4XYNA

X-ray structure of ca(2+)-s100b with human rage-derived w61 peptide
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
90
structure length
90
Chain Sequence
MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein, metal binding protein
molecule keywords Receptor for advanced glycation endproducts-derived peptide
publication title Structural insights into the binding of the human receptor for advanced glycation end products (RAGE) by S100B, as revealed by an S100B-RAGE-derived peptide complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 90
sequence length 90
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4xynA00
3EVVA 4JWQA 3LK1A 1DF0A 1ZACA 2BKIB 2H61A 3I5GB 1DTLA 3OHMB 4M2PA 4AQJA 2BL0B 3CR4X 2L4HA 3NXAA 1B1GA 3TS5B 2JT3A 2MBXA 1DJYA 1AVSA 3WHUB 4C0KA 1WLZA 5KTYA 1TRFA 1NWDA 2LP2A 1KSOA 3PN7C 3BUWB 4ZCVA 1TOPA 2JTZA 4M2OA 4OVNF 1UHJA 1RJVA 1RK9A 3KEVA 1SW8A 3F45A 4E68A 2JRFA 4I5KA 2LM5A 1EL4A 1WRKA 4ETOA 1LXFC 1J1DA 1MXEA 4GPLB 4PHKA 1AJ5A 2Y1NA 3EKHA 4USLA 4NDCA 1Y1AA 1A75A 3OB1B 1UWOA 1ZFSA 1NX2A 2MLFC 2LNKA 4WQ3A 4PHJA 4XJKB 1K2HA 1FPWA 4U8DA 2JXCA 1XK4C 2KI6C 3PN7B 1U5IA 3GK4X 1IRJA 1CFPA 1G4YR 2D8NA 4MZLA 4XYNA 3SJSA 1W7IB 3JVTB 1KFXS 1H4BA 1AUIB 1CB1A 1G33A 2KAYA 3DF0A 4MZKA 4CFRA 1F54A 4L9MA 2JU0A 4N5XA 1TNWA 2JWWA 4YI8A 1MXLC 4D1EA 1K96A 1OZOA 4N1GA 1MR8A 2M3WA 1JWDA 2KOTA 2L5XB 1QLKA 2JNFA 1TNXA 1S5GZ 2CT9A 1WDCC 2LHLA 1GJYA 1S36A 2JTTA 1XVJA 2I18A 1LA0A 1BF5A 1DJZA 1J7OA 3EK7A 1CTRA 1QX7A 1F4OA 1QV1A 5AANA 1CFFA 1JBAA 2M8UA 1MHOA 3EK8A 4M2QA 1QV0A 2ZFDA 3K21A 1IKUA 1M45A 5DKQA 1S3PA 3BUMB 2L0PA 1M39A 2M0RA 4OCIA 4A4CA 2MRDA 2COLB 2JXLA 4GGNA 2JZIA 1NX0A 3I5IB 4C0LA 1JSAA 2HETA 1F70A 1XO5A 1ZOTB 2CBLA 2F33A 2FOTA 1UHHA 2EGDA 2LLTA 2RGIA 3I5HB 1IJ6A 1NYAA 4DS7A 2LLSA 2F8PA 5AFPA 4MVFA 3TDIA 1LA3A 1A03A 3QRXA 2I7AA 1YUTA 3FS7A 5KU1A 2JQ6A 1CLMA 3VRNA 4WRIA 3AKAA 2LAPA 2WCEA 1CLBA 2G2BA 1C7VA 2DOQA 2JPTA 2MAZA 2Q91A 2CNPA 5I2LA 1NSHA 4ORAB 1J7QA 1OMDA 1SL7A 3IQQA 3NSLA 2WCBA 1TNPA 1QIVA 3EVUA 2ZNDA 4PE0A 2E30A 5PALA 3SG3A 4I5JA 3BUXB 1AJ4A 3O4YA 5AXIA 1CDLA 1E8AA 1NCYA 1YRUB 1F4QA 3D0YB 5FYXA 1F55A 2M1KB 3CWGA 1IWQA 1YRTB 1J7PA 3TDUA 1OQPA 2HPSA 1LINA 2QACA 2PMYA 3GK2A 4MZJA 3ZWHA 1S26D 3GOFA 1BMOA 5J3XA 2LANA 4DUQA 4QJ5B 4YI9A 2L2EA 2TN4A 1M63B 3LL8B 4BY5A 2ZRSA 1BT6A 1KK8C 2KQYA 1DJGA 2LLUA 1FW4A 5HKWA 1SKTA 1SY9A 2PSRA 2KGRA 3SIAA 2ZNEA 4HSZA 1NX1A 1NCXA 4GNKB 1Y6WA 5B8IB 2JC2A 1YUUA 3PFVA 1KWOC 1MWNA 1QTXA 3CLNA 1IQ5A 1CMGA 3ICBA 3JVTC 4PHNA 5K89A 4YGDB 5ER5A 1SCMC 1RECA 2GGZA 4MRXA 1CLLA 1KK7Y 4HRHA 1AP4A 1F71A 1CKKA 2F3YA 2PRUA 1CNPA 2BKHB 2WORA 1JFJA 1B7TY 1D1OA 1KK8B 1PK0D 3TUYC 2L98A 1JF2A 1NCZA 2AUCA 5HLOA 1XA5A 3AAJA 1L7ZA 5AEQA 3SG6A 1M46A 4IL1A 1PSRA 2AMIA 4QJ3B 2LMUA 4YGEB 1CM4A 1KWOB 2VRGA 3A4UB 1QXPA 2JOJA 2L51A 4PE1A 2JT8A 5KSZA 2NCPA 1SCVA 1SCMB 2Y5IA 3EKJA 4PE7A 3I5IC 3GK1A 3OX5A 3KPXA 2KHNA 5BPJA 1JFKA 4GGFC 3AAKA 1CM1A 2FCEA 2SASA 1Y0VH 1K9KA 1N65A 1BR1B 3I5HC 1OMVA 2M49B 3HX4A 3PSRA 1CFCA 1YURA 1YUSA 4YRUA 1EJ3A 1ODBA 1YVLA 1CDMA 2HQ8A 3TUYB 1TCOB 4GBAA 2BE6A 2KGBC 5CPVA 1TNQA 2PASA 5D7FA 5DKRA 4AQIA 2GGMA 1K95A 1QVIZ 4GFTA 2QPTA 2MJWB 1Y1XA 4MN0A 2M97A 3KHEA 4NDBA 3EK4A 4XJKA 1BLQA 2R2IA 1BOCA 2WCFA 1K9PA 2K7OA 1MQ1A 3OB2B 2WC8A 1PALA 1K9UA 1NUBA 1B9AA 3BUOB 1J55A 1KFUS 1F8HA 1TTXA 1UHNA 1B8CA 1FI6A 2JT0A 2JULA 2LUCA 2KI6D 3OP0A 1DJXA 3LCPC 1JUOA 2KDHA 1EH2A 5AERA 1J1EA 1H8BA 1BR4B 2I2RE 1BODA 4JPZB 1ALWA 1SBJA 1GQMA 2LVKA 3ZNIA 1FI5A 2IS9A 3LK0A 1YR5A 2LMVA 1XFWO 1YX8A 1MUXA 1B47A 1S6IA 2LVVA 1KFXL 1XK4A 2KFGA 2KAVA 3RLZA 2K0JA 1TIZA 5I8NA 2I94A 3IQOA 2EHBA 2GV5A 1ALVA 3DVJA 3TDZA 1XYDA 4FTGA 3M0WA 4YGAA 1KK7Z 4CFQA 4PALA 2WOSA 1LVCD 3WNXB 5HYDA 4C0JA 1YTZC 1B7TZ 2A4JA 1RFJA 3DVMA 1QX2A 3BOWB 1KQVA 1NIWA 1SNLA 1DF0B 1A29A 2F3ZA 1OSAA 4MEWA 1WLMA 1L2OC 1DGUA 2BCXA 3DD4A 2ISDA 3BUNB 2SCPA 4ZCUA 1K93D 4HRGA 2EC6C 1KQMC 4YBHB 3PM8A 3VGOA 1AK8A 1UHKA 3MSEB 2WNDA 1PSBA 5DKNA 5I2OA 5JJGA 3PLFB 3I5FC 2M7NA 4TNCA 2BE4A 3KF9A 3SIBA 2O60A 4MRYA 2HF5A 1NP8A 2K61A 4HREE 2K2FA 1MF8B 2K2AA 3FIAA 1DVIA 1IH0A 2CTNA 1W7JB 3O78A 1EG3A 1N2DA 1UURA 2H2KA 4CIDA 3JTDC 2AAOA 1B8LA 1OE9B 3D0YA 2BCAA 3CS1A 2KBMA 3BOWA 4PE4A 2MHHA 2K7BA 1L2OB 1A2XA 4QJ4B 1GGWA 1YX7A 1WY9A 3O2PA 3WHTB 1JC2A 3HCMA 1QJTA 3NSIA 4GUKA 4YGCB 5ER4X 2EC6B 1KQMB 2MA2A 1XFUO 1S6JA 4MSPA 4YGBB 2ZRTA 1U5IB 3SG7A 4CPVA 3I5FB 2OS8C 3SG5A 1SR6B 2ZKMX 2BCBA 3PATA 1N0YA 4GAOA 2PALA 3TZ1A 2FCDA 4Q04A 5CSNA 2MLEC 3DF0B 5GQQC 2OTGC 1DJHA 3CGAA 2KFFA 3D10A 1FBVA 1KSMA 2NXQA 2M1UA 2P6BB 1DJWA 2L4IA 3JTDB 1VRKA 4UPGA 2BECA 2NZ0A 4ORCB 4PCWA 4DRWA 2LMTA 3CR2A 3CZTX 2ZN8A 1A4PA 2KFHA 3E3RA 1CDPA 3H4SE 5JOLA 2HQWA 1CMFA 1FF1A 1CFDA 1Y1UA 3SG2A 2OS8B 5F6TA 4PHMA 1BJFA 3BYAA 1PVBA 1IG5A 2CCMA 4MBEA 1EG4A 1RWYA 1QASA 1TN4A 2LV7A 2M29A 2OTGB 2JNXA 4OV2A 4NDDA 1QX5B 1NX3A 2OPOA 2K7CA 4WQ2A 1HQVA 5CSFA 2M7LA 4R1EA 1QLSA 3WXAA 2Y4QA 3EVRA 3FWBA 3PALA 2LCPA 4OKHA 2KNEA 3DVKA 5G08A 2LVJA 3RM1A 1BG1A 3AKBA 1XFXO 2BBMA 5HKZA 2NCOA 2LC5A 3NSKA 4AOMA 1PVAA 1R2UA 1ZUZA 1KCYA 3VRRA 1QS7A 4I5NB 3VRQA 5TNCA 5D69A 1UUSA 3IF7A 1IJ5A 3LLEA 2H61C 1K8UA 1S1EA 3KO0A 2KI4C 3VRPA 1OZSA 1SL8A 2K7DA 4I5LB 2KQ6A 2O5GA 4N1FA 4F0ZB 1NPQA 1CDNA 3BQ3A 4P5OE 5CSIA 1V1GA 2KSPA 4JQ0D 2FJUB 2KYFA 1DT7B 1M31A 1X02A 2CXJA 2LP3A 1B4CA 1HT9A 4A4BA 1EXRA 1DJIA 1GGZA 2LHIA 2KAXA 3VROA 2KYCA 1WDCB 2LUXA 4DIRA 1V1FA 1Q80A 1B8RA 1WRLA 2E6WA 4GGFA 1IQ3A 3SG4A 2ZN9A 3CR5X 5CSJA 1JF0A 1UP5A 1WRZA 1SPYA 2G9BA 2M9GA 4ICBA 1YVHA 2KBIA 1SL9A 3O6BA 1K90D 1C7WA 4DCKA 5I2QA 1DMOA 5HKYA 2KI4B 1S5GY 3C1VA 3FWCA 1K94A 1SRAA 3I5GC 4P2YB 2BL0C 2F2OA 2V53A 1RTP1 1OMRA 1TCFA 1PRWA 4FQOA 1LKJA 3NSOA 1SYMA 2PVBA 3TS5C 4MLWA 1UHIA 2BBNA 1XFVO 3BXKA 2B1UA 3OX6A 5HLVA 4CLNA 1ZMZA 1G8IA 2Q4UA 1QVIY 4PDZA 1SR6C 1R6PA 1KFUL 1S6CA 3A8RA 1RROA 1AHRA 1XFYO 2LE9B 4OR9B 4ORBB 1OOJA 1IGVA 2F2PA 4NQGA 1SMGA 3CTNA 2Y1MA 1BU3A 1J7RA 4BY4A 1QATA 1QIWA 2NLNA 2L50A 1DGVA 1XFZO 1PULA 2LVIA 3DVEA 1SK6D 5IBWA 1C07A 2K8MB 1A75B
chains in the Genus database with same CATH superfamily
3EVVA 4JWQA 3LK1A 1DF0A 1ZACA 2BKIB 2H61A 3CYZA 1DTLA 3I5GB 3OHMB 4M2PA 4AQJA 2BL0B 3CR4X 2L4HA 3NXAA 1B1GA 3TS5B 2JT3A 2MBXA 1DJYA 1AVSA 3DXLA 3WHUB 4C0KA 2BAPA 1WLZA 5KTYA 1TRFA 1NWDA 2LP2A 1KSOA 3PN7C 3BUWB 4ZCVA 1TOPA 2BNXA 2JTZA 4M2OA 4OVNF 1UHJA 2KLDA 1RJVA 1RK9A 3KEVA 1SW8A 1T14A 3F45A 2PYQA 4E68A 2JRFA 1OOFA 2LM5A 1EL4A 1WRKA 3QMEA 4I5KA 3RZSA 4ETOA 1LXFC 1J1DA 4F7FA 1MXEA 4GPLB 4PHKA 1AJ5A 2Y1NA 3EKHA 2QEVA 4NDCA 4USLA 3D74A 1Y1AA 1A75A 3OB1B 1UWOA 3FE9A 1ZFSA 1NX2A 3UO9A 2MLFC 3Q8IA 2LNKA 4WQ3A 4PHJA 4XJKB 1K2HA 1FPWA 4U8DA 2JXCA 1XK4C 2KI6C 3PN7B 1U5IA 3GK4X 1IRJA 1CFPA 1G4YR 2WCHA 2D8NA 4MZLA 4XYNA 3SJSA 1W7IB 3JVTB 1KFXS 3B6XA 1H4BA 1AUIB 1CB1A 1G33A 2KAYA 3DF0A 4MZKA 4CFRA 1F54A 4L9MA 2JU0A 4N5XA 3S0EA 1TNWA 2JWWA 4YI8A 2WCKA 1MXLC 3D75A 4D1EA 1K96A 1OZOA 2QEOA 4N1GA 1MR8A 2M3WA 1JWDA 2KOTA 2L5XB 1QLKA 2JNFA 1TNXA 1S5GZ 2CT9A 3S0FA 1WDCC 2LHLA 1GJYA 1S36A 2JTTA 1XVJA 2I18A 1LA0A 1OOHA 1BF5A 1DJZA 1J7OA 3EK7A 1CTRA 1QX7A 1F4OA 1QV1A 2K60A 5AANA 1CFFA 1JBAA 2M8UA 1MHOA 3EK8A 3B87A 4M2QA 1QV0A 2ZFDA 3K21A 1IKUA 1M45A 5DKQA 1S3PA 3BUMB 2L0PA 1M39A 2M0RA 4OCIA 4A4CA 2MRDA 2COLB 2JXLA 4GGNA 1DEKA 1NX0A 2JZIA 3I5IB 4C0LA 2HETA 1JSAA 1F70A 3V2LA 1XO5A 1ZOTB 2CBLA 2F33A 2FOTA 1UHHA 2EGDA 2LLTA 2RGIA 3I5HB 1IJ6A 1NYAA 4DS7A 2LLSA 2F8PA 1QWVA 5AFPA 4MVFA 3TDIA 1LA3A 1A03A 3NHTA 3QRXA 2I7AA 1YUTA 3FS7A 5KU1A 2JQ6A 1CLMA 3VRNA 1C3ZA 4WRIA 3AKAA 2LAPA 2WCEA 1CLBA 2G2BA 1C7VA 1XFRA 2DOQA 2JPTA 2MAZA 2Q91A 2CNPA 5I2LA 1NSHA 4ORAB 1J7QA 1OMDA 4JKTA 1SL7A 3FE6A 3IQQA 3NGVA 3NSLA 2WCBA 3S0DA 1TNPA 1QIVA 3EVUA 2ZNDA 4PE0A 5EL2A 1DC1A 2E30A 5PALA 3SG3A 4I5JA 3BUXB 1AJ4A 3O4YA 5AXIA 1CDLA 1E8AA 1NCYA 1YRUB 1F4QA 3D0YB 5FYXA 3S0BA 2M1KB 1F55A 3CWGA 1IWQA 1YRTB 1J7PA 3TDUA 1OQPA 2HPSA 2YGUA 1LINA 2QACA 2PMYA 3GK2A 4MZJA 3BFHA 3ZWHA 1S26D 3GOFA 1BMOA 5J3XA 2LANA 4DUQA 4QJ5B 3D77A 2L2EA 4YI9A 2TN4A 1M63B 3LL8B 4BY5A 2ZRSA 1BT6A 1KK8C 2GTEA 1DJGA 2KQYA 2LLUA 1FW4A 2H8VA 5HKWA 1SKTA 1LS8A 1SY9A 2PSRA 2KGRA 3SIAA 2ZNEA 4HSZA 1NX1A 1NCXA 4GNKB 1Y6WA 5B8IB 2JC2A 3VB1A 1YUUA 3PFVA 1KWOC 1MWNA 1QTXA 3CLNA 1IQ5A 1CMGA 3ICBA 3JVTC 4PHNA 5K89A 4YGDB 5ER5A 1SCMC 1RECA 2GGZA 4INXA 4MRXA 1CLLA 3S0AA 4OZDA 1KK7Y 4HRHA 1AP4A 1F71A 1CKKA 2F3YA 2PRUA 1CNPA 3B88A 2BKHB 2WORA 1JFJA 1B7TY 1D1OA 1KK8B 1PK0D 5D3OA 3TUYC 1TWOA 1JF2A 1NCZA 2AUCA 2L98A 1DQEA 5HLOA 1XA5A 1Z2CB 3AAJA 3PM2A 1L7ZA 5AEQA 3SG6A 1M46A 4IL1A 1PSRA 2AMIA 4QJ3B 2LMUA 4YGEB 1CM4A 1KWOB 2VRGA 3A4UB 1QXPA 2JOJA 2L51A 4PE1A 2JT8A 5KSZA 2NCPA 1SCVA 1SCMB 2WC5A 2Y5IA 3EKJA 3I5IC 3GK1A 1W9ZA 3OX5A 4PE7A 3KPXA 2KHNA 5BPJA 1JFKA 4GGFC 3AAKA 4FQTA 1CM1A 2FCEA 3R1VA 2SASA 1Y0VH 1K9KA 1N65A 1BR1B 3I5HC 1OMVA 2M49B 3HX4A 3N7HA 3PSRA 1CFCA 1YURA 1YUSA 4YRUA 1EJ3A 1ODBA 1YVLA 1CDMA 2HQ8A 3TUYB 1TCOB 4GBAA 3CDNA 2BE6A 2KGBC 2WCLA 5CPVA 1TNQA 2PASA 5D7FA 5DKRA 3DYEA 4AQIA 2GGMA 1K95A 1QVIZ 4GFTA 1OOIX 3R1OA 2QPTA 3SS3A 2MJWB 1Y1XA 4MN0A 2M97A 3KHEA 4NDBA 3EK4A 4XJKA 1BLQA 2R2IA 1BOCA 2WCFA 1K9PA 2K7OA 1MQ1A 3OB2B 2WC8A 1PALA 1K9UA 1NUBA 1B9AA 3BUOB 1J55A 1KFUS 1F8HA 2QEBA 3BJHA 1TTXA 1UHNA 1B8CA 1FI6A 3R72A 2JT0A 2JULA 2LUCA 2KI6D 3DZTA 3OP0A 3SS5A 1DJXA 3LCPC 1JUOA 3S0GA 2KDHA 1EH2A 5AERA 1J1EA 1H8BA 1BR4B 2I2RE 1BODA 4JPZB 1ALWA 1SBJA 1GQMA 2LVKA 3ZNIA 1FI5A 2IS9A 2L2CA 2QEHA 1YR5A 3LK0A 2LMVA 1XFWO 1YX8A 3UNWA 1MUXA 1B47A 1S6IA 2LVVA 3D78A 2KPHA 1KFXL 1XK4A 2KFGA 2KAVA 3D76A 3RLZA 2K0JA 1TIZA 5I8NA 2I94A 3IQOA 2EHBA 2GV5A 1ALVA 3DVJA 3TDZA 1XYDA 4FTGA 3M0WA 4YGAA 3NHIA 1KK7Z 4CFQA 5FI6A 4PALA 2WOSA 1LVCD 3WNXB 3OBVA 5HYDA 4C0JA 1YTZC 1B7TZ 2A4JA 1RFJA 3DVMA 3CZ0A 1QX2A 3BOWB 1KQVA 1NIWA 1SNLA 1DF0B 1A29A 2F3ZA 1OSAA 4MEWA 1WLMA 5FI7A 2ERBA 1L2OC 1DGUA 2BCXA 3DD4A 2ISDA 3BUNB 3D73A 2SCPA 4ZCUA 1K93D 4HRGA 2EC6C 1KQMC 2WC6A 4YBHB 3PM8A 3VGOA 1AK8A 1UHKA 3MSEB 2WNDA 1PSBA 5DKNA 5I2OA 5JJGA 3PLFB 3SS4A 3I5FC 2M7NA 4TNCA 2BE4A 3KF9A 1SSEB 3SIBA 3CABA 2O60A 4MRYA 2HF5A 2WCMA 1NP8A 2K61A 3L4LA 2P71A 4HREE 2K2FA 1MF8B 2K2AA 3FIAA 1DVIA 4INWA 1IH0A 2CTNA 1W7JB 3O78A 1EG3A 1N2DA 1UURA 2H2KA 4CIDA 3JTDC 2AAOA 1B8LA 1OE9B 3D0YA 2BCAA 3CS1A 2KBMA 3BOWA 4PE4A 2MHHA 2K7BA 1L2OB 1GM0A 1A2XA 4QJ4B 1GGWA 1P28A 1YX7A 3B86A 1WY9A 3O2PA 3WHTB 1JC2A 3HCMA 1QJTA 3NSIA 4GUKA 4YGCB 5ER4X 2EC6B 1KQMB 2MA2A 1C3YA 1XFUO 1S6JA 3BFBA 4MSPA 5I94A 4YGBB 2ZRTA 1U5IB 3SG7A 4CPVA 3I5FB 2OS8C 3SG5A 1SR6B 2ZKMX 2BCBA 3PATA 1N0YA 4GAOA 2PALA 3TZ1A 2FCDA 4Q04A 1ORGA 2MLEC 3DF0B 5CSNA 5GQQC 2OTGC 1DJHA 3CGAA 2KFFA 4IJ7A 3D10A 1FBVA 1KSMA 2NXQA 2P70A 2M1UA 2P6BB 1DJWA 2L4IA 3JTDB 5DICA 3B7AA 1VRKA 4UPGA 2JPOA 2BECA 2NZ0A 4JD9A 4ORCB 4PCWA 2LMTA 3CR2A 3CZTX 4DRWA 2ZN8A 1A4PA 2KFHA 3E3RA 1CDPA 3H4SE 5JOLA 1TUJA 2HQWA 1CMFA 1FF1A 1CFDA 1DELA 1Y1UA 3SG2A 2OS8B 5F6TA 4PHMA 1BJFA 3BYAA 1PVBA 1IG5A 2CCMA 4MBEA 1EG4A 1RWYA 2PQLA 1QASA 1TN4A 2LV7A 2M29A 2OTGB 2JNXA 3R1PA 4NDDA 1QX5B 1NX3A 2OPOA 2K7CA 4WQ2A 1IIOA 3CZ2A 2L5YA 1HQVA 5CSFA 2M7LA 5HL1A 4R1EA 2KLEA 1QLSA 3K1EA 3WXAA 2Y4QA 3PJIA 5FI2A 1Z4HA 3EVRA 3O4XA 3FWBA 3PALA 2LCPA 4KYNA 4OKHA 2KNEA 3DVKA 5G08A 2LVJA 3RM1A 1BG1A 3AKBA 1XFXO 2BBMA 5HKZA 3DY9A 2NCOA 2LC5A 2QDIA 3NSKA 1PVAA 4AOMA 1R2UA 1ZUZA 1KCYA 3VRRA 1QS7A 4I5NB 3VRQA 5TNCA 2WCJA 5D69A 1UUSA 3FE8A 3IF7A 1IJ5A 3LLEA 2H61C 1K8UA 1S1EA 3KO0A 2KI4C 3VRPA 1OZSA 1SL8A 1OOGA 2K7DA 2KQ6A 2O5GA 4I5LB 4N1FA 1NPQA 4F0ZB 1CDNA 3BQ3A 2FJYA 4P5OE 5CSIA 1V1GA 2KSPA 4JQ0D 2FJUB 2KYFA 1DT7B 1M31A 1X02A 2CXJA 2LP3A 1B4CA 3OGNA 1HT9A 4A4BA 1EXRA 1DJIA 1GGZA 2LHIA 2KAXA 3VROA 2KYCA 1WDCB 2LUXA 4DIRA 4PT1A 1V1FA 1Q80A 1B8RA 1WRLA 2E6WA 4GGFA 1IQ3A 3SG4A 2ZN9A 3CR5X 5CSJA 1JF0A 1UP5A 1WRZA 1SPYA 2G9BA 2M9GA 4ICBA 1YVHA 2KBIA 1SL9A 3O6BA 1K90D 1C7WA 4DCKA 5I2QA 1DMOA 5HKYA 2KI4B 1S5GY 3C1VA 3FWCA 1K94A 1SRAA 3BFAA 3CZ1A 3I5GC 4P2YB 2BL0C 2F2OA 2V53A 1RTP1 1OMRA 1TCFA 1PRWA 4FQOA 1LKJA 3NSOA 1SYMA 2PVBA 3TS5C 4MLWA 1UHIA 2BBNA 1XFVO 3BXKA 2B1UA 1TUZA 3OX6A 5HLVA 1ZMZA 4CLNA 1G8IA 2Q4UA 1QVIY 3EG5B 4PDZA 1SR6C 1R6PA 3L47A 1KFUL 1OW4A 1S6CA 3A8RA 1RROA 1AHRA 1XFYO 2LE9B 3IVTA 4OR9B 4ORBB 1OOJA 4OV2A 1IGVA 2F2PA 3L4AA 4NQGA 1SMGA 3CTNA 2Y1MA 1BU3A 1J7RA 4BY4A 1QATA 1QIWA 2NLNA 2L50A 1DGVA 1XFZO 1PULA 2LVIA 3DVEA 1SK6D 5IBWA 1C07A 2K8MB 1A75B
chains in the Genus database with same CATH topology
3EVVA 4JWQA 3LK1A 1DF0A 1ZACA 2BKIB 2H61A 3I5GB 1DTLA 3OHMB 4M2PA 4AQJA 2BL0B 3CR4X 2L4HA 3NXAA 1B1GA 3TS5B 2JT3A 2MBXA 1DJYA 1AVSA 3WHUB 4C0KA 1WLZA 5KTYA 1TRFA 1NWDA 2LP2A 1KSOA 3PN7C 3BUWB 4ZCVA 1TOPA 2JTZA 4M2OA 4OVNF 1UHJA 1RJVA 1RK9A 3KEVA 1SW8A 3F45A 4E68A 2JRFA 4I5KA 2LM5A 1EL4A 1WRKA 4ETOA 1LXFC 1J1DA 1MXEA 4GPLB 4PHKA 1AJ5A 2Y1NA 3EKHA 4USLA 4NDCA 1Y1AA 1A75A 3OB1B 1UWOA 1ZFSA 1NX2A 2MLFC 2LNKA 4WQ3A 4PHJA 4XJKB 1K2HA 1FPWA 4U8DA 2JXCA 1XK4C 2KI6C 3PN7B 1U5IA 3GK4X 1IRJA 1CFPA 1G4YR 2D8NA 4MZLA 4XYNA 3SJSA 1W7IB 3JVTB 1KFXS 1H4BA 1AUIB 1CB1A 1G33A 2KAYA 3DF0A 4MZKA 4CFRA 1F54A 4L9MA 2JU0A 4N5XA 1TNWA 2JWWA 4YI8A 1MXLC 4D1EA 1K96A 1OZOA 4N1GA 1MR8A 2M3WA 1JWDA 2KOTA 2L5XB 1QLKA 2JNFA 1TNXA 1S5GZ 2CT9A 1WDCC 2LHLA 1GJYA 1S36A 2JTTA 1XVJA 2I18A 1LA0A 1BF5A 1DJZA 1J7OA 3EK7A 1CTRA 1QX7A 1F4OA 1QV1A 5AANA 1CFFA 1JBAA 2M8UA 1MHOA 3EK8A 4M2QA 1QV0A 2ZFDA 3K21A 1IKUA 1M45A 5DKQA 1S3PA 3BUMB 2L0PA 1M39A 2M0RA 4OCIA 4A4CA 2MRDA 2COLB 2JXLA 4GGNA 2JZIA 1NX0A 3I5IB 4C0LA 1JSAA 2HETA 1F70A 1XO5A 1ZOTB 2CBLA 2F33A 2FOTA 1UHHA 2EGDA 2LLTA 2RGIA 3I5HB 1IJ6A 1NYAA 4DS7A 2LLSA 2F8PA 5AFPA 4MVFA 3TDIA 1LA3A 1A03A 3QRXA 2I7AA 1YUTA 3FS7A 5KU1A 2JQ6A 1CLMA 3VRNA 4WRIA 3AKAA 2LAPA 2WCEA 1CLBA 2G2BA 1C7VA 2DOQA 2JPTA 2MAZA 2Q91A 2CNPA 5I2LA 1NSHA 4ORAB 1J7QA 1OMDA 1SL7A 3IQQA 3NSLA 2WCBA 1TNPA 1QIVA 3EVUA 2ZNDA 4PE0A 2E30A 5PALA 3SG3A 4I5JA 3BUXB 1AJ4A 3O4YA 5AXIA 1CDLA 1E8AA 1NCYA 1YRUB 1F4QA 3D0YB 5FYXA 1F55A 2M1KB 3CWGA 1IWQA 1YRTB 1J7PA 3TDUA 1OQPA 2HPSA 1LINA 2QACA 2PMYA 3GK2A 4MZJA 3ZWHA 1S26D 3GOFA 1BMOA 5J3XA 2LANA 4DUQA 4QJ5B 4YI9A 2L2EA 2TN4A 1M63B 3LL8B 4BY5A 2ZRSA 1BT6A 1KK8C 2KQYA 1DJGA 2LLUA 1FW4A 5HKWA 1SKTA 1SY9A 2PSRA 2KGRA 3SIAA 2ZNEA 4HSZA 1NX1A 1NCXA 4GNKB 1Y6WA 5B8IB 2JC2A 1YUUA 3PFVA 1KWOC 1MWNA 1QTXA 3CLNA 1IQ5A 1CMGA 3ICBA 3JVTC 4PHNA 5K89A 4YGDB 5ER5A 1SCMC 1RECA 2GGZA 4MRXA 1CLLA 1KK7Y 4HRHA 1AP4A 1F71A 1CKKA 2F3YA 2PRUA 1CNPA 2BKHB 2WORA 1JFJA 1B7TY 1D1OA 1KK8B 1PK0D 3TUYC 2L98A 1JF2A 1NCZA 2AUCA 5HLOA 1XA5A 3AAJA 1L7ZA 5AEQA 3SG6A 1M46A 4IL1A 1PSRA 2AMIA 4QJ3B 2LMUA 4YGEB 1CM4A 1KWOB 2VRGA 3A4UB 1QXPA 2JOJA 2L51A 4PE1A 2JT8A 5KSZA 2NCPA 1SCVA 1SCMB 2Y5IA 3EKJA 4PE7A 3I5IC 3GK1A 3OX5A 3KPXA 2KHNA 5BPJA 1JFKA 4GGFC 3AAKA 1CM1A 2FCEA 2SASA 1Y0VH 1K9KA 1N65A 1BR1B 3I5HC 1OMVA 2M49B 3HX4A 3PSRA 1CFCA 1YURA 1YUSA 4YRUA 1EJ3A 1ODBA 1YVLA 1CDMA 2HQ8A 3TUYB 1TCOB 4GBAA 2BE6A 2KGBC 5CPVA 1TNQA 2PASA 5D7FA 5DKRA 4AQIA 2GGMA 1K95A 1QVIZ 4GFTA 2QPTA 2MJWB 1Y1XA 4MN0A 2M97A 3KHEA 4NDBA 3EK4A 4XJKA 1BLQA 2R2IA 1BOCA 2WCFA 1K9PA 2K7OA 1MQ1A 3OB2B 2WC8A 1PALA 1K9UA 1NUBA 1B9AA 3BUOB 1J55A 1KFUS 1F8HA 1TTXA 1UHNA 1B8CA 1FI6A 2JT0A 2JULA 2LUCA 2KI6D 3OP0A 1DJXA 3LCPC 1JUOA 2KDHA 1EH2A 5AERA 1J1EA 1H8BA 1BR4B 2I2RE 1BODA 4JPZB 1ALWA 1SBJA 1GQMA 2LVKA 3ZNIA 1FI5A 2IS9A 3LK0A 1YR5A 2LMVA 1XFWO 1YX8A 1MUXA 1B47A 1S6IA 2LVVA 1KFXL 1XK4A 2KFGA 2KAVA 3RLZA 2K0JA 1TIZA 5I8NA 2I94A 3IQOA 2EHBA 2GV5A 1ALVA 3DVJA 3TDZA 1XYDA 4FTGA 3M0WA 4YGAA 1KK7Z 4CFQA 4PALA 2WOSA 1LVCD 3WNXB 5HYDA 4C0JA 1YTZC 1B7TZ 2A4JA 1RFJA 3DVMA 1QX2A 3BOWB 1KQVA 1NIWA 1SNLA 1DF0B 1A29A 2F3ZA 1OSAA 4MEWA 1WLMA 1L2OC 1DGUA 2BCXA 3DD4A 2ISDA 3BUNB 2SCPA 4ZCUA 1K93D 4HRGA 2EC6C 1KQMC 4YBHB 3PM8A 3VGOA 1AK8A 1UHKA 3MSEB 2WNDA 1PSBA 5DKNA 5I2OA 5JJGA 3PLFB 3I5FC 2M7NA 4TNCA 2BE4A 3KF9A 3SIBA 2O60A 4MRYA 2HF5A 1NP8A 2K61A 4HREE 2K2FA 1MF8B 2K2AA 3FIAA 1DVIA 1IH0A 2CTNA 1W7JB 3O78A 1EG3A 1N2DA 1UURA 2H2KA 4CIDA 3JTDC 2AAOA 1B8LA 1OE9B 3D0YA 2BCAA 3CS1A 2KBMA 3BOWA 4PE4A 2MHHA 2K7BA 1L2OB 1A2XA 4QJ4B 1GGWA 1YX7A 1WY9A 3O2PA 3WHTB 1JC2A 3HCMA 1QJTA 3NSIA 4GUKA 4YGCB 5ER4X 2EC6B 1KQMB 2MA2A 1XFUO 1S6JA 4MSPA 4YGBB 2ZRTA 1U5IB 3SG7A 4CPVA 3I5FB 2OS8C 3SG5A 1SR6B 2ZKMX 2BCBA 3PATA 1N0YA 4GAOA 2PALA 3TZ1A 2FCDA 4Q04A 5CSNA 2MLEC 3DF0B 5GQQC 2OTGC 1DJHA 3CGAA 2KFFA 3D10A 1FBVA 1KSMA 2NXQA 2M1UA 2P6BB 1DJWA 2L4IA 3JTDB 1VRKA 4UPGA 2BECA 2NZ0A 4ORCB 4PCWA 4DRWA 2LMTA 3CR2A 3CZTX 2ZN8A 1A4PA 2KFHA 3E3RA 1CDPA 3H4SE 5JOLA 2HQWA 1CMFA 1FF1A 1CFDA 1Y1UA 3SG2A 2OS8B 5F6TA 4PHMA 1BJFA 3BYAA 1PVBA 1IG5A 2CCMA 4MBEA 1EG4A 1RWYA 1QASA 1TN4A 2LV7A 2M29A 2OTGB 2JNXA 4OV2A 4NDDA 1QX5B 1NX3A 2OPOA 2K7CA 4WQ2A 1HQVA 5CSFA 2M7LA 4R1EA 1QLSA 3WXAA 2Y4QA 3EVRA 3FWBA 3PALA 2LCPA 4OKHA 2KNEA 3DVKA 5G08A 2LVJA 3RM1A 1BG1A 3AKBA 1XFXO 2BBMA 5HKZA 2NCOA 2LC5A 3NSKA 4AOMA 1PVAA 1R2UA 1ZUZA 1KCYA 3VRRA 1QS7A 4I5NB 3VRQA 5TNCA 5D69A 1UUSA 3IF7A 1IJ5A 3LLEA 2H61C 1K8UA 1S1EA 3KO0A 2KI4C 3VRPA 1OZSA 1SL8A 2K7DA 4I5LB 2KQ6A 2O5GA 4N1FA 4F0ZB 1NPQA 1CDNA 3BQ3A 4P5OE 5CSIA 1V1GA 2KSPA 4JQ0D 2FJUB 2KYFA 1DT7B 1M31A 1X02A 2CXJA 2LP3A 1B4CA 1HT9A 4A4BA 1EXRA 1DJIA 1GGZA 2LHIA 2KAXA 3VROA 2KYCA 1WDCB 2LUXA 4DIRA 1V1FA 1Q80A 1B8RA 1WRLA 2E6WA 4GGFA 1IQ3A 3SG4A 2ZN9A 3CR5X 5CSJA 1JF0A 1UP5A 1WRZA 1SPYA 2G9BA 2M9GA 4ICBA 1YVHA 2KBIA 1SL9A 3O6BA 1K90D 1C7WA 4DCKA 5I2QA 1DMOA 5HKYA 2KI4B 1S5GY 3C1VA 3FWCA 1K94A 1SRAA 3I5GC 4P2YB 2BL0C 2F2OA 2V53A 1RTP1 1OMRA 1TCFA 1PRWA 4FQOA 1LKJA 3NSOA 1SYMA 2PVBA 3TS5C 4MLWA 1UHIA 2BBNA 1XFVO 3BXKA 2B1UA 3OX6A 5HLVA 4CLNA 1ZMZA 1G8IA 2Q4UA 1QVIY 4PDZA 1SR6C 1R6PA 1KFUL 1S6CA 3A8RA 1RROA 1AHRA 1XFYO 2LE9B 4OR9B 4ORBB 1OOJA 1IGVA 2F2PA 4NQGA 1SMGA 3CTNA 2Y1MA 1BU3A 1J7RA 4BY4A 1QATA 1QIWA 2NLNA 2L50A 1DGVA 1XFZO 1PULA 2LVIA 3DVEA 1SK6D 5IBWA 1C07A 2K8MB 1A75B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EVV A;  4JWQ A;  3LK1 A;  1DF0 A;  1ZAC A;  2BKI B;  2H61 A;  3I5G B;  1DTL A;  3OHM B;  4M2P A;  4AQJ A;  2BL0 B;  3CR4 X;  2L4H A;  3NXA A;  1B1G A;  3TS5 B;  2JT3 A;  2MBX A;  1DJY A;  1AVS A;  3WHU B;  4C0K A;  1WLZ A;  5KTY A;  1TRF A;  1NWD A;  2LP2 A;  1KSO A;  3PN7 C;  3BUW B;  4ZCV A;  1TOP A;  2JTZ A;  4M2O A;  4OVN F;  1UHJ A;  1RJV A;  1RK9 A;  3KEV A;  1SW8 A;  3F45 A;  4E68 A;  2JRF A;  4I5K A;  2LM5 A;  1EL4 A;  1WRK A;  4ETO A;  1LXF C;  1J1D A;  1MXE A;  4GPL B;  4PHK A;  1AJ5 A;  2Y1N A;  3EKH A;  4USL A;  4NDC A;  1Y1A A;  1A75 A;  3OB1 B;  1UWO A;  1ZFS A;  1NX2 A;  2MLF C;  2LNK A;  4WQ3 A;  4PHJ A;  4XJK B;  1K2H A;  1FPW A;  4U8D A;  2JXC A;  1XK4 C;  2KI6 C;  3PN7 B;  1U5I A;  3GK4 X;  1IRJ A;  1CFP A;  1G4Y R;  2D8N A;  4MZL A;  4XYN A;  3SJS A;  1W7I B;  3JVT B;  1KFX S;  1H4B A;  1AUI B;  1CB1 A;  1G33 A;  2KAY A;  3DF0 A;  4MZK A;  4CFR A;  1F54 A;  4L9M A;  2JU0 A;  4N5X A;  1TNW A;  2JWW A;  4YI8 A;  1MXL C;  4D1E A;  1K96 A;  1OZO A;  4N1G A;  1MR8 A;  2M3W A;  1JWD A;  2KOT A;  2L5X B;  1QLK A;  2JNF A;  1TNX A;  1S5G Z;  2CT9 A;  1WDC C;  2LHL A;  1GJY A;  1S36 A;  2JTT A;  1XVJ A;  2I18 A;  1LA0 A;  1BF5 A;  1DJZ A;  1J7O A;  3EK7 A;  1CTR A;  1QX7 A;  1F4O A;  1QV1 A;  5AAN A;  1CFF A;  1JBA A;  2M8U A;  1MHO A;  3EK8 A;  4M2Q A;  1QV0 A;  2ZFD A;  3K21 A;  1IKU A;  1M45 A;  5DKQ A;  1S3P A;  3BUM B;  2L0P A;  1M39 A;  2M0R A;  4OCI A;  4A4C A;  2MRD A;  2COL B;  2JXL A;  4GGN A;  2JZI A;  1NX0 A;  3I5I B;  4C0L A;  1JSA A;  2HET A;  1F70 A;  1XO5 A;  1ZOT B;  2CBL A;  2F33 A;  2FOT A;  1UHH A;  2EGD A;  2LLT A;  2RGI A;  3I5H B;  1IJ6 A;  1NYA A;  4DS7 A;  2LLS A;  2F8P A;  5AFP A;  4MVF A;  3TDI A;  1LA3 A;  1A03 A;  3QRX A;  2I7A A;  1YUT A;  3FS7 A;  5KU1 A;  2JQ6 A;  1CLM A;  3VRN A;  4WRI A;  3AKA A;  2LAP A;  2WCE A;  1CLB A;  2G2B A;  1C7V A;  2DOQ A;  2JPT A;  2MAZ A;  2Q91 A;  2CNP A;  5I2L A;  1NSH A;  4ORA B;  1J7Q A;  1OMD A;  1SL7 A;  3IQQ A;  3NSL A;  2WCB A;  1TNP A;  1QIV A;  3EVU A;  2ZND A;  4PE0 A;  2E30 A;  5PAL A;  3SG3 A;  4I5J A;  3BUX B;  1AJ4 A;  3O4Y A;  5AXI A;  1CDL A;  1E8A A;  1NCY A;  1YRU B;  1F4Q A;  3D0Y B;  5FYX A;  1F55 A;  2M1K B;  3CWG A;  1IWQ A;  1YRT B;  1J7P A;  3TDU A;  1OQP A;  2HPS A;  1LIN A;  2QAC A;  2PMY A;  3GK2 A;  4MZJ A;  3ZWH A;  1S26 D;  3GOF A;  1BMO A;  5J3X A;  2LAN A;  4DUQ A;  4QJ5 B;  4YI9 A;  2L2E A;  2TN4 A;  1M63 B;  3LL8 B;  4BY5 A;  2ZRS A;  1BT6 A;  1KK8 C;  2KQY A;  1DJG A;  2LLU A;  1FW4 A;  5HKW A;  1SKT A;  1SY9 A;  2PSR A;  2KGR A;  3SIA A;  2ZNE A;  4HSZ A;  1NX1 A;  1NCX A;  4GNK B;  1Y6W A;  5B8I B;  2JC2 A;  1YUU A;  3PFV A;  1KWO C;  1MWN A;  1QTX A;  3CLN A;  1IQ5 A;  1CMG A;  3ICB A;  3JVT C;  4PHN A;  5K89 A;  4YGD B;  5ER5 A;  1SCM C;  1REC A;  2GGZ A;  4MRX A;  1CLL A;  1KK7 Y;  4HRH A;  1AP4 A;  1F71 A;  1CKK A;  2F3Y A;  2PRU A;  1CNP A;  2BKH B;  2WOR A;  1JFJ A;  1B7T Y;  1D1O A;  1KK8 B;  1PK0 D;  3TUY C;  2L98 A;  1JF2 A;  1NCZ A;  2AUC A;  5HLO A;  1XA5 A;  3AAJ A;  1L7Z A;  5AEQ A;  3SG6 A;  1M46 A;  4IL1 A;  1PSR A;  2AMI A;  4QJ3 B;  2LMU A;  4YGE B;  1CM4 A;  1KWO B;  2VRG A;  3A4U B;  1QXP A;  2JOJ A;  2L51 A;  4PE1 A;  2JT8 A;  5KSZ A;  2NCP A;  1SCV A;  1SCM B;  2Y5I A;  3EKJ A;  4PE7 A;  3I5I C;  3GK1 A;  3OX5 A;  3KPX A;  2KHN A;  5BPJ A;  1JFK A;  4GGF C;  3AAK A;  1CM1 A;  2FCE A;  2SAS A;  1Y0V H;  1K9K A;  1N65 A;  1BR1 B;  3I5H C;  1OMV A;  2M49 B;  3HX4 A;  3PSR A;  1CFC A;  1YUR A;  1YUS A;  4YRU A;  1EJ3 A;  1ODB A;  1YVL A;  1CDM A;  2HQ8 A;  3TUY B;  1TCO B;  4GBA A;  2BE6 A;  2KGB C;  5CPV A;  1TNQ A;  2PAS A;  5D7F A;  5DKR A;  4AQI A;  2GGM A;  1K95 A;  1QVI Z;  4GFT A;  2QPT A;  2MJW B;  1Y1X A;  4MN0 A;  2M97 A;  3KHE A;  4NDB A;  3EK4 A;  4XJK A;  1BLQ A;  2R2I A;  1BOC A;  2WCF A;  1K9P A;  2K7O A;  1MQ1 A;  3OB2 B;  2WC8 A;  1PAL A;  1K9U A;  1NUB A;  1B9A A;  3BUO B;  1J55 A;  1KFU S;  1F8H A;  1TTX A;  1UHN A;  1B8C A;  1FI6 A;  2JT0 A;  2JUL A;  2LUC A;  2KI6 D;  3OP0 A;  1DJX A;  3LCP C;  1JUO A;  2KDH A;  1EH2 A;  5AER A;  1J1E A;  1H8B A;  1BR4 B;  2I2R E;  1BOD A;  4JPZ B;  1ALW A;  1SBJ A;  1GQM A;  2LVK A;  3ZNI A;  1FI5 A;  2IS9 A;  3LK0 A;  1YR5 A;  2LMV A;  1XFW O;  1YX8 A;  1MUX A;  1B47 A;  1S6I A;  2LVV A;  1KFX L;  1XK4 A;  2KFG A;  2KAV A;  3RLZ A;  2K0J A;  1TIZ A;  5I8N A;  2I94 A;  3IQO A;  2EHB A;  2GV5 A;  1ALV A;  3DVJ A;  3TDZ A;  1XYD A;  4FTG A;  3M0W A;  4YGA A;  1KK7 Z;  4CFQ A;  4PAL A;  2WOS A;  1LVC D;  3WNX B;  5HYD A;  4C0J A;  1YTZ C;  1B7T Z;  2A4J A;  1RFJ A;  3DVM A;  1QX2 A;  3BOW B;  1KQV A;  1NIW A;  1SNL A;  1DF0 B;  1A29 A;  2F3Z A;  1OSA A;  4MEW A;  1WLM A;  1L2O C;  1DGU A;  2BCX A;  3DD4 A;  2ISD A;  3BUN B;  2SCP A;  4ZCU A;  1K93 D;  4HRG A;  2EC6 C;  1KQM C;  4YBH B;  3PM8 A;  3VGO A;  1AK8 A;  1UHK A;  3MSE B;  2WND A;  1PSB A;  5DKN A;  5I2O A;  5JJG A;  3PLF B;  3I5F C;  2M7N A;  4TNC A;  2BE4 A;  3KF9 A;  3SIB A;  2O60 A;  4MRY A;  2HF5 A;  1NP8 A;  2K61 A;  4HRE E;  2K2F A;  1MF8 B;  2K2A A;  3FIA A;  1DVI A;  1IH0 A;  2CTN A;  1W7J B;  3O78 A;  1EG3 A;  1N2D A;  1UUR A;  2H2K A;  4CID A;  3JTD C;  2AAO A;  1B8L A;  1OE9 B;  3D0Y A;  2BCA A;  3CS1 A;  2KBM A;  3BOW A;  4PE4 A;  2MHH A;  2K7B A;  1L2O B;  1A2X A;  4QJ4 B;  1GGW A;  1YX7 A;  1WY9 A;  3O2P A;  3WHT B;  1JC2 A;  3HCM A;  1QJT A;  3NSI A;  4GUK A;  4YGC B;  5ER4 X;  2EC6 B;  1KQM B;  2MA2 A;  1XFU O;  1S6J A;  4MSP A;  4YGB B;  2ZRT A;  1U5I B;  3SG7 A;  4CPV A;  3I5F B;  2OS8 C;  3SG5 A;  1SR6 B;  2ZKM X;  2BCB A;  3PAT A;  1N0Y A;  4GAO A;  2PAL A;  3TZ1 A;  2FCD A;  4Q04 A;  5CSN A;  2MLE C;  3DF0 B;  5GQQ C;  2OTG C;  1DJH A;  3CGA A;  2KFF A;  3D10 A;  1FBV A;  1KSM A;  2NXQ A;  2M1U A;  2P6B B;  1DJW A;  2L4I A;  3JTD B;  1VRK A;  4UPG A;  2BEC A;  2NZ0 A;  4ORC B;  4PCW A;  4DRW A;  2LMT A;  3CR2 A;  3CZT X;  2ZN8 A;  1A4P A;  2KFH A;  3E3R A;  1CDP A;  3H4S E;  5JOL A;  2HQW A;  1CMF A;  1FF1 A;  1CFD A;  1Y1U A;  3SG2 A;  2OS8 B;  5F6T A;  4PHM A;  1BJF A;  3BYA A;  1PVB A;  1IG5 A;  2CCM A;  4MBE A;  1EG4 A;  1RWY A;  1QAS A;  1TN4 A;  2LV7 A;  2M29 A;  2OTG B;  2JNX A;  4OV2 A;  4NDD A;  1QX5 B;  1NX3 A;  2OPO A;  2K7C A;  4WQ2 A;  1HQV A;  5CSF A;  2M7L A;  4R1E A;  1QLS A;  3WXA A;  2Y4Q A;  3EVR A;  3FWB A;  3PAL A;  2LCP A;  4OKH A;  2KNE A;  3DVK A;  5G08 A;  2LVJ A;  3RM1 A;  1BG1 A;  3AKB A;  1XFX O;  2BBM A;  5HKZ A;  2NCO A;  2LC5 A;  3NSK A;  4AOM A;  1PVA A;  1R2U A;  1ZUZ A;  1KCY A;  3VRR A;  1QS7 A;  4I5N B;  3VRQ A;  5TNC A;  5D69 A;  1UUS A;  3IF7 A;  1IJ5 A;  3LLE A;  2H61 C;  1K8U A;  1S1E A;  3KO0 A;  2KI4 C;  3VRP A;  1OZS A;  1SL8 A;  2K7D A;  4I5L B;  2KQ6 A;  2O5G A;  4N1F A;  4F0Z B;  1NPQ A;  1CDN A;  3BQ3 A;  4P5O E;  5CSI A;  1V1G A;  2KSP A;  4JQ0 D;  2FJU B;  2KYF A;  1DT7 B;  1M31 A;  1X02 A;  2CXJ A;  2LP3 A;  1B4C A;  1HT9 A;  4A4B A;  1EXR A;  1DJI A;  1GGZ A;  2LHI A;  2KAX A;  3VRO A;  2KYC A;  1WDC B;  2LUX A;  4DIR A;  1V1F A;  1Q80 A;  1B8R A;  1WRL A;  2E6W A;  4GGF A;  1IQ3 A;  3SG4 A;  2ZN9 A;  3CR5 X;  5CSJ A;  1JF0 A;  1UP5 A;  1WRZ A;  1SPY A;  2G9B A;  2M9G A;  4ICB A;  1YVH A;  2KBI A;  1SL9 A;  3O6B A;  1K90 D;  1C7W A;  4DCK A;  5I2Q A;  1DMO A;  5HKY A;  2KI4 B;  1S5G Y;  3C1V A;  3FWC A;  1K94 A;  1SRA A;  3I5G C;  4P2Y B;  2BL0 C;  2F2O A;  2V53 A;  1RTP 1;  1OMR A;  1TCF A;  1PRW A;  4FQO A;  1LKJ A;  3NSO A;  1SYM A;  2PVB A;  3TS5 C;  4MLW A;  1UHI A;  2BBN A;  1XFV O;  3BXK A;  2B1U A;  3OX6 A;  5HLV A;  4CLN A;  1ZMZ A;  1G8I A;  2Q4U A;  1QVI Y;  4PDZ A;  1SR6 C;  1R6P A;  1KFU L;  1S6C A;  3A8R A;  1RRO A;  1AHR A;  1XFY O;  2LE9 B;  4OR9 B;  4ORB B;  1OOJ A;  1IGV A;  2F2P A;  4NQG A;  1SMG A;  3CTN A;  2Y1M A;  1BU3 A;  1J7R A;  4BY4 A;  1QAT A;  1QIW A;  2NLN A;  2L50 A;  1DGV A;  1XFZ O;  1PUL A;  2LVI A;  3DVE A;  1SK6 D;  5IBW A;  1C07 A;  2K8M B;  1A75 B; 
#chains in the Genus database with same CATH topology
 3EVV A;  4JWQ A;  3LK1 A;  1DF0 A;  1ZAC A;  2BKI B;  2H61 A;  3CYZ A;  1DTL A;  3I5G B;  3OHM B;  4M2P A;  4AQJ A;  2BL0 B;  3CR4 X;  2L4H A;  3NXA A;  1B1G A;  3TS5 B;  2JT3 A;  2MBX A;  1DJY A;  1AVS A;  3DXL A;  3WHU B;  4C0K A;  2BAP A;  1WLZ A;  5KTY A;  1TRF A;  1NWD A;  2LP2 A;  1KSO A;  3PN7 C;  3BUW B;  4ZCV A;  1TOP A;  2BNX A;  2JTZ A;  4M2O A;  4OVN F;  1UHJ A;  2KLD A;  1RJV A;  1RK9 A;  3KEV A;  1SW8 A;  1T14 A;  3F45 A;  2PYQ A;  4E68 A;  2JRF A;  1OOF A;  2LM5 A;  1EL4 A;  1WRK A;  3QME A;  4I5K A;  3RZS A;  4ETO A;  1LXF C;  1J1D A;  4F7F A;  1MXE A;  4GPL B;  4PHK A;  1AJ5 A;  2Y1N A;  3EKH A;  2QEV A;  4NDC A;  4USL A;  3D74 A;  1Y1A A;  1A75 A;  3OB1 B;  1UWO A;  3FE9 A;  1ZFS A;  1NX2 A;  3UO9 A;  2MLF C;  3Q8I A;  2LNK A;  4WQ3 A;  4PHJ A;  4XJK B;  1K2H A;  1FPW A;  4U8D A;  2JXC A;  1XK4 C;  2KI6 C;  3PN7 B;  1U5I A;  3GK4 X;  1IRJ A;  1CFP A;  1G4Y R;  2WCH A;  2D8N A;  4MZL A;  4XYN A;  3SJS A;  1W7I B;  3JVT B;  1KFX S;  3B6X A;  1H4B A;  1AUI B;  1CB1 A;  1G33 A;  2KAY A;  3DF0 A;  4MZK A;  4CFR A;  1F54 A;  4L9M A;  2JU0 A;  4N5X A;  3S0E A;  1TNW A;  2JWW A;  4YI8 A;  2WCK A;  1MXL C;  3D75 A;  4D1E A;  1K96 A;  1OZO A;  2QEO A;  4N1G A;  1MR8 A;  2M3W A;  1JWD A;  2KOT A;  2L5X B;  1QLK A;  2JNF A;  1TNX A;  1S5G Z;  2CT9 A;  3S0F A;  1WDC C;  2LHL A;  1GJY A;  1S36 A;  2JTT A;  1XVJ A;  2I18 A;  1LA0 A;  1OOH A;  1BF5 A;  1DJZ A;  1J7O A;  3EK7 A;  1CTR A;  1QX7 A;  1F4O A;  1QV1 A;  2K60 A;  5AAN A;  1CFF A;  1JBA A;  2M8U A;  1MHO A;  3EK8 A;  3B87 A;  4M2Q A;  1QV0 A;  2ZFD A;  3K21 A;  1IKU A;  1M45 A;  5DKQ A;  1S3P A;  3BUM B;  2L0P A;  1M39 A;  2M0R A;  4OCI A;  4A4C A;  2MRD A;  2COL B;  2JXL A;  4GGN A;  1DEK A;  1NX0 A;  2JZI A;  3I5I B;  4C0L A;  2HET A;  1JSA A;  1F70 A;  3V2L A;  1XO5 A;  1ZOT B;  2CBL A;  2F33 A;  2FOT A;  1UHH A;  2EGD A;  2LLT A;  2RGI A;  3I5H B;  1IJ6 A;  1NYA A;  4DS7 A;  2LLS A;  2F8P A;  1QWV A;  5AFP A;  4MVF A;  3TDI A;  1LA3 A;  1A03 A;  3NHT A;  3QRX A;  2I7A A;  1YUT A;  3FS7 A;  5KU1 A;  2JQ6 A;  1CLM A;  3VRN A;  1C3Z A;  4WRI A;  3AKA A;  2LAP A;  2WCE A;  1CLB A;  2G2B A;  1C7V A;  1XFR A;  2DOQ A;  2JPT A;  2MAZ A;  2Q91 A;  2CNP A;  5I2L A;  1NSH A;  4ORA B;  1J7Q A;  1OMD A;  4JKT A;  1SL7 A;  3FE6 A;  3IQQ A;  3NGV A;  3NSL A;  2WCB A;  3S0D A;  1TNP A;  1QIV A;  3EVU A;  2ZND A;  4PE0 A;  5EL2 A;  1DC1 A;  2E30 A;  5PAL A;  3SG3 A;  4I5J A;  3BUX B;  1AJ4 A;  3O4Y A;  5AXI A;  1CDL A;  1E8A A;  1NCY A;  1YRU B;  1F4Q A;  3D0Y B;  5FYX A;  3S0B A;  2M1K B;  1F55 A;  3CWG A;  1IWQ A;  1YRT B;  1J7P A;  3TDU A;  1OQP A;  2HPS A;  2YGU A;  1LIN A;  2QAC A;  2PMY A;  3GK2 A;  4MZJ A;  3BFH A;  3ZWH A;  1S26 D;  3GOF A;  1BMO A;  5J3X A;  2LAN A;  4DUQ A;  4QJ5 B;  3D77 A;  2L2E A;  4YI9 A;  2TN4 A;  1M63 B;  3LL8 B;  4BY5 A;  2ZRS A;  1BT6 A;  1KK8 C;  2GTE A;  1DJG A;  2KQY A;  2LLU A;  1FW4 A;  2H8V A;  5HKW A;  1SKT A;  1LS8 A;  1SY9 A;  2PSR A;  2KGR A;  3SIA A;  2ZNE A;  4HSZ A;  1NX1 A;  1NCX A;  4GNK B;  1Y6W A;  5B8I B;  2JC2 A;  3VB1 A;  1YUU A;  3PFV A;  1KWO C;  1MWN A;  1QTX A;  3CLN A;  1IQ5 A;  1CMG A;  3ICB A;  3JVT C;  4PHN A;  5K89 A;  4YGD B;  5ER5 A;  1SCM C;  1REC A;  2GGZ A;  4INX A;  4MRX A;  1CLL A;  3S0A A;  4OZD A;  1KK7 Y;  4HRH A;  1AP4 A;  1F71 A;  1CKK A;  2F3Y A;  2PRU A;  1CNP A;  3B88 A;  2BKH B;  2WOR A;  1JFJ A;  1B7T Y;  1D1O A;  1KK8 B;  1PK0 D;  5D3O A;  3TUY C;  1TWO A;  1JF2 A;  1NCZ A;  2AUC A;  2L98 A;  1DQE A;  5HLO A;  1XA5 A;  1Z2C B;  3AAJ A;  3PM2 A;  1L7Z A;  5AEQ A;  3SG6 A;  1M46 A;  4IL1 A;  1PSR A;  2AMI A;  4QJ3 B;  2LMU A;  4YGE B;  1CM4 A;  1KWO B;  2VRG A;  3A4U B;  1QXP A;  2JOJ A;  2L51 A;  4PE1 A;  2JT8 A;  5KSZ A;  2NCP A;  1SCV A;  1SCM B;  2WC5 A;  2Y5I A;  3EKJ A;  3I5I C;  3GK1 A;  1W9Z A;  3OX5 A;  4PE7 A;  3KPX A;  2KHN A;  5BPJ A;  1JFK A;  4GGF C;  3AAK A;  4FQT A;  1CM1 A;  2FCE A;  3R1V A;  2SAS A;  1Y0V H;  1K9K A;  1N65 A;  1BR1 B;  3I5H C;  1OMV A;  2M49 B;  3HX4 A;  3N7H A;  3PSR A;  1CFC A;  1YUR A;  1YUS A;  4YRU A;  1EJ3 A;  1ODB A;  1YVL A;  1CDM A;  2HQ8 A;  3TUY B;  1TCO B;  4GBA A;  3CDN A;  2BE6 A;  2KGB C;  2WCL A;  5CPV A;  1TNQ A;  2PAS A;  5D7F A;  5DKR A;  3DYE A;  4AQI A;  2GGM A;  1K95 A;  1QVI Z;  4GFT A;  1OOI X;  3R1O A;  2QPT A;  3SS3 A;  2MJW B;  1Y1X A;  4MN0 A;  2M97 A;  3KHE A;  4NDB A;  3EK4 A;  4XJK A;  1BLQ A;  2R2I A;  1BOC A;  2WCF A;  1K9P A;  2K7O A;  1MQ1 A;  3OB2 B;  2WC8 A;  1PAL A;  1K9U A;  1NUB A;  1B9A A;  3BUO B;  1J55 A;  1KFU S;  1F8H A;  2QEB A;  3BJH A;  1TTX A;  1UHN A;  1B8C A;  1FI6 A;  3R72 A;  2JT0 A;  2JUL A;  2LUC A;  2KI6 D;  3DZT A;  3OP0 A;  3SS5 A;  1DJX A;  3LCP C;  1JUO A;  3S0G A;  2KDH A;  1EH2 A;  5AER A;  1J1E A;  1H8B A;  1BR4 B;  2I2R E;  1BOD A;  4JPZ B;  1ALW A;  1SBJ A;  1GQM A;  2LVK A;  3ZNI A;  1FI5 A;  2IS9 A;  2L2C A;  2QEH A;  1YR5 A;  3LK0 A;  2LMV A;  1XFW O;  1YX8 A;  3UNW A;  1MUX A;  1B47 A;  1S6I A;  2LVV A;  3D78 A;  2KPH A;  1KFX L;  1XK4 A;  2KFG A;  2KAV A;  3D76 A;  3RLZ A;  2K0J A;  1TIZ A;  5I8N A;  2I94 A;  3IQO A;  2EHB A;  2GV5 A;  1ALV A;  3DVJ A;  3TDZ A;  1XYD A;  4FTG A;  3M0W A;  4YGA A;  3NHI A;  1KK7 Z;  4CFQ A;  5FI6 A;  4PAL A;  2WOS A;  1LVC D;  3WNX B;  3OBV A;  5HYD A;  4C0J A;  1YTZ C;  1B7T Z;  2A4J A;  1RFJ A;  3DVM A;  3CZ0 A;  1QX2 A;  3BOW B;  1KQV A;  1NIW A;  1SNL A;  1DF0 B;  1A29 A;  2F3Z A;  1OSA A;  4MEW A;  1WLM A;  5FI7 A;  2ERB A;  1L2O C;  1DGU A;  2BCX A;  3DD4 A;  2ISD A;  3BUN B;  3D73 A;  2SCP A;  4ZCU A;  1K93 D;  4HRG A;  2EC6 C;  1KQM C;  2WC6 A;  4YBH B;  3PM8 A;  3VGO A;  1AK8 A;  1UHK A;  3MSE B;  2WND A;  1PSB A;  5DKN A;  5I2O A;  5JJG A;  3PLF B;  3SS4 A;  3I5F C;  2M7N A;  4TNC A;  2BE4 A;  3KF9 A;  1SSE B;  3SIB A;  3CAB A;  2O60 A;  4MRY A;  2HF5 A;  2WCM A;  1NP8 A;  2K61 A;  3L4L A;  2P71 A;  4HRE E;  2K2F A;  1MF8 B;  2K2A A;  3FIA A;  1DVI A;  4INW A;  1IH0 A;  2CTN A;  1W7J B;  3O78 A;  1EG3 A;  1N2D A;  1UUR A;  2H2K A;  4CID A;  3JTD C;  2AAO A;  1B8L A;  1OE9 B;  3D0Y A;  2BCA A;  3CS1 A;  2KBM A;  3BOW A;  4PE4 A;  2MHH A;  2K7B A;  1L2O B;  1GM0 A;  1A2X A;  4QJ4 B;  1GGW A;  1P28 A;  1YX7 A;  3B86 A;  1WY9 A;  3O2P A;  3WHT B;  1JC2 A;  3HCM A;  1QJT A;  3NSI A;  4GUK A;  4YGC B;  5ER4 X;  2EC6 B;  1KQM B;  2MA2 A;  1C3Y A;  1XFU O;  1S6J A;  3BFB A;  4MSP A;  5I94 A;  4YGB B;  2ZRT A;  1U5I B;  3SG7 A;  4CPV A;  3I5F B;  2OS8 C;  3SG5 A;  1SR6 B;  2ZKM X;  2BCB A;  3PAT A;  1N0Y A;  4GAO A;  2PAL A;  3TZ1 A;  2FCD A;  4Q04 A;  1ORG A;  2MLE C;  3DF0 B;  5CSN A;  5GQQ C;  2OTG C;  1DJH A;  3CGA A;  2KFF A;  4IJ7 A;  3D10 A;  1FBV A;  1KSM A;  2NXQ A;  2P70 A;  2M1U A;  2P6B B;  1DJW A;  2L4I A;  3JTD B;  5DIC A;  3B7A A;  1VRK A;  4UPG A;  2JPO A;  2BEC A;  2NZ0 A;  4JD9 A;  4ORC B;  4PCW A;  2LMT A;  3CR2 A;  3CZT X;  4DRW A;  2ZN8 A;  1A4P A;  2KFH A;  3E3R A;  1CDP A;  3H4S E;  5JOL A;  1TUJ A;  2HQW A;  1CMF A;  1FF1 A;  1CFD A;  1DEL A;  1Y1U A;  3SG2 A;  2OS8 B;  5F6T A;  4PHM A;  1BJF A;  3BYA A;  1PVB A;  1IG5 A;  2CCM A;  4MBE A;  1EG4 A;  1RWY A;  2PQL A;  1QAS A;  1TN4 A;  2LV7 A;  2M29 A;  2OTG B;  2JNX A;  3R1P A;  4NDD A;  1QX5 B;  1NX3 A;  2OPO A;  2K7C A;  4WQ2 A;  1IIO A;  3CZ2 A;  2L5Y A;  1HQV A;  5CSF A;  2M7L A;  5HL1 A;  4R1E A;  2KLE A;  1QLS A;  3K1E A;  3WXA A;  2Y4Q A;  3PJI A;  5FI2 A;  1Z4H A;  3EVR A;  3O4X A;  3FWB A;  3PAL A;  2LCP A;  4KYN A;  4OKH A;  2KNE A;  3DVK A;  5G08 A;  2LVJ A;  3RM1 A;  1BG1 A;  3AKB A;  1XFX O;  2BBM A;  5HKZ A;  3DY9 A;  2NCO A;  2LC5 A;  2QDI A;  3NSK A;  1PVA A;  4AOM A;  1R2U A;  1ZUZ A;  1KCY A;  3VRR A;  1QS7 A;  4I5N B;  3VRQ A;  5TNC A;  2WCJ A;  5D69 A;  1UUS A;  3FE8 A;  3IF7 A;  1IJ5 A;  3LLE A;  2H61 C;  1K8U A;  1S1E A;  3KO0 A;  2KI4 C;  3VRP A;  1OZS A;  1SL8 A;  1OOG A;  2K7D A;  2KQ6 A;  2O5G A;  4I5L B;  4N1F A;  1NPQ A;  4F0Z B;  1CDN A;  3BQ3 A;  2FJY A;  4P5O E;  5CSI A;  1V1G A;  2KSP A;  4JQ0 D;  2FJU B;  2KYF A;  1DT7 B;  1M31 A;  1X02 A;  2CXJ A;  2LP3 A;  1B4C A;  3OGN A;  1HT9 A;  4A4B A;  1EXR A;  1DJI A;  1GGZ A;  2LHI A;  2KAX A;  3VRO A;  2KYC A;  1WDC B;  2LUX A;  4DIR A;  4PT1 A;  1V1F A;  1Q80 A;  1B8R A;  1WRL A;  2E6W A;  4GGF A;  1IQ3 A;  3SG4 A;  2ZN9 A;  3CR5 X;  5CSJ A;  1JF0 A;  1UP5 A;  1WRZ A;  1SPY A;  2G9B A;  2M9G A;  4ICB A;  1YVH A;  2KBI A;  1SL9 A;  3O6B A;  1K90 D;  1C7W A;  4DCK A;  5I2Q A;  1DMO A;  5HKY A;  2KI4 B;  1S5G Y;  3C1V A;  3FWC A;  1K94 A;  1SRA A;  3BFA A;  3CZ1 A;  3I5G C;  4P2Y B;  2BL0 C;  2F2O A;  2V53 A;  1RTP 1;  1OMR A;  1TCF A;  1PRW A;  4FQO A;  1LKJ A;  3NSO A;  1SYM A;  2PVB A;  3TS5 C;  4MLW A;  1UHI A;  2BBN A;  1XFV O;  3BXK A;  2B1U A;  1TUZ A;  3OX6 A;  5HLV A;  1ZMZ A;  4CLN A;  1G8I A;  2Q4U A;  1QVI Y;  3EG5 B;  4PDZ A;  1SR6 C;  1R6P A;  3L47 A;  1KFU L;  1OW4 A;  1S6C A;  3A8R A;  1RRO A;  1AHR A;  1XFY O;  2LE9 B;  3IVT A;  4OR9 B;  4ORB B;  1OOJ A;  4OV2 A;  1IGV A;  2F2P A;  3L4A A;  4NQG A;  1SMG A;  3CTN A;  2Y1M A;  1BU3 A;  1J7R A;  4BY4 A;  1QAT A;  1QIW A;  2NLN A;  2L50 A;  1DGV A;  1XFZ O;  1PUL A;  2LVI A;  3DVE A;  1SK6 D;  5IBW A;  1C07 A;  2K8M B;  1A75 B; 
#chains in the Genus database with same CATH homology
 3EVV A;  4JWQ A;  3LK1 A;  1DF0 A;  1ZAC A;  2BKI B;  2H61 A;  3I5G B;  1DTL A;  3OHM B;  4M2P A;  4AQJ A;  2BL0 B;  3CR4 X;  2L4H A;  3NXA A;  1B1G A;  3TS5 B;  2JT3 A;  2MBX A;  1DJY A;  1AVS A;  3WHU B;  4C0K A;  1WLZ A;  5KTY A;  1TRF A;  1NWD A;  2LP2 A;  1KSO A;  3PN7 C;  3BUW B;  4ZCV A;  1TOP A;  2JTZ A;  4M2O A;  4OVN F;  1UHJ A;  1RJV A;  1RK9 A;  3KEV A;  1SW8 A;  3F45 A;  4E68 A;  2JRF A;  4I5K A;  2LM5 A;  1EL4 A;  1WRK A;  4ETO A;  1LXF C;  1J1D A;  1MXE A;  4GPL B;  4PHK A;  1AJ5 A;  2Y1N A;  3EKH A;  4USL A;  4NDC A;  1Y1A A;  1A75 A;  3OB1 B;  1UWO A;  1ZFS A;  1NX2 A;  2MLF C;  2LNK A;  4WQ3 A;  4PHJ A;  4XJK B;  1K2H A;  1FPW A;  4U8D A;  2JXC A;  1XK4 C;  2KI6 C;  3PN7 B;  1U5I A;  3GK4 X;  1IRJ A;  1CFP A;  1G4Y R;  2D8N A;  4MZL A;  4XYN A;  3SJS A;  1W7I B;  3JVT B;  1KFX S;  1H4B A;  1AUI B;  1CB1 A;  1G33 A;  2KAY A;  3DF0 A;  4MZK A;  4CFR A;  1F54 A;  4L9M A;  2JU0 A;  4N5X A;  1TNW A;  2JWW A;  4YI8 A;  1MXL C;  4D1E A;  1K96 A;  1OZO A;  4N1G A;  1MR8 A;  2M3W A;  1JWD A;  2KOT A;  2L5X B;  1QLK A;  2JNF A;  1TNX A;  1S5G Z;  2CT9 A;  1WDC C;  2LHL A;  1GJY A;  1S36 A;  2JTT A;  1XVJ A;  2I18 A;  1LA0 A;  1BF5 A;  1DJZ A;  1J7O A;  3EK7 A;  1CTR A;  1QX7 A;  1F4O A;  1QV1 A;  5AAN A;  1CFF A;  1JBA A;  2M8U A;  1MHO A;  3EK8 A;  4M2Q A;  1QV0 A;  2ZFD A;  3K21 A;  1IKU A;  1M45 A;  5DKQ A;  1S3P A;  3BUM B;  2L0P A;  1M39 A;  2M0R A;  4OCI A;  4A4C A;  2MRD A;  2COL B;  2JXL A;  4GGN A;  2JZI A;  1NX0 A;  3I5I B;  4C0L A;  1JSA A;  2HET A;  1F70 A;  1XO5 A;  1ZOT B;  2CBL A;  2F33 A;  2FOT A;  1UHH A;  2EGD A;  2LLT A;  2RGI A;  3I5H B;  1IJ6 A;  1NYA A;  4DS7 A;  2LLS A;  2F8P A;  5AFP A;  4MVF A;  3TDI A;  1LA3 A;  1A03 A;  3QRX A;  2I7A A;  1YUT A;  3FS7 A;  5KU1 A;  2JQ6 A;  1CLM A;  3VRN A;  4WRI A;  3AKA A;  2LAP A;  2WCE A;  1CLB A;  2G2B A;  1C7V A;  2DOQ A;  2JPT A;  2MAZ A;  2Q91 A;  2CNP A;  5I2L A;  1NSH A;  4ORA B;  1J7Q A;  1OMD A;  1SL7 A;  3IQQ A;  3NSL A;  2WCB A;  1TNP A;  1QIV A;  3EVU A;  2ZND A;  4PE0 A;  2E30 A;  5PAL A;  3SG3 A;  4I5J A;  3BUX B;  1AJ4 A;  3O4Y A;  5AXI A;  1CDL A;  1E8A A;  1NCY A;  1YRU B;  1F4Q A;  3D0Y B;  5FYX A;  1F55 A;  2M1K B;  3CWG A;  1IWQ A;  1YRT B;  1J7P A;  3TDU A;  1OQP A;  2HPS A;  1LIN A;  2QAC A;  2PMY A;  3GK2 A;  4MZJ A;  3ZWH A;  1S26 D;  3GOF A;  1BMO A;  5J3X A;  2LAN A;  4DUQ A;  4QJ5 B;  4YI9 A;  2L2E A;  2TN4 A;  1M63 B;  3LL8 B;  4BY5 A;  2ZRS A;  1BT6 A;  1KK8 C;  2KQY A;  1DJG A;  2LLU A;  1FW4 A;  5HKW A;  1SKT A;  1SY9 A;  2PSR A;  2KGR A;  3SIA A;  2ZNE A;  4HSZ A;  1NX1 A;  1NCX A;  4GNK B;  1Y6W A;  5B8I B;  2JC2 A;  1YUU A;  3PFV A;  1KWO C;  1MWN A;  1QTX A;  3CLN A;  1IQ5 A;  1CMG A;  3ICB A;  3JVT C;  4PHN A;  5K89 A;  4YGD B;  5ER5 A;  1SCM C;  1REC A;  2GGZ A;  4MRX A;  1CLL A;  1KK7 Y;  4HRH A;  1AP4 A;  1F71 A;  1CKK A;  2F3Y A;  2PRU A;  1CNP A;  2BKH B;  2WOR A;  1JFJ A;  1B7T Y;  1D1O A;  1KK8 B;  1PK0 D;  3TUY C;  2L98 A;  1JF2 A;  1NCZ A;  2AUC A;  5HLO A;  1XA5 A;  3AAJ A;  1L7Z A;  5AEQ A;  3SG6 A;  1M46 A;  4IL1 A;  1PSR A;  2AMI A;  4QJ3 B;  2LMU A;  4YGE B;  1CM4 A;  1KWO B;  2VRG A;  3A4U B;  1QXP A;  2JOJ A;  2L51 A;  4PE1 A;  2JT8 A;  5KSZ A;  2NCP A;  1SCV A;  1SCM B;  2Y5I A;  3EKJ A;  4PE7 A;  3I5I C;  3GK1 A;  3OX5 A;  3KPX A;  2KHN A;  5BPJ A;  1JFK A;  4GGF C;  3AAK A;  1CM1 A;  2FCE A;  2SAS A;  1Y0V H;  1K9K A;  1N65 A;  1BR1 B;  3I5H C;  1OMV A;  2M49 B;  3HX4 A;  3PSR A;  1CFC A;  1YUR A;  1YUS A;  4YRU A;  1EJ3 A;  1ODB A;  1YVL A;  1CDM A;  2HQ8 A;  3TUY B;  1TCO B;  4GBA A;  2BE6 A;  2KGB C;  5CPV A;  1TNQ A;  2PAS A;  5D7F A;  5DKR A;  4AQI A;  2GGM A;  1K95 A;  1QVI Z;  4GFT A;  2QPT A;  2MJW B;  1Y1X A;  4MN0 A;  2M97 A;  3KHE A;  4NDB A;  3EK4 A;  4XJK A;  1BLQ A;  2R2I A;  1BOC A;  2WCF A;  1K9P A;  2K7O A;  1MQ1 A;  3OB2 B;  2WC8 A;  1PAL A;  1K9U A;  1NUB A;  1B9A A;  3BUO B;  1J55 A;  1KFU S;  1F8H A;  1TTX A;  1UHN A;  1B8C A;  1FI6 A;  2JT0 A;  2JUL A;  2LUC A;  2KI6 D;  3OP0 A;  1DJX A;  3LCP C;  1JUO A;  2KDH A;  1EH2 A;  5AER A;  1J1E A;  1H8B A;  1BR4 B;  2I2R E;  1BOD A;  4JPZ B;  1ALW A;  1SBJ A;  1GQM A;  2LVK A;  3ZNI A;  1FI5 A;  2IS9 A;  3LK0 A;  1YR5 A;  2LMV A;  1XFW O;  1YX8 A;  1MUX A;  1B47 A;  1S6I A;  2LVV A;  1KFX L;  1XK4 A;  2KFG A;  2KAV A;  3RLZ A;  2K0J A;  1TIZ A;  5I8N A;  2I94 A;  3IQO A;  2EHB A;  2GV5 A;  1ALV A;  3DVJ A;  3TDZ A;  1XYD A;  4FTG A;  3M0W A;  4YGA A;  1KK7 Z;  4CFQ A;  4PAL A;  2WOS A;  1LVC D;  3WNX B;  5HYD A;  4C0J A;  1YTZ C;  1B7T Z;  2A4J A;  1RFJ A;  3DVM A;  1QX2 A;  3BOW B;  1KQV A;  1NIW A;  1SNL A;  1DF0 B;  1A29 A;  2F3Z A;  1OSA A;  4MEW A;  1WLM A;  1L2O C;  1DGU A;  2BCX A;  3DD4 A;  2ISD A;  3BUN B;  2SCP A;  4ZCU A;  1K93 D;  4HRG A;  2EC6 C;  1KQM C;  4YBH B;  3PM8 A;  3VGO A;  1AK8 A;  1UHK A;  3MSE B;  2WND A;  1PSB A;  5DKN A;  5I2O A;  5JJG A;  3PLF B;  3I5F C;  2M7N A;  4TNC A;  2BE4 A;  3KF9 A;  3SIB A;  2O60 A;  4MRY A;  2HF5 A;  1NP8 A;  2K61 A;  4HRE E;  2K2F A;  1MF8 B;  2K2A A;  3FIA A;  1DVI A;  1IH0 A;  2CTN A;  1W7J B;  3O78 A;  1EG3 A;  1N2D A;  1UUR A;  2H2K A;  4CID A;  3JTD C;  2AAO A;  1B8L A;  1OE9 B;  3D0Y A;  2BCA A;  3CS1 A;  2KBM A;  3BOW A;  4PE4 A;  2MHH A;  2K7B A;  1L2O B;  1A2X A;  4QJ4 B;  1GGW A;  1YX7 A;  1WY9 A;  3O2P A;  3WHT B;  1JC2 A;  3HCM A;  1QJT A;  3NSI A;  4GUK A;  4YGC B;  5ER4 X;  2EC6 B;  1KQM B;  2MA2 A;  1XFU O;  1S6J A;  4MSP A;  4YGB B;  2ZRT A;  1U5I B;  3SG7 A;  4CPV A;  3I5F B;  2OS8 C;  3SG5 A;  1SR6 B;  2ZKM X;  2BCB A;  3PAT A;  1N0Y A;  4GAO A;  2PAL A;  3TZ1 A;  2FCD A;  4Q04 A;  5CSN A;  2MLE C;  3DF0 B;  5GQQ C;  2OTG C;  1DJH A;  3CGA A;  2KFF A;  3D10 A;  1FBV A;  1KSM A;  2NXQ A;  2M1U A;  2P6B B;  1DJW A;  2L4I A;  3JTD B;  1VRK A;  4UPG A;  2BEC A;  2NZ0 A;  4ORC B;  4PCW A;  4DRW A;  2LMT A;  3CR2 A;  3CZT X;  2ZN8 A;  1A4P A;  2KFH A;  3E3R A;  1CDP A;  3H4S E;  5JOL A;  2HQW A;  1CMF A;  1FF1 A;  1CFD A;  1Y1U A;  3SG2 A;  2OS8 B;  5F6T A;  4PHM A;  1BJF A;  3BYA A;  1PVB A;  1IG5 A;  2CCM A;  4MBE A;  1EG4 A;  1RWY A;  1QAS A;  1TN4 A;  2LV7 A;  2M29 A;  2OTG B;  2JNX A;  4OV2 A;  4NDD A;  1QX5 B;  1NX3 A;  2OPO A;  2K7C A;  4WQ2 A;  1HQV A;  5CSF A;  2M7L A;  4R1E A;  1QLS A;  3WXA A;  2Y4Q A;  3EVR A;  3FWB A;  3PAL A;  2LCP A;  4OKH A;  2KNE A;  3DVK A;  5G08 A;  2LVJ A;  3RM1 A;  1BG1 A;  3AKB A;  1XFX O;  2BBM A;  5HKZ A;  2NCO A;  2LC5 A;  3NSK A;  4AOM A;  1PVA A;  1R2U A;  1ZUZ A;  1KCY A;  3VRR A;  1QS7 A;  4I5N B;  3VRQ A;  5TNC A;  5D69 A;  1UUS A;  3IF7 A;  1IJ5 A;  3LLE A;  2H61 C;  1K8U A;  1S1E A;  3KO0 A;  2KI4 C;  3VRP A;  1OZS A;  1SL8 A;  2K7D A;  4I5L B;  2KQ6 A;  2O5G A;  4N1F A;  4F0Z B;  1NPQ A;  1CDN A;  3BQ3 A;  4P5O E;  5CSI A;  1V1G A;  2KSP A;  4JQ0 D;  2FJU B;  2KYF A;  1DT7 B;  1M31 A;  1X02 A;  2CXJ A;  2LP3 A;  1B4C A;  1HT9 A;  4A4B A;  1EXR A;  1DJI A;  1GGZ A;  2LHI A;  2KAX A;  3VRO A;  2KYC A;  1WDC B;  2LUX A;  4DIR A;  1V1F A;  1Q80 A;  1B8R A;  1WRL A;  2E6W A;  4GGF A;  1IQ3 A;  3SG4 A;  2ZN9 A;  3CR5 X;  5CSJ A;  1JF0 A;  1UP5 A;  1WRZ A;  1SPY A;  2G9B A;  2M9G A;  4ICB A;  1YVH A;  2KBI A;  1SL9 A;  3O6B A;  1K90 D;  1C7W A;  4DCK A;  5I2Q A;  1DMO A;  5HKY A;  2KI4 B;  1S5G Y;  3C1V A;  3FWC A;  1K94 A;  1SRA A;  3I5G C;  4P2Y B;  2BL0 C;  2F2O A;  2V53 A;  1RTP 1;  1OMR A;  1TCF A;  1PRW A;  4FQO A;  1LKJ A;  3NSO A;  1SYM A;  2PVB A;  3TS5 C;  4MLW A;  1UHI A;  2BBN A;  1XFV O;  3BXK A;  2B1U A;  3OX6 A;  5HLV A;  4CLN A;  1ZMZ A;  1G8I A;  2Q4U A;  1QVI Y;  4PDZ A;  1SR6 C;  1R6P A;  1KFU L;  1S6C A;  3A8R A;  1RRO A;  1AHR A;  1XFY O;  2LE9 B;  4OR9 B;  4ORB B;  1OOJ A;  1IGV A;  2F2P A;  4NQG A;  1SMG A;  3CTN A;  2Y1M A;  1BU3 A;  1J7R A;  4BY4 A;  1QAT A;  1QIW A;  2NLN A;  2L50 A;  1DGV A;  1XFZ O;  1PUL A;  2LVI A;  3DVE A;  1SK6 D;  5IBW A;  1C07 A;  2K8M B;  1A75 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...