4XYNA

X-ray structure of ca(2+)-s100b with human rage-derived w61 peptide
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
90
structure length
90
Chain Sequence
b'MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Receptor for advanced glycation endproducts-derived peptide
publication title Structural insights into the binding of the human receptor for advanced glycation end products (RAGE) by S100B, as revealed by an S100B-RAGE-derived peptide complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein, metal binding protein
total genus 28
structure length 90
sequence length 90
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4xynA00
2LHIA 1RTP1 2KYFA 4HRGA 1JFJA 2I7AA 5G08A 1A29A 2M49B 1KK8C 1RK9A 4CFRA 3BYAA 2LLSA 1BODA 1XK4A 1OSAA 1Y1UA 4OKHA 2JT8A 3KO0A 2LAPA 1CB1A 1CMFA 1CDNA 1IH0A 1TCFA 2M1KB 2I94A 1XFYO 4UPGA 4D1EA 1SBJA 4PCWA 5F6TA 1JF2A 1XK4C 1WLMA 1WLZA 4GBAA 3TUYB 3ICBA 1IRJA 4YBHB 4DCKA 1UUSA 2BKIB 5KSZA 2LUXA 4PE7A 1JBAA 3EK7A 1G4YR 1S6IA 1S5GZ 1ZFSA 2LUCA 2I2RE 1B8LA 3PN7B 1CM4A 1C7VA 2KQYA 4GAOA 2E6WA 4MLWA 1UHNA 1LXFC 1Y0VH 1ZUZA 2JT3A 1M31A 3I5HC 1TOPA 1Y1XA 2JPTA 5I8NA 1S5GY 1OZOA 2H61A 1OOJA 5PALA 2KGRA 2KQ6A 1IGVA 3TDUA 1LA0A 3OX5A 4PHNA 3AAKA 2M29A 1PVBA 1QASA 2MLFC 2OPOA 1DJGA 1LVCD 2F33A 2LNKA 4MZKA 4GNKB 4ORBB 4C0JA 2CBLA 2K8MB 1MR8A 2H61C 2L2EA 2WCBA 1NPQA 4YGAA 4DUQA 3PFVA 1A03A 1BOCA 1GGZA 2KFGA 1YVLA 3BUXB 4ZCVA 1ZOTB 4XYNA 4OVNF 1AHRA 1KFXL 1Q80A 2EGDA 4JPZB 4MVFA 2JTTA 4L9MA 3CR2A 1C7WA 1XVJA 4M2QA 1M39A 3GOFA 3SJSA 2L50A 1L2OC 4TNCA 2RGIA 1K93D 1DJYA 1CDPA 2M7LA 3OB2B 1EJ3A 2CT9A 1SR6C 1K8UA 1DJWA 2K0JA 2JQ6A 1OQPA 2HQ8A 1SKTA 3AKBA 1CDMA 1IWQA 3FIAA 1SCVA 2LMTA 3I5FC 1TRFA 1TN4A 2KI4B 3DVMA 1BR1B 3LLEA 2BECA 2CNPA 2F3YA 1U5IB 1XFVO 1KSMA 1AP4A 1J1DA 3D10A 4PDZA 1BJFA 1SK6D 3JTDB 1SL8A 1BMOA 1KFXS 3O2PA 1KK7Z 1NP8A 4QJ4B 1EL4A 2F2OA 2JULA 3WNXB 3CTNA 1PVAA 5KU1A 1A75A 1BR4B 1S6CA 1VRKA 5JOLA 4QJ3B 1IQ3A 1XFWO 2LANA 3JVTB 2WNDA 4PE4A 1J1EA 2QACA 1R2UA 2BL0B 3RM1A 2I18A 4I5LB 1QIVA 1E8AA 3SG4A 2KFHA 3CZTX 3D0YA 1TTXA 3BOWB 1CFFA 2KAVA 2KAYA 1EH2A 1EG4A 3IQQA 4PHJA 1QJTA 3DF0A 3BQ3A 2OTGC 1QX2A 3SG5A 3NXAA 1XFUO 2K61A 4F0ZB 3DVJA 4I5JA 4PHKA 2IS9A 1IJ6A 1KSOA 1KQVA 1K94A 4GUKA 1RWYA 1KWOC 4BY4A 5HKYA 2ZKMX 2LCPA 2QPTA 3EKHA 2NXQA 3C1VA 3SG7A 1AK8A 1GJYA 2M9GA 3SG3A 3TDZA 4ORAB 1G8IA 2MAZA 1DMOA 1F8HA 1K90D 2M0RA 2EC6B 2KDHA 2P6BB 1EG3A 2FCEA 1K9PA 4MEWA 3HX4A 2PMYA 3LCPC 1GQMA 1IJ5A 4YGEB 4N1GA 1JWDA 1UURA 1TIZA 5ER5A 3ZWHA 1LA3A 2K7BA 2ZRSA 5CPVA 4GPLB 4GGNA 1J7RA 4I5NB 2OS8B 4USLA 1AJ4A 2E30A 2DOQA 4OV2A 1UHHA 3KEVA 1BLQA 4ZCUA 4N1FA 1NX3A 1DF0A 2KBMA 1M63B 1B7TZ 3H4SE 1F55A 2JXLA 2K7DA 3M0WA 3NSLA 2JT0A 4MN0A 2KOTA 2KAXA 3EVUA 2MHHA 1RJVA 1KQMC 1DTLA 1N2DA 4XJKB 1DGVA 2LE9B 1K9UA 4NDCA 1QIWA 4M2PA 1NX0A 2K7OA 5AFPA 2HETA 2MLEC 1B7TY 2NLNA 5CSNA 2LP2A 1IKUA 2JZIA 2NCOA 1GGWA 4Q04A 3CR4X 1DGUA 2M7NA 5J3XA 3VRRA 1SCMB 3WHUB 3EK4A 3O78A 3KPXA 5HKZA 1UHJA 2LHLA 2MJWB 3IF7A 2LM5A 4YRUA 2ZN9A 1WY9A 1B47A 1QX7A 2ZNEA 1J55A 3KHEA 5TNCA 1CM1A 2ZRTA 3A8RA 3TUYC 1MWNA 3O6BA 1WRLA 4WQ3A 4YI8A 3EVVA 2EHBA 1CFDA 1N65A 1PSRA 1SR6B 4IL1A 5HYDA 2PALA 4PALA 1TNPA 3HCMA 1V1FA 2PRUA 1YX8A 4P2YB 1XFZO 3F45A 5FYXA 1CFPA 3OHMB 2GGMA 1WRZA 1IQ5A 1QATA 3A4UB 3I5FB 1QV0A 1IG5A 1AVSA 2GGZA 4MZJA 5BPJA 1CLBA 1F71A 4E68A 2O5GA 1ODBA 1YRTB 1X02A 2ZNDA 2LMVA 1NUBA 1M46A 2JNXA 4C0KA 1YUSA 2F8PA 4GGFA 3TS5B 1ALWA 3EKJA 1RECA 1B9AA 1NCXA 4MSPA 3E3RA 4R1EA 3SG2A 1ZMZA 2GV5A 3PLFB 1QLSA 3NSIA 1WDCB 2JNFA 1LINA 4GGFC 2G9BA 3OP0A 1DJXA 3NSKA 4C0LA 1CNPA 1XYDA 2LLUA 3I5IB 2BBNA 2LVJA 4ETOA 3BUNB 2O60A 3EK8A 4OR9B 5CSFA 3WXAA 2B1UA 2R2IA 3RLZA 2OTGB 4QJ5B 2TN4A 3DD4A 3D0YB 1RFJA 1KK7Y 2FOTA 1NIWA 1QS7A 5HLOA 4DIRA 3DF0B 2JOJA 1NWDA 2JXCA 2V53A 3CR5X 4ICBA 3LK0A 4HRHA 3AAJA 4ORCB 4DRWA 2H2KA 1MXLC 1F4OA 3IQOA 2F3ZA 4HSZA 5AERA 1AUIB 1SY9A 3OX6A 1FI5A 1S1EA 4U8DA 1KK8B 3I5GC 1SYMA 1H4BA 3GK2A 3PALA 2K2AA 2KFFA 1QV1A 1XFXO 4HREE 2K7CA 3JTDC 1FF1A 2KI6C 3BXKA 1OMVA 1F70A 1SNLA 1TNXA 2VRGA 3DVKA 2Y1MA 1UHIA 1SRAA 4YI9A 1DVIA 5K89A 1SL7A 2BCAA 1CTRA 2BKHB 1SW8A 4CLNA 1QVIZ 2BE6A 1JSAA 2SASA 2HPSA 1S6JA 2LV7A 5I2LA 2BL0C 1B1GA 4NDDA 5DKQA 1OE9B 1KFUL 5GQQC 1AJ5A 2KGBC 4DS7A 1S3PA 4YGBB 2L0PA 1JFKA 1QVIY 1H8BA 3K21A 2AMIA 4N5XA 3I5HB 1TNWA 3EVRA 3VROA 1B8CA 3QRXA 1XA5A 2CXJA 2MRDA 3SIAA 1XO5A 3LL8B 5AANA 1SMGA 3VRQA 4JQ0D 5AEQA 5KTYA 2HQWA 2LVKA 1UP5A 1MHOA 2LLTA 4PHMA 1K96A 2KYCA 2AAOA 1S26D 3GK4X 1MXEA 5I2QA 1SL9A 1MUXA 1FBVA 4OCIA 1Y1AA 2EC6C 5DKRA 5HLVA 1UHKA 1J7PA 2CCMA 2BCXA 3ZNIA 4AOMA 1EXRA 1D1OA 2CTNA 3OB1B 2KBIA 4PE1A 1K2HA 2M3WA 1A4PA 1OZSA 4PE0A 1MF8B 2G2BA 2M8UA 2ZN8A 1TCOB 2L51A 1L2OB 1KFUS 1LKJA 1QXPA 2FJUB 2MBXA 5IBWA 5B8IB 2OS8C 1CMGA 1PRWA 1N0YA 2SCPA 5HKWA 1NYAA 4XJKA 2JC2A 1YUUA 5DKNA 3VRPA 1A2XA 3KF9A 2LVVA 2FCDA 2PSRA 1WRKA 3PN7C 3FWCA 1HQVA 1HT9A 4A4CA 1PALA 2A4JA 1PK0D 2Y1NA 1M45A 1YX7A 2LP3A 3NSOA 1FPWA 2BBMA 4CFQA 4JWQA 3AKAA 2WCEA 2JWWA 1SCMC 2PASA 1CDLA 3PM8A 4MRYA 2HF5A 2Y5IA 5ER4X 1KCYA 4NQGA 1DT7B 1V1GA 4YGCB 1Y6WA 1NCYA 1BG1A 2MA2A 2WCFA 3PSRA 4NDBA 3TDIA 1CFCA 3FWBA 1YURA 2WOSA 3VGOA 2NCPA 2PVBA 2BE4A 4MBEA 1CLLA 2M97A 1A75B 4AQJA 2WORA 1YTZC 1CLMA 1NSHA 4CIDA 3TZ1A 2L5XB 3WHTB 5AXIA 1J7QA 2KHNA 1ALVA 2LVIA 4MRXA 1YVHA 5D69A 1JC2A 1FI6A 3I5GB 3CS1A 3LK1A 5CSIA 2K2FA 1MQ1A 3CGAA 4I5KA 2D8NA 1QX5B 1PSBA 1ZACA 1B8RA 2LMUA 1KWOB 2M1UA 3GK1A 3MSEB 2JU0A 4GFTA 2ISDA 4YGDB 5CSJA 4P5OE 1G33A 1U5IA 3CLNA 1OMRA 1L7ZA 3SIBA 3DVEA 3TS5C 2NZ0A 2WC8A 3VRNA 1JF0A 4AQIA 3BUMB 2KI4C 3O4YA 1JUOA 2L98A 2LC5A 2Q4UA 1R6PA 4CPVA 3PATA 1K9KA 1NX2A 2JRFA 1WDCC 2L4IA 4FQOA 5JJGA 1J7OA 4BY5A 1CKKA 1DJHA 1S36A 1F54A 2KSPA 1NX1A 5I2OA 3I5IC 1B4CA 1W7JB 2JTZA 2KNEA 3SG6A 1YUTA 2ZFDA 3BUWB 4MZLA 3BOWA 4WRIA 1QLKA 4WQ2A 4A4BA 2AUCA 5D7FA 1BT6A 1UWOA 3JVTC 1C07A 1DJIA 1YR5A 2L4HA 4M2OA 1NCZA 1OMDA 3CWGA 1SPYA 3FS7A 1TNQA 2BCBA 2Y4QA 2F2PA 1BU3A 1KQMB 1K95A 3BUOB 1PULA 1YRUB 1W7IB 2Q91A 1RROA 1DF0B 1FW4A 4FTGA 2KI6D 1BF5A 2COLB 1QTXA 1F4QA 1DJZA
chains in the Genus database with same CATH superfamily
2LHIA 1RTP1 2KYFA 4HRGA 2WCHA 2I7AA 3CZ1A 1A29A 2M49B 5G08A 1KK8C 1RK9A 1JFJA 4CFRA 3BYAA 2LLSA 1BODA 2ISDA 1XK4A 1OSAA 1Y1UA 4OKHA 5DICA 2JT8A 3KO0A 2LAPA 1CB1A 1CMFA 1CDNA 2GTEA 1IH0A 1TCFA 2M1KB 3NHIA 3CABA 2I94A 1XFYO 4UPGA 4D1EA 1SBJA 4PCWA 5F6TA 1JF2A 1XK4C 1WLMA 1WLZA 2L5YA 4GBAA 3ICBA 1IRJA 4YBHB 3TUYB 4DCKA 1UUSA 3D76A 2BKIB 5KSZA 2LUXA 4PE7A 1JBAA 3EK7A 1G4YR 1S6IA 1S5GZ 1ZFSA 2LUCA 2I2RE 1B8LA 3PN7B 1CM4A 5FI2A 4PT1A 1C7VA 2KQYA 4GAOA 2E6WA 4MLWA 1UHNA 1LXFC 1Y0VH 1ZUZA 2JT3A 1M31A 3I5HC 1TOPA 1Y1XA 2JPTA 5I8NA 1S5GY 1OZOA 3R1VA 2H61A 1OOJA 5PALA 2KGRA 2KQ6A 1IGVA 3TDUA 1LA0A 3OX5A 4PHNA 3AAKA 2M29A 1PVBA 1QASA 2MLFC 2OPOA 1T14A 1DJGA 1LVCD 2F33A 2LNKA 4MZKA 4GNKB 4ORBB 4C0JA 2CBLA 2K8MB 1MR8A 2H61C 5FI7A 3Q8IA 2L2EA 2WCBA 1NPQA 4YGAA 4DUQA 3PFVA 1A03A 3OGNA 1BOCA 1GGZA 2KFGA 1YVLA 3BUXB 4ZCVA 1ZOTB 4XYNA 4OVNF 1AHRA 1KFXL 1Q80A 2EGDA 4INWA 4JPZB 4MVFA 2JTTA 4L9MA 3CZ0A 2WCMA 1C7WA 1XVJA 3CR2A 4M2QA 1M39A 3GOFA 3SJSA 2L50A 1L2OC 4TNCA 2RGIA 2QEVA 1K93D 1DJYA 1CDPA 3DZTA 2M7LA 2JPOA 3OB2B 1OOIX 1EJ3A 2CT9A 1SR6C 1K8UA 1DJWA 3R72A 2K0JA 2WCLA 2JQ6A 1OQPA 2HQ8A 1SKTA 3AKBA 1CDMA 1IWQA 2YGUA 5HL1A 3FIAA 1SCVA 2LMTA 3I5FC 3D75A 1TRFA 1TN4A 2KI4B 3DVMA 1BR1B 3LLEA 2BECA 2CNPA 2F3YA 4JD9A 5D3OA 3B7AA 1U5IB 1XFVO 1KSMA 1AP4A 1J1DA 3D10A 4PDZA 1BJFA 1SK6D 3JTDB 1SL8A 1BMOA 1KFXS 3O2PA 1KK7Z 1NP8A 4QJ4B 1EL4A 2F2OA 3SS5A 2JULA 3WNXB 3CTNA 1PVAA 1TUJA 1A75A 5KU1A 1BR4B 1S6CA 1VRKA 1Z2CB 5JOLA 3VB1A 4QJ3B 1IQ3A 1XFWO 2LANA 3JVTB 2WNDA 4PE4A 1J1EA 2QACA 1R2UA 2BL0B 3RM1A 2I18A 4I5LB 1QIVA 1E8AA 3SG4A 2KFHA 3CZTX 3D0YA 1TTXA 3BOWB 1CFFA 2KAVA 2KAYA 1EH2A 1EG4A 3IQQA 4PHJA 1QJTA 2P71A 3DF0A 3BQ3A 2OTGC 1QX2A 3SG5A 3NXAA 1XFUO 2K61A 4F0ZB 3OBVA 3DVJA 4I5JA 4PHKA 2K60A 3B87A 2IS9A 1IJ6A 1KSOA 3S0DA 1KQVA 1K94A 4GUKA 1RWYA 1KWOC 4BY4A 5HKYA 2ZKMX 2LCPA 2QPTA 3EKHA 2NXQA 3C1VA 3SG7A 1AK8A 1GJYA 2M9GA 3SG3A 3TDZA 4ORAB 1G8IA 2MAZA 1DMOA 1F8HA 1K90D 2M0RA 2EC6B 2KDHA 2P6BB 1EG3A 2FCEA 1K9PA 4MEWA 3HX4A 3FE8A 3R1PA 2PMYA 1DC1A 3LCPC 1GQMA 1IJ5A 4YGEB 4N1GA 1JWDA 1UURA 1TIZA 5ER5A 3ZWHA 3NGVA 3S0EA 1LA3A 2K7BA 2ZRSA 5CPVA 4GPLB 3NHTA 4GGNA 1J7RA 4I5NB 2OS8B 4USLA 1AJ4A 2E30A 2DOQA 3D74A 1UHHA 3IVTA 3KEVA 2QEBA 3N7HA 4OV2A 4ZCUA 4N1FA 1NX3A 1DF0A 2KBMA 1M63B 1B7TZ 3H4SE 1F55A 2JXLA 2K7DA 3M0WA 3NSLA 2JT0A 4MN0A 2KOTA 2KAXA 3EVUA 2MHHA 1DEKA 1RJVA 1KQMC 3L47A 1DTLA 1N2DA 4XJKB 1DGVA 2LE9B 1K9UA 4NDCA 1QIWA 4M2PA 1C3YA 1NX0A 2K7OA 5AFPA 1OOFA 2HETA 2MLEC 1B7TY 2NLNA 5CSNA 2LP2A 1IKUA 2JZIA 2NCOA 5FI6A 1GGWA 4Q04A 3CR4X 1DGUA 2M7NA 5J3XA 3S0BA 1SCMB 3VRRA 3WHUB 3EK4A 3O78A 3KPXA 5HKZA 1UHJA 2LHLA 2MJWB 3IF7A 2LM5A 4YRUA 2ZN9A 1WY9A 4IJ7A 1B47A 1QX7A 2ZNEA 3B86A 1J55A 3KHEA 5TNCA 1CM1A 2BAPA 2ZRTA 3A8RA 3TUYC 1DELA 3CZ2A 1MWNA 3O6BA 1WRLA 4WQ3A 4YI8A 3EVVA 2EHBA 1CFDA 1N65A 1PSRA 1SR6B 4IL1A 5HYDA 2PALA 3R1OA 4PALA 1TNPA 3HCMA 1V1FA 2PRUA 1YX8A 4P2YB 1XFZO 3F45A 5FYXA 1CFPA 3L4LA 3O4XA 3OHMB 2GGMA 1WRZA 3BJHA 1IQ5A 1QATA 2P70A 3A4UB 3B6XA 2L2CA 3I5FB 1QV0A 2WCKA 1IG5A 1AVSA 2GGZA 4MZJA 5BPJA 1CLBA 1F71A 4E68A 2O5GA 1ODBA 1YRTB 1X02A 2ZNDA 2LMVA 1NUBA 1M46A 2JNXA 4C0KA 1YUSA 2F8PA 4GGFA 3S0AA 3TS5B 1ALWA 3EKJA 1RECA 3BFBA 1B9AA 1NCXA 4MSPA 3E3RA 4R1EA 3SG2A 1ZMZA 2GV5A 3PLFB 1QLSA 3NSIA 3S0GA 1WDCB 2JNFA 1LINA 4GGFC 1TWOA 2G9BA 2BNXA 3OP0A 1DJXA 3NSKA 4C0LA 1CNPA 1XYDA 2LLUA 3I5IB 2BBNA 2KLEA 2LVJA 3BUNB 4ETOA 2O60A 3EK8A 4OR9B 5CSFA 3WXAA 2B1UA 2R2IA 3RLZA 1BLQA 2OTGB 4QJ5B 2TN4A 3DD4A 3D0YB 1RFJA 1KK7Y 2FOTA 1NIWA 1QS7A 2KLDA 5HLOA 4DIRA 3DF0B 2JOJA 1NWDA 2JXCA 2V53A 3CR5X 4ICBA 3LK0A 4HRHA 3AAJA 4ORCB 4DRWA 2H2KA 1MXLC 1F4OA 3IQOA 1TUZA 2F3ZA 4HSZA 1DQEA 1AUIB 5AERA 1SY9A 3OX6A 1FI5A 1S1EA 4U8DA 1KK8B 3I5GC 1SYMA 1H4BA 3GK2A 3PALA 2K2AA 2KFFA 1QV1A 1XFXO 4HREE 2K7CA 3JTDC 1FF1A 2KI6C 3BXKA 1OMVA 1F70A 1SNLA 1OW4A 1TNXA 3D77A 2VRGA 3DVKA 2Y1MA 1UHIA 1SRAA 3FE9A 4YI9A 1DVIA 5K89A 1SL7A 2BCAA 1CTRA 2BKHB 1SW8A 4CLNA 1QVIZ 2BE6A 3PM2A 1IIOA 1JSAA 2SASA 2HPSA 1S6JA 2LV7A 5I2LA 2BL0C 1B1GA 4NDDA 5DKQA 1OE9B 3DY9A 2PYQA 4JKTA 1KFUL 5GQQC 1AJ5A 2KGBC 4DS7A 1S3PA 4YGBB 2L0PA 1C3ZA 1JFKA 1QVIY 3CDNA 3K21A 1H8BA 2AMIA 4N5XA 3D78A 3I5HB 1TNWA 3EVRA 3VROA 1B8CA 3QRXA 1XA5A 2CXJA 2MRDA 3SIAA 1XO5A 3LL8B 4KYNA 5AANA 1SMGA 3VRQA 2QDIA 4JQ0D 5AEQA 5KTYA 2HQWA 2LVKA 1UP5A 1MHOA 2LLTA 4PHMA 1K96A 2KYCA 2AAOA 1S26D 3GK4X 1MXEA 5I2QA 1SL9A 1MUXA 1FBVA 4OCIA 1Y1AA 2EC6C 5DKRA 5HLVA 2WC5A 1UHKA 1J7PA 2BCXA 2CCMA 3D73A 3QMEA 1EXRA 3ZNIA 2CTNA 3OB1B 4AOMA 2KBIA 4PE1A 1D1OA 1K2HA 1SSEB 2M3WA 5I94A 1A4PA 1OZSA 4PE0A 1MF8B 2G2BA 2M8UA 2ZN8A 3DYEA 1TCOB 2L51A 1L2OB 3DXLA 1KFUS 1LKJA 1QXPA 3FE6A 2FJUB 3RZSA 2MBXA 5IBWA 5B8IB 2OS8C 1CMGA 1PRWA 1N0YA 2SCPA 5HKWA 1NYAA 4XJKA 2JC2A 1YUUA 5DKNA 3VRPA 1A2XA 3KF9A 2PQLA 2LVVA 2FCDA 2PSRA 3EG5B 1WRKA 1Z4HA 3PN7C 3FWCA 1HQVA 1HT9A 4A4CA 2QEOA 4FQTA 1PALA 2A4JA 1PK0D 2Y1NA 1M45A 1YX7A 2LP3A 3NSOA 1FPWA 2BBMA 4CFQA 3S0FA 2FJYA 4JWQA 3AKAA 2WCEA 2JWWA 1SCMC 3BFAA 3L4AA 2PASA 1CDLA 3PM8A 4MRYA 1OOHA 2HF5A 1ORGA 2Y5IA 5ER4X 3UNWA 1KCYA 4NQGA 1DT7B 1V1GA 4YGCB 1Y6WA 1NCYA 1BG1A 2MA2A 2WCFA 3PSRA 4NDBA 3TDIA 1QWVA 1CFCA 3FWBA 1YURA 2WOSA 3VGOA 2NCPA 2PVBA 2QEHA 2BE4A 4MBEA 1CLLA 2M97A 1A75B 1LS8A 2WC6A 4AQJA 2WORA 1YTZC 2WCJA 1CLMA 1NSHA 2H8VA 4CIDA 3K1EA 3TZ1A 2L5XB 3WHTB 5AXIA 1J7QA 2KHNA 1ALVA 2LVIA 3PJIA 4MRXA 1YVHA 5D69A 1JC2A 1FI6A 3I5GB 3CS1A 3LK1A 5CSIA 2K2FA 3V2LA 1MQ1A 3CGAA 1OOGA 4I5KA 2D8NA 1QX5B 1PSBA 1ZACA 1B8RA 2ERBA 1KWOB 2LMUA 2M1UA 3GK1A 2JU0A 3MSEB 4GFTA 4YGDB 5CSJA 4P5OE 1G33A 1U5IA 1W9ZA 3CLNA 1OMRA 4INXA 1L7ZA 3SIBA 3SS4A 3DVEA 1XFRA 3TS5C 2NZ0A 2WC8A 3VRNA 1JF0A 3UO9A 2KPHA 2KI4C 3BUMB 1JUOA 3O4YA 4AQIA 2L98A 2LC5A 2Q4UA 1R6PA 4CPVA 3PATA 1K9KA 1NX2A 2JRFA 1WDCC 2L4IA 4FQOA 4F7FA 5JJGA 1J7OA 4BY5A 1GM0A 4OZDA 1CKKA 1DJHA 3BFHA 1S36A 1F54A 2KSPA 1NX1A 5I2OA 3I5IC 1B4CA 1W7JB 2JTZA 2KNEA 3SG6A 1YUTA 2ZFDA 3BUWB 4MZLA 3BOWA 4WRIA 1QLKA 4WQ2A 4A4BA 2AUCA 5D7FA 5EL2A 1BT6A 1UWOA 3JVTC 1C07A 3SS3A 1DJIA 1P28A 1YR5A 2L4HA 4M2OA 1NCZA 1OMDA 3CWGA 1SPYA 3FS7A 1TNQA 2BCBA 2Y4QA 2F2PA 1BU3A 1KQMB 1K95A 3BUOB 1PULA 1YRUB 3B88A 1W7IB 2Q91A 1RROA 1DF0B 1FW4A 4FTGA 3CYZA 2KI6D 1BF5A 2COLB 1QTXA 1F4QA 1DJZA
chains in the Genus database with same CATH topology
2LHIA 1RTP1 2KYFA 4HRGA 1JFJA 2I7AA 5G08A 1A29A 2M49B 1KK8C 1RK9A 4CFRA 3BYAA 2LLSA 1BODA 1XK4A 1OSAA 1Y1UA 4OKHA 2JT8A 3KO0A 2LAPA 1CB1A 1CMFA 1CDNA 1IH0A 1TCFA 2M1KB 2I94A 1XFYO 4UPGA 4D1EA 1SBJA 4PCWA 5F6TA 1JF2A 1XK4C 1WLMA 1WLZA 4GBAA 3TUYB 3ICBA 1IRJA 4YBHB 4DCKA 1UUSA 2BKIB 5KSZA 2LUXA 4PE7A 1JBAA 3EK7A 1G4YR 1S6IA 1S5GZ 1ZFSA 2LUCA 2I2RE 1B8LA 3PN7B 1CM4A 1C7VA 2KQYA 4GAOA 2E6WA 4MLWA 1UHNA 1LXFC 1Y0VH 1ZUZA 2JT3A 1M31A 3I5HC 1TOPA 1Y1XA 2JPTA 5I8NA 1S5GY 1OZOA 2H61A 1OOJA 5PALA 2KGRA 2KQ6A 1IGVA 3TDUA 1LA0A 3OX5A 4PHNA 3AAKA 2M29A 1PVBA 1QASA 2MLFC 2OPOA 1DJGA 1LVCD 2F33A 2LNKA 4MZKA 4GNKB 4ORBB 4C0JA 2CBLA 2K8MB 1MR8A 2H61C 2L2EA 2WCBA 1NPQA 4YGAA 4DUQA 3PFVA 1A03A 1BOCA 1GGZA 2KFGA 1YVLA 3BUXB 4ZCVA 1ZOTB 4XYNA 4OVNF 1AHRA 1KFXL 1Q80A 2EGDA 4JPZB 4MVFA 2JTTA 4L9MA 3CR2A 1C7WA 1XVJA 4M2QA 1M39A 3GOFA 3SJSA 2L50A 1L2OC 4TNCA 2RGIA 1K93D 1DJYA 1CDPA 2M7LA 3OB2B 1EJ3A 2CT9A 1SR6C 1K8UA 1DJWA 2K0JA 2JQ6A 1OQPA 2HQ8A 1SKTA 3AKBA 1CDMA 1IWQA 3FIAA 1SCVA 2LMTA 3I5FC 1TRFA 1TN4A 2KI4B 3DVMA 1BR1B 3LLEA 2BECA 2CNPA 2F3YA 1U5IB 1XFVO 1KSMA 1AP4A 1J1DA 3D10A 4PDZA 1BJFA 1SK6D 3JTDB 1SL8A 1BMOA 1KFXS 3O2PA 1KK7Z 1NP8A 4QJ4B 1EL4A 2F2OA 2JULA 3WNXB 3CTNA 1PVAA 5KU1A 1A75A 1BR4B 1S6CA 1VRKA 5JOLA 4QJ3B 1IQ3A 1XFWO 2LANA 3JVTB 2WNDA 4PE4A 1J1EA 2QACA 1R2UA 2BL0B 3RM1A 2I18A 4I5LB 1QIVA 1E8AA 3SG4A 2KFHA 3CZTX 3D0YA 1TTXA 3BOWB 1CFFA 2KAVA 2KAYA 1EH2A 1EG4A 3IQQA 4PHJA 1QJTA 3DF0A 3BQ3A 2OTGC 1QX2A 3SG5A 3NXAA 1XFUO 2K61A 4F0ZB 3DVJA 4I5JA 4PHKA 2IS9A 1IJ6A 1KSOA 1KQVA 1K94A 4GUKA 1RWYA 1KWOC 4BY4A 5HKYA 2ZKMX 2LCPA 2QPTA 3EKHA 2NXQA 3C1VA 3SG7A 1AK8A 1GJYA 2M9GA 3SG3A 3TDZA 4ORAB 1G8IA 2MAZA 1DMOA 1F8HA 1K90D 2M0RA 2EC6B 2KDHA 2P6BB 1EG3A 2FCEA 1K9PA 4MEWA 3HX4A 2PMYA 3LCPC 1GQMA 1IJ5A 4YGEB 4N1GA 1JWDA 1UURA 1TIZA 5ER5A 3ZWHA 1LA3A 2K7BA 2ZRSA 5CPVA 4GPLB 4GGNA 1J7RA 4I5NB 2OS8B 4USLA 1AJ4A 2E30A 2DOQA 4OV2A 1UHHA 3KEVA 1BLQA 4ZCUA 4N1FA 1NX3A 1DF0A 2KBMA 1M63B 1B7TZ 3H4SE 1F55A 2JXLA 2K7DA 3M0WA 3NSLA 2JT0A 4MN0A 2KOTA 2KAXA 3EVUA 2MHHA 1RJVA 1KQMC 1DTLA 1N2DA 4XJKB 1DGVA 2LE9B 1K9UA 4NDCA 1QIWA 4M2PA 1NX0A 2K7OA 5AFPA 2HETA 2MLEC 1B7TY 2NLNA 5CSNA 2LP2A 1IKUA 2JZIA 2NCOA 1GGWA 4Q04A 3CR4X 1DGUA 2M7NA 5J3XA 3VRRA 1SCMB 3WHUB 3EK4A 3O78A 3KPXA 5HKZA 1UHJA 2LHLA 2MJWB 3IF7A 2LM5A 4YRUA 2ZN9A 1WY9A 1B47A 1QX7A 2ZNEA 1J55A 3KHEA 5TNCA 1CM1A 2ZRTA 3A8RA 3TUYC 1MWNA 3O6BA 1WRLA 4WQ3A 4YI8A 3EVVA 2EHBA 1CFDA 1N65A 1PSRA 1SR6B 4IL1A 5HYDA 2PALA 4PALA 1TNPA 3HCMA 1V1FA 2PRUA 1YX8A 4P2YB 1XFZO 3F45A 5FYXA 1CFPA 3OHMB 2GGMA 1WRZA 1IQ5A 1QATA 3A4UB 3I5FB 1QV0A 1IG5A 1AVSA 2GGZA 4MZJA 5BPJA 1CLBA 1F71A 4E68A 2O5GA 1ODBA 1YRTB 1X02A 2ZNDA 2LMVA 1NUBA 1M46A 2JNXA 4C0KA 1YUSA 2F8PA 4GGFA 3TS5B 1ALWA 3EKJA 1RECA 1B9AA 1NCXA 4MSPA 3E3RA 4R1EA 3SG2A 1ZMZA 2GV5A 3PLFB 1QLSA 3NSIA 1WDCB 2JNFA 1LINA 4GGFC 2G9BA 3OP0A 1DJXA 3NSKA 4C0LA 1CNPA 1XYDA 2LLUA 3I5IB 2BBNA 2LVJA 4ETOA 3BUNB 2O60A 3EK8A 4OR9B 5CSFA 3WXAA 2B1UA 2R2IA 3RLZA 2OTGB 4QJ5B 2TN4A 3DD4A 3D0YB 1RFJA 1KK7Y 2FOTA 1NIWA 1QS7A 5HLOA 4DIRA 3DF0B 2JOJA 1NWDA 2JXCA 2V53A 3CR5X 4ICBA 3LK0A 4HRHA 3AAJA 4ORCB 4DRWA 2H2KA 1MXLC 1F4OA 3IQOA 2F3ZA 4HSZA 5AERA 1AUIB 1SY9A 3OX6A 1FI5A 1S1EA 4U8DA 1KK8B 3I5GC 1SYMA 1H4BA 3GK2A 3PALA 2K2AA 2KFFA 1QV1A 1XFXO 4HREE 2K7CA 3JTDC 1FF1A 2KI6C 3BXKA 1OMVA 1F70A 1SNLA 1TNXA 2VRGA 3DVKA 2Y1MA 1UHIA 1SRAA 4YI9A 1DVIA 5K89A 1SL7A 2BCAA 1CTRA 2BKHB 1SW8A 4CLNA 1QVIZ 2BE6A 1JSAA 2SASA 2HPSA 1S6JA 2LV7A 5I2LA 2BL0C 1B1GA 4NDDA 5DKQA 1OE9B 1KFUL 5GQQC 1AJ5A 2KGBC 4DS7A 1S3PA 4YGBB 2L0PA 1JFKA 1QVIY 1H8BA 3K21A 2AMIA 4N5XA 3I5HB 1TNWA 3EVRA 3VROA 1B8CA 3QRXA 1XA5A 2CXJA 2MRDA 3SIAA 1XO5A 3LL8B 5AANA 1SMGA 3VRQA 4JQ0D 5AEQA 5KTYA 2HQWA 2LVKA 1UP5A 1MHOA 2LLTA 4PHMA 1K96A 2KYCA 2AAOA 1S26D 3GK4X 1MXEA 5I2QA 1SL9A 1MUXA 1FBVA 4OCIA 1Y1AA 2EC6C 5DKRA 5HLVA 1UHKA 1J7PA 2CCMA 2BCXA 3ZNIA 4AOMA 1EXRA 1D1OA 2CTNA 3OB1B 2KBIA 4PE1A 1K2HA 2M3WA 1A4PA 1OZSA 4PE0A 1MF8B 2G2BA 2M8UA 2ZN8A 1TCOB 2L51A 1L2OB 1KFUS 1LKJA 1QXPA 2FJUB 2MBXA 5IBWA 5B8IB 2OS8C 1CMGA 1PRWA 1N0YA 2SCPA 5HKWA 1NYAA 4XJKA 2JC2A 1YUUA 5DKNA 3VRPA 1A2XA 3KF9A 2LVVA 2FCDA 2PSRA 1WRKA 3PN7C 3FWCA 1HQVA 1HT9A 4A4CA 1PALA 2A4JA 1PK0D 2Y1NA 1M45A 1YX7A 2LP3A 3NSOA 1FPWA 2BBMA 4CFQA 4JWQA 3AKAA 2WCEA 2JWWA 1SCMC 2PASA 1CDLA 3PM8A 4MRYA 2HF5A 2Y5IA 5ER4X 1KCYA 4NQGA 1DT7B 1V1GA 4YGCB 1Y6WA 1NCYA 1BG1A 2MA2A 2WCFA 3PSRA 4NDBA 3TDIA 1CFCA 3FWBA 1YURA 2WOSA 3VGOA 2NCPA 2PVBA 2BE4A 4MBEA 1CLLA 2M97A 1A75B 4AQJA 2WORA 1YTZC 1CLMA 1NSHA 4CIDA 3TZ1A 2L5XB 3WHTB 5AXIA 1J7QA 2KHNA 1ALVA 2LVIA 4MRXA 1YVHA 5D69A 1JC2A 1FI6A 3I5GB 3CS1A 3LK1A 5CSIA 2K2FA 1MQ1A 3CGAA 4I5KA 2D8NA 1QX5B 1PSBA 1ZACA 1B8RA 2LMUA 1KWOB 2M1UA 3GK1A 3MSEB 2JU0A 4GFTA 2ISDA 4YGDB 5CSJA 4P5OE 1G33A 1U5IA 3CLNA 1OMRA 1L7ZA 3SIBA 3DVEA 3TS5C 2NZ0A 2WC8A 3VRNA 1JF0A 4AQIA 3BUMB 2KI4C 3O4YA 1JUOA 2L98A 2LC5A 2Q4UA 1R6PA 4CPVA 3PATA 1K9KA 1NX2A 2JRFA 1WDCC 2L4IA 4FQOA 5JJGA 1J7OA 4BY5A 1CKKA 1DJHA 1S36A 1F54A 2KSPA 1NX1A 5I2OA 3I5IC 1B4CA 1W7JB 2JTZA 2KNEA 3SG6A 1YUTA 2ZFDA 3BUWB 4MZLA 3BOWA 4WRIA 1QLKA 4WQ2A 4A4BA 2AUCA 5D7FA 1BT6A 1UWOA 3JVTC 1C07A 1DJIA 1YR5A 2L4HA 4M2OA 1NCZA 1OMDA 3CWGA 1SPYA 3FS7A 1TNQA 2BCBA 2Y4QA 2F2PA 1BU3A 1KQMB 1K95A 3BUOB 1PULA 1YRUB 1W7IB 2Q91A 1RROA 1DF0B 1FW4A 4FTGA 2KI6D 1BF5A 2COLB 1QTXA 1F4QA 1DJZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LHI A;  1RTP 1;  2KYF A;  4HRG A;  1JFJ A;  2I7A A;  5G08 A;  1A29 A;  2M49 B;  1KK8 C;  1RK9 A;  4CFR A;  3BYA A;  2LLS A;  1BOD A;  1XK4 A;  1OSA A;  1Y1U A;  4OKH A;  2JT8 A;  3KO0 A;  2LAP A;  1CB1 A;  1CMF A;  1CDN A;  1IH0 A;  1TCF A;  2M1K B;  2I94 A;  1XFY O;  4UPG A;  4D1E A;  1SBJ A;  4PCW A;  5F6T A;  1JF2 A;  1XK4 C;  1WLM A;  1WLZ A;  4GBA A;  3TUY B;  3ICB A;  1IRJ A;  4YBH B;  4DCK A;  1UUS A;  2BKI B;  5KSZ A;  2LUX A;  4PE7 A;  1JBA A;  3EK7 A;  1G4Y R;  1S6I A;  1S5G Z;  1ZFS A;  2LUC A;  2I2R E;  1B8L A;  3PN7 B;  1CM4 A;  1C7V A;  2KQY A;  4GAO A;  2E6W A;  4MLW A;  1UHN A;  1LXF C;  1Y0V H;  1ZUZ A;  2JT3 A;  1M31 A;  3I5H C;  1TOP A;  1Y1X A;  2JPT A;  5I8N A;  1S5G Y;  1OZO A;  2H61 A;  1OOJ A;  5PAL A;  2KGR A;  2KQ6 A;  1IGV A;  3TDU A;  1LA0 A;  3OX5 A;  4PHN A;  3AAK A;  2M29 A;  1PVB A;  1QAS A;  2MLF C;  2OPO A;  1DJG A;  1LVC D;  2F33 A;  2LNK A;  4MZK A;  4GNK B;  4ORB B;  4C0J A;  2CBL A;  2K8M B;  1MR8 A;  2H61 C;  2L2E A;  2WCB A;  1NPQ A;  4YGA A;  4DUQ A;  3PFV A;  1A03 A;  1BOC A;  1GGZ A;  2KFG A;  1YVL A;  3BUX B;  4ZCV A;  1ZOT B;  4XYN A;  4OVN F;  1AHR A;  1KFX L;  1Q80 A;  2EGD A;  4JPZ B;  4MVF A;  2JTT A;  4L9M A;  3CR2 A;  1C7W A;  1XVJ A;  4M2Q A;  1M39 A;  3GOF A;  3SJS A;  2L50 A;  1L2O C;  4TNC A;  2RGI A;  1K93 D;  1DJY A;  1CDP A;  2M7L A;  3OB2 B;  1EJ3 A;  2CT9 A;  1SR6 C;  1K8U A;  1DJW A;  2K0J A;  2JQ6 A;  1OQP A;  2HQ8 A;  1SKT A;  3AKB A;  1CDM A;  1IWQ A;  3FIA A;  1SCV A;  2LMT A;  3I5F C;  1TRF A;  1TN4 A;  2KI4 B;  3DVM A;  1BR1 B;  3LLE A;  2BEC A;  2CNP A;  2F3Y A;  1U5I B;  1XFV O;  1KSM A;  1AP4 A;  1J1D A;  3D10 A;  4PDZ A;  1BJF A;  1SK6 D;  3JTD B;  1SL8 A;  1BMO A;  1KFX S;  3O2P A;  1KK7 Z;  1NP8 A;  4QJ4 B;  1EL4 A;  2F2O A;  2JUL A;  3WNX B;  3CTN A;  1PVA A;  5KU1 A;  1A75 A;  1BR4 B;  1S6C A;  1VRK A;  5JOL A;  4QJ3 B;  1IQ3 A;  1XFW O;  2LAN A;  3JVT B;  2WND A;  4PE4 A;  1J1E A;  2QAC A;  1R2U A;  2BL0 B;  3RM1 A;  2I18 A;  4I5L B;  1QIV A;  1E8A A;  3SG4 A;  2KFH A;  3CZT X;  3D0Y A;  1TTX A;  3BOW B;  1CFF A;  2KAV A;  2KAY A;  1EH2 A;  1EG4 A;  3IQQ A;  4PHJ A;  1QJT A;  3DF0 A;  3BQ3 A;  2OTG C;  1QX2 A;  3SG5 A;  3NXA A;  1XFU O;  2K61 A;  4F0Z B;  3DVJ A;  4I5J A;  4PHK A;  2IS9 A;  1IJ6 A;  1KSO A;  1KQV A;  1K94 A;  4GUK A;  1RWY A;  1KWO C;  4BY4 A;  5HKY A;  2ZKM X;  2LCP A;  2QPT A;  3EKH A;  2NXQ A;  3C1V A;  3SG7 A;  1AK8 A;  1GJY A;  2M9G A;  3SG3 A;  3TDZ A;  4ORA B;  1G8I A;  2MAZ A;  1DMO A;  1F8H A;  1K90 D;  2M0R A;  2EC6 B;  2KDH A;  2P6B B;  1EG3 A;  2FCE A;  1K9P A;  4MEW A;  3HX4 A;  2PMY A;  3LCP C;  1GQM A;  1IJ5 A;  4YGE B;  4N1G A;  1JWD A;  1UUR A;  1TIZ A;  5ER5 A;  3ZWH A;  1LA3 A;  2K7B A;  2ZRS A;  5CPV A;  4GPL B;  4GGN A;  1J7R A;  4I5N B;  2OS8 B;  4USL A;  1AJ4 A;  2E30 A;  2DOQ A;  4OV2 A;  1UHH A;  3KEV A;  1BLQ A;  4ZCU A;  4N1F A;  1NX3 A;  1DF0 A;  2KBM A;  1M63 B;  1B7T Z;  3H4S E;  1F55 A;  2JXL A;  2K7D A;  3M0W A;  3NSL A;  2JT0 A;  4MN0 A;  2KOT A;  2KAX A;  3EVU A;  2MHH A;  1RJV A;  1KQM C;  1DTL A;  1N2D A;  4XJK B;  1DGV A;  2LE9 B;  1K9U A;  4NDC A;  1QIW A;  4M2P A;  1NX0 A;  2K7O A;  5AFP A;  2HET A;  2MLE C;  1B7T Y;  2NLN A;  5CSN A;  2LP2 A;  1IKU A;  2JZI A;  2NCO A;  1GGW A;  4Q04 A;  3CR4 X;  1DGU A;  2M7N A;  5J3X A;  3VRR A;  1SCM B;  3WHU B;  3EK4 A;  3O78 A;  3KPX A;  5HKZ A;  1UHJ A;  2LHL A;  2MJW B;  3IF7 A;  2LM5 A;  4YRU A;  2ZN9 A;  1WY9 A;  1B47 A;  1QX7 A;  2ZNE A;  1J55 A;  3KHE A;  5TNC A;  1CM1 A;  2ZRT A;  3A8R A;  3TUY C;  1MWN A;  3O6B A;  1WRL A;  4WQ3 A;  4YI8 A;  3EVV A;  2EHB A;  1CFD A;  1N65 A;  1PSR A;  1SR6 B;  4IL1 A;  5HYD A;  2PAL A;  4PAL A;  1TNP A;  3HCM A;  1V1F A;  2PRU A;  1YX8 A;  4P2Y B;  1XFZ O;  3F45 A;  5FYX A;  1CFP A;  3OHM B;  2GGM A;  1WRZ A;  1IQ5 A;  1QAT A;  3A4U B;  3I5F B;  1QV0 A;  1IG5 A;  1AVS A;  2GGZ A;  4MZJ A;  5BPJ A;  1CLB A;  1F71 A;  4E68 A;  2O5G A;  1ODB A;  1YRT B;  1X02 A;  2ZND A;  2LMV A;  1NUB A;  1M46 A;  2JNX A;  4C0K A;  1YUS A;  2F8P A;  4GGF A;  3TS5 B;  1ALW A;  3EKJ A;  1REC A;  1B9A A;  1NCX A;  4MSP A;  3E3R A;  4R1E A;  3SG2 A;  1ZMZ A;  2GV5 A;  3PLF B;  1QLS A;  3NSI A;  1WDC B;  2JNF A;  1LIN A;  4GGF C;  2G9B A;  3OP0 A;  1DJX A;  3NSK A;  4C0L A;  1CNP A;  1XYD A;  2LLU A;  3I5I B;  2BBN A;  2LVJ A;  4ETO A;  3BUN B;  2O60 A;  3EK8 A;  4OR9 B;  5CSF A;  3WXA A;  2B1U A;  2R2I A;  3RLZ A;  2OTG B;  4QJ5 B;  2TN4 A;  3DD4 A;  3D0Y B;  1RFJ A;  1KK7 Y;  2FOT A;  1NIW A;  1QS7 A;  5HLO A;  4DIR A;  3DF0 B;  2JOJ A;  1NWD A;  2JXC A;  2V53 A;  3CR5 X;  4ICB A;  3LK0 A;  4HRH A;  3AAJ A;  4ORC B;  4DRW A;  2H2K A;  1MXL C;  1F4O A;  3IQO A;  2F3Z A;  4HSZ A;  5AER A;  1AUI B;  1SY9 A;  3OX6 A;  1FI5 A;  1S1E A;  4U8D A;  1KK8 B;  3I5G C;  1SYM A;  1H4B A;  3GK2 A;  3PAL A;  2K2A A;  2KFF A;  1QV1 A;  1XFX O;  4HRE E;  2K7C A;  3JTD C;  1FF1 A;  2KI6 C;  3BXK A;  1OMV A;  1F70 A;  1SNL A;  1TNX A;  2VRG A;  3DVK A;  2Y1M A;  1UHI A;  1SRA A;  4YI9 A;  1DVI A;  5K89 A;  1SL7 A;  2BCA A;  1CTR A;  2BKH B;  1SW8 A;  4CLN A;  1QVI Z;  2BE6 A;  1JSA A;  2SAS A;  2HPS A;  1S6J A;  2LV7 A;  5I2L A;  2BL0 C;  1B1G A;  4NDD A;  5DKQ A;  1OE9 B;  1KFU L;  5GQQ C;  1AJ5 A;  2KGB C;  4DS7 A;  1S3P A;  4YGB B;  2L0P A;  1JFK A;  1QVI Y;  1H8B A;  3K21 A;  2AMI A;  4N5X A;  3I5H B;  1TNW A;  3EVR A;  3VRO A;  1B8C A;  3QRX A;  1XA5 A;  2CXJ A;  2MRD A;  3SIA A;  1XO5 A;  3LL8 B;  5AAN A;  1SMG A;  3VRQ A;  4JQ0 D;  5AEQ A;  5KTY A;  2HQW A;  2LVK A;  1UP5 A;  1MHO A;  2LLT A;  4PHM A;  1K96 A;  2KYC A;  2AAO A;  1S26 D;  3GK4 X;  1MXE A;  5I2Q A;  1SL9 A;  1MUX A;  1FBV A;  4OCI A;  1Y1A A;  2EC6 C;  5DKR A;  5HLV A;  1UHK A;  1J7P A;  2CCM A;  2BCX A;  3ZNI A;  4AOM A;  1EXR A;  1D1O A;  2CTN A;  3OB1 B;  2KBI A;  4PE1 A;  1K2H A;  2M3W A;  1A4P A;  1OZS A;  4PE0 A;  1MF8 B;  2G2B A;  2M8U A;  2ZN8 A;  1TCO B;  2L51 A;  1L2O B;  1KFU S;  1LKJ A;  1QXP A;  2FJU B;  2MBX A;  5IBW A;  5B8I B;  2OS8 C;  1CMG A;  1PRW A;  1N0Y A;  2SCP A;  5HKW A;  1NYA A;  4XJK A;  2JC2 A;  1YUU A;  5DKN A;  3VRP A;  1A2X A;  3KF9 A;  2LVV A;  2FCD A;  2PSR A;  1WRK A;  3PN7 C;  3FWC A;  1HQV A;  1HT9 A;  4A4C A;  1PAL A;  2A4J A;  1PK0 D;  2Y1N A;  1M45 A;  1YX7 A;  2LP3 A;  3NSO A;  1FPW A;  2BBM A;  4CFQ A;  4JWQ A;  3AKA A;  2WCE A;  2JWW A;  1SCM C;  2PAS A;  1CDL A;  3PM8 A;  4MRY A;  2HF5 A;  2Y5I A;  5ER4 X;  1KCY A;  4NQG A;  1DT7 B;  1V1G A;  4YGC B;  1Y6W A;  1NCY A;  1BG1 A;  2MA2 A;  2WCF A;  3PSR A;  4NDB A;  3TDI A;  1CFC A;  3FWB A;  1YUR A;  2WOS A;  3VGO A;  2NCP A;  2PVB A;  2BE4 A;  4MBE A;  1CLL A;  2M97 A;  1A75 B;  4AQJ A;  2WOR A;  1YTZ C;  1CLM A;  1NSH A;  4CID A;  3TZ1 A;  2L5X B;  3WHT B;  5AXI A;  1J7Q A;  2KHN A;  1ALV A;  2LVI A;  4MRX A;  1YVH A;  5D69 A;  1JC2 A;  1FI6 A;  3I5G B;  3CS1 A;  3LK1 A;  5CSI A;  2K2F A;  1MQ1 A;  3CGA A;  4I5K A;  2D8N A;  1QX5 B;  1PSB A;  1ZAC A;  1B8R A;  2LMU A;  1KWO B;  2M1U A;  3GK1 A;  3MSE B;  2JU0 A;  4GFT A;  2ISD A;  4YGD B;  5CSJ A;  4P5O E;  1G33 A;  1U5I A;  3CLN A;  1OMR A;  1L7Z A;  3SIB A;  3DVE A;  3TS5 C;  2NZ0 A;  2WC8 A;  3VRN A;  1JF0 A;  4AQI A;  3BUM B;  2KI4 C;  3O4Y A;  1JUO A;  2L98 A;  2LC5 A;  2Q4U A;  1R6P A;  4CPV A;  3PAT A;  1K9K A;  1NX2 A;  2JRF A;  1WDC C;  2L4I A;  4FQO A;  5JJG A;  1J7O A;  4BY5 A;  1CKK A;  1DJH A;  1S36 A;  1F54 A;  2KSP A;  1NX1 A;  5I2O A;  3I5I C;  1B4C A;  1W7J B;  2JTZ A;  2KNE A;  3SG6 A;  1YUT A;  2ZFD A;  3BUW B;  4MZL A;  3BOW A;  4WRI A;  1QLK A;  4WQ2 A;  4A4B A;  2AUC A;  5D7F A;  1BT6 A;  1UWO A;  3JVT C;  1C07 A;  1DJI A;  1YR5 A;  2L4H A;  4M2O A;  1NCZ A;  1OMD A;  3CWG A;  1SPY A;  3FS7 A;  1TNQ A;  2BCB A;  2Y4Q A;  2F2P A;  1BU3 A;  1KQM B;  1K95 A;  3BUO B;  1PUL A;  1YRU B;  1W7I B;  2Q91 A;  1RRO A;  1DF0 B;  1FW4 A;  4FTG A;  2KI6 D;  1BF5 A;  2COL B;  1QTX A;  1F4Q A;  1DJZ A; 
#chains in the Genus database with same CATH topology
 2LHI A;  1RTP 1;  2KYF A;  4HRG A;  2WCH A;  2I7A A;  3CZ1 A;  1A29 A;  2M49 B;  5G08 A;  1KK8 C;  1RK9 A;  1JFJ A;  4CFR A;  3BYA A;  2LLS A;  1BOD A;  2ISD A;  1XK4 A;  1OSA A;  1Y1U A;  4OKH A;  5DIC A;  2JT8 A;  3KO0 A;  2LAP A;  1CB1 A;  1CMF A;  1CDN A;  2GTE A;  1IH0 A;  1TCF A;  2M1K B;  3NHI A;  3CAB A;  2I94 A;  1XFY O;  4UPG A;  4D1E A;  1SBJ A;  4PCW A;  5F6T A;  1JF2 A;  1XK4 C;  1WLM A;  1WLZ A;  2L5Y A;  4GBA A;  3ICB A;  1IRJ A;  4YBH B;  3TUY B;  4DCK A;  1UUS A;  3D76 A;  2BKI B;  5KSZ A;  2LUX A;  4PE7 A;  1JBA A;  3EK7 A;  1G4Y R;  1S6I A;  1S5G Z;  1ZFS A;  2LUC A;  2I2R E;  1B8L A;  3PN7 B;  1CM4 A;  5FI2 A;  4PT1 A;  1C7V A;  2KQY A;  4GAO A;  2E6W A;  4MLW A;  1UHN A;  1LXF C;  1Y0V H;  1ZUZ A;  2JT3 A;  1M31 A;  3I5H C;  1TOP A;  1Y1X A;  2JPT A;  5I8N A;  1S5G Y;  1OZO A;  3R1V A;  2H61 A;  1OOJ A;  5PAL A;  2KGR A;  2KQ6 A;  1IGV A;  3TDU A;  1LA0 A;  3OX5 A;  4PHN A;  3AAK A;  2M29 A;  1PVB A;  1QAS A;  2MLF C;  2OPO A;  1T14 A;  1DJG A;  1LVC D;  2F33 A;  2LNK A;  4MZK A;  4GNK B;  4ORB B;  4C0J A;  2CBL A;  2K8M B;  1MR8 A;  2H61 C;  5FI7 A;  3Q8I A;  2L2E A;  2WCB A;  1NPQ A;  4YGA A;  4DUQ A;  3PFV A;  1A03 A;  3OGN A;  1BOC A;  1GGZ A;  2KFG A;  1YVL A;  3BUX B;  4ZCV A;  1ZOT B;  4XYN A;  4OVN F;  1AHR A;  1KFX L;  1Q80 A;  2EGD A;  4INW A;  4JPZ B;  4MVF A;  2JTT A;  4L9M A;  3CZ0 A;  2WCM A;  1C7W A;  1XVJ A;  3CR2 A;  4M2Q A;  1M39 A;  3GOF A;  3SJS A;  2L50 A;  1L2O C;  4TNC A;  2RGI A;  2QEV A;  1K93 D;  1DJY A;  1CDP A;  3DZT A;  2M7L A;  2JPO A;  3OB2 B;  1OOI X;  1EJ3 A;  2CT9 A;  1SR6 C;  1K8U A;  1DJW A;  3R72 A;  2K0J A;  2WCL A;  2JQ6 A;  1OQP A;  2HQ8 A;  1SKT A;  3AKB A;  1CDM A;  1IWQ A;  2YGU A;  5HL1 A;  3FIA A;  1SCV A;  2LMT A;  3I5F C;  3D75 A;  1TRF A;  1TN4 A;  2KI4 B;  3DVM A;  1BR1 B;  3LLE A;  2BEC A;  2CNP A;  2F3Y A;  4JD9 A;  5D3O A;  3B7A A;  1U5I B;  1XFV O;  1KSM A;  1AP4 A;  1J1D A;  3D10 A;  4PDZ A;  1BJF A;  1SK6 D;  3JTD B;  1SL8 A;  1BMO A;  1KFX S;  3O2P A;  1KK7 Z;  1NP8 A;  4QJ4 B;  1EL4 A;  2F2O A;  3SS5 A;  2JUL A;  3WNX B;  3CTN A;  1PVA A;  1TUJ A;  1A75 A;  5KU1 A;  1BR4 B;  1S6C A;  1VRK A;  1Z2C B;  5JOL A;  3VB1 A;  4QJ3 B;  1IQ3 A;  1XFW O;  2LAN A;  3JVT B;  2WND A;  4PE4 A;  1J1E A;  2QAC A;  1R2U A;  2BL0 B;  3RM1 A;  2I18 A;  4I5L B;  1QIV A;  1E8A A;  3SG4 A;  2KFH A;  3CZT X;  3D0Y A;  1TTX A;  3BOW B;  1CFF A;  2KAV A;  2KAY A;  1EH2 A;  1EG4 A;  3IQQ A;  4PHJ A;  1QJT A;  2P71 A;  3DF0 A;  3BQ3 A;  2OTG C;  1QX2 A;  3SG5 A;  3NXA A;  1XFU O;  2K61 A;  4F0Z B;  3OBV A;  3DVJ A;  4I5J A;  4PHK A;  2K60 A;  3B87 A;  2IS9 A;  1IJ6 A;  1KSO A;  3S0D A;  1KQV A;  1K94 A;  4GUK A;  1RWY A;  1KWO C;  4BY4 A;  5HKY A;  2ZKM X;  2LCP A;  2QPT A;  3EKH A;  2NXQ A;  3C1V A;  3SG7 A;  1AK8 A;  1GJY A;  2M9G A;  3SG3 A;  3TDZ A;  4ORA B;  1G8I A;  2MAZ A;  1DMO A;  1F8H A;  1K90 D;  2M0R A;  2EC6 B;  2KDH A;  2P6B B;  1EG3 A;  2FCE A;  1K9P A;  4MEW A;  3HX4 A;  3FE8 A;  3R1P A;  2PMY A;  1DC1 A;  3LCP C;  1GQM A;  1IJ5 A;  4YGE B;  4N1G A;  1JWD A;  1UUR A;  1TIZ A;  5ER5 A;  3ZWH A;  3NGV A;  3S0E A;  1LA3 A;  2K7B A;  2ZRS A;  5CPV A;  4GPL B;  3NHT A;  4GGN A;  1J7R A;  4I5N B;  2OS8 B;  4USL A;  1AJ4 A;  2E30 A;  2DOQ A;  3D74 A;  1UHH A;  3IVT A;  3KEV A;  2QEB A;  3N7H A;  4OV2 A;  4ZCU A;  4N1F A;  1NX3 A;  1DF0 A;  2KBM A;  1M63 B;  1B7T Z;  3H4S E;  1F55 A;  2JXL A;  2K7D A;  3M0W A;  3NSL A;  2JT0 A;  4MN0 A;  2KOT A;  2KAX A;  3EVU A;  2MHH A;  1DEK A;  1RJV A;  1KQM C;  3L47 A;  1DTL A;  1N2D A;  4XJK B;  1DGV A;  2LE9 B;  1K9U A;  4NDC A;  1QIW A;  4M2P A;  1C3Y A;  1NX0 A;  2K7O A;  5AFP A;  1OOF A;  2HET A;  2MLE C;  1B7T Y;  2NLN A;  5CSN A;  2LP2 A;  1IKU A;  2JZI A;  2NCO A;  5FI6 A;  1GGW A;  4Q04 A;  3CR4 X;  1DGU A;  2M7N A;  5J3X A;  3S0B A;  1SCM B;  3VRR A;  3WHU B;  3EK4 A;  3O78 A;  3KPX A;  5HKZ A;  1UHJ A;  2LHL A;  2MJW B;  3IF7 A;  2LM5 A;  4YRU A;  2ZN9 A;  1WY9 A;  4IJ7 A;  1B47 A;  1QX7 A;  2ZNE A;  3B86 A;  1J55 A;  3KHE A;  5TNC A;  1CM1 A;  2BAP A;  2ZRT A;  3A8R A;  3TUY C;  1DEL A;  3CZ2 A;  1MWN A;  3O6B A;  1WRL A;  4WQ3 A;  4YI8 A;  3EVV A;  2EHB A;  1CFD A;  1N65 A;  1PSR A;  1SR6 B;  4IL1 A;  5HYD A;  2PAL A;  3R1O A;  4PAL A;  1TNP A;  3HCM A;  1V1F A;  2PRU A;  1YX8 A;  4P2Y B;  1XFZ O;  3F45 A;  5FYX A;  1CFP A;  3L4L A;  3O4X A;  3OHM B;  2GGM A;  1WRZ A;  3BJH A;  1IQ5 A;  1QAT A;  2P70 A;  3A4U B;  3B6X A;  2L2C A;  3I5F B;  1QV0 A;  2WCK A;  1IG5 A;  1AVS A;  2GGZ A;  4MZJ A;  5BPJ A;  1CLB A;  1F71 A;  4E68 A;  2O5G A;  1ODB A;  1YRT B;  1X02 A;  2ZND A;  2LMV A;  1NUB A;  1M46 A;  2JNX A;  4C0K A;  1YUS A;  2F8P A;  4GGF A;  3S0A A;  3TS5 B;  1ALW A;  3EKJ A;  1REC A;  3BFB A;  1B9A A;  1NCX A;  4MSP A;  3E3R A;  4R1E A;  3SG2 A;  1ZMZ A;  2GV5 A;  3PLF B;  1QLS A;  3NSI A;  3S0G A;  1WDC B;  2JNF A;  1LIN A;  4GGF C;  1TWO A;  2G9B A;  2BNX A;  3OP0 A;  1DJX A;  3NSK A;  4C0L A;  1CNP A;  1XYD A;  2LLU A;  3I5I B;  2BBN A;  2KLE A;  2LVJ A;  3BUN B;  4ETO A;  2O60 A;  3EK8 A;  4OR9 B;  5CSF A;  3WXA A;  2B1U A;  2R2I A;  3RLZ A;  1BLQ A;  2OTG B;  4QJ5 B;  2TN4 A;  3DD4 A;  3D0Y B;  1RFJ A;  1KK7 Y;  2FOT A;  1NIW A;  1QS7 A;  2KLD A;  5HLO A;  4DIR A;  3DF0 B;  2JOJ A;  1NWD A;  2JXC A;  2V53 A;  3CR5 X;  4ICB A;  3LK0 A;  4HRH A;  3AAJ A;  4ORC B;  4DRW A;  2H2K A;  1MXL C;  1F4O A;  3IQO A;  1TUZ A;  2F3Z A;  4HSZ A;  1DQE A;  1AUI B;  5AER A;  1SY9 A;  3OX6 A;  1FI5 A;  1S1E A;  4U8D A;  1KK8 B;  3I5G C;  1SYM A;  1H4B A;  3GK2 A;  3PAL A;  2K2A A;  2KFF A;  1QV1 A;  1XFX O;  4HRE E;  2K7C A;  3JTD C;  1FF1 A;  2KI6 C;  3BXK A;  1OMV A;  1F70 A;  1SNL A;  1OW4 A;  1TNX A;  3D77 A;  2VRG A;  3DVK A;  2Y1M A;  1UHI A;  1SRA A;  3FE9 A;  4YI9 A;  1DVI A;  5K89 A;  1SL7 A;  2BCA A;  1CTR A;  2BKH B;  1SW8 A;  4CLN A;  1QVI Z;  2BE6 A;  3PM2 A;  1IIO A;  1JSA A;  2SAS A;  2HPS A;  1S6J A;  2LV7 A;  5I2L A;  2BL0 C;  1B1G A;  4NDD A;  5DKQ A;  1OE9 B;  3DY9 A;  2PYQ A;  4JKT A;  1KFU L;  5GQQ C;  1AJ5 A;  2KGB C;  4DS7 A;  1S3P A;  4YGB B;  2L0P A;  1C3Z A;  1JFK A;  1QVI Y;  3CDN A;  3K21 A;  1H8B A;  2AMI A;  4N5X A;  3D78 A;  3I5H B;  1TNW A;  3EVR A;  3VRO A;  1B8C A;  3QRX A;  1XA5 A;  2CXJ A;  2MRD A;  3SIA A;  1XO5 A;  3LL8 B;  4KYN A;  5AAN A;  1SMG A;  3VRQ A;  2QDI A;  4JQ0 D;  5AEQ A;  5KTY A;  2HQW A;  2LVK A;  1UP5 A;  1MHO A;  2LLT A;  4PHM A;  1K96 A;  2KYC A;  2AAO A;  1S26 D;  3GK4 X;  1MXE A;  5I2Q A;  1SL9 A;  1MUX A;  1FBV A;  4OCI A;  1Y1A A;  2EC6 C;  5DKR A;  5HLV A;  2WC5 A;  1UHK A;  1J7P A;  2BCX A;  2CCM A;  3D73 A;  3QME A;  1EXR A;  3ZNI A;  2CTN A;  3OB1 B;  4AOM A;  2KBI A;  4PE1 A;  1D1O A;  1K2H A;  1SSE B;  2M3W A;  5I94 A;  1A4P A;  1OZS A;  4PE0 A;  1MF8 B;  2G2B A;  2M8U A;  2ZN8 A;  3DYE A;  1TCO B;  2L51 A;  1L2O B;  3DXL A;  1KFU S;  1LKJ A;  1QXP A;  3FE6 A;  2FJU B;  3RZS A;  2MBX A;  5IBW A;  5B8I B;  2OS8 C;  1CMG A;  1PRW A;  1N0Y A;  2SCP A;  5HKW A;  1NYA A;  4XJK A;  2JC2 A;  1YUU A;  5DKN A;  3VRP A;  1A2X A;  3KF9 A;  2PQL A;  2LVV A;  2FCD A;  2PSR A;  3EG5 B;  1WRK A;  1Z4H A;  3PN7 C;  3FWC A;  1HQV A;  1HT9 A;  4A4C A;  2QEO A;  4FQT A;  1PAL A;  2A4J A;  1PK0 D;  2Y1N A;  1M45 A;  1YX7 A;  2LP3 A;  3NSO A;  1FPW A;  2BBM A;  4CFQ A;  3S0F A;  2FJY A;  4JWQ A;  3AKA A;  2WCE A;  2JWW A;  1SCM C;  3BFA A;  3L4A A;  2PAS A;  1CDL A;  3PM8 A;  4MRY A;  1OOH A;  2HF5 A;  1ORG A;  2Y5I A;  5ER4 X;  3UNW A;  1KCY A;  4NQG A;  1DT7 B;  1V1G A;  4YGC B;  1Y6W A;  1NCY A;  1BG1 A;  2MA2 A;  2WCF A;  3PSR A;  4NDB A;  3TDI A;  1QWV A;  1CFC A;  3FWB A;  1YUR A;  2WOS A;  3VGO A;  2NCP A;  2PVB A;  2QEH A;  2BE4 A;  4MBE A;  1CLL A;  2M97 A;  1A75 B;  1LS8 A;  2WC6 A;  4AQJ A;  2WOR A;  1YTZ C;  2WCJ A;  1CLM A;  1NSH A;  2H8V A;  4CID A;  3K1E A;  3TZ1 A;  2L5X B;  3WHT B;  5AXI A;  1J7Q A;  2KHN A;  1ALV A;  2LVI A;  3PJI A;  4MRX A;  1YVH A;  5D69 A;  1JC2 A;  1FI6 A;  3I5G B;  3CS1 A;  3LK1 A;  5CSI A;  2K2F A;  3V2L A;  1MQ1 A;  3CGA A;  1OOG A;  4I5K A;  2D8N A;  1QX5 B;  1PSB A;  1ZAC A;  1B8R A;  2ERB A;  1KWO B;  2LMU A;  2M1U A;  3GK1 A;  2JU0 A;  3MSE B;  4GFT A;  4YGD B;  5CSJ A;  4P5O E;  1G33 A;  1U5I A;  1W9Z A;  3CLN A;  1OMR A;  4INX A;  1L7Z A;  3SIB A;  3SS4 A;  3DVE A;  1XFR A;  3TS5 C;  2NZ0 A;  2WC8 A;  3VRN A;  1JF0 A;  3UO9 A;  2KPH A;  2KI4 C;  3BUM B;  1JUO A;  3O4Y A;  4AQI A;  2L98 A;  2LC5 A;  2Q4U A;  1R6P A;  4CPV A;  3PAT A;  1K9K A;  1NX2 A;  2JRF A;  1WDC C;  2L4I A;  4FQO A;  4F7F A;  5JJG A;  1J7O A;  4BY5 A;  1GM0 A;  4OZD A;  1CKK A;  1DJH A;  3BFH A;  1S36 A;  1F54 A;  2KSP A;  1NX1 A;  5I2O A;  3I5I C;  1B4C A;  1W7J B;  2JTZ A;  2KNE A;  3SG6 A;  1YUT A;  2ZFD A;  3BUW B;  4MZL A;  3BOW A;  4WRI A;  1QLK A;  4WQ2 A;  4A4B A;  2AUC A;  5D7F A;  5EL2 A;  1BT6 A;  1UWO A;  3JVT C;  1C07 A;  3SS3 A;  1DJI A;  1P28 A;  1YR5 A;  2L4H A;  4M2O A;  1NCZ A;  1OMD A;  3CWG A;  1SPY A;  3FS7 A;  1TNQ A;  2BCB A;  2Y4Q A;  2F2P A;  1BU3 A;  1KQM B;  1K95 A;  3BUO B;  1PUL A;  1YRU B;  3B88 A;  1W7I B;  2Q91 A;  1RRO A;  1DF0 B;  1FW4 A;  4FTG A;  3CYZ A;  2KI6 D;  1BF5 A;  2COL B;  1QTX A;  1F4Q A;  1DJZ A; 
#chains in the Genus database with same CATH homology
 2LHI A;  1RTP 1;  2KYF A;  4HRG A;  1JFJ A;  2I7A A;  5G08 A;  1A29 A;  2M49 B;  1KK8 C;  1RK9 A;  4CFR A;  3BYA A;  2LLS A;  1BOD A;  1XK4 A;  1OSA A;  1Y1U A;  4OKH A;  2JT8 A;  3KO0 A;  2LAP A;  1CB1 A;  1CMF A;  1CDN A;  1IH0 A;  1TCF A;  2M1K B;  2I94 A;  1XFY O;  4UPG A;  4D1E A;  1SBJ A;  4PCW A;  5F6T A;  1JF2 A;  1XK4 C;  1WLM A;  1WLZ A;  4GBA A;  3TUY B;  3ICB A;  1IRJ A;  4YBH B;  4DCK A;  1UUS A;  2BKI B;  5KSZ A;  2LUX A;  4PE7 A;  1JBA A;  3EK7 A;  1G4Y R;  1S6I A;  1S5G Z;  1ZFS A;  2LUC A;  2I2R E;  1B8L A;  3PN7 B;  1CM4 A;  1C7V A;  2KQY A;  4GAO A;  2E6W A;  4MLW A;  1UHN A;  1LXF C;  1Y0V H;  1ZUZ A;  2JT3 A;  1M31 A;  3I5H C;  1TOP A;  1Y1X A;  2JPT A;  5I8N A;  1S5G Y;  1OZO A;  2H61 A;  1OOJ A;  5PAL A;  2KGR A;  2KQ6 A;  1IGV A;  3TDU A;  1LA0 A;  3OX5 A;  4PHN A;  3AAK A;  2M29 A;  1PVB A;  1QAS A;  2MLF C;  2OPO A;  1DJG A;  1LVC D;  2F33 A;  2LNK A;  4MZK A;  4GNK B;  4ORB B;  4C0J A;  2CBL A;  2K8M B;  1MR8 A;  2H61 C;  2L2E A;  2WCB A;  1NPQ A;  4YGA A;  4DUQ A;  3PFV A;  1A03 A;  1BOC A;  1GGZ A;  2KFG A;  1YVL A;  3BUX B;  4ZCV A;  1ZOT B;  4XYN A;  4OVN F;  1AHR A;  1KFX L;  1Q80 A;  2EGD A;  4JPZ B;  4MVF A;  2JTT A;  4L9M A;  3CR2 A;  1C7W A;  1XVJ A;  4M2Q A;  1M39 A;  3GOF A;  3SJS A;  2L50 A;  1L2O C;  4TNC A;  2RGI A;  1K93 D;  1DJY A;  1CDP A;  2M7L A;  3OB2 B;  1EJ3 A;  2CT9 A;  1SR6 C;  1K8U A;  1DJW A;  2K0J A;  2JQ6 A;  1OQP A;  2HQ8 A;  1SKT A;  3AKB A;  1CDM A;  1IWQ A;  3FIA A;  1SCV A;  2LMT A;  3I5F C;  1TRF A;  1TN4 A;  2KI4 B;  3DVM A;  1BR1 B;  3LLE A;  2BEC A;  2CNP A;  2F3Y A;  1U5I B;  1XFV O;  1KSM A;  1AP4 A;  1J1D A;  3D10 A;  4PDZ A;  1BJF A;  1SK6 D;  3JTD B;  1SL8 A;  1BMO A;  1KFX S;  3O2P A;  1KK7 Z;  1NP8 A;  4QJ4 B;  1EL4 A;  2F2O A;  2JUL A;  3WNX B;  3CTN A;  1PVA A;  5KU1 A;  1A75 A;  1BR4 B;  1S6C A;  1VRK A;  5JOL A;  4QJ3 B;  1IQ3 A;  1XFW O;  2LAN A;  3JVT B;  2WND A;  4PE4 A;  1J1E A;  2QAC A;  1R2U A;  2BL0 B;  3RM1 A;  2I18 A;  4I5L B;  1QIV A;  1E8A A;  3SG4 A;  2KFH A;  3CZT X;  3D0Y A;  1TTX A;  3BOW B;  1CFF A;  2KAV A;  2KAY A;  1EH2 A;  1EG4 A;  3IQQ A;  4PHJ A;  1QJT A;  3DF0 A;  3BQ3 A;  2OTG C;  1QX2 A;  3SG5 A;  3NXA A;  1XFU O;  2K61 A;  4F0Z B;  3DVJ A;  4I5J A;  4PHK A;  2IS9 A;  1IJ6 A;  1KSO A;  1KQV A;  1K94 A;  4GUK A;  1RWY A;  1KWO C;  4BY4 A;  5HKY A;  2ZKM X;  2LCP A;  2QPT A;  3EKH A;  2NXQ A;  3C1V A;  3SG7 A;  1AK8 A;  1GJY A;  2M9G A;  3SG3 A;  3TDZ A;  4ORA B;  1G8I A;  2MAZ A;  1DMO A;  1F8H A;  1K90 D;  2M0R A;  2EC6 B;  2KDH A;  2P6B B;  1EG3 A;  2FCE A;  1K9P A;  4MEW A;  3HX4 A;  2PMY A;  3LCP C;  1GQM A;  1IJ5 A;  4YGE B;  4N1G A;  1JWD A;  1UUR A;  1TIZ A;  5ER5 A;  3ZWH A;  1LA3 A;  2K7B A;  2ZRS A;  5CPV A;  4GPL B;  4GGN A;  1J7R A;  4I5N B;  2OS8 B;  4USL A;  1AJ4 A;  2E30 A;  2DOQ A;  4OV2 A;  1UHH A;  3KEV A;  1BLQ A;  4ZCU A;  4N1F A;  1NX3 A;  1DF0 A;  2KBM A;  1M63 B;  1B7T Z;  3H4S E;  1F55 A;  2JXL A;  2K7D A;  3M0W A;  3NSL A;  2JT0 A;  4MN0 A;  2KOT A;  2KAX A;  3EVU A;  2MHH A;  1RJV A;  1KQM C;  1DTL A;  1N2D A;  4XJK B;  1DGV A;  2LE9 B;  1K9U A;  4NDC A;  1QIW A;  4M2P A;  1NX0 A;  2K7O A;  5AFP A;  2HET A;  2MLE C;  1B7T Y;  2NLN A;  5CSN A;  2LP2 A;  1IKU A;  2JZI A;  2NCO A;  1GGW A;  4Q04 A;  3CR4 X;  1DGU A;  2M7N A;  5J3X A;  3VRR A;  1SCM B;  3WHU B;  3EK4 A;  3O78 A;  3KPX A;  5HKZ A;  1UHJ A;  2LHL A;  2MJW B;  3IF7 A;  2LM5 A;  4YRU A;  2ZN9 A;  1WY9 A;  1B47 A;  1QX7 A;  2ZNE A;  1J55 A;  3KHE A;  5TNC A;  1CM1 A;  2ZRT A;  3A8R A;  3TUY C;  1MWN A;  3O6B A;  1WRL A;  4WQ3 A;  4YI8 A;  3EVV A;  2EHB A;  1CFD A;  1N65 A;  1PSR A;  1SR6 B;  4IL1 A;  5HYD A;  2PAL A;  4PAL A;  1TNP A;  3HCM A;  1V1F A;  2PRU A;  1YX8 A;  4P2Y B;  1XFZ O;  3F45 A;  5FYX A;  1CFP A;  3OHM B;  2GGM A;  1WRZ A;  1IQ5 A;  1QAT A;  3A4U B;  3I5F B;  1QV0 A;  1IG5 A;  1AVS A;  2GGZ A;  4MZJ A;  5BPJ A;  1CLB A;  1F71 A;  4E68 A;  2O5G A;  1ODB A;  1YRT B;  1X02 A;  2ZND A;  2LMV A;  1NUB A;  1M46 A;  2JNX A;  4C0K A;  1YUS A;  2F8P A;  4GGF A;  3TS5 B;  1ALW A;  3EKJ A;  1REC A;  1B9A A;  1NCX A;  4MSP A;  3E3R A;  4R1E A;  3SG2 A;  1ZMZ A;  2GV5 A;  3PLF B;  1QLS A;  3NSI A;  1WDC B;  2JNF A;  1LIN A;  4GGF C;  2G9B A;  3OP0 A;  1DJX A;  3NSK A;  4C0L A;  1CNP A;  1XYD A;  2LLU A;  3I5I B;  2BBN A;  2LVJ A;  4ETO A;  3BUN B;  2O60 A;  3EK8 A;  4OR9 B;  5CSF A;  3WXA A;  2B1U A;  2R2I A;  3RLZ A;  2OTG B;  4QJ5 B;  2TN4 A;  3DD4 A;  3D0Y B;  1RFJ A;  1KK7 Y;  2FOT A;  1NIW A;  1QS7 A;  5HLO A;  4DIR A;  3DF0 B;  2JOJ A;  1NWD A;  2JXC A;  2V53 A;  3CR5 X;  4ICB A;  3LK0 A;  4HRH A;  3AAJ A;  4ORC B;  4DRW A;  2H2K A;  1MXL C;  1F4O A;  3IQO A;  2F3Z A;  4HSZ A;  5AER A;  1AUI B;  1SY9 A;  3OX6 A;  1FI5 A;  1S1E A;  4U8D A;  1KK8 B;  3I5G C;  1SYM A;  1H4B A;  3GK2 A;  3PAL A;  2K2A A;  2KFF A;  1QV1 A;  1XFX O;  4HRE E;  2K7C A;  3JTD C;  1FF1 A;  2KI6 C;  3BXK A;  1OMV A;  1F70 A;  1SNL A;  1TNX A;  2VRG A;  3DVK A;  2Y1M A;  1UHI A;  1SRA A;  4YI9 A;  1DVI A;  5K89 A;  1SL7 A;  2BCA A;  1CTR A;  2BKH B;  1SW8 A;  4CLN A;  1QVI Z;  2BE6 A;  1JSA A;  2SAS A;  2HPS A;  1S6J A;  2LV7 A;  5I2L A;  2BL0 C;  1B1G A;  4NDD A;  5DKQ A;  1OE9 B;  1KFU L;  5GQQ C;  1AJ5 A;  2KGB C;  4DS7 A;  1S3P A;  4YGB B;  2L0P A;  1JFK A;  1QVI Y;  1H8B A;  3K21 A;  2AMI A;  4N5X A;  3I5H B;  1TNW A;  3EVR A;  3VRO A;  1B8C A;  3QRX A;  1XA5 A;  2CXJ A;  2MRD A;  3SIA A;  1XO5 A;  3LL8 B;  5AAN A;  1SMG A;  3VRQ A;  4JQ0 D;  5AEQ A;  5KTY A;  2HQW A;  2LVK A;  1UP5 A;  1MHO A;  2LLT A;  4PHM A;  1K96 A;  2KYC A;  2AAO A;  1S26 D;  3GK4 X;  1MXE A;  5I2Q A;  1SL9 A;  1MUX A;  1FBV A;  4OCI A;  1Y1A A;  2EC6 C;  5DKR A;  5HLV A;  1UHK A;  1J7P A;  2CCM A;  2BCX A;  3ZNI A;  4AOM A;  1EXR A;  1D1O A;  2CTN A;  3OB1 B;  2KBI A;  4PE1 A;  1K2H A;  2M3W A;  1A4P A;  1OZS A;  4PE0 A;  1MF8 B;  2G2B A;  2M8U A;  2ZN8 A;  1TCO B;  2L51 A;  1L2O B;  1KFU S;  1LKJ A;  1QXP A;  2FJU B;  2MBX A;  5IBW A;  5B8I B;  2OS8 C;  1CMG A;  1PRW A;  1N0Y A;  2SCP A;  5HKW A;  1NYA A;  4XJK A;  2JC2 A;  1YUU A;  5DKN A;  3VRP A;  1A2X A;  3KF9 A;  2LVV A;  2FCD A;  2PSR A;  1WRK A;  3PN7 C;  3FWC A;  1HQV A;  1HT9 A;  4A4C A;  1PAL A;  2A4J A;  1PK0 D;  2Y1N A;  1M45 A;  1YX7 A;  2LP3 A;  3NSO A;  1FPW A;  2BBM A;  4CFQ A;  4JWQ A;  3AKA A;  2WCE A;  2JWW A;  1SCM C;  2PAS A;  1CDL A;  3PM8 A;  4MRY A;  2HF5 A;  2Y5I A;  5ER4 X;  1KCY A;  4NQG A;  1DT7 B;  1V1G A;  4YGC B;  1Y6W A;  1NCY A;  1BG1 A;  2MA2 A;  2WCF A;  3PSR A;  4NDB A;  3TDI A;  1CFC A;  3FWB A;  1YUR A;  2WOS A;  3VGO A;  2NCP A;  2PVB A;  2BE4 A;  4MBE A;  1CLL A;  2M97 A;  1A75 B;  4AQJ A;  2WOR A;  1YTZ C;  1CLM A;  1NSH A;  4CID A;  3TZ1 A;  2L5X B;  3WHT B;  5AXI A;  1J7Q A;  2KHN A;  1ALV A;  2LVI A;  4MRX A;  1YVH A;  5D69 A;  1JC2 A;  1FI6 A;  3I5G B;  3CS1 A;  3LK1 A;  5CSI A;  2K2F A;  1MQ1 A;  3CGA A;  4I5K A;  2D8N A;  1QX5 B;  1PSB A;  1ZAC A;  1B8R A;  2LMU A;  1KWO B;  2M1U A;  3GK1 A;  3MSE B;  2JU0 A;  4GFT A;  2ISD A;  4YGD B;  5CSJ A;  4P5O E;  1G33 A;  1U5I A;  3CLN A;  1OMR A;  1L7Z A;  3SIB A;  3DVE A;  3TS5 C;  2NZ0 A;  2WC8 A;  3VRN A;  1JF0 A;  4AQI A;  3BUM B;  2KI4 C;  3O4Y A;  1JUO A;  2L98 A;  2LC5 A;  2Q4U A;  1R6P A;  4CPV A;  3PAT A;  1K9K A;  1NX2 A;  2JRF A;  1WDC C;  2L4I A;  4FQO A;  5JJG A;  1J7O A;  4BY5 A;  1CKK A;  1DJH A;  1S36 A;  1F54 A;  2KSP A;  1NX1 A;  5I2O A;  3I5I C;  1B4C A;  1W7J B;  2JTZ A;  2KNE A;  3SG6 A;  1YUT A;  2ZFD A;  3BUW B;  4MZL A;  3BOW A;  4WRI A;  1QLK A;  4WQ2 A;  4A4B A;  2AUC A;  5D7F A;  1BT6 A;  1UWO A;  3JVT C;  1C07 A;  1DJI A;  1YR5 A;  2L4H A;  4M2O A;  1NCZ A;  1OMD A;  3CWG A;  1SPY A;  3FS7 A;  1TNQ A;  2BCB A;  2Y4Q A;  2F2P A;  1BU3 A;  1KQM B;  1K95 A;  3BUO B;  1PUL A;  1YRU B;  1W7I B;  2Q91 A;  1RRO A;  1DF0 B;  1FW4 A;  4FTG A;  2KI6 D;  1BF5 A;  2COL B;  1QTX A;  1F4Q A;  1DJZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...