCP A;  3MSE B;  1NCZ A;  2I7A A;  2KI6 D;  1QVI Z;  1QS7 A;  4GNK B;  2KQ6 A;  4CFR A;  2ZN9 A;  2E30 A;  2ZNE A;  3D10 A;  2F3Z A;  1EG3 A;  2JXL A;  1M63 B;  2I2R E;  2LVV A;  2GGM A;  4MBE A;  1LKJ A;  1QX7 A;  1NX1 A;  2G2B A;  2Q91 A;  1WRL A;  3EKH A;  1CDL A;  2LP3 A;  2JNF A;  2Y4Q A;  1L2O B;  1DJI A;  1L7Z A;  1Y0V H;  1J7R A;  1TIZ A;  1YVH A;  4XJK B;  4MLW A;  1LVC D;  1OSA A;  1SCV A;  1YX8 A;  1DJY A;  2KI6 C;  2F3Y A;  4I5K A;  4YGE B;  1TNX A;  4PHN A;  3O4Y A;  3FIA A;  1S3P A;  2LHI A;  2LM5 A;  1EJ3 A;  3EK4 A;  4OCI A;  1F8H A;  1OOJ A;  2JT8 A;  3K21 A;  4DIR A;  1NX0 A;  2EC6 C;  1REC A;  2MRD A;  1K94 A;  1K8U A;  1DJX A;  5HKZ A;  2KNE A;  1SY9 A;  2K7O A;  2O5G A;  2LAN A;  4GGF C;  1WDC B;  3DVM A;  4P2Y B;  1A75 A;  1G8I A;  3DVJ A;  3FWB A;  2Q4U A;  4MRX A;  3QRX A;  1NCX A;  1XFV O;  2JPT A;  1BT6 A;  2AAO A;  2FCE A;  3FWC A;  4L9M A;  3AKB A;  2F33 A;  1QIW A;  3BUX B;  4GGN A;  4PHM A;  2WCB A;  2LMU A;  4DS7 A;  1NIW A;  2HQ8 A;  4OVN F;  1B8R A;  5CSN A;  5I8N A;  1B7T Z;  3GK2 A;  2KBM A;  2NCO A;  2R2I A;  3SG3 A;  1RTP 1;  1F70 A;  2KFF A;  2M29 A;  5HLV A;  1K9K A;  4FTG A;  3VRN A;  3TZ1 A;  4PHK A;  3VRQ A;  3JVT B;  1S5G Z;  1F4O A;  2E6W A;  1OE9 B;  2M9G A;  1IJ5 A;  1PSB A;  1M39 A;  1ZFS A;  2FJU B;  1K9U A;  2O60 A;  3CR4 X;  3I5I C;  3LLE A;  4M2O A;  5AAN A;  3SG4 A;  3SG7 A;  2JT3 A;  1XK4 A;  2B1U A;  1DJW A;  2LAP A;  1DTL A;  1MXE A;  1CLL A;  2RGI A;  3WNX B;  1KQM B;  1B8L A;  2OTG C;  1DJH A;  2LUC A;  2D8N A;  5G08 A;  2MLF C;  3NSK A;  1TN4 A;  1QV1 A;  1U5I B;  1J7O A;  4N5X A;  3IQO A;  4OR9 B;  4JPZ B;  1WLM A;  3DVK A;  1OMR A;  4M2P A;  1JSA A;  1A2X A;  3I5H C;  3O6B A;  1CTR A;  3PN7 B;  5TNC A;  1CLM A;  1JC2 A;  3TDU A;  3EK7 A;  1AVS A;  2KAX A;  2M7L A;  1WDC C;  2LLT A;  4AQI A;  2F2P A;  2V53 A;  1ZUZ A;  1QTX A;  2BL0 B;  2GV5 A;  2KDH A;  1PK0 D;  1PRW A;  2LMV A;  4MEW A;  4MVF A;  3H4S E;  1WY9 A;  3TS5 B;  1AHR A;  5CPV A;  1OQP A;  1FPW A;  1JUO A;  2I18 A;  1MHO A;  1WLZ A;  3I5F B;  1EL4 A;  2M97 A;  4PDZ A;  2K7C A;  3EVU A;  3CS1 A;  1Y1X A;  1FBV A;  2Y1M A;  2PVB A;  2F2O A;  1QV0 A;  3PLF B;  1XFZ O;  4CLN A;  2BCB A;  1NYA A;  4OKH A;  5AXI A;  5AEQ A;  1JBA A;  1DJG A;  1WRZ A;  2KYF A;  1KWO B;  2P6B B;  4PCW A;  1A4P A;  1DJZ A;  1UP5 A;  2EHB A;  3PAT A;  1IRJ A;  1K95 A;  3VGO A;  1B4C A;  2AMI A;  1IH0 A;  1KFX L;  2CTN A;  4GFT A;  1SKT A;  1JFK A;  1TCF A;  5I2O A;  2BCA A;  1DF0 B;  1G4Y R;  1CFD A;  1F54 A;  1YRU B;  2LVK A;  2PMY A;  4N1G A;  3TUY B;  1CFC A;  1K90 D;  2SCP A;  2WC8 A;  4IL1 A;  2PAL A;  4P5O E;  4YRU A;  2KBI A;  1QVI Y;  2BBN A;  1ZAC A;  2A4J A;  4A4C A;  1XFX O;  3AAJ A;  4TNC A;  2MLE C;  5ER4 X;  5ER5 A;  1OMD A;  2KI4 C;  3NSL A;  4C0K A;  2HQW A;  2ZFD A;  4E68 A;  4XYN A;  2BKI B;  1GQM A;  5AER A;  3GOF A;  4I5J A;  1KCY A;  3LCP C;  1A75 B;  4MN0 A;  4CPV A;  2ZN8 A;  2M49 B;  1CM4 A;  1SRA A;  2BL0 C;  4HRG A;  1A03 A;  2JRF A;  1C07 A;  2KAV A;  2K7B A;  1B1G A;  2H61 C;  4A4B A;  2BE4 A;  3FS7 A;  1KQV A;  1N2D A;  3CZT X;  4D1E A;  3I5F C;  3D0Y A;  3BYA A;  3I5G B;  5JJG A;  4WRI A;  2M7N A;  1M46 A;  4MZK A;  1IG5 A;  3KO0 A;  3SG5 A;  1J1D A;  1CLB A;  1NPQ A;  1ODB A;  1BG1 A;  1Y1U A;  2K2F A;  4FQO A;  1KK8 C;  4ETO A;  1MQ1 A;  5CSJ A;  2OPO A;  4HSZ A;  2KGR A;  4C0L A;  2KOT A;  1OMV A;  1CM1 A;  3IQQ A;  4YI9 A;  4YI8 A;  1KWO C;  2FOT A;  2KFG A;  1J1E A;  4GGF A;  1SK6 D;  2COL B;  3DD4 A;  1B9A A;  2K61 A;  1QLK A;  1PSR A;  2M0R A;  1LXF C;  2KAY A;  1UUS A;  2JC2 A;  2L4H A;  1LIN A;  1RK9 A;  1ALW A;  1V1F A;  5BPJ A;  4U8D A;  2JQ6 A;  4DUQ A;  1QJT A;  2L51 A;  1PAL A;  5D7F A;  3SJS A;  1BF5 A;  3OX6 A;  4GAO A;  3CGA A;  4M2Q A;  2K7D A;  4ICB A;  3ZWH A;  4CFQ A;  4DRW A;  1Y6W A;  2Y1N A;  5KU1 A;  2M8U A;  5PAL A;  3OP0 A;  1FF1 A;  2H2K A;  1J7Q A;  4DCK A;  3LL8 B;  1DVI A;  3BUW B;  4HRE E;  2HET A;  1IWQ A;  1S5G Y;  4BY4 A;  3BOW A;  2MHH A;  2G9B A;  2ZRT A;  2JUL A;  2KQY A;  2MAZ A;  2NXQ A;  1IJ6 A;  1DGV A;  4ZCV A;  1Y1A A;  1L2O C;  1GGZ A;  2ZKM X;  3HCM A;  1IQ5 A;  1ALV A;  1FW4 A;  2GGZ A;  1EXR A;  2JT0 A;  2MJW B;  1S26 D;  2EGD A;  3I5G C;  3C1V A;  4PE4 A;  4WQ2 A;  4QJ5 B;  1CNP A;  2HF5 A;  2WOR A;  1NCY A;  1S6I A;  2JZI A;  1SR6 B;  1RFJ A;  1YRT B;  1QAT A;  2L2E A;  4PE0 A;  2DOQ A;  1D1O A;  1UHH A;  1TCO B;  1S6J A;  3M0W A;  4ORB B;  5D69 A;  4ZCU A;  5KSZ A;  1ZOT B;  2KFH A;  1BOD A;  2NZ0 A;  5IBW A;  1QX2 A;  2OS8 B;  3BUM B;  3VRP A;  4I5N B;  1SCM B;  1SBJ A;  2BEC A;  1XFY O;  3VRO A;  1KFU S;  1SL9 A;  1G33 A;  1BOC A;  3EVR A;  2CXJ A;  1SPY A;  1VRK A;  1R6P A;  4YGA A;  1TNQ A;  1R2U A;  2CBL A;  1CFP A;  2MA2 A;  1K9P A;  1W7J B;  1SW8 A;  2SAS A;  1A29 A;  2LE9 B;  2K8M B;  1MR8 A;  1NSH A;  3ICB A;  5CSI A;  1S6C A;  2ZRS A;  1YX7 A;  1CMG A;  1EH2 A;  1XO5 A;  1DGU A;  4YGB B;  1QAS A;  1KFX S;  1OZO A;  3RM1 A;  1DMO A;  1QX5 B;  4GBA A;  3SIA A;  2L5X B;  2PAS A;  1F55 A;  5F6T A;  1UUR A;  3KEV A;  1TOP A;  1X02 A;  3JVT C;  2AUC A;  1M45 A;  1UHJ A;  3PAL A;  3DVE A;  4GUK A;  2LLU A;  1HT9 A;  4PAL A;  2NLN A;  1DT7 B;  3O78 A;  2JOJ A;  2JWW A;  2CNP A;  4MZL A;  1AK8 A;  2K2A A;  1KQM C;  2JTT A;  1K93 D;  2LC5 A;  3PFV A;  4USL A;  3CR5 X;  2WND A;  1JF2 A;  4NQG A;  1MF8 B;  1W7I B;  1KK7 Z;  1B47 A;  2EC6 B;  1S1E A;  1HQV A;  1E8A A;  3CR2 A;  5I2Q A;  1JWD A;  1UWO A;  2BBM A;  3AAK A;  1H4B A;  1FI6 A;  4ORC B;  4YBH B;  3PN7 C;  1RRO A;  2LV7 A;  4R1E A;  1SL7 A;  4MSP A;  3GK4 X;  3KHE A;  1C7W A;  1V1G A;  2KSP A;  4GPL B;  1K96 A;  1CDP A;  2JU0 A;  2LCP A;  2F8P A;  4JWQ A;  1AP4 A;  3PSR A;  1IGV A;  1KSO A;  2H61 A;  1YTZ C;  3DF0 A;  2KHN A;  4NDB A;  3TS5 C;  4BY5 A;  1Q80 A;  2M3W A;  1AJ5 A;  3TDZ A;  1EG4 A;  1N65 A;  3WHU B;  1TNW A;  1LA3 A;  4QJ3 B;  3CTN A;  5GQQ C;  2ISD A;  2KGB C;  3CWG A;  3SG6 A;  2ZND A;  1S36 A;  5HLO A;  5HKW A;  1YR5 A;  1YVL A;  3AKA A;  1JFJ A;  2JXC A;  3BOW B;  1QLS A;  3SG2 A;  3JTD B;  2LVI A;  3I5I B;  3WXA A;  1XA5 A; 
#chains in the Genus database with same CATH topology
 1CDM A;  3NSI A;  2WOS A;  1N0Y A;  3E3R A;  1TRF A;  4PE7 A;  5DKN A;  3R1O A;  3NXA A;  4PHJ A;  5I2L A;  2BCX A;  5JOL A;  4F0Z B;  1IKU A;  4Q04 A;  2LP2 A;  2MBX A;  2OTG B;  1TTX A;  4C0J A;  1DF0 A;  2KYC A;  1GM0 A;  1MUX A;  3A8R A;  3ZNI A;  3TUY C;  1Z4H A;  1B7T Y;  4ORA B;  1XVJ A;  1UHK A;  2KLD A;  4INX A;  4QJ4 B;  4PE1 A;  5HYD A;  2LVJ A;  1QIV A;  3TDI A;  3B87 A;  3CLN A;  1GJY A;  1PVA A;  5DKQ A;  4OV2 A;  3I5H B;  1GGW A;  2FJY A;  1SYM A;  3N7H A;  1YUT A;  1PVB A;  3B6X A;  1P28 A;  2LMT A;  3PM8 A;  1KSM A;  2L98 A;  1CFF A;  5DKR A;  1QXP A;  1YUR A;  3IF7 A;  5I94 A;  1NWD A;  4NDD A;  4AOM A;  1H8B A;  1XFR A;  3BUO B;  2L4I A;  1LA0 A;  3B86 A;  3OBV A;  3CZ0 A;  1ZMZ A;  3D77 A;  2LUX A;  4MRY A;  3Q8I A;  1RJV A;  4XJK A;  1UHI A;  1F4Q A;  3VB1 A;  2M1K B;  1SMG A;  2L2C A;  3LK0 A;  1SL8 A;  1CKK A;  3KPX A;  1AUI B;  3BJH A;  1BR4 B;  2BKH B;  1SNL A;  3R1V A;  3SS5 A;  2JTZ A;  2JNX A;  4HRH A;  2QPT A;  1J55 A;  3UNW A;  1NP8 A;  1BR1 B;  1NX2 A;  1FI5 A;  1DC1 A;  3D73 A;  3JTD C;  5B8I B;  1WRK A;  4I5L B;  4NDC A;  1BLQ A;  2LNK A;  1F71 A;  2TN4 A;  1XK4 C;  1OOI X;  1BMO A;  1NUB A;  2PYQ A;  2WCF A;  4IJ7 A;  2LHL A;  1BU3 A;  2WCE A;  5CSF A;  4JKT A;  4PT1 A;  4WQ3 A;  5FYX A;  1NX3 A;  3NSO A;  1CDN A;  1CMF A;  3SIB A;  1K2H A;  3BUN B;  4JQ0 D;  3O4X A;  3EK8 A;  3BQ3 A;  1TNP A;  2KI4 B;  2FCD A;  3OB1 B;  3WHT B;  1AJ4 A;  1PUL A;  1SSE B;  3KF9 A;  5J3X A;  3VRR A;  1XFW O;  4CID A;  1QWV A;  3O2P A;  2PSR A;  1B8C A;  2IS9 A;  4YGC B;  2BAP A;  1BJF A;  5AFP A;  3RLZ A;  3DF0 B;  2VRG A;  2Y5I A;  3FE9 A;  3EVV A;  3S0G A;  2HPS A;  2BE6 A;  3LK1 A;  3NHT A;  1J7P A;  1KFU L;  3D0Y B;  2PRU A;  3BFH A;  1UHN A;  2CCM A;  3DXL A;  5KTY A;  3OB2 B;  1C7V A;  3D76 A;  1U5I A;  1SR6 C;  2I94 A;  2L5Y A;  1YUS A;  1IQ3 A;  1KK8 B;  1KK7 Y;  1YUU A;  4N1F A;  1CB1 A;  1JF0 A;  5HL1 A;  4AQJ A;  3OHM B;  4MZJ A;  1M31 A;  1Z2C B;  3GK1 A;  4UPG A;  3A4U B;  4OZD A;  1XYD A;  2OS8 C;  2K0J A;  1MWN A;  4FQT A;  1SCM C;  2L0P A;  2L50 A;  2LLS A;  2QAC A;  1OZS A;  1IIO A;  1XFU O;  2CT9 A;  1MXL C;  2WCM A;  3F45 A;  2M1U A;  3HX4 A;  3CDN A;  1RWY A;  3EKJ A;  1W9Z A;  4YGD B;  5K89 A;  3OX5 A;  5HKY A;  3BXK A;  2NCP A;  3MSE B;  1NCZ A;  2I7A A;  2KI6 D;  1QVI Z;  1QS7 A;  4GNK B;  2KQ6 A;  4CFR A;  2ZN9 A;  2E30 A;  2ZNE A;  3D10 A;  2F3Z A;  2BNX A;  1EG3 A;  3L4A A;  2JXL A;  1M63 B;  2I2R E;  2LVV A;  2GGM A;  4JD9 A;  4MBE A;  3CZ2 A;  1LKJ A;  3BFB A;  1QX7 A;  1NX1 A;  2G2B A;  2Q91 A;  1WRL A;  3EKH A;  1CDL A;  2LP3 A;  2JNF A;  2Y4Q A;  1L2O B;  1DJI A;  1L7Z A;  1Y0V H;  1J7R A;  1TIZ A;  1YVH A;  4XJK B;  4MLW A;  1LVC D;  1OSA A;  1SCV A;  1YX8 A;  2ERB A;  1DJY A;  2KI6 C;  3EG5 B;  2F3Y A;  4I5K A;  4YGE B;  1TNX A;  4PHN A;  3O4Y A;  3FIA A;  3SS3 A;  1S3P A;  2LHI A;  2LM5 A;  1EJ3 A;  3EK4 A;  4OCI A;  1F8H A;  1OOJ A;  2WCH A;  2JT8 A;  3K21 A;  4DIR A;  1NX0 A;  2EC6 C;  5FI2 A;  1REC A;  2MRD A;  1K94 A;  1K8U A;  1DJX A;  5HKZ A;  1LS8 A;  2KNE A;  1SY9 A;  2K7O A;  2O5G A;  2LAN A;  4GGF C;  1WDC B;  3DVM A;  4P2Y B;  1A75 A;  1G8I A;  3DVJ A;  3FWB A;  1OOG A;  2Q4U A;  3QRX A;  4MRX A;  1NCX A;  1XFV O;  2JPT A;  1BT6 A;  2AAO A;  2FCE A;  3FWC A;  4L9M A;  3L47 A;  3AKB A;  2F33 A;  1QIW A;  3BUX B;  4GGN A;  4PHM A;  2WCB A;  2LMU A;  4DS7 A;  1NIW A;  2HQ8 A;  4OVN F;  1B8R A;  5CSN A;  5I8N A;  1B7T Z;  2H8V A;  3GK2 A;  2KBM A;  2NCO A;  2R2I A;  2P71 A;  3SG3 A;  1RTP 1;  1F70 A;  5EL2 A;  2KFF A;  2M29 A;  5HLV A;  1K9K A;  4FTG A;  3VRN A;  3TZ1 A;  2JPO A;  4PHK A;  3VRQ A;  3JVT B;  1S5G Z;  1F4O A;  2E6W A;  1OE9 B;  2M9G A;  1IJ5 A;  1PSB A;  1M39 A;  1ZFS A;  2FJU B;  1K9U A;  2O60 A;  3CR4 X;  3I5I C;  3L4L A;  3LLE A;  4M2O A;  5AAN A;  3SG4 A;  2JT3 A;  3SG7 A;  1XK4 A;  2B1U A;  1DJW A;  2LAP A;  1DQE A;  1DTL A;  3CYZ A;  1MXE A;  1CLL A;  3B88 A;  2RGI A;  3WNX B;  1OOH A;  1KQM B;  1B8L A;  2OTG C;  1DJH A;  2LUC A;  2D8N A;  3S0E A;  5G08 A;  2MLF C;  3NSK A;  1TN4 A;  1QV1 A;  1U5I B;  1J7O A;  4N5X A;  2YGU A;  3IQO A;  4OR9 B;  2PQL A;  4JPZ B;  1WLM A;  3DVK A;  1OMR A;  4M2P A;  1JSA A;  1A2X A;  3I5H C;  3O6B A;  1CTR A;  3PN7 B;  5TNC A;  1CLM A;  1JC2 A;  3TDU A;  3EK7 A;  1AVS A;  2KAX A;  2M7L A;  1WDC C;  2LLT A;  3CZ1 A;  2F2P A;  4AQI A;  2V53 A;  1ZUZ A;  1QTX A;  2BL0 B;  2GV5 A;  2KDH A;  5D3O A;  1PK0 D;  1PRW A;  2LMV A;  4MEW A;  4MVF A;  3H4S E;  1WY9 A;  3TS5 B;  1TUZ A;  3DY9 A;  1AHR A;  5CPV A;  1OQP A;  1FPW A;  1JUO A;  2I18 A;  1MHO A;  1WLZ A;  3I5F B;  3RZS A;  1EL4 A;  2M97 A;  4PDZ A;  2K7C A;  3EVU A;  3CS1 A;  1Y1X A;  3S0D A;  1FBV A;  2Y1M A;  3S0F A;  2PVB A;  2F2O A;  1QV0 A;  3PLF B;  1XFZ O;  4CLN A;  2BCB A;  2WC6 A;  1NYA A;  4OKH A;  5AXI A;  5AEQ A;  1JBA A;  1DJG A;  1WRZ A;  2KYF A;  1KWO B;  2P6B B;  4PCW A;  1A4P A;  1DJZ A;  1UP5 A;  3S0A A;  2EHB A;  3PAT A;  1IRJ A;  1K95 A;  3VGO A;  1B4C A;  2AMI A;  1IH0 A;  1KFX L;  2CTN A;  4GFT A;  1SKT A;  2QEB A;  1JFK A;  1TCF A;  5I2O A;  2BCA A;  1DF0 B;  1G4Y R;  1CFD A;  1F54 A;  1YRU B;  2LVK A;  2PMY A;  4N1G A;  3TUY B;  1CFC A;  1K90 D;  2SCP A;  2WC8 A;  4IL1 A;  2PAL A;  4P5O E;  4YRU A;  2KBI A;  1QVI Y;  2BBN A;  3R72 A;  1ZAC A;  2A4J A;  4KYN A;  4A4C A;  1XFX O;  3AAJ A;  4TNC A;  2MLE C;  5ER4 X;  5ER5 A;  1OMD A;  2KI4 C;  1ORG A;  3NSL A;  4C0K A;  2HQW A;  2ZFD A;  4E68 A;  3S0B A;  4XYN A;  2BKI B;  1GQM A;  5AER A;  3GOF A;  3PJI A;  4I5J A;  1KCY A;  3FE8 A;  3LCP C;  1A75 B;  3OGN A;  4F7F A;  4MN0 A;  4CPV A;  2ZN8 A;  2M49 B;  1CM4 A;  1SRA A;  2BL0 C;  4HRG A;  1A03 A;  2JRF A;  1C07 A;  2KAV A;  3NHI A;  2K7B A;  1B1G A;  2H61 C;  4A4B A;  2BE4 A;  3FS7 A;  1KQV A;  1N2D A;  2WCJ A;  3CZT X;  3PM2 A;  3I5F C;  3D0Y A;  3BYA A;  4D1E A;  3I5G B;  5JJG A;  4WRI A;  2M7N A;  1M46 A;  4MZK A;  1IG5 A;  3KO0 A;  3K1E A;  1J1D A;  3SG5 A;  1CLB A;  1NPQ A;  1ODB A;  1BG1 A;  1Y1U A;  2K2F A;  4FQO A;  1KK8 C;  4ETO A;  1MQ1 A;  5CSJ A;  3R1P A;  2OPO A;  4HSZ A;  2KGR A;  4C0L A;  2KOT A;  1OMV A;  1CM1 A;  3IQQ A;  4YI9 A;  4YI8 A;  1KWO C;  2FOT A;  2KFG A;  1J1E A;  4GGF A;  1SK6 D;  2COL B;  3DD4 A;  1B9A A;  2K61 A;  1QLK A;  1CNP A;  1PSR A;  1TWO A;  2M0R A;  1LXF C;  2KAY A;  1UUS A;  2JC2 A;  2L4H A;  1LIN A;  1RK9 A;  1ALW A;  1V1F A;  5BPJ A;  4U8D A;  3NGV A;  2JQ6 A;  4DUQ A;  1QJT A;  2L51 A;  1PAL A;  2QEO A;  3CAB A;  5D7F A;  3SJS A;  1BF5 A;  3OX6 A;  4GAO A;  3CGA A;  4M2Q A;  2K7D A;  4ICB A;  3ZWH A;  4CFQ A;  4DRW A;  1DEL A;  1Y6W A;  2Y1N A;  5KU1 A;  2M8U A;  5PAL A;  3OP0 A;  1FF1 A;  2H2K A;  1J7Q A;  4DCK A;  2K60 A;  3LL8 B;  1DVI A;  2P70 A;  3BUW B;  4HRE E;  2HET A;  1IWQ A;  1S5G Y;  4BY4 A;  3BOW A;  1T14 A;  2G9B A;  2MHH A;  2ZRT A;  2KPH A;  2JUL A;  2KQY A;  2MAZ A;  2NXQ A;  2QEV A;  1IJ6 A;  1DGV A;  4ZCV A;  1Y1A A;  1L2O C;  1GGZ A;  2ZKM X;  2KLE A;  3HCM A;  1IQ5 A;  2WC5 A;  1ALV A;  1FW4 A;  2GGZ A;  1EXR A;  2JT0 A;  2MJW B;  1S26 D;  2EGD A;  3I5G C;  3C1V A;  3D78 A;  4PE4 A;  4WQ2 A;  3UO9 A;  2HF5 A;  2WOR A;  1NCY A;  1S6I A;  2JZI A;  4QJ5 B;  1SR6 B;  1RFJ A;  1YRT B;  1QAT A;  2L2E A;  4PE0 A;  2DOQ A;  1D1O A;  1UHH A;  1TCO B;  1S6J A;  3M0W A;  4ORB B;  5D69 A;  4ZCU A;  5KSZ A;  3BFA A;  1ZOT B;  2KFH A;  2QEH A;  2NZ0 A;  5IBW A;  1BOD A;  1QX2 A;  2OS8 B;  3BUM B;  3V2L A;  4I5N B;  3VRP A;  1SCM B;  1SBJ A;  2BEC A;  1C3Z A;  1XFY O;  3VRO A;  1KFU S;  1SL9 A;  1G33 A;  1BOC A;  3EVR A;  2CXJ A;  1SPY A;  1VRK A;  1R6P A;  5DIC A;  4YGA A;  1TNQ A;  1R2U A;  2CBL A;  1CFP A;  3DYE A;  2MA2 A;  1K9P A;  1W7J B;  3IVT A;  1SW8 A;  2SAS A;  1A29 A;  2LE9 B;  2K8M B;  1MR8 A;  1NSH A;  3ICB A;  5CSI A;  1S6C A;  2ZRS A;  1YX7 A;  3FE6 A;  1DEK A;  1CMG A;  2QDI A;  1EH2 A;  1TUJ A;  1XO5 A;  2WCK A;  1DGU A;  4YGB B;  2GTE A;  1QAS A;  1KFX S;  1OZO A;  3RM1 A;  1DMO A;  1QX5 B;  4GBA A;  3SIA A;  2L5X B;  2PAS A;  1F55 A;  5F6T A;  1UUR A;  3KEV A;  1TOP A;  1X02 A;  3JVT C;  3QME A;  2AUC A;  1M45 A;  3B7A A;  1UHJ A;  3PAL A;  3DVE A;  4GUK A;  2LLU A;  1HT9 A;  4PAL A;  2NLN A;  1DT7 B;  3O78 A;  2JOJ A;  2JWW A;  2CNP A;  1C3Y A;  4MZL A;  3DZT A;  1AK8 A;  2K2A A;  1KQM C;  2JTT A;  1K93 D;  2LC5 A;  3PFV A;  4USL A;  3CR5 X;  2WND A;  1JF2 A;  1OOF A;  4NQG A;  3SS4 A;  1MF8 B;  1W7I B;  1KK7 Z;  1B47 A;  2EC6 B;  1S1E A;  1HQV A;  1E8A A;  3CR2 A;  5I2Q A;  1JWD A;  1UWO A;  2BBM A;  3AAK A;  1H4B A;  1FI6 A;  4ORC B;  4YBH B;  5FI7 A;  3PN7 C;  1RRO A;  2LV7 A;  4R1E A;  1SL7 A;  4MSP A;  3GK4 X;  4INW A;  3KHE A;  1C7W A;  1V1G A;  2KSP A;  1OW4 A;  4GPL B;  1K96 A;  1CDP A;  2JU0 A;  2LCP A;  2F8P A;  4JWQ A;  1AP4 A;  3PSR A;  1IGV A;  1KSO A;  2H61 A;  1YTZ C;  3DF0 A;  2KHN A;  4NDB A;  3TS5 C;  4BY5 A;  3D74 A;  1Q80 A;  2M3W A;  1AJ5 A;  3TDZ A;  1EG4 A;  3D75 A;  1N65 A;  3WHU B;  1TNW A;  1LA3 A;  4QJ3 B;  3CTN A;  5GQQ C;  2ISD A;  2KGB C;  3CWG A;  3SG6 A;  2ZND A;  1S36 A;  5HLO A;  5HKW A;  1YR5 A;  1YVL A;  3AKA A;  1JFJ A;  2JXC A;  2WCL A;  3BOW B;  1QLS A;  3SG2 A;  3JTD B;  2LVI A;  3I5I B;  5FI6 A;  3WXA A;  1XA5 A; 
#chains in the Genus database with same CATH homology
 1CDM A;  3NSI A;  2WOS A;  1N0Y A;  3E3R A;  1TRF A;  4PE7 A;  5DKN A;  5I2L A;  3NXA A;  4PHJ A;  2BCX A;  5JOL A;  4F0Z B;  1IKU A;  4Q04 A;  2LP2 A;  2MBX A;  2OTG B;  1TTX A;  4C0J A;  1DF0 A;  2KYC A;  1MUX A;  3A8R A;  3ZNI A;  3TUY C;  1B7T Y;  4ORA B;  1XVJ A;  1UHK A;  5HYD A;  4QJ4 B;  4PE1 A;  2LVJ A;  1QIV A;  3TDI A;  3CLN A;  1GJY A;  1PVA A;  5DKQ A;  4OV2 A;  3I5H B;  1GGW A;  1SYM A;  1YUT A;  1PVB A;  2LMT A;  3PM8 A;  1KSM A;  2L98 A;  1CFF A;  5DKR A;  1QXP A;  1YUR A;  3IF7 A;  1NWD A;  4NDD A;  4AOM A;  1H8B A;  3BUO B;  2L4I A;  1LA0 A;  1ZMZ A;  4MRY A;  2LUX A;  1RJV A;  4XJK A;  1UHI A;  1F4Q A;  2M1K B;  1SMG A;  3LK0 A;  1SL8 A;  1CKK A;  3KPX A;  1AUI B;  1BR4 B;  2BKH B;  1SNL A;  2JTZ A;  2JNX A;  4HRH A;  2QPT A;  1J55 A;  1NP8 A;  1BR1 B;  1NX2 A;  1FI5 A;  3JTD C;  5B8I B;  1WRK A;  4I5L B;  4NDC A;  1BLQ A;  2LNK A;  1F71 A;  2TN4 A;  1XK4 C;  1BMO A;  1NUB A;  2WCF A;  2LHL A;  1BU3 A;  2WCE A;  5CSF A;  4WQ3 A;  5FYX A;  1NX3 A;  3NSO A;  1CDN A;  1CMF A;  3SIB A;  1K2H A;  3BUN B;  4JQ0 D;  3EK8 A;  3BQ3 A;  1TNP A;  2KI4 B;  2FCD A;  3OB1 B;  3WHT B;  1AJ4 A;  1PUL A;  3KF9 A;  5J3X A;  3VRR A;  1XFW O;  4CID A;  3O2P A;  2PSR A;  1B8C A;  2IS9 A;  4YGC B;  1BJF A;  5AFP A;  3RLZ A;  3DF0 B;  2VRG A;  2Y5I A;  3EVV A;  2HPS A;  2BE6 A;  3LK1 A;  1J7P A;  1KFU L;  3D0Y B;  2PRU A;  1UHN A;  2CCM A;  5KTY A;  3OB2 B;  1C7V A;  1U5I A;  1SR6 C;  2I94 A;  1IQ3 A;  1YUS A;  1KK8 B;  1KK7 Y;  1YUU A;  4N1F A;  1CB1 A;  1JF0 A;  4AQJ A;  3OHM B;  4MZJ A;  1M31 A;  3GK1 A;  4UPG A;  3A4U B;  1XYD A;  2OS8 C;  2K0J A;  1MWN A;  1SCM C;  2L0P A;  2L50 A;  2LLS A;  2QAC A;  1OZS A;  1XFU O;  2CT9 A;  1MXL C;  3F45 A;  2M1U A;  3HX4 A;  1RWY A;  3EKJ A;  4YGD B;  5K89 A;  3OX5 A;  5HKY A;  3BXK A;  2NCP A;  3MSE B;  1NCZ A;  2I7A A;  2KI6 D;  1QVI Z;  1QS7 A;  4GNK B;  2KQ6 A;  4CFR A;  2ZN9 A;  2E30 A;  2ZNE A;  3D10 A;  2F3Z A;  1EG3 A;  2JXL A;  1M63 B;  2I2R E;  2LVV A;  2GGM A;  4MBE A;  1LKJ A;  1QX7 A;  1NX1 A;  2G2B A;  2Q91 A;  1WRL A;  3EKH A;  1CDL A;  2LP3 A;  2JNF A;  2Y4Q A;  1L2O B;  1DJI A;  1L7Z A;  1Y0V H;  1J7R A;  1TIZ A;  1YVH A;  4XJK B;  4MLW A;  1LVC D;  1OSA A;  1SCV A;  1YX8 A;  1DJY A;  2KI6 C;  2F3Y A;  4I5K A;  4YGE B;  1TNX A;  4PHN A;  3O4Y A;  3FIA A;  1S3P A;  2LHI A;  2LM5 A;  1EJ3 A;  3EK4 A;  4OCI A;  1F8H A;  1OOJ A;  2JT8 A;  3K21 A;  4DIR A;  1NX0 A;  2EC6 C;  1REC A;  2MRD A;  1K94 A;  1K8U A;  1DJX A;  5HKZ A;  2KNE A;  1SY9 A;  2K7O A;  2O5G A;  2LAN A;  4GGF C;  1WDC B;  3DVM A;  4P2Y B;  1A75 A;  1G8I A;  3DVJ A;  3FWB A;  2Q4U A;  4MRX A;  3QRX A;  1NCX A;  1XFV O;  2JPT A;  1BT6 A;  2AAO A;  2FCE A;  3FWC A;  4L9M A;  3AKB A;  2F33 A;  1QIW A;  3BUX B;  4GGN A;  4PHM A;  2WCB A;  2LMU A;  4DS7 A;  1NIW A;  2HQ8 A;  4OVN F;  1B8R A;  5CSN A;  5I8N A;  1B7T Z;  3GK2 A;  2KBM A;  2NCO A;  2R2I A;  3SG3 A;  1RTP 1;  1F70 A;  2KFF A;  2M29 A;  5HLV A;  1K9K A;  4FTG A;  3VRN A;  3TZ1 A;  4PHK A;  3VRQ A;  3JVT B;  1S5G Z;  1F4O A;  2E6W A;  1OE9 B;  2M9G A;  1IJ5 A;  1PSB A;  1M39 A;  1ZFS A;  2FJU B;  1K9U A;  2O60 A;  3CR4 X;  3I5I C;  3LLE A;  4M2O A;  5AAN A;  3SG4 A;  3SG7 A;  2JT3 A;  1XK4 A;  2B1U A;  1DJW A;  2LAP A;  1DTL A;  1MXE A;  1CLL A;  2RGI A;  3WNX B;  1KQM B;  1B8L A;  2OTG C;  1DJH A;  2LUC A;  2D8N A;  5G08 A;  2MLF C;  3NSK A;  1TN4 A;  1QV1 A;  1U5I B;  1J7O A;  4N5X A;  3IQO A;  4OR9 B;  4JPZ B;  1WLM A;  3DVK A;  1OMR A;  4M2P A;  1JSA A;  1A2X A;  3I5H C;  3O6B A;  1CTR A;  3PN7 B;  5TNC A;  1CLM A;  1JC2 A;  3TDU A;  3EK7 A;  1AVS A;  2KAX A;  2M7L A;  1WDC C;  2LLT A;  4AQI A;  2F2P A;  2V53 A;  1ZUZ A;  1QTX A;  2BL0 B;  2GV5 A;  2KDH A;  1PK0 D;  1PRW A;  2LMV A;  4MEW A;  4MVF A;  3H4S E;  1WY9 A;  3TS5 B;  1AHR A;  5CPV A;  1OQP A;  1FPW A;  1JUO A;  2I18 A;  1MHO A;  1WLZ A;  3I5F B;  1EL4 A;  2M97 A;  4PDZ A;  2K7C A;  3EVU A;  3CS1 A;  1Y1X A;  1FBV A;  2Y1M A;  2PVB A;  2F2O A;  1QV0 A;  3PLF B;  1XFZ O;  4CLN A;  2BCB A;  1NYA A;  4OKH A;  5AXI A;  5AEQ A;  1JBA A;  1DJG A;  1WRZ A;  2KYF A;  1KWO B;  2P6B B;  4PCW A;  1A4P A;  1DJZ A;  1UP5 A;  2EHB A;  3PAT A;  1IRJ A;  1K95 A;  3VGO A;  1B4C A;  2AMI A;  1IH0 A;  1KFX L;  2CTN A;  4GFT A;  1SKT A;  1JFK A;  1TCF A;  5I2O A;  2BCA A;  1DF0 B;  1G4Y R;  1CFD A;  1F54 A;  1YRU B;  2LVK A;  2PMY A;  4N1G A;  3TUY B;  1CFC A;  1K90 D;  2SCP A;  2WC8 A;  4IL1 A;  2PAL A;  4P5O E;  4YRU A;  2KBI A;  1QVI Y;  2BBN A;  1ZAC A;  2A4J A;  4A4C A;  1XFX O;  3AAJ A;  4TNC A;  2MLE C;  5ER4 X;  5ER5 A;  1OMD A;  2KI4 C;  3NSL A;  4C0K A;  2HQW A;  2ZFD A;  4E68 A;  4XYN A;  2BKI B;  1GQM A;  5AER A;  3GOF A;  4I5J A;  1KCY A;  3LCP C;  1A75 B;  4MN0 A;  4CPV A;  2ZN8 A;  2M49 B;  1CM4 A;  1SRA A;  2BL0 C;  4HRG A;  1A03 A;  2JRF A;  1C07 A;  2KAV A;  2K7B A;  1B1G A;  2H61 C;  4A4B A;  2BE4 A;  3FS7 A;  1KQV A;  1N2D A;  3CZT X;  4D1E A;  3I5F C;  3D0Y A;  3BYA A;  3I5G B;  5JJG A;  4WRI A;  2M7N A;  1M46 A;  4MZK A;  1IG5 A;  3KO0 A;  3SG5 A;  1J1D A;  1CLB A;  1NPQ A;  1ODB A;  1BG1 A;  1Y1U A;  2K2F A;  4FQO A;  1KK8 C;  4ETO A;  1MQ1 A;  5CSJ A;  2OPO A;  4HSZ A;  2KGR A;  4C0L A;  2KOT A;  1OMV A;  1CM1 A;  3IQQ A;  4YI9 A;  4YI8 A;  1KWO C;  2FOT A;  2KFG A;  1J1E A;  4GGF A;  1SK6 D;  2COL B;  3DD4 A;  1B9A A;  2K61 A;  1QLK A;  1PSR A;  2M0R A;  1LXF C;  2KAY A;  1UUS A;  2JC2 A;  2L4H A;  1LIN A;  1RK9 A;  1ALW A;  1V1F A;  5BPJ A;  4U8D A;  2JQ6 A;  4DUQ A;  1QJT A;  2L51 A;  1PAL A;  5D7F A;  3SJS A;  1BF5 A;  3OX6 A;  4GAO A;  3CGA A;  4M2Q A;  2K7D A;  4ICB A;  3ZWH A;  4CFQ A;  4DRW A;  1Y6W A;  2Y1N A;  5KU1 A;  2M8U A;  5PAL A;  3OP0 A;  1FF1 A;  2H2K A;  1J7Q A;  4DCK A;  3LL8 B;  1DVI A;  3BUW B;  4HRE E;  2HET A;  1IWQ A;  1S5G Y;  4BY4 A;  3BOW A;  2MHH A;  2G9B A;  2ZRT A;  2JUL A;  2KQY A;  2MAZ A;  2NXQ A;  1IJ6 A;  1DGV A;  4ZCV A;  1Y1A A;  1L2O C;  1GGZ A;  2ZKM X;  3HCM A;  1IQ5 A;  1ALV A;  1FW4 A;  2GGZ A;  1EXR A;  2JT0 A;  2MJW B;  1S26 D;  2EGD A;  3I5G C;  3C1V A;  4PE4 A;  4WQ2 A;  4QJ5 B;  1CNP A;  2HF5 A;  2WOR A;  1NCY A;  1S6I A;  2JZI A;  1SR6 B;  1RFJ A;  1YRT B;  1QAT A;  2L2E A;  4PE0 A;  2DOQ A;  1D1O A;  1UHH A;  1TCO B;  1S6J A;  3M0W A;  4ORB B;  5D69 A;  4ZCU A;  5KSZ A;  1ZOT B;  2KFH A;  1BOD A;  2NZ0 A;  5IBW A;  1QX2 A;  2OS8 B;  3BUM B;  3VRP A;  4I5N B;  1SCM B;  1SBJ A;  2BEC A;  1XFY O;  3VRO A;  1KFU S;  1SL9 A;  1G33 A;  1BOC A;  3EVR A;  2CXJ A;  1SPY A;  1VRK A;  1R6P A;  4YGA A;  1TNQ A;  1R2U A;  2CBL A;  1CFP A;  2MA2 A;  1K9P A;  1W7J B;  1SW8 A;  2SAS A;  1A29 A;  2LE9 B;  2K8M B;  1MR8 A;  1NSH A;  3ICB A;  5CSI A;  1S6C A;  2ZRS A;  1YX7 A;  1CMG A;  1EH2 A;  1XO5 A;  1DGU A;  4YGB B;  1QAS A;  1KFX S;  1OZO A;  3RM1 A;  1DMO A;  1QX5 B;  4GBA A;  3SIA A;  2L5X B;  2PAS A;  1F55 A;  5F6T A;  1UUR A;  3KEV A;  1TOP A;  1X02 A;  3JVT C;  2AUC A;  1M45 A;  1UHJ A;  3PAL A;  3DVE A;  4GUK A;  2LLU A;  1HT9 A;  4PAL A;  2NLN A;  1DT7 B;  3O78 A;  2JOJ A;  2JWW A;  2CNP A;  4MZL A;  1AK8 A;  2K2A A;  1KQM C;  2JTT A;  1K93 D;  2LC5 A;  3PFV A;  4USL A;  3CR5 X;  2WND A;  1JF2 A;  4NQG A;  1MF8 B;  1W7I B;  1KK7 Z;  1B47 A;  2EC6 B;  1S1E A;  1HQV A;  1E8A A;  3CR2 A;  5I2Q A;  1JWD A;  1UWO A;  2BBM A;  3AAK A;  1H4B A;  1FI6 A;  4ORC B;  4YBH B;  3PN7 C;  1RRO A;  2LV7 A;  4R1E A;  1SL7 A;  4MSP A;  3GK4 X;  3KHE A;  1C7W A;  1V1G A;  2KSP A;  4GPL B;  1K96 A;  1CDP A;  2JU0 A;  2LCP A;  2F8P A;  4JWQ A;  1AP4 A;  3PSR A;  1IGV A;  1KSO A;  2H61 A;  1YTZ C;  3DF0 A;  2KHN A;  4NDB A;  3TS5 C;  4BY5 A;  1Q80 A;  2M3W A;  1AJ5 A;  3TDZ A;  1EG4 A;  1N65 A;  3WHU B;  1TNW A;  1LA3 A;  4QJ3 B;  3CTN A;  5GQQ C;  2ISD A;  2KGB C;  3CWG A;  3SG6 A;  2ZND A;  1S36 A;  5HLO A;  5HKW A;  1YR5 A;  1YVL A;  3AKA A;  1JFJ A;  2JXC A;  3BOW B;  1QLS A;  3SG2 A;  3JTD B;  2LVI A;  3I5I B;  3WXA A;  1XA5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...