1GQMA

The structure of s100a12 in a hexameric form and its proposed role in receptor signalling
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
87
structure length
87
Chain Sequence
b'TKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CALGRANULIN C
publication title The Structure of S100A12 in a Hexameric Form and its Proposed Role in Receptor Signalling
pubmed doi rcsb
molecule tags Antimicrobial protein
total genus 29
structure length 87
sequence length 87
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2001-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1gqmA00
2KFGA 1ALWA 2L0PA 3RM1A 3VRNA 1WY9A 3CR5X 2KFHA 2KAYA 1F4OA 1QX2A 2MLEC 1KQMC 4MRYA 4I5JA 3EK8A 1M63B 1Y1AA 2Q4UA 2WNDA 1SL8A 2TN4A 4PE1A 1CLLA 3K21A 1MHOA 5HLOA 1YX8A 2V53A 2JZIA 1TNWA 2ZFDA 2LVVA 3DVKA 4I5LB 1KK8B 4MEWA 1FI5A 2JTTA 1OOJA 2L4HA 2FCDA 3A4UB 1FBVA 1C7VA 2EC6B 1BMOA 2WCBA 1PULA 4PE4A 1H8BA 2BBNA 3DVMA 3LCPC 2Y1NA 4OVNF 2KI4C 4I5KA 1W7IB 3BYAA 1F55A 5HKYA 2JT0A 3EKJA 1S5GY 2M0RA 1VRKA 2LHLA 3VROA 1BOCA 1S5GZ 1J1EA 1Y1XA 3BUXB 1CFPA 1XYDA 1EH2A 2PSRA 4ORBB 1XFWO 2L50A 1IRJA 4USLA 3RLZA 4C0LA 1CKKA 1TN4A 3PFVA 5F6TA 1M46A 2LNKA 1TNXA 1YVHA 2OTGC 1X02A 3KPXA 1NCZA 4R1EA 4YGEB 1CLBA 1CLMA 3EVRA 4MBEA 1JWDA 2E6WA 1BU3A 5FYXA 1CMFA 2H2KA 2F2PA 2BL0B 3WXAA 1M39A 1SCMC 1EXRA 1CMGA 2K0JA 4HREE 2KYCA 5IBWA 4HSZA 2WC8A 1WDCB 2JNFA 2K8MB 2LAPA 3KEVA 1A03A 1NWDA 1RJVA 3LLEA 1FF1A 3TDUA 2K7CA 2RGIA 3F45A 1J7QA 2ISDA 2F8PA 1SPYA 3NSOA 2COLB 1UHKA 2NCPA 4PHNA 1LA0A 3I5IB 1F4QA 4ORCB 2HQ8A 1K8UA 4PCWA 1DJWA 1OZOA 1MF8B 1AVSA 2AMIA 1OE9B 3DD4A 1RTP1 3CR4X 4YGCB 4N1GA 2P6BB 1CFFA 1M45A 2LE9B 3CGAA 3HCMA 3TS5B 2ZN8A 1NCYA 4DRWA 1BT6A 5I2LA 3DVJA 4PHMA 2K7DA 1OSAA 5AFPA 1B9AA 3TDZA 1DJXA 4MLWA 3SG2A 2KGRA 2I94A 3QRXA 1K2HA 1OMVA 2JWWA 5KU1A 2LCPA 2ZNDA 3TUYC 1BG1A 1CDPA 1NX1A 1DGVA 2BKIB 3CTNA 4NDBA 1NX0A 1V1GA 5CSNA 5G08A 3BOWA 2Y5IA 1QTXA 1ZACA 2CCMA 1DT7B 5AERA 1NSHA 3OX6A 1LKJA 1F71A 1MQ1A 1DF0B 2F33A 3JTDC 1TTXA 2KBMA 1A4PA 1S6IA 3C1VA 3I5FC 1GQMA 1AUIB 2JPTA 4MZKA 3PATA 1A75A 1XVJA 2G2BA 1B8RA 1NIWA 2JRFA 2QACA 1J55A 2KBIA 1DJGA 1SMGA 1JF2A 1N65A 2L51A 2JT8A 3PALA 1U5IB 2BBMA 4GPLB 4DS7A 1GGWA 5AEQA 1MXLC 1JFKA 2M97A 2BCXA 2JTZA 1N2DA 2LP2A 1KFXL 1SRAA 2VRGA 2KAXA 2WOSA 3AKBA 4MZLA 3WHUB 1BJFA 2LC5A 2NXQA 2NLNA 2PALA 1QATA 1QASA 3NXAA 5DKQA 1LVCD 1N0YA 2PASA 1J7RA 2OS8C 3JVTB 5CSFA 1ZUZA 4OR9B 4GBAA 1EL4A 1HQVA 1RK9A 2JU0A 2IS9A 1WRKA 3AKAA 4FQOA 1XK4C 1SK6D 1XA5A 1G33A 4C0JA 2ZNEA 1DVIA 1QXPA 1UHIA 3I5HB 1QV0A 2AUCA 1WRZA 1UP5A 3EK7A 5J3XA 1MXEA 1V1FA 4XJKA 2WCEA 4A4CA 1F8HA 1B7TY 1GJYA 1NX3A 2KQ6A 1B47A 1KSOA 3LK0A 1EG4A 3OHMB 1B7TZ 3VRQA 2CXJA 4CLNA 2CTNA 3EVUA 3SJSA 2M1UA 1CM1A 2KGBC 1R6PA 2M29A 2HF5A 3AAJA 4CFRA 1SBJA 1EJ3A 1J1DA 4OV2A 3D0YB 1C07A 3E3RA 2B1UA 1WRLA 2MHHA 5HYDA 1S6JA 3NSIA 3I5GB 5I2OA 5KTYA 2F2OA 5TNCA 2MJWB 1A2XA 1YTZC 1UHNA 3ICBA 1K95A 5CPVA 1G8IA 1RECA 2SCPA 2GGZA 2LM5A 3FS7A 4YGBB 5ER5A 1BR1B 4F0ZB 5AXIA 2K2FA 4PDZA 3CS1A 4HRHA 1TRFA 1B8LA 1QJTA 2KI6C 3DF0A 4QJ4B 4C0KA 4M2OA 1PRWA 1SKTA 1BF5A 3OX5A 4I5NB 4M2QA 1YUTA 4CPVA 1DJZA 4PALA 1L2OB 2O5GA 5D69A 1DJHA 2H61A 3NSKA 5I8NA 1UHJA 2KFFA 4YGDB 1IGVA 1WDCC 1XFYO 4FTGA 1SL9A 4AQIA 4Q04A 2LVIA 1MUXA 3GK2A 5BPJA 1YVLA 1BLQA 1S6CA 2HPSA 4GUKA 4OKHA 1E8AA 4NDDA 1B1GA 1OZSA 3PM8A 3CR2A 1ZOTB 1IWQA 5AANA 1OQPA 2E30A 4PE0A 4UPGA 2BE4A 1YUSA 2H61C 1K96A 1YX7A 3O4YA 2KAVA 1KQVA 3O78A 1QIVA 3VRPA 2BKHB 1SW8A 3CZTX 1KSMA 2JXCA 2LMTA 3PN7C 4D1EA 2WORA 4E68A 1Q80A 2WCFA 1F70A 3BQ3A 2MLFC 1LXFC 1B8CA 1IJ5A 1KK7Y 3SIBA 3SG5A 1KK7Z 4JPZB 2LHIA 1FW4A 1JBAA 2JT3A 2KDHA 1R2UA 2BECA 2K61A 2L2EA 2LUXA 2KNEA 4YGAA 1QX7A 4MRXA 3KHEA 1D1OA 1KCYA 1CDMA 3FIAA 3IQQA 2BCAA 1PALA 3NSLA 2KQYA 1KWOC 2CNPA 2ZRSA 1SYMA 1YRTB 3LL8B 2LP3A 1CM4A 1CNPA 1K94A 2FCEA 1NYAA 1FPWA 4GAOA 1PVAA 1UUSA 4P2YB 1XK4A 3PSRA 4BY5A 2I7AA 1YUUA 4QJ5B 5ER4X 4ORAB 1K9UA 3TDIA 1SR6C 1BR4B 1XFUO 4DIRA 3CLNA 2GGMA 3I5FB 2KHNA 3AAKA 2G9BA 3PLFB 4MSPA 4QJ3B 1QIWA 4HRGA 5I2QA 1TNQA 1F54A 2FJUB 2LLSA 2LVKA 4N5XA 4MZJA 1AP4A 1CFCA 3JVTC 4OCIA 3SG4A 3D10A 4CFQA 3IF7A 1JF0A 2BCBA 2PVBA 1SY9A 2M9GA 2M7NA 2MBXA 1ALVA 2M1KB 1K9KA 2LMUA 3BOWB 2KSPA 3I5HC 1KFUL 3DVEA 3GOFA 3OB1B 1RROA 1SNLA 4ZCVA 3O6BA 1MWNA 4BY4A 2CT9A 1IQ5A 1KK8C 4YI8A 1HT9A 1RWYA 1XFVO 3GK1A 2OS8B 1ODBA 3BUWB 3BXKA 3IQOA 2K7BA 4ETOA 2LUCA 1IH0A 1S1EA 2LV7A 1NP8A 1A75B 1MR8A 2EC6C 2I2RE 1KQMB 1LA3A 1TCFA 4P5OE 5B8IB 4GGNA 4MVFA 1KFXS 3M0WA 1AJ4A 5CSJA 2M8UA 3SIAA 2NZ0A 4XYNA 1QV1A 3SG7A 1IQ3A 1WLZA 4CIDA 1CFDA 5JOLA 1L7ZA 4YI9A 1CDNA 3WHTB 1QLKA 1XFXO 1YURA 4NQGA 4WQ3A 4U8DA 1DJYA 2MAZA 3I5GC 2ZRTA 1S3PA 1Y1UA 1K9PA 1UHHA 1W7JB 1SL7A 2BE6A 2NCOA 2KOTA 3BUMB 1Y0VH 5D7FA 1EG3A 1CB1A 1IG5A 1H4BA 1AK8A 1TIZA 5JJGA 1UURA 2KI4B 3A8RA 4WRIA 2L98A 2JXLA 2L5XB 1IJ6A 2R2IA 1KFUS 4YRUA 1YRUB 1A29A 3EK4A 2BL0C 2K2AA 1UWOA 5KSZA 3O2PA 4TNCA 2HETA 3EKHA 4XJKB 1DMOA 2LMVA 3GK4X 4ICBA 5HLVA 2OTGB 2A4JA 1L2OC 2OPOA 1RFJA 3LK1A 4GFTA 5CSIA 2KI6D 1B4CA 1XO5A 1JFJA 4PHJA 2Q91A 2GV5A 1SCMB 4GNKB 5K89A 3I5IC 3SG6A 3MSEB 2DOQA 3FWCA 1CTRA 1TNPA 2JC2A 3KF9A 4AOMA 4L9MA 4WQ2A 5HKWA 4A4BA 2I18A 1DGUA 4GGFA 2MA2A 1S26D 2EHBA 1AJ5A 3FWBA 1YR5A 2JNXA 3TS5C 1JC2A 1NX2A 1K93D 2PRUA 1ZFSA 1DF0A 3VGOA 2LANA 1PK0D 1S36A 3DF0B 3TZ1A 1QLSA 1PVBA 2EGDA 2O60A 1NCXA 1NUBA 2HQWA 1ZMZA 2Y4QA 1IKUA 1J7OA 4PHKA 1U5IA 4JWQA 4MN0A 3BUNB 5GQQC 2KYFA 1GGZA 2K7OA 4GGFC 3VRRA 3OB2B 1M31A 5PALA 2ZKMX 3SG3A 4IL1A 1DTLA 2PMYA 3PN7B 1C7WA 1K90D 1OMDA 2LLTA 3TUYB 2F3ZA 3H4SE 4N1FA 4PE7A 1QX5B 2AAOA 2FOTA 4JQ0D 2MRDA 1LINA 2M7LA 2D8NA 5HKZA 1BODA 4M2PA 3ZWHA 1QVIY 1G4YR 5DKRA 4DCKA 1QVIZ 1TOPA 1J7PA 4AQJA 3CWGA 4YBHB 3WNXB 3JTDB 1KWOB 1WLMA 3OP0A 3BUOB 4DUQA 2JOJA 1TCOB 4NDCA 1Y6WA 3ZNIA 1PSRA 1SCVA 3KO0A 2F3YA 3EVVA 1OMRA 1AHRA 4ZCUA 1XFZO 2QPTA 1DJIA 1PSBA 1JUOA 2M49B 2L4IA 2Y1MA 1JSAA 1NPQA 2M3WA 2JULA 3D0YA 1SR6B 5DKNA 2CBLA 1QS7A 2SASA 2LLUA 1CDLA 2JQ6A 3HX4A 2ZN9A 2LVJA 1FI6A
chains in the Genus database with same CATH superfamily
2KFGA 1ALWA 2L0PA 3RM1A 3VRNA 2K60A 1WY9A 4KYNA 3CR5X 2KFHA 2KAYA 1F4OA 1QX2A 2MLEC 1KQMC 4MRYA 4I5JA 3RZSA 3EK8A 3FE8A 1M63B 1Y1AA 2Q4UA 2WNDA 1SL8A 2TN4A 4PE1A 1CLLA 1OW4A 3K21A 1MHOA 5HLOA 1YX8A 2V53A 2JZIA 1TNWA 2ZFDA 2LVVA 3DVKA 4I5LB 1KK8B 4MEWA 1FI5A 2JTTA 3BFHA 1OOJA 2L4HA 2FCDA 3A4UB 1FBVA 1DC1A 2EC6B 1BMOA 2WCBA 1C7VA 1PULA 3FE6A 4PE4A 1H8BA 2BBNA 3OGNA 3DVMA 3LCPC 2Y1NA 2WCLA 4OVNF 2KI4C 4I5KA 4INWA 1W7IB 3BYAA 1F55A 1IIOA 5HKYA 2JT0A 3EKJA 1S5GY 2M0RA 1VRKA 2LHLA 3VROA 1BOCA 1S5GZ 1J1EA 1Y1XA 3BUXB 1CFPA 1XYDA 1EH2A 2PSRA 4ORBB 1XFWO 2L50A 1IRJA 4USLA 3RLZA 4C0LA 1CKKA 1TN4A 3PFVA 4JD9A 5F6TA 1M46A 3R72A 2LNKA 1TNXA 1YVHA 2OTGC 1TUJA 1X02A 1NCZA 3KPXA 4R1EA 4YGEB 1CLBA 3B88A 1CLMA 2QDIA 3CZ1A 3SS3A 3EVRA 4MBEA 4F7FA 1JWDA 2E6WA 1BU3A 4JKTA 5FYXA 1CMFA 2H2KA 2F2PA 2BL0B 3WXAA 1M39A 1SCMC 1EXRA 3CZ0A 1CMGA 2K0JA 4HREE 2KYCA 2P70A 5IBWA 4HSZA 2WC8A 1WDCB 2JNFA 2K8MB 2LAPA 3KEVA 1A03A 1NWDA 1RJVA 2QEOA 3LLEA 3TDUA 2K7CA 2RGIA 3F45A 1J7QA 1FF1A 2ISDA 2F8PA 1SPYA 3NSOA 2COLB 1UHKA 3N7HA 3D75A 2WCKA 2NCPA 4PHNA 1LA0A 3I5IB 1F4QA 4ORCB 2HQ8A 1K8UA 4PCWA 1DJWA 1OZOA 1MF8B 1AVSA 2AMIA 1OE9B 3DD4A 1RTP1 3CR4X 4YGCB 4N1GA 2P6BB 1CFFA 1M45A 2LE9B 3CGAA 3HCMA 3TS5B 2ZN8A 1NCYA 4DRWA 1BT6A 5I2LA 3DVJA 4PHMA 2K7DA 3D78A 1OSAA 5AFPA 1B9AA 2KLDA 3TDZA 1DJXA 3K1EA 4MLWA 3SG2A 2KGRA 2I94A 3QRXA 3CZ2A 1K2HA 1OMVA 2JWWA 5KU1A 2LCPA 2ZNDA 3TUYC 1BG1A 2QEBA 1CDPA 1NX1A 1DGVA 2BKIB 3CTNA 4NDBA 1NX0A 1V1GA 5CSNA 5G08A 3BOWA 2Y5IA 1QTXA 1ZACA 2CCMA 1DT7B 5AERA 1NSHA 3OX6A 2GTEA 1LKJA 3L4LA 1F71A 1MQ1A 1DF0B 2F33A 3JTDC 1TTXA 2KBMA 1A4PA 1S6IA 3C1VA 3I5FC 1GQMA 1AUIB 1ORGA 2JPTA 4MZKA 3PATA 3S0GA 1A75A 1XVJA 2G2BA 1B8RA 1NIWA 2JRFA 2KLEA 2QACA 1J55A 2KBIA 1DJGA 3UO9A 1SMGA 1JF2A 3R1PA 1N65A 2L51A 2JT8A 3PALA 1U5IB 2BBMA 4GPLB 4DS7A 1GGWA 5AEQA 1MXLC 1JFKA 2M97A 2BCXA 2JTZA 1N2DA 2LP2A 1KFXL 1SRAA 2VRGA 2KAXA 2WOSA 3AKBA 4MZLA 3WHUB 1BJFA 2LC5A 2NXQA 2NLNA 2PALA 1QATA 1QASA 3NXAA 5DKQA 1LVCD 1N0YA 2PASA 1J7RA 3D73A 1SSEB 2OS8C 3JVTB 5CSFA 1ZUZA 4OR9B 4GBAA 1EL4A 1HQVA 1RK9A 2JU0A 2IS9A 1WRKA 3AKAA 4FQOA 1XK4C 1SK6D 3DY9A 1XA5A 1G33A 4C0JA 2ZNEA 1DVIA 1QXPA 1UHIA 3I5HB 5FI7A 1QV0A 2AUCA 1WRZA 1UP5A 2PQLA 3EK7A 5J3XA 1MXEA 1V1FA 4XJKA 2WCEA 4A4CA 1F8HA 1B7TY 1GJYA 1NX3A 1P28A 1B47A 1KSOA 2KQ6A 1EG4A 3LK0A 1B7TZ 3OHMB 3VRQA 2CXJA 4CLNA 2CTNA 3EVUA 3SJSA 2M1UA 1CM1A 2KGBC 1R6PA 2M29A 2WCMA 2YGUA 3QMEA 2HF5A 3AAJA 3R1VA 4CFRA 1C3YA 1SBJA 1EJ3A 1J1DA 4OV2A 3D0YB 1C07A 3E3RA 2B1UA 1WRLA 2MHHA 5HYDA 1S6JA 3NSIA 3I5GB 5I2OA 5KTYA 2F2OA 5TNCA 2MJWB 1A2XA 1LS8A 1YTZC 1UHNA 2WCHA 3ICBA 1K95A 5CPVA 1G8IA 2QEVA 1W9ZA 1RECA 2SCPA 1DELA 2GGZA 2LM5A 3FS7A 4YGBB 5ER5A 1BR1B 4F0ZB 5AXIA 2K2FA 4PDZA 3CS1A 4HRHA 1TRFA 1B8LA 1QJTA 2KI6C 3DF0A 2KPHA 4QJ4B 4C0KA 4M2OA 1PRWA 1SKTA 1BF5A 3S0FA 2ERBA 3OX5A 4I5NB 4M2QA 1YUTA 4CPVA 1DJZA 4PALA 1L2OB 3R1OA 2O5GA 5D69A 1DJHA 2H61A 3NSKA 5I8NA 1UHJA 2KFFA 4YGDB 1IGVA 1WDCC 1XFYO 4FTGA 1SL9A 4AQIA 4Q04A 2LVIA 1MUXA 3GK2A 5BPJA 1YVLA 1BLQA 3S0BA 1S6CA 2HPSA 4GUKA 4OKHA 1E8AA 4NDDA 5HL1A 1B1GA 2H8VA 1OZSA 3PM8A 3SS4A 3CR2A 1ZOTB 1IWQA 5AANA 1OQPA 2E30A 4PE0A 4UPGA 2BE4A 1YUSA 2H61C 1K96A 1YX7A 3O4YA 2KAVA 1KQVA 3O78A 1QIVA 3VRPA 2BKHB 1SW8A 3CZTX 1KSMA 2JXCA 2LMTA 3PN7C 4D1EA 2L2CA 2WORA 4E68A 1Q80A 2WCFA 1F70A 3BQ3A 2MLFC 3NGVA 1LXFC 1B8CA 1IJ5A 1KK7Y 3SIBA 3SG5A 1KK7Z 4JPZB 2LHIA 1FW4A 1JBAA 2JT3A 2KDHA 1R2UA 2BECA 2K61A 2L2EA 2LUXA 2KNEA 4YGAA 1QX7A 3B87A 4MRXA 3KHEA 1D1OA 1KCYA 1CDMA 3FIAA 3IQQA 2BCAA 3L4AA 1PALA 3NSLA 2KQYA 1KWOC 2CNPA 3DXLA 3D77A 3EG5B 2ZRSA 1SYMA 1YRTB 3LL8B 2LP3A 3CDNA 1CM4A 3PM2A 1CNPA 1K94A 2FCEA 1NYAA 1OOHA 1FPWA 4GAOA 1PVAA 1UUSA 4P2YB 1XK4A 3PSRA 4BY5A 2I7AA 1YUUA 4QJ5B 5ER4X 4INXA 3FE9A 4ORAB 1OOIX 1K9UA 3TDIA 1SR6C 1BR4B 1XFUO 3BFBA 4DIRA 3CLNA 2GGMA 3I5FB 2KHNA 3AAKA 2G9BA 3PLFB 4MSPA 4OZDA 1QIWA 4QJ3B 4HRGA 5I2QA 3NHTA 1TNQA 1F54A 2FJUB 3O4XA 2LLSA 2LVKA 1Z2CB 4N5XA 4MZJA 1AP4A 1CFCA 3JVTC 4OCIA 3SG4A 3D10A 4CFQA 3IF7A 2WC5A 1JF0A 2BCBA 1QWVA 2PVBA 3UNWA 1SY9A 2M9GA 3OBVA 2M7NA 3PJIA 2MBXA 1ALVA 2M1KB 1K9KA 2LMUA 3BOWB 2KSPA 3S0EA 3I5HC 1KFUL 3DVEA 3GOFA 3OB1B 2PYQA 1RROA 1SNLA 4IJ7A 4ZCVA 3O6BA 1MWNA 4BY4A 3IVTA 2CT9A 1IQ5A 3Q8IA 1KK8C 4YI8A 1HT9A 1RWYA 1XFVO 3GK1A 2OS8B 1ODBA 3BUWB 3BXKA 3IQOA 2K7BA 4ETOA 2LUCA 1IH0A 1S1EA 2LV7A 1NP8A 1A75B 1MR8A 2EC6C 2I2RE 1KQMB 1LA3A 1TCFA 4P5OE 5B8IB 4GGNA 4MVFA 1KFXS 5FI2A 3M0WA 5EL2A 1AJ4A 1DEKA 5CSJA 2M8UA 3SIAA 2FJYA 2NZ0A 4XYNA 1QV1A 3SG7A 1IQ3A 1WLZA 4CIDA 1CFDA 5JOLA 1XFRA 1L7ZA 4YI9A 1CDNA 3WHTB 1QLKA 1XFXO 1YURA 4NQGA 4WQ3A 4U8DA 1DJYA 2MAZA 3I5GC 1TWOA 2ZRTA 1S3PA 3L47A 1Y1UA 1K9PA 1UHHA 1W7JB 1SL7A 2BE6A 2NCOA 2KOTA 3BUMB 1Y0VH 5D7FA 1EG3A 1CB1A 1IG5A 1H4BA 1AK8A 1TIZA 5JJGA 1UURA 2KI4B 3A8RA 4WRIA 2L98A 2JXLA 2L5XB 1IJ6A 2R2IA 1KFUS 4YRUA 3NHIA 3D76A 1YRUB 2QEHA 1A29A 3EK4A 2BL0C 2K2AA 1UWOA 5FI6A 3O2PA 5KSZA 4TNCA 2HETA 3EKHA 4XJKB 1DMOA 2LMVA 3GK4X 4ICBA 5HLVA 2OTGB 2A4JA 1L2OC 2OPOA 1RFJA 3LK1A 4GFTA 5CSIA 2KI6D 1B4CA 1XO5A 1JFJA 4PT1A 4PHJA 2Q91A 2GV5A 1SCMB 4GNKB 5K89A 3I5IC 2JPOA 3SG6A 3MSEB 2DOQA 1TUZA 3FWCA 1CTRA 1TNPA 2JC2A 3D74A 3KF9A 4AOMA 3DZTA 4L9MA 4WQ2A 5HKWA 4A4BA 2I18A 1DGUA 4GGFA 2MA2A 1S26D 2EHBA 1AJ5A 5DICA 3FWBA 1YR5A 3S0AA 2JNXA 3TS5C 1JC2A 1NX2A 1K93D 2PRUA 1ZFSA 1DF0A 3VGOA 2LANA 1PK0D 1S36A 1GM0A 2BAPA 3DF0B 3TZ1A 1QLSA 2WCJA 1PVBA 2EGDA 2O60A 3BFAA 4FQTA 1NCXA 1NUBA 2HQWA 1ZMZA 2Y4QA 1IKUA 1J7OA 4PHKA 1U5IA 4JWQA 4MN0A 3CYZA 3SS5A 3BUNB 5GQQC 3B86A 2KYFA 1GGZA 2K7OA 4GGFC 3VRRA 3OB2B 1M31A 5PALA 2ZKMX 3B7AA 3VB1A 3SG3A 3CABA 4IL1A 1DTLA 2PMYA 3PN7B 1C7WA 1K90D 1OMDA 2LLTA 3TUYB 1C3ZA 1DQEA 2F3ZA 3H4SE 4N1FA 1Z4HA 1T14A 2WC6A 4PE7A 1QX5B 3S0DA 2AAOA 2BNXA 2FOTA 4JQ0D 2MRDA 1LINA 2M7LA 2D8NA 5HKZA 1BODA 4M2PA 3ZWHA 1QVIY 1G4YR 5DKRA 4DCKA 1QVIZ 1TOPA 1J7PA 4AQJA 3CWGA 4YBHB 3BJHA 3WNXB 3JTDB 1KWOB 1WLMA 3OP0A 2P71A 3BUOB 4DUQA 2JOJA 1TCOB 4NDCA 1Y6WA 3V2LA 3ZNIA 1OOGA 1PSRA 1SCVA 3KO0A 2F3YA 3EVVA 1OMRA 1AHRA 4ZCUA 1XFZO 2QPTA 1DJIA 1PSBA 1JUOA 2M49B 2L4IA 2Y1MA 5I94A 1JSAA 1NPQA 2M3WA 2JULA 3DYEA 5D3OA 3D0YA 1SR6B 3B6XA 5DKNA 2CBLA 1OOFA 1QS7A 2SASA 2LLUA 1CDLA 2JQ6A 3HX4A 2ZN9A 2LVJA 1FI6A 2L5YA
chains in the Genus database with same CATH topology
2KFGA 1ALWA 2L0PA 3RM1A 3VRNA 1WY9A 3CR5X 2KFHA 2KAYA 1F4OA 1QX2A 2MLEC 1KQMC 4MRYA 4I5JA 3EK8A 1M63B 1Y1AA 2Q4UA 2WNDA 1SL8A 2TN4A 4PE1A 1CLLA 3K21A 1MHOA 5HLOA 1YX8A 2V53A 2JZIA 1TNWA 2ZFDA 2LVVA 3DVKA 4I5LB 1KK8B 4MEWA 1FI5A 2JTTA 1OOJA 2L4HA 2FCDA 3A4UB 1FBVA 1C7VA 2EC6B 1BMOA 2WCBA 1PULA 4PE4A 1H8BA 2BBNA 3DVMA 3LCPC 2Y1NA 4OVNF 2KI4C 4I5KA 1W7IB 3BYAA 1F55A 5HKYA 2JT0A 3EKJA 1S5GY 2M0RA 1VRKA 2LHLA 3VROA 1BOCA 1S5GZ 1J1EA 1Y1XA 3BUXB 1CFPA 1XYDA 1EH2A 2PSRA 4ORBB 1XFWO 2L50A 1IRJA 4USLA 3RLZA 4C0LA 1CKKA 1TN4A 3PFVA 5F6TA 1M46A 2LNKA 1TNXA 1YVHA 2OTGC 1X02A 3KPXA 1NCZA 4R1EA 4YGEB 1CLBA 1CLMA 3EVRA 4MBEA 1JWDA 2E6WA 1BU3A 5FYXA 1CMFA 2H2KA 2F2PA 2BL0B 3WXAA 1M39A 1SCMC 1EXRA 1CMGA 2K0JA 4HREE 2KYCA 5IBWA 4HSZA 2WC8A 1WDCB 2JNFA 2K8MB 2LAPA 3KEVA 1A03A 1NWDA 1RJVA 3LLEA 1FF1A 3TDUA 2K7CA 2RGIA 3F45A 1J7QA 2ISDA 2F8PA 1SPYA 3NSOA 2COLB 1UHKA 2NCPA 4PHNA 1LA0A 3I5IB 1F4QA 4ORCB 2HQ8A 1K8UA 4PCWA 1DJWA 1OZOA 1MF8B 1AVSA 2AMIA 1OE9B 3DD4A 1RTP1 3CR4X 4YGCB 4N1GA 2P6BB 1CFFA 1M45A 2LE9B 3CGAA 3HCMA 3TS5B 2ZN8A 1NCYA 4DRWA 1BT6A 5I2LA 3DVJA 4PHMA 2K7DA 1OSAA 5AFPA 1B9AA 3TDZA 1DJXA 4MLWA 3SG2A 2KGRA 2I94A 3QRXA 1K2HA 1OMVA 2JWWA 5KU1A 2LCPA 2ZNDA 3TUYC 1BG1A 1CDPA 1NX1A 1DGVA 2BKIB 3CTNA 4NDBA 1NX0A 1V1GA 5CSNA 5G08A 3BOWA 2Y5IA 1QTXA 1ZACA 2CCMA 1DT7B 5AERA 1NSHA 3OX6A 1LKJA 1F71A 1MQ1A 1DF0B 2F33A 3JTDC 1TTXA 2KBMA 1A4PA 1S6IA 3C1VA 3I5FC 1GQMA 1AUIB 2JPTA 4MZKA 3PATA 1A75A 1XVJA 2G2BA 1B8RA 1NIWA 2JRFA 2QACA 1J55A 2KBIA 1DJGA 1SMGA 1JF2A 1N65A 2L51A 2JT8A 3PALA 1U5IB 2BBMA 4GPLB 4DS7A 1GGWA 5AEQA 1MXLC 1JFKA 2M97A 2BCXA 2JTZA 1N2DA 2LP2A 1KFXL 1SRAA 2VRGA 2KAXA 2WOSA 3AKBA 4MZLA 3WHUB 1BJFA 2LC5A 2NXQA 2NLNA 2PALA 1QATA 1QASA 3NXAA 5DKQA 1LVCD 1N0YA 2PASA 1J7RA 2OS8C 3JVTB 5CSFA 1ZUZA 4OR9B 4GBAA 1EL4A 1HQVA 1RK9A 2JU0A 2IS9A 1WRKA 3AKAA 4FQOA 1XK4C 1SK6D 1XA5A 1G33A 4C0JA 2ZNEA 1DVIA 1QXPA 1UHIA 3I5HB 1QV0A 2AUCA 1WRZA 1UP5A 3EK7A 5J3XA 1MXEA 1V1FA 4XJKA 2WCEA 4A4CA 1F8HA 1B7TY 1GJYA 1NX3A 2KQ6A 1B47A 1KSOA 3LK0A 1EG4A 3OHMB 1B7TZ 3VRQA 2CXJA 4CLNA 2CTNA 3EVUA 3SJSA 2M1UA 1CM1A 2KGBC 1R6PA 2M29A 2HF5A 3AAJA 4CFRA 1SBJA 1EJ3A 1J1DA 4OV2A 3D0YB 1C07A 3E3RA 2B1UA 1WRLA 2MHHA 5HYDA 1S6JA 3NSIA 3I5GB 5I2OA 5KTYA 2F2OA 5TNCA 2MJWB 1A2XA 1YTZC 1UHNA 3ICBA 1K95A 5CPVA 1G8IA 1RECA 2SCPA 2GGZA 2LM5A 3FS7A 4YGBB 5ER5A 1BR1B 4F0ZB 5AXIA 2K2FA 4PDZA 3CS1A 4HRHA 1TRFA 1B8LA 1QJTA 2KI6C 3DF0A 4QJ4B 4C0KA 4M2OA 1PRWA 1SKTA 1BF5A 3OX5A 4I5NB 4M2QA 1YUTA 4CPVA 1DJZA 4PALA 1L2OB 2O5GA 5D69A 1DJHA 2H61A 3NSKA 5I8NA 1UHJA 2KFFA 4YGDB 1IGVA 1WDCC 1XFYO 4FTGA 1SL9A 4AQIA 4Q04A 2LVIA 1MUXA 3GK2A 5BPJA 1YVLA 1BLQA 1S6CA 2HPSA 4GUKA 4OKHA 1E8AA 4NDDA 1B1GA 1OZSA 3PM8A 3CR2A 1ZOTB 1IWQA 5AANA 1OQPA 2E30A 4PE0A 4UPGA 2BE4A 1YUSA 2H61C 1K96A 1YX7A 3O4YA 2KAVA 1KQVA 3O78A 1QIVA 3VRPA 2BKHB 1SW8A 3CZTX 1KSMA 2JXCA 2LMTA 3PN7C 4D1EA 2WORA 4E68A 1Q80A 2WCFA 1F70A 3BQ3A 2MLFC 1LXFC 1B8CA 1IJ5A 1KK7Y 3SIBA 3SG5A 1KK7Z 4JPZB 2LHIA 1FW4A 1JBAA 2JT3A 2KDHA 1R2UA 2BECA 2K61A 2L2EA 2LUXA 2KNEA 4YGAA 1QX7A 4MRXA 3KHEA 1D1OA 1KCYA 1CDMA 3FIAA 3IQQA 2BCAA 1PALA 3NSLA 2KQYA 1KWOC 2CNPA 2ZRSA 1SYMA 1YRTB 3LL8B 2LP3A 1CM4A 1CNPA 1K94A 2FCEA 1NYAA 1FPWA 4GAOA 1PVAA 1UUSA 4P2YB 1XK4A 3PSRA 4BY5A 2I7AA 1YUUA 4QJ5B 5ER4X 4ORAB 1K9UA 3TDIA 1SR6C 1BR4B 1XFUO 4DIRA 3CLNA 2GGMA 3I5FB 2KHNA 3AAKA 2G9BA 3PLFB 4MSPA 4QJ3B 1QIWA 4HRGA 5I2QA 1TNQA 1F54A 2FJUB 2LLSA 2LVKA 4N5XA 4MZJA 1AP4A 1CFCA 3JVTC 4OCIA 3SG4A 3D10A 4CFQA 3IF7A 1JF0A 2BCBA 2PVBA 1SY9A 2M9GA 2M7NA 2MBXA 1ALVA 2M1KB 1K9KA 2LMUA 3BOWB 2KSPA 3I5HC 1KFUL 3DVEA 3GOFA 3OB1B 1RROA 1SNLA 4ZCVA 3O6BA 1MWNA 4BY4A 2CT9A 1IQ5A 1KK8C 4YI8A 1HT9A 1RWYA 1XFVO 3GK1A 2OS8B 1ODBA 3BUWB 3BXKA 3IQOA 2K7BA 4ETOA 2LUCA 1IH0A 1S1EA 2LV7A 1NP8A 1A75B 1MR8A 2EC6C 2I2RE 1KQMB 1LA3A 1TCFA 4P5OE 5B8IB 4GGNA 4MVFA 1KFXS 3M0WA 1AJ4A 5CSJA 2M8UA 3SIAA 2NZ0A 4XYNA 1QV1A 3SG7A 1IQ3A 1WLZA 4CIDA 1CFDA 5JOLA 1L7ZA 4YI9A 1CDNA 3WHTB 1QLKA 1XFXO 1YURA 4NQGA 4WQ3A 4U8DA 1DJYA 2MAZA 3I5GC 2ZRTA 1S3PA 1Y1UA 1K9PA 1UHHA 1W7JB 1SL7A 2BE6A 2NCOA 2KOTA 3BUMB 1Y0VH 5D7FA 1EG3A 1CB1A 1IG5A 1H4BA 1AK8A 1TIZA 5JJGA 1UURA 2KI4B 3A8RA 4WRIA 2L98A 2JXLA 2L5XB 1IJ6A 2R2IA 1KFUS 4YRUA 1YRUB 1A29A 3EK4A 2BL0C 2K2AA 1UWOA 5KSZA 3O2PA 4TNCA 2HETA 3EKHA 4XJKB 1DMOA 2LMVA 3GK4X 4ICBA 5HLVA 2OTGB 2A4JA 1L2OC 2OPOA 1RFJA 3LK1A 4GFTA 5CSIA 2KI6D 1B4CA 1XO5A 1JFJA 4PHJA 2Q91A 2GV5A 1SCMB 4GNKB 5K89A 3I5IC 3SG6A 3MSEB 2DOQA 3FWCA 1CTRA 1TNPA 2JC2A 3KF9A 4AOMA 4L9MA 4WQ2A 5HKWA 4A4BA 2I18A 1DGUA 4GGFA 2MA2A 1S26D 2EHBA 1AJ5A 3FWBA 1YR5A 2JNXA 3TS5C 1JC2A 1NX2A 1K93D 2PRUA 1ZFSA 1DF0A 3VGOA 2LANA 1PK0D 1S36A 3DF0B 3TZ1A 1QLSA 1PVBA 2EGDA 2O60A 1NCXA 1NUBA 2HQWA 1ZMZA 2Y4QA 1IKUA 1J7OA 4PHKA 1U5IA 4JWQA 4MN0A 3BUNB 5GQQC 2KYFA 1GGZA 2K7OA 4GGFC 3VRRA 3OB2B 1M31A 5PALA 2ZKMX 3SG3A 4IL1A 1DTLA 2PMYA 3PN7B 1C7WA 1K90D 1OMDA 2LLTA 3TUYB 2F3ZA 3H4SE 4N1FA 4PE7A 1QX5B 2AAOA 2FOTA 4JQ0D 2MRDA 1LINA 2M7LA 2D8NA 5HKZA 1BODA 4M2PA 3ZWHA 1QVIY 1G4YR 5DKRA 4DCKA 1QVIZ 1TOPA 1J7PA 4AQJA 3CWGA 4YBHB 3WNXB 3JTDB 1KWOB 1WLMA 3OP0A 3BUOB 4DUQA 2JOJA 1TCOB 4NDCA 1Y6WA 3ZNIA 1PSRA 1SCVA 3KO0A 2F3YA 3EVVA 1OMRA 1AHRA 4ZCUA 1XFZO 2QPTA 1DJIA 1PSBA 1JUOA 2M49B 2L4IA 2Y1MA 1JSAA 1NPQA 2M3WA 2JULA 3D0YA 1SR6B 5DKNA 2CBLA 1QS7A 2SASA 2LLUA 1CDLA 2JQ6A 3HX4A 2ZN9A 2LVJA 1FI6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KFG A;  1ALW A;  2L0P A;  3RM1 A;  3VRN A;  1WY9 A;  3CR5 X;  2KFH A;  2KAY A;  1F4O A;  1QX2 A;  2MLE C;  1KQM C;  4MRY A;  4I5J A;  3EK8 A;  1M63 B;  1Y1A A;  2Q4U A;  2WND A;  1SL8 A;  2TN4 A;  4PE1 A;  1CLL A;  3K21 A;  1MHO A;  5HLO A;  1YX8 A;  2V53 A;  2JZI A;  1TNW A;  2ZFD A;  2LVV A;  3DVK A;  4I5L B;  1KK8 B;  4MEW A;  1FI5 A;  2JTT A;  1OOJ A;  2L4H A;  2FCD A;  3A4U B;  1FBV A;  1C7V A;  2EC6 B;  1BMO A;  2WCB A;  1PUL A;  4PE4 A;  1H8B A;  2BBN A;  3DVM A;  3LCP C;  2Y1N A;  4OVN F;  2KI4 C;  4I5K A;  1W7I B;  3BYA A;  1F55 A;  5HKY A;  2JT0 A;  3EKJ A;  1S5G Y;  2M0R A;  1VRK A;  2LHL A;  3VRO A;  1BOC A;  1S5G Z;  1J1E A;  1Y1X A;  3BUX B;  1CFP A;  1XYD A;  1EH2 A;  2PSR A;  4ORB B;  1XFW O;  2L50 A;  1IRJ A;  4USL A;  3RLZ A;  4C0L A;  1CKK A;  1TN4 A;  3PFV A;  5F6T A;  1M46 A;  2LNK A;  1TNX A;  1YVH A;  2OTG C;  1X02 A;  3KPX A;  1NCZ A;  4R1E A;  4YGE B;  1CLB A;  1CLM A;  3EVR A;  4MBE A;  1JWD A;  2E6W A;  1BU3 A;  5FYX A;  1CMF A;  2H2K A;  2F2P A;  2BL0 B;  3WXA A;  1M39 A;  1SCM C;  1EXR A;  1CMG A;  2K0J A;  4HRE E;  2KYC A;  5IBW A;  4HSZ A;  2WC8 A;  1WDC B;  2JNF A;  2K8M B;  2LAP A;  3KEV A;  1A03 A;  1NWD A;  1RJV A;  3LLE A;  1FF1 A;  3TDU A;  2K7C A;  2RGI A;  3F45 A;  1J7Q A;  2ISD A;  2F8P A;  1SPY A;  3NSO A;  2COL B;  1UHK A;  2NCP A;  4PHN A;  1LA0 A;  3I5I B;  1F4Q A;  4ORC B;  2HQ8 A;  1K8U A;  4PCW A;  1DJW A;  1OZO A;  1MF8 B;  1AVS A;  2AMI A;  1OE9 B;  3DD4 A;  1RTP 1;  3CR4 X;  4YGC B;  4N1G A;  2P6B B;  1CFF A;  1M45 A;  2LE9 B;  3CGA A;  3HCM A;  3TS5 B;  2ZN8 A;  1NCY A;  4DRW A;  1BT6 A;  5I2L A;  3DVJ A;  4PHM A;  2K7D A;  1OSA A;  5AFP A;  1B9A A;  3TDZ A;  1DJX A;  4MLW A;  3SG2 A;  2KGR A;  2I94 A;  3QRX A;  1K2H A;  1OMV A;  2JWW A;  5KU1 A;  2LCP A;  2ZND A;  3TUY C;  1BG1 A;  1CDP A;  1NX1 A;  1DGV A;  2BKI B;  3CTN A;  4NDB A;  1NX0 A;  1V1G A;  5CSN A;  5G08 A;  3BOW A;  2Y5I A;  1QTX A;  1ZAC A;  2CCM A;  1DT7 B;  5AER A;  1NSH A;  3OX6 A;  1LKJ A;  1F71 A;  1MQ1 A;  1DF0 B;  2F33 A;  3JTD C;  1TTX A;  2KBM A;  1A4P A;  1S6I A;  3C1V A;  3I5F C;  1GQM A;  1AUI B;  2JPT A;  4MZK A;  3PAT A;  1A75 A;  1XVJ A;  2G2B A;  1B8R A;  1NIW A;  2JRF A;  2QAC A;  1J55 A;  2KBI A;  1DJG A;  1SMG A;  1JF2 A;  1N65 A;  2L51 A;  2JT8 A;  3PAL A;  1U5I B;  2BBM A;  4GPL B;  4DS7 A;  1GGW A;  5AEQ A;  1MXL C;  1JFK A;  2M97 A;  2BCX A;  2JTZ A;  1N2D A;  2LP2 A;  1KFX L;  1SRA A;  2VRG A;  2KAX A;  2WOS A;  3AKB A;  4MZL A;  3WHU B;  1BJF A;  2LC5 A;  2NXQ A;  2NLN A;  2PAL A;  1QAT A;  1QAS A;  3NXA A;  5DKQ A;  1LVC D;  1N0Y A;  2PAS A;  1J7R A;  2OS8 C;  3JVT B;  5CSF A;  1ZUZ A;  4OR9 B;  4GBA A;  1EL4 A;  1HQV A;  1RK9 A;  2JU0 A;  2IS9 A;  1WRK A;  3AKA A;  4FQO A;  1XK4 C;  1SK6 D;  1XA5 A;  1G33 A;  4C0J A;  2ZNE A;  1DVI A;  1QXP A;  1UHI A;  3I5H B;  1QV0 A;  2AUC A;  1WRZ A;  1UP5 A;  3EK7 A;  5J3X A;  1MXE A;  1V1F A;  4XJK A;  2WCE A;  4A4C A;  1F8H A;  1B7T Y;  1GJY A;  1NX3 A;  2KQ6 A;  1B47 A;  1KSO A;  3LK0 A;  1EG4 A;  3OHM B;  1B7T Z;  3VRQ A;  2CXJ A;  4CLN A;  2CTN A;  3EVU A;  3SJS A;  2M1U A;  1CM1 A;  2KGB C;  1R6P A;  2M29 A;  2HF5 A;  3AAJ A;  4CFR A;  1SBJ A;  1EJ3 A;  1J1D A;  4OV2 A;  3D0Y B;  1C07 A;  3E3R A;  2B1U A;  1WRL A;  2MHH A;  5HYD A;  1S6J A;  3NSI A;  3I5G B;  5I2O A;  5KTY A;  2F2O A;  5TNC A;  2MJW B;  1A2X A;  1YTZ C;  1UHN A;  3ICB A;  1K95 A;  5CPV A;  1G8I A;  1REC A;  2SCP A;  2GGZ A;  2LM5 A;  3FS7 A;  4YGB B;  5ER5 A;  1BR1 B;  4F0Z B;  5AXI A;  2K2F A;  4PDZ A;  3CS1 A;  4HRH A;  1TRF A;  1B8L A;  1QJT A;  2KI6 C;  3DF0 A;  4QJ4 B;  4C0K A;  4M2O A;  1PRW A;  1SKT A;  1BF5 A;  3OX5 A;  4I5N B;  4M2Q A;  1YUT A;  4CPV A;  1DJZ A;  4PAL A;  1L2O B;  2O5G A;  5D69 A;  1DJH A;  2H61 A;  3NSK A;  5I8N A;  1UHJ A;  2KFF A;  4YGD B;  1IGV A;  1WDC C;  1XFY O;  4FTG A;  1SL9 A;  4AQI A;  4Q04 A;  2LVI A;  1MUX A;  3GK2 A;  5BPJ A;  1YVL A;  1BLQ A;  1S6C A;  2HPS A;  4GUK A;  4OKH A;  1E8A A;  4NDD A;  1B1G A;  1OZS A;  3PM8 A;  3CR2 A;  1ZOT B;  1IWQ A;  5AAN A;  1OQP A;  2E30 A;  4PE0 A;  4UPG A;  2BE4 A;  1YUS A;  2H61 C;  1K96 A;  1YX7 A;  3O4Y A;  2KAV A;  1KQV A;  3O78 A;  1QIV A;  3VRP A;  2BKH B;  1SW8 A;  3CZT X;  1KSM A;  2JXC A;  2LMT A;  3PN7 C;  4D1E A;  2WOR A;  4E68 A;  1Q80 A;  2WCF A;  1F70 A;  3BQ3 A;  2MLF C;  1LXF C;  1B8C A;  1IJ5 A;  1KK7 Y;  3SIB A;  3SG5 A;  1KK7 Z;  4JPZ B;  2LHI A;  1FW4 A;  1JBA A;  2JT3 A;  2KDH A;  1R2U A;  2BEC A;  2K61 A;  2L2E A;  2LUX A;  2KNE A;  4YGA A;  1QX7 A;  4MRX A;  3KHE A;  1D1O A;  1KCY A;  1CDM A;  3FIA A;  3IQQ A;  2BCA A;  1PAL A;  3NSL A;  2KQY A;  1KWO C;  2CNP A;  2ZRS A;  1SYM A;  1YRT B;  3LL8 B;  2LP3 A;  1CM4 A;  1CNP A;  1K94 A;  2FCE A;  1NYA A;  1FPW A;  4GAO A;  1PVA A;  1UUS A;  4P2Y B;  1XK4 A;  3PSR A;  4BY5 A;  2I7A A;  1YUU A;  4QJ5 B;  5ER4 X;  4ORA B;  1K9U A;  3TDI A;  1SR6 C;  1BR4 B;  1XFU O;  4DIR A;  3CLN A;  2GGM A;  3I5F B;  2KHN A;  3AAK A;  2G9B A;  3PLF B;  4MSP A;  4QJ3 B;  1QIW A;  4HRG A;  5I2Q A;  1TNQ A;  1F54 A;  2FJU B;  2LLS A;  2LVK A;  4N5X A;  4MZJ A;  1AP4 A;  1CFC A;  3JVT C;  4OCI A;  3SG4 A;  3D10 A;  4CFQ A;  3IF7 A;  1JF0 A;  2BCB A;  2PVB A;  1SY9 A;  2M9G A;  2M7N A;  2MBX A;  1ALV A;  2M1K B;  1K9K A;  2LMU A;  3BOW B;  2KSP A;  3I5H C;  1KFU L;  3DVE A;  3GOF A;  3OB1 B;  1RRO A;  1SNL A;  4ZCV A;  3O6B A;  1MWN A;  4BY4 A;  2CT9 A;  1IQ5 A;  1KK8 C;  4YI8 A;  1HT9 A;  1RWY A;  1XFV O;  3GK1 A;  2OS8 B;  1ODB A;  3BUW B;  3BXK A;  3IQO A;  2K7B A;  4ETO A;  2LUC A;  1IH0 A;  1S1E A;  2LV7 A;  1NP8 A;  1A75 B;  1MR8 A;  2EC6 C;  2I2R E;  1KQM B;  1LA3 A;  1TCF A;  4P5O E;  5B8I B;  4GGN A;  4MVF A;  1KFX S;  3M0W A;  1AJ4 A;  5CSJ A;  2M8U A;  3SIA A;  2NZ0 A;  4XYN A;  1QV1 A;  3SG7 A;  1IQ3 A;  1WLZ A;  4CID A;  1CFD A;  5JOL A;  1L7Z A;  4YI9 A;  1CDN A;  3WHT B;  1QLK A;  1XFX O;  1YUR A;  4NQG A;  4WQ3 A;  4U8D A;  1DJY A;  2MAZ A;  3I5G C;  2ZRT A;  1S3P A;  1Y1U A;  1K9P A;  1UHH A;  1W7J B;  1SL7 A;  2BE6 A;  2NCO A;  2KOT A;  3BUM B;  1Y0V H;  5D7F A;  1EG3 A;  1CB1 A;  1IG5 A;  1H4B A;  1AK8 A;  1TIZ A;  5JJG A;  1UUR A;  2KI4 B;  3A8R A;  4WRI A;  2L98 A;  2JXL A;  2L5X B;  1IJ6 A;  2R2I A;  1KFU S;  4YRU A;  1YRU B;  1A29 A;  3EK4 A;  2BL0 C;  2K2A A;  1UWO A;  5KSZ A;  3O2P A;  4TNC A;  2HET A;  3EKH A;  4XJK B;  1DMO A;  2LMV A;  3GK4 X;  4ICB A;  5HLV A;  2OTG B;  2A4J A;  1L2O C;  2OPO A;  1RFJ A;  3LK1 A;  4GFT A;  5CSI A;  2KI6 D;  1B4C A;  1XO5 A;  1JFJ A;  4PHJ A;  2Q91 A;  2GV5 A;  1SCM B;  4GNK B;  5K89 A;  3I5I C;  3SG6 A;  3MSE B;  2DOQ A;  3FWC A;  1CTR A;  1TNP A;  2JC2 A;  3KF9 A;  4AOM A;  4L9M A;  4WQ2 A;  5HKW A;  4A4B A;  2I18 A;  1DGU A;  4GGF A;  2MA2 A;  1S26 D;  2EHB A;  1AJ5 A;  3FWB A;  1YR5 A;  2JNX A;  3TS5 C;  1JC2 A;  1NX2 A;  1K93 D;  2PRU A;  1ZFS A;  1DF0 A;  3VGO A;  2LAN A;  1PK0 D;  1S36 A;  3DF0 B;  3TZ1 A;  1QLS A;  1PVB A;  2EGD A;  2O60 A;  1NCX A;  1NUB A;  2HQW A;  1ZMZ A;  2Y4Q A;  1IKU A;  1J7O A;  4PHK A;  1U5I A;  4JWQ A;  4MN0 A;  3BUN B;  5GQQ C;  2KYF A;  1GGZ A;  2K7O A;  4GGF C;  3VRR A;  3OB2 B;  1M31 A;  5PAL A;  2ZKM X;  3SG3 A;  4IL1 A;  1DTL A;  2PMY A;  3PN7 B;  1C7W A;  1K90 D;  1OMD A;  2LLT A;  3TUY B;  2F3Z A;  3H4S E;  4N1F A;  4PE7 A;  1QX5 B;  2AAO A;  2FOT A;  4JQ0 D;  2MRD A;  1LIN A;  2M7L A;  2D8N A;  5HKZ A;  1BOD A;  4M2P A;  3ZWH A;  1QVI Y;  1G4Y R;  5DKR A;  4DCK A;  1QVI Z;  1TOP A;  1J7P A;  4AQJ A;  3CWG A;  4YBH B;  3WNX B;  3JTD B;  1KWO B;  1WLM A;  3OP0 A;  3BUO B;  4DUQ A;  2JOJ A;  1TCO B;  4NDC A;  1Y6W A;  3ZNI A;  1PSR A;  1SCV A;  3KO0 A;  2F3Y A;  3EVV A;  1OMR A;  1AHR A;  4ZCU A;  1XFZ O;  2QPT A;  1DJI A;  1PSB A;  1JUO A;  2M49 B;  2L4I A;  2Y1M A;  1JSA A;  1NPQ A;  2M3W A;  2JUL A;  3D0Y A;  1SR6 B;  5DKN A;  2CBL A;  1QS7 A;  2SAS A;  2LLU A;  1CDL A;  2JQ6 A;  3HX4 A;  2ZN9 A;  2LVJ A;  1FI6 A; 
#chains in the Genus database with same CATH topology
 2KFG A;  1ALW A;  2L0P A;  3RM1 A;  3VRN A;  2K60 A;  1WY9 A;  4KYN A;  3CR5 X;  2KFH A;  2KAY A;  1F4O A;  1QX2 A;  2MLE C;  1KQM C;  4MRY A;  4I5J A;  3RZS A;  3EK8 A;  3FE8 A;  1M63 B;  1Y1A A;  2Q4U A;  2WND A;  1SL8 A;  2TN4 A;  4PE1 A;  1CLL A;  1OW4 A;  3K21 A;  1MHO A;  5HLO A;  1YX8 A;  2V53 A;  2JZI A;  1TNW A;  2ZFD A;  2LVV A;  3DVK A;  4I5L B;  1KK8 B;  4MEW A;  1FI5 A;  2JTT A;  3BFH A;  1OOJ A;  2L4H A;  2FCD A;  3A4U B;  1FBV A;  1DC1 A;  2EC6 B;  1BMO A;  2WCB A;  1C7V A;  1PUL A;  3FE6 A;  4PE4 A;  1H8B A;  2BBN A;  3OGN A;  3DVM A;  3LCP C;  2Y1N A;  2WCL A;  4OVN F;  2KI4 C;  4I5K A;  4INW A;  1W7I B;  3BYA A;  1F55 A;  1IIO A;  5HKY A;  2JT0 A;  3EKJ A;  1S5G Y;  2M0R A;  1VRK A;  2LHL A;  3VRO A;  1BOC A;  1S5G Z;  1J1E A;  1Y1X A;  3BUX B;  1CFP A;  1XYD A;  1EH2 A;  2PSR A;  4ORB B;  1XFW O;  2L50 A;  1IRJ A;  4USL A;  3RLZ A;  4C0L A;  1CKK A;  1TN4 A;  3PFV A;  4JD9 A;  5F6T A;  1M46 A;  3R72 A;  2LNK A;  1TNX A;  1YVH A;  2OTG C;  1TUJ A;  1X02 A;  1NCZ A;  3KPX A;  4R1E A;  4YGE B;  1CLB A;  3B88 A;  1CLM A;  2QDI A;  3CZ1 A;  3SS3 A;  3EVR A;  4MBE A;  4F7F A;  1JWD A;  2E6W A;  1BU3 A;  4JKT A;  5FYX A;  1CMF A;  2H2K A;  2F2P A;  2BL0 B;  3WXA A;  1M39 A;  1SCM C;  1EXR A;  3CZ0 A;  1CMG A;  2K0J A;  4HRE E;  2KYC A;  2P70 A;  5IBW A;  4HSZ A;  2WC8 A;  1WDC B;  2JNF A;  2K8M B;  2LAP A;  3KEV A;  1A03 A;  1NWD A;  1RJV A;  2QEO A;  3LLE A;  3TDU A;  2K7C A;  2RGI A;  3F45 A;  1J7Q A;  1FF1 A;  2ISD A;  2F8P A;  1SPY A;  3NSO A;  2COL B;  1UHK A;  3N7H A;  3D75 A;  2WCK A;  2NCP A;  4PHN A;  1LA0 A;  3I5I B;  1F4Q A;  4ORC B;  2HQ8 A;  1K8U A;  4PCW A;  1DJW A;  1OZO A;  1MF8 B;  1AVS A;  2AMI A;  1OE9 B;  3DD4 A;  1RTP 1;  3CR4 X;  4YGC B;  4N1G A;  2P6B B;  1CFF A;  1M45 A;  2LE9 B;  3CGA A;  3HCM A;  3TS5 B;  2ZN8 A;  1NCY A;  4DRW A;  1BT6 A;  5I2L A;  3DVJ A;  4PHM A;  2K7D A;  3D78 A;  1OSA A;  5AFP A;  1B9A A;  2KLD A;  3TDZ A;  1DJX A;  3K1E A;  4MLW A;  3SG2 A;  2KGR A;  2I94 A;  3QRX A;  3CZ2 A;  1K2H A;  1OMV A;  2JWW A;  5KU1 A;  2LCP A;  2ZND A;  3TUY C;  1BG1 A;  2QEB A;  1CDP A;  1NX1 A;  1DGV A;  2BKI B;  3CTN A;  4NDB A;  1NX0 A;  1V1G A;  5CSN A;  5G08 A;  3BOW A;  2Y5I A;  1QTX A;  1ZAC A;  2CCM A;  1DT7 B;  5AER A;  1NSH A;  3OX6 A;  2GTE A;  1LKJ A;  3L4L A;  1F71 A;  1MQ1 A;  1DF0 B;  2F33 A;  3JTD C;  1TTX A;  2KBM A;  1A4P A;  1S6I A;  3C1V A;  3I5F C;  1GQM A;  1AUI B;  1ORG A;  2JPT A;  4MZK A;  3PAT A;  3S0G A;  1A75 A;  1XVJ A;  2G2B A;  1B8R A;  1NIW A;  2JRF A;  2KLE A;  2QAC A;  1J55 A;  2KBI A;  1DJG A;  3UO9 A;  1SMG A;  1JF2 A;  3R1P A;  1N65 A;  2L51 A;  2JT8 A;  3PAL A;  1U5I B;  2BBM A;  4GPL B;  4DS7 A;  1GGW A;  5AEQ A;  1MXL C;  1JFK A;  2M97 A;  2BCX A;  2JTZ A;  1N2D A;  2LP2 A;  1KFX L;  1SRA A;  2VRG A;  2KAX A;  2WOS A;  3AKB A;  4MZL A;  3WHU B;  1BJF A;  2LC5 A;  2NXQ A;  2NLN A;  2PAL A;  1QAT A;  1QAS A;  3NXA A;  5DKQ A;  1LVC D;  1N0Y A;  2PAS A;  1J7R A;  3D73 A;  1SSE B;  2OS8 C;  3JVT B;  5CSF A;  1ZUZ A;  4OR9 B;  4GBA A;  1EL4 A;  1HQV A;  1RK9 A;  2JU0 A;  2IS9 A;  1WRK A;  3AKA A;  4FQO A;  1XK4 C;  1SK6 D;  3DY9 A;  1XA5 A;  1G33 A;  4C0J A;  2ZNE A;  1DVI A;  1QXP A;  1UHI A;  3I5H B;  5FI7 A;  1QV0 A;  2AUC A;  1WRZ A;  1UP5 A;  2PQL A;  3EK7 A;  5J3X A;  1MXE A;  1V1F A;  4XJK A;  2WCE A;  4A4C A;  1F8H A;  1B7T Y;  1GJY A;  1NX3 A;  1P28 A;  1B47 A;  1KSO A;  2KQ6 A;  1EG4 A;  3LK0 A;  1B7T Z;  3OHM B;  3VRQ A;  2CXJ A;  4CLN A;  2CTN A;  3EVU A;  3SJS A;  2M1U A;  1CM1 A;  2KGB C;  1R6P A;  2M29 A;  2WCM A;  2YGU A;  3QME A;  2HF5 A;  3AAJ A;  3R1V A;  4CFR A;  1C3Y A;  1SBJ A;  1EJ3 A;  1J1D A;  4OV2 A;  3D0Y B;  1C07 A;  3E3R A;  2B1U A;  1WRL A;  2MHH A;  5HYD A;  1S6J A;  3NSI A;  3I5G B;  5I2O A;  5KTY A;  2F2O A;  5TNC A;  2MJW B;  1A2X A;  1LS8 A;  1YTZ C;  1UHN A;  2WCH A;  3ICB A;  1K95 A;  5CPV A;  1G8I A;  2QEV A;  1W9Z A;  1REC A;  2SCP A;  1DEL A;  2GGZ A;  2LM5 A;  3FS7 A;  4YGB B;  5ER5 A;  1BR1 B;  4F0Z B;  5AXI A;  2K2F A;  4PDZ A;  3CS1 A;  4HRH A;  1TRF A;  1B8L A;  1QJT A;  2KI6 C;  3DF0 A;  2KPH A;  4QJ4 B;  4C0K A;  4M2O A;  1PRW A;  1SKT A;  1BF5 A;  3S0F A;  2ERB A;  3OX5 A;  4I5N B;  4M2Q A;  1YUT A;  4CPV A;  1DJZ A;  4PAL A;  1L2O B;  3R1O A;  2O5G A;  5D69 A;  1DJH A;  2H61 A;  3NSK A;  5I8N A;  1UHJ A;  2KFF A;  4YGD B;  1IGV A;  1WDC C;  1XFY O;  4FTG A;  1SL9 A;  4AQI A;  4Q04 A;  2LVI A;  1MUX A;  3GK2 A;  5BPJ A;  1YVL A;  1BLQ A;  3S0B A;  1S6C A;  2HPS A;  4GUK A;  4OKH A;  1E8A A;  4NDD A;  5HL1 A;  1B1G A;  2H8V A;  1OZS A;  3PM8 A;  3SS4 A;  3CR2 A;  1ZOT B;  1IWQ A;  5AAN A;  1OQP A;  2E30 A;  4PE0 A;  4UPG A;  2BE4 A;  1YUS A;  2H61 C;  1K96 A;  1YX7 A;  3O4Y A;  2KAV A;  1KQV A;  3O78 A;  1QIV A;  3VRP A;  2BKH B;  1SW8 A;  3CZT X;  1KSM A;  2JXC A;  2LMT A;  3PN7 C;  4D1E A;  2L2C A;  2WOR A;  4E68 A;  1Q80 A;  2WCF A;  1F70 A;  3BQ3 A;  2MLF C;  3NGV A;  1LXF C;  1B8C A;  1IJ5 A;  1KK7 Y;  3SIB A;  3SG5 A;  1KK7 Z;  4JPZ B;  2LHI A;  1FW4 A;  1JBA A;  2JT3 A;  2KDH A;  1R2U A;  2BEC A;  2K61 A;  2L2E A;  2LUX A;  2KNE A;  4YGA A;  1QX7 A;  3B87 A;  4MRX A;  3KHE A;  1D1O A;  1KCY A;  1CDM A;  3FIA A;  3IQQ A;  2BCA A;  3L4A A;  1PAL A;  3NSL A;  2KQY A;  1KWO C;  2CNP A;  3DXL A;  3D77 A;  3EG5 B;  2ZRS A;  1SYM A;  1YRT B;  3LL8 B;  2LP3 A;  3CDN A;  1CM4 A;  3PM2 A;  1CNP A;  1K94 A;  2FCE A;  1NYA A;  1OOH A;  1FPW A;  4GAO A;  1PVA A;  1UUS A;  4P2Y B;  1XK4 A;  3PSR A;  4BY5 A;  2I7A A;  1YUU A;  4QJ5 B;  5ER4 X;  4INX A;  3FE9 A;  4ORA B;  1OOI X;  1K9U A;  3TDI A;  1SR6 C;  1BR4 B;  1XFU O;  3BFB A;  4DIR A;  3CLN A;  2GGM A;  3I5F B;  2KHN A;  3AAK A;  2G9B A;  3PLF B;  4MSP A;  4OZD A;  1QIW A;  4QJ3 B;  4HRG A;  5I2Q A;  3NHT A;  1TNQ A;  1F54 A;  2FJU B;  3O4X A;  2LLS A;  2LVK A;  1Z2C B;  4N5X A;  4MZJ A;  1AP4 A;  1CFC A;  3JVT C;  4OCI A;  3SG4 A;  3D10 A;  4CFQ A;  3IF7 A;  2WC5 A;  1JF0 A;  2BCB A;  1QWV A;  2PVB A;  3UNW A;  1SY9 A;  2M9G A;  3OBV A;  2M7N A;  3PJI A;  2MBX A;  1ALV A;  2M1K B;  1K9K A;  2LMU A;  3BOW B;  2KSP A;  3S0E A;  3I5H C;  1KFU L;  3DVE A;  3GOF A;  3OB1 B;  2PYQ A;  1RRO A;  1SNL A;  4IJ7 A;  4ZCV A;  3O6B A;  1MWN A;  4BY4 A;  3IVT A;  2CT9 A;  1IQ5 A;  3Q8I A;  1KK8 C;  4YI8 A;  1HT9 A;  1RWY A;  1XFV O;  3GK1 A;  2OS8 B;  1ODB A;  3BUW B;  3BXK A;  3IQO A;  2K7B A;  4ETO A;  2LUC A;  1IH0 A;  1S1E A;  2LV7 A;  1NP8 A;  1A75 B;  1MR8 A;  2EC6 C;  2I2R E;  1KQM B;  1LA3 A;  1TCF A;  4P5O E;  5B8I B;  4GGN A;  4MVF A;  1KFX S;  5FI2 A;  3M0W A;  5EL2 A;  1AJ4 A;  1DEK A;  5CSJ A;  2M8U A;  3SIA A;  2FJY A;  2NZ0 A;  4XYN A;  1QV1 A;  3SG7 A;  1IQ3 A;  1WLZ A;  4CID A;  1CFD A;  5JOL A;  1XFR A;  1L7Z A;  4YI9 A;  1CDN A;  3WHT B;  1QLK A;  1XFX O;  1YUR A;  4NQG A;  4WQ3 A;  4U8D A;  1DJY A;  2MAZ A;  3I5G C;  1TWO A;  2ZRT A;  1S3P A;  3L47 A;  1Y1U A;  1K9P A;  1UHH A;  1W7J B;  1SL7 A;  2BE6 A;  2NCO A;  2KOT A;  3BUM B;  1Y0V H;  5D7F A;  1EG3 A;  1CB1 A;  1IG5 A;  1H4B A;  1AK8 A;  1TIZ A;  5JJG A;  1UUR A;  2KI4 B;  3A8R A;  4WRI A;  2L98 A;  2JXL A;  2L5X B;  1IJ6 A;  2R2I A;  1KFU S;  4YRU A;  3NHI A;  3D76 A;  1YRU B;  2QEH A;  1A29 A;  3EK4 A;  2BL0 C;  2K2A A;  1UWO A;  5FI6 A;  3O2P A;  5KSZ A;  4TNC A;  2HET A;  3EKH A;  4XJK B;  1DMO A;  2LMV A;  3GK4 X;  4ICB A;  5HLV A;  2OTG B;  2A4J A;  1L2O C;  2OPO A;  1RFJ A;  3LK1 A;  4GFT A;  5CSI A;  2KI6 D;  1B4C A;  1XO5 A;  1JFJ A;  4PT1 A;  4PHJ A;  2Q91 A;  2GV5 A;  1SCM B;  4GNK B;  5K89 A;  3I5I C;  2JPO A;  3SG6 A;  3MSE B;  2DOQ A;  1TUZ A;  3FWC A;  1CTR A;  1TNP A;  2JC2 A;  3D74 A;  3KF9 A;  4AOM A;  3DZT A;  4L9M A;  4WQ2 A;  5HKW A;  4A4B A;  2I18 A;  1DGU A;  4GGF A;  2MA2 A;  1S26 D;  2EHB A;  1AJ5 A;  5DIC A;  3FWB A;  1YR5 A;  3S0A A;  2JNX A;  3TS5 C;  1JC2 A;  1NX2 A;  1K93 D;  2PRU A;  1ZFS A;  1DF0 A;  3VGO A;  2LAN A;  1PK0 D;  1S36 A;  1GM0 A;  2BAP A;  3DF0 B;  3TZ1 A;  1QLS A;  2WCJ A;  1PVB A;  2EGD A;  2O60 A;  3BFA A;  4FQT A;  1NCX A;  1NUB A;  2HQW A;  1ZMZ A;  2Y4Q A;  1IKU A;  1J7O A;  4PHK A;  1U5I A;  4JWQ A;  4MN0 A;  3CYZ A;  3SS5 A;  3BUN B;  5GQQ C;  3B86 A;  2KYF A;  1GGZ A;  2K7O A;  4GGF C;  3VRR A;  3OB2 B;  1M31 A;  5PAL A;  2ZKM X;  3B7A A;  3VB1 A;  3SG3 A;  3CAB A;  4IL1 A;  1DTL A;  2PMY A;  3PN7 B;  1C7W A;  1K90 D;  1OMD A;  2LLT A;  3TUY B;  1C3Z A;  1DQE A;  2F3Z A;  3H4S E;  4N1F A;  1Z4H A;  1T14 A;  2WC6 A;  4PE7 A;  1QX5 B;  3S0D A;  2AAO A;  2BNX A;  2FOT A;  4JQ0 D;  2MRD A;  1LIN A;  2M7L A;  2D8N A;  5HKZ A;  1BOD A;  4M2P A;  3ZWH A;  1QVI Y;  1G4Y R;  5DKR A;  4DCK A;  1QVI Z;  1TOP A;  1J7P A;  4AQJ A;  3CWG A;  4YBH B;  3BJH A;  3WNX B;  3JTD B;  1KWO B;  1WLM A;  3OP0 A;  2P71 A;  3BUO B;  4DUQ A;  2JOJ A;  1TCO B;  4NDC A;  1Y6W A;  3V2L A;  3ZNI A;  1OOG A;  1PSR A;  1SCV A;  3KO0 A;  2F3Y A;  3EVV A;  1OMR A;  1AHR A;  4ZCU A;  1XFZ O;  2QPT A;  1DJI A;  1PSB A;  1JUO A;  2M49 B;  2L4I A;  2Y1M A;  5I94 A;  1JSA A;  1NPQ A;  2M3W A;  2JUL A;  3DYE A;  5D3O A;  3D0Y A;  1SR6 B;  3B6X A;  5DKN A;  2CBL A;  1OOF A;  1QS7 A;  2SAS A;  2LLU A;  1CDL A;  2JQ6 A;  3HX4 A;  2ZN9 A;  2LVJ A;  1FI6 A;  2L5Y A; 
#chains in the Genus database with same CATH homology
 2KFG A;  1ALW A;  2L0P A;  3RM1 A;  3VRN A;  1WY9 A;  3CR5 X;  2KFH A;  2KAY A;  1F4O A;  1QX2 A;  2MLE C;  1KQM C;  4MRY A;  4I5J A;  3EK8 A;  1M63 B;  1Y1A A;  2Q4U A;  2WND A;  1SL8 A;  2TN4 A;  4PE1 A;  1CLL A;  3K21 A;  1MHO A;  5HLO A;  1YX8 A;  2V53 A;  2JZI A;  1TNW A;  2ZFD A;  2LVV A;  3DVK A;  4I5L B;  1KK8 B;  4MEW A;  1FI5 A;  2JTT A;  1OOJ A;  2L4H A;  2FCD A;  3A4U B;  1FBV A;  1C7V A;  2EC6 B;  1BMO A;  2WCB A;  1PUL A;  4PE4 A;  1H8B A;  2BBN A;  3DVM A;  3LCP C;  2Y1N A;  4OVN F;  2KI4 C;  4I5K A;  1W7I B;  3BYA A;  1F55 A;  5HKY A;  2JT0 A;  3EKJ A;  1S5G Y;  2M0R A;  1VRK A;  2LHL A;  3VRO A;  1BOC A;  1S5G Z;  1J1E A;  1Y1X A;  3BUX B;  1CFP A;  1XYD A;  1EH2 A;  2PSR A;  4ORB B;  1XFW O;  2L50 A;  1IRJ A;  4USL A;  3RLZ A;  4C0L A;  1CKK A;  1TN4 A;  3PFV A;  5F6T A;  1M46 A;  2LNK A;  1TNX A;  1YVH A;  2OTG C;  1X02 A;  3KPX A;  1NCZ A;  4R1E A;  4YGE B;  1CLB A;  1CLM A;  3EVR A;  4MBE A;  1JWD A;  2E6W A;  1BU3 A;  5FYX A;  1CMF A;  2H2K A;  2F2P A;  2BL0 B;  3WXA A;  1M39 A;  1SCM C;  1EXR A;  1CMG A;  2K0J A;  4HRE E;  2KYC A;  5IBW A;  4HSZ A;  2WC8 A;  1WDC B;  2JNF A;  2K8M B;  2LAP A;  3KEV A;  1A03 A;  1NWD A;  1RJV A;  3LLE A;  1FF1 A;  3TDU A;  2K7C A;  2RGI A;  3F45 A;  1J7Q A;  2ISD A;  2F8P A;  1SPY A;  3NSO A;  2COL B;  1UHK A;  2NCP A;  4PHN A;  1LA0 A;  3I5I B;  1F4Q A;  4ORC B;  2HQ8 A;  1K8U A;  4PCW A;  1DJW A;  1OZO A;  1MF8 B;  1AVS A;  2AMI A;  1OE9 B;  3DD4 A;  1RTP 1;  3CR4 X;  4YGC B;  4N1G A;  2P6B B;  1CFF A;  1M45 A;  2LE9 B;  3CGA A;  3HCM A;  3TS5 B;  2ZN8 A;  1NCY A;  4DRW A;  1BT6 A;  5I2L A;  3DVJ A;  4PHM A;  2K7D A;  1OSA A;  5AFP A;  1B9A A;  3TDZ A;  1DJX A;  4MLW A;  3SG2 A;  2KGR A;  2I94 A;  3QRX A;  1K2H A;  1OMV A;  2JWW A;  5KU1 A;  2LCP A;  2ZND A;  3TUY C;  1BG1 A;  1CDP A;  1NX1 A;  1DGV A;  2BKI B;  3CTN A;  4NDB A;  1NX0 A;  1V1G A;  5CSN A;  5G08 A;  3BOW A;  2Y5I A;  1QTX A;  1ZAC A;  2CCM A;  1DT7 B;  5AER A;  1NSH A;  3OX6 A;  1LKJ A;  1F71 A;  1MQ1 A;  1DF0 B;  2F33 A;  3JTD C;  1TTX A;  2KBM A;  1A4P A;  1S6I A;  3C1V A;  3I5F C;  1GQM A;  1AUI B;  2JPT A;  4MZK A;  3PAT A;  1A75 A;  1XVJ A;  2G2B A;  1B8R A;  1NIW A;  2JRF A;  2QAC A;  1J55 A;  2KBI A;  1DJG A;  1SMG A;  1JF2 A;  1N65 A;  2L51 A;  2JT8 A;  3PAL A;  1U5I B;  2BBM A;  4GPL B;  4DS7 A;  1GGW A;  5AEQ A;  1MXL C;  1JFK A;  2M97 A;  2BCX A;  2JTZ A;  1N2D A;  2LP2 A;  1KFX L;  1SRA A;  2VRG A;  2KAX A;  2WOS A;  3AKB A;  4MZL A;  3WHU B;  1BJF A;  2LC5 A;  2NXQ A;  2NLN A;  2PAL A;  1QAT A;  1QAS A;  3NXA A;  5DKQ A;  1LVC D;  1N0Y A;  2PAS A;  1J7R A;  2OS8 C;  3JVT B;  5CSF A;  1ZUZ A;  4OR9 B;  4GBA A;  1EL4 A;  1HQV A;  1RK9 A;  2JU0 A;  2IS9 A;  1WRK A;  3AKA A;  4FQO A;  1XK4 C;  1SK6 D;  1XA5 A;  1G33 A;  4C0J A;  2ZNE A;  1DVI A;  1QXP A;  1UHI A;  3I5H B;  1QV0 A;  2AUC A;  1WRZ A;  1UP5 A;  3EK7 A;  5J3X A;  1MXE A;  1V1F A;  4XJK A;  2WCE A;  4A4C A;  1F8H A;  1B7T Y;  1GJY A;  1NX3 A;  2KQ6 A;  1B47 A;  1KSO A;  3LK0 A;  1EG4 A;  3OHM B;  1B7T Z;  3VRQ A;  2CXJ A;  4CLN A;  2CTN A;  3EVU A;  3SJS A;  2M1U A;  1CM1 A;  2KGB C;  1R6P A;  2M29 A;  2HF5 A;  3AAJ A;  4CFR A;  1SBJ A;  1EJ3 A;  1J1D A;  4OV2 A;  3D0Y B;  1C07 A;  3E3R A;  2B1U A;  1WRL A;  2MHH A;  5HYD A;  1S6J A;  3NSI A;  3I5G B;  5I2O A;  5KTY A;  2F2O A;  5TNC A;  2MJW B;  1A2X A;  1YTZ C;  1UHN A;  3ICB A;  1K95 A;  5CPV A;  1G8I A;  1REC A;  2SCP A;  2GGZ A;  2LM5 A;  3FS7 A;  4YGB B;  5ER5 A;  1BR1 B;  4F0Z B;  5AXI A;  2K2F A;  4PDZ A;  3CS1 A;  4HRH A;  1TRF A;  1B8L A;  1QJT A;  2KI6 C;  3DF0 A;  4QJ4 B;  4C0K A;  4M2O A;  1PRW A;  1SKT A;  1BF5 A;  3OX5 A;  4I5N B;  4M2Q A;  1YUT A;  4CPV A;  1DJZ A;  4PAL A;  1L2O B;  2O5G A;  5D69 A;  1DJH A;  2H61 A;  3NSK A;  5I8N A;  1UHJ A;  2KFF A;  4YGD B;  1IGV A;  1WDC C;  1XFY O;  4FTG A;  1SL9 A;  4AQI A;  4Q04 A;  2LVI A;  1MUX A;  3GK2 A;  5BPJ A;  1YVL A;  1BLQ A;  1S6C A;  2HPS A;  4GUK A;  4OKH A;  1E8A A;  4NDD A;  1B1G A;  1OZS A;  3PM8 A;  3CR2 A;  1ZOT B;  1IWQ A;  5AAN A;  1OQP A;  2E30 A;  4PE0 A;  4UPG A;  2BE4 A;  1YUS A;  2H61 C;  1K96 A;  1YX7 A;  3O4Y A;  2KAV A;  1KQV A;  3O78 A;  1QIV A;  3VRP A;  2BKH B;  1SW8 A;  3CZT X;  1KSM A;  2JXC A;  2LMT A;  3PN7 C;  4D1E A;  2WOR A;  4E68 A;  1Q80 A;  2WCF A;  1F70 A;  3BQ3 A;  2MLF C;  1LXF C;  1B8C A;  1IJ5 A;  1KK7 Y;  3SIB A;  3SG5 A;  1KK7 Z;  4JPZ B;  2LHI A;  1FW4 A;  1JBA A;  2JT3 A;  2KDH A;  1R2U A;  2BEC A;  2K61 A;  2L2E A;  2LUX A;  2KNE A;  4YGA A;  1QX7 A;  4MRX A;  3KHE A;  1D1O A;  1KCY A;  1CDM A;  3FIA A;  3IQQ A;  2BCA A;  1PAL A;  3NSL A;  2KQY A;  1KWO C;  2CNP A;  2ZRS A;  1SYM A;  1YRT B;  3LL8 B;  2LP3 A;  1CM4 A;  1CNP A;  1K94 A;  2FCE A;  1NYA A;  1FPW A;  4GAO A;  1PVA A;  1UUS A;  4P2Y B;  1XK4 A;  3PSR A;  4BY5 A;  2I7A A;  1YUU A;  4QJ5 B;  5ER4 X;  4ORA B;  1K9U A;  3TDI A;  1SR6 C;  1BR4 B;  1XFU O;  4DIR A;  3CLN A;  2GGM A;  3I5F B;  2KHN A;  3AAK A;  2G9B A;  3PLF B;  4MSP A;  4QJ3 B;  1QIW A;  4HRG A;  5I2Q A;  1TNQ A;  1F54 A;  2FJU B;  2LLS A;  2LVK A;  4N5X A;  4MZJ A;  1AP4 A;  1CFC A;  3JVT C;  4OCI A;  3SG4 A;  3D10 A;  4CFQ A;  3IF7 A;  1JF0 A;  2BCB A;  2PVB A;  1SY9 A;  2M9G A;  2M7N A;  2MBX A;  1ALV A;  2M1K B;  1K9K A;  2LMU A;  3BOW B;  2KSP A;  3I5H C;  1KFU L;  3DVE A;  3GOF A;  3OB1 B;  1RRO A;  1SNL A;  4ZCV A;  3O6B A;  1MWN A;  4BY4 A;  2CT9 A;  1IQ5 A;  1KK8 C;  4YI8 A;  1HT9 A;  1RWY A;  1XFV O;  3GK1 A;  2OS8 B;  1ODB A;  3BUW B;  3BXK A;  3IQO A;  2K7B A;  4ETO A;  2LUC A;  1IH0 A;  1S1E A;  2LV7 A;  1NP8 A;  1A75 B;  1MR8 A;  2EC6 C;  2I2R E;  1KQM B;  1LA3 A;  1TCF A;  4P5O E;  5B8I B;  4GGN A;  4MVF A;  1KFX S;  3M0W A;  1AJ4 A;  5CSJ A;  2M8U A;  3SIA A;  2NZ0 A;  4XYN A;  1QV1 A;  3SG7 A;  1IQ3 A;  1WLZ A;  4CID A;  1CFD A;  5JOL A;  1L7Z A;  4YI9 A;  1CDN A;  3WHT B;  1QLK A;  1XFX O;  1YUR A;  4NQG A;  4WQ3 A;  4U8D A;  1DJY A;  2MAZ A;  3I5G C;  2ZRT A;  1S3P A;  1Y1U A;  1K9P A;  1UHH A;  1W7J B;  1SL7 A;  2BE6 A;  2NCO A;  2KOT A;  3BUM B;  1Y0V H;  5D7F A;  1EG3 A;  1CB1 A;  1IG5 A;  1H4B A;  1AK8 A;  1TIZ A;  5JJG A;  1UUR A;  2KI4 B;  3A8R A;  4WRI A;  2L98 A;  2JXL A;  2L5X B;  1IJ6 A;  2R2I A;  1KFU S;  4YRU A;  1YRU B;  1A29 A;  3EK4 A;  2BL0 C;  2K2A A;  1UWO A;  5KSZ A;  3O2P A;  4TNC A;  2HET A;  3EKH A;  4XJK B;  1DMO A;  2LMV A;  3GK4 X;  4ICB A;  5HLV A;  2OTG B;  2A4J A;  1L2O C;  2OPO A;  1RFJ A;  3LK1 A;  4GFT A;  5CSI A;  2KI6 D;  1B4C A;  1XO5 A;  1JFJ A;  4PHJ A;  2Q91 A;  2GV5 A;  1SCM B;  4GNK B;  5K89 A;  3I5I C;  3SG6 A;  3MSE B;  2DOQ A;  3FWC A;  1CTR A;  1TNP A;  2JC2 A;  3KF9 A;  4AOM A;  4L9M A;  4WQ2 A;  5HKW A;  4A4B A;  2I18 A;  1DGU A;  4GGF A;  2MA2 A;  1S26 D;  2EHB A;  1AJ5 A;  3FWB A;  1YR5 A;  2JNX A;  3TS5 C;  1JC2 A;  1NX2 A;  1K93 D;  2PRU A;  1ZFS A;  1DF0 A;  3VGO A;  2LAN A;  1PK0 D;  1S36 A;  3DF0 B;  3TZ1 A;  1QLS A;  1PVB A;  2EGD A;  2O60 A;  1NCX A;  1NUB A;  2HQW A;  1ZMZ A;  2Y4Q A;  1IKU A;  1J7O A;  4PHK A;  1U5I A;  4JWQ A;  4MN0 A;  3BUN B;  5GQQ C;  2KYF A;  1GGZ A;  2K7O A;  4GGF C;  3VRR A;  3OB2 B;  1M31 A;  5PAL A;  2ZKM X;  3SG3 A;  4IL1 A;  1DTL A;  2PMY A;  3PN7 B;  1C7W A;  1K90 D;  1OMD A;  2LLT A;  3TUY B;  2F3Z A;  3H4S E;  4N1F A;  4PE7 A;  1QX5 B;  2AAO A;  2FOT A;  4JQ0 D;  2MRD A;  1LIN A;  2M7L A;  2D8N A;  5HKZ A;  1BOD A;  4M2P A;  3ZWH A;  1QVI Y;  1G4Y R;  5DKR A;  4DCK A;  1QVI Z;  1TOP A;  1J7P A;  4AQJ A;  3CWG A;  4YBH B;  3WNX B;  3JTD B;  1KWO B;  1WLM A;  3OP0 A;  3BUO B;  4DUQ A;  2JOJ A;  1TCO B;  4NDC A;  1Y6W A;  3ZNI A;  1PSR A;  1SCV A;  3KO0 A;  2F3Y A;  3EVV A;  1OMR A;  1AHR A;  4ZCU A;  1XFZ O;  2QPT A;  1DJI A;  1PSB A;  1JUO A;  2M49 B;  2L4I A;  2Y1M A;  1JSA A;  1NPQ A;  2M3W A;  2JUL A;  3D0Y A;  1SR6 B;  5DKN A;  2CBL A;  1QS7 A;  2SAS A;  2LLU A;  1CDL A;  2JQ6 A;  3HX4 A;  2ZN9 A;  2LVJ A;  1FI6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...