2LMUA

Androcam at high calcium
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
147
structure length
147
Chain Sequence
SELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQDLIAEAENNNNGQLNFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFISPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calmodulin-related protein 97A
publication title Structure of androcam supports specialized interactions with myosin VI.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Metal binding protein
total genus 40
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2011-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2lmuA01
2F3ZA 1AVSA 1QVIZ 4L9MA 1MXLC 1NX1A 1A29A 1TOPA 1YURA 1G4YR 4NQGA 3VRQA 5AERA 1S5GY 1B8LA 1J1DA 1CFFA 2WOSA 3ICBA 1ZACA 1B4CA 3CR5X 2JPTA 2WCFA 3O6BA 2M29A 4CLNA 1SRAA 2I18A 1F70A 1YX8A 3SIAA 1JF0A 1BG1A 2BBMA 2KNEA 1BLQA 2K8MB 1IGVA 3SG6A 1F8HA 2BKIB 2O60A 3I5FB 1F54A 4R1EA 1DJGA 3AKBA 1SCVA 3D10A 5DKRA 3E3RA 4GNKB 1N2DA 1UUSA 3PFVA 1M45A 3SG5A 1OMDA 2AUCA 2JXCA 3I5FC 4PHNA 1RECA 4QJ3B 5G08A 2KFHA 2HETA 1BR1B 1F4OA 2QPTA 1K2HA 1IRJA 2JT3A 4OVNF 4BY5A 1A75A 1Y1XA 5AXIA 4DS7A 4ICBA 1UHIA 2F33A 2HPSA 2WORA 4NDBA 1DJWA 1IQ5A 2WNDA 1J7RA 1K94A 2MA2A 2MHHA 3DF0A 3LCPC 1J7QA 4HRGA 3EKHA 2L5XB 1TNQA 4OV2A 2M7LA 1K9PA 2JNXA 1L2OB 4YBHB 3NSLA 3DVEA 3A8RA 2EGDA 3O78A 1J55A 2E30A 5I8NA 1YX7A 2JWWA 2K7BA 3DVKA 1QJTA 1XYDA 2JC2A 3PSRA 2WC8A 4JWQA 1SBJA 3BOWA 3BUNB 3DVMA 5J3XA 1L2OC 5BPJA 4I5JA 2L50A 1NSHA 4HRHA 2NLNA 1RFJA 1MUXA 4OKHA 1UP5A 1XFUO 1WY9A 2KBMA 2QACA 3JVTB 2LCPA 3C1VA 3LL8B 1CDMA 3FWBA 2HQWA 2OS8C 4A4CA 1BMOA 1S1EA 1M31A 1IJ5A 1A03A 1ALWA 1JC2A 2LHIA 5DKNA 2ZNDA 1YRTB 1NX2A 2MJWB 3A4UB 3JVTC 1PULA 2BCBA 2LVJA 4ORBB 2NCPA 2NZ0A 4OCIA 3O4YA 3BQ3A 4PE7A 4C0KA 4WQ2A 2OTGB 2A4JA 4IL1A 1NX3A 1KCYA 3HX4A 4YGBB 1DJZA 1RK9A 2HQ8A 4M2PA 4MRXA 4WQ3A 1GGZA 3DD4A 2K7OA 1CLBA 3FIAA 5FYXA 1OZSA 2OTGC 4YI9A 4FTGA 4YI8A 1HT9A 1RROA 1B7TY 1EH2A 1M63B 1NX0A 1LINA 2BBNA 2M1UA 3PM8A 3D0YA 1R2UA 1LVCD 2JT8A 5D69A 3VRRA 1V1FA 2GV5A 1DJHA 4AOMA 2KI6C 3PATA 2MBXA 2JT0A 4XYNA 3BXKA 3CZTX 1C7WA 1JFJA 4WRIA 4HSZA 2LMVA 2KQ6A 4DRWA 3TUYB 3RLZA 4OR9B 2LNKA 1S36A 2D8NA 2EC6B 2TN4A 1OOJA 2ZNEA 2M8UA 3WNXB 2ZFDA 3VRPA 2F2OA 3I5GB 1ZUZA 2F8PA 2LLUA 4P2YB 3SIBA 3WHTB 5IBWA 1EJ3A 3TUYC 5HKZA 4GGNA 2L98A 2K2AA 4TNCA 3I5IB 2EC6C 4NDCA 1PVBA 4MEWA 4MN0A 3OHMB 5CSIA 4PHMA 2MAZA 1KK7Y 2LM5A 3H4SE 2JNFA 2KYFA 3KF9A 1PVAA 1EXRA 3OX5A 2KBIA 3I5GC 1CDPA 2COLB 1AHRA 2KGRA 5AANA 3I5IC 3CGAA 2ZRTA 4GGFC 1XK4C 1YUTA 1X02A 2KAVA 1WRLA 4M2OA 5CPVA 1M39A 1PALA 1CM1A 2L51A 4JQ0D 1VRKA 2Q91A 1SL8A 1DT7B 2M3WA 1ALVA 1A4PA 2LMTA 3KO0A 1K96A 1SW8A 3EK4A 4YGEB 1Y6WA 3IQQA 1CLMA 1BODA 2LE9B 4N1GA 1PRWA 2ZN8A 2PASA 2LP2A 1K9KA 4YRUA 1ZFSA 2CT9A 1S5GZ 2FOTA 5AFPA 1D1OA 4QJ5B 4JPZB 1WRKA 1DJYA 1JFKA 2BKHB 1A2XA 1QV0A 4UPGA 4XJKB 2KOTA 4PDZA 3TDIA 1TIZA 3CLNA 1IG5A 1J7PA 4CPVA 2BL0B 1NUBA 1OMRA 1B9AA 2L4IA 2F2PA 2GGMA 1SCMB 2K7DA 4QJ4B 3BUMB 2Q4UA 5HKYA 1QIWA 2PSRA 2HF5A 1UWOA 2LLSA 1AUIB 1N65A 1QX5B 1QX7A 1QTXA 2BCAA 3QRXA 2BL0C 1YVLA 1B8RA 2M49B 4PE1A 1DMOA 1CMFA 4D1EA 1SCMC 1SY9A 2CCMA 4C0LA 3GK2A 4PHKA 2VRGA 1AP4A 1F4QA 3EVUA 3OB2B 2KFFA 3AKAA 2KHNA 1DVIA 1FW4A 1Y1AA 2OPOA 4AQIA 2AAOA 1Q80A 3FWCA 2SCPA 1TN4A 5I2QA 1HQVA 3SG3A 3PLFB 3OB1B 2O5GA 3OP0A 1ZOTB 5GQQC 1QLKA 1OZOA 1M46A 2CBLA 5JJGA 4P5OE 1K93D 1JUOA 1DF0B 3AAKA 1KFUS 1MF8B 3BUWB 1JSAA 1BT6A 5HLOA 1MWNA 1TNXA 1XFXO 2B1UA 5CSNA 2KI6D 1CM4A 2MLFC 1PK0D 1TNWA 5KSZA 2LVVA 2R2IA 2LAPA 2KSPA 1DGVA 2ZKMX 2L2EA 1IKUA 2GGZA 1XFYO 1UHKA 2P6BB 2ZN9A 4CFQA 2RGIA 1BOCA 1N0YA 2LV7A 4ETOA 1CDNA 3BYAA 1KSOA 2LC5A 4N5XA 3EK7A 1B1GA 4YGDB 2H61C 4CFRA 5I2OA 1CFDA 3F45A 4GAOA 2MLEC 2KFGA 1Y1UA 1JWDA 3NSIA 3SG4A 1GGWA 4DUQA 1QASA 1KK8B 3KEVA 2MRDA 1H4BA 1IH0A 1SKTA 2LUXA 2M1KB 3MSEB 1LA3A 1W7JB 1NCXA 3CWGA 1AK8A 1YR5A 4C0JA 5PALA 3CTNA 1BR4B 2JU0A 3IF7A 1FPWA 1OMVA 1GQMA 2M0RA 1YUSA 1UURA 1BF5A 5CSFA 1H8BA 1JF2A 2LVKA 1CDLA 1CB1A 2I94A 1QX2A 1QV1A 1TTXA 3PALA 1SK6D 3EVVA 1NCZA 3K21A 1NP8A 1CMGA 1F55A 4N1FA 1DTLA 2AMIA 4MBEA 1B7TZ 1RWYA 1KFXL 1QS7A 2JULA 2F3YA 1KSMA 2KQYA 3DVJA 2WCEA 1K8UA 1TRFA 5K89A 1XFZO 3AAJA 5D7FA 2I2RE 1V1GA 1QVIY 2KAXA 1SNLA 2PALA 1YRUB 1CTRA 1XK4A 4GGFA 1MXEA 2K2FA 1XA5A 1WRZA 1SYMA 1U5IB 1NCYA 2KDHA 4USLA 4GBAA 1C07A 2G2BA 4MZKA 3JTDB 2LLTA 2BECA 2KGBC 1KQMB 3VROA 1J1EA 1SPYA 2G9BA 2I7AA 1XFWO 5AEQA 1TCOB 3M0WA 1KK7Z 3IQOA 2K61A 3WXAA 2Y1NA 2CXJA 3JTDC 3O2PA 1S26D 3CR2A 2NCOA 2LVIA 1EG4A 1KWOB 4MSPA 4ZCVA 3NSKA 1KQMC 1KQVA 4GUKA 4E68A 4MLWA 5KTYA 3EKJA 1CFPA 1IJ6A 1YTZC 1AJ4A 1QXPA 2K7CA 4MZLA 4MVFA 1KWOC 3CS1A 4XJKA 3TZ1A 2CTNA 2V53A 1RTP1 2KYCA 4PE4A 1C7VA 5KU1A 4BY4A 1J7OA 4Q04A 1BU3A 2ZRSA 3EK8A 1WLZA 2Y4QA 2FCDA 1SR6B 2E6WA 4A4BA 2PMYA 5TNCA 2LUCA 1G8IA 1NIWA 1S3PA 2K0JA 4GPLB 2LP3A 2JTTA 5HKWA 1WDCB 1A75B 1K9UA 1BJFA 1PSRA 1IWQA 4MRYA 4DIRA 1CKKA 5ER4X 1SL9A 2DOQA 2KI4B 1FI6A 1IQ3A 1SR6C 3DF0B 4ORCB 4NDDA 5B8IB 3SG7A 4PHJA 1UHHA 1CFCA 1WDCC 2JTZA 4YGCB 4M2QA 1XO5A 3ZWHA 2KI4C 3LLEA 1R6PA 2FCEA 1NWDA 3LK0A 1FF1A 4ORAB 1YVHA 3TDUA 3BOWB 1DF0A 3HCMA 3OX6A 2BE4A 2KAYA 1CNPA 4HREE 3WHUB 5JOLA 1G33A 1ODBA 2OS8B 5CSJA 2LANA 3ZNIA 1OSAA 1UHNA 1XFVO 2PRUA 3RM1A 1W7IB 5HYDA 3TS5B 1DJIA 1CLLA 2H61A 1XVJA 1SMGA 1FI5A 4I5KA 2H2KA 2ISDA 4U8DA 1YUUA 2IS9A 3LK1A 3PN7B 1L7ZA 1KFXS 2M9GA 1LKJA 2NXQA 4PCWA 5ER5A 5I2LA 2JZIA 3TS5C 1FBVA 3CR4X 3NXAA 1PSBA 1TNPA 1JBAA 3GK4X 1B8CA 1OQPA 4I5NB 5HLVA 2EHBA 1SL7A 1B47A 1S6IA 4GFTA 3I5HB 3FS7A 3PN7C 1TCFA 2Y5IA 3BUOB 1DGUA 1S6JA 2BE6A 2JRFA 1LXFC 1S6CA 2M97A 1K95A 1EL4A 1KK8C 2JOJA 2LHLA 2L4HA 3I5HC 1EG3A 1ZMZA 3KHEA 1F71A 5DKQA 1KFUL 1NYAA 1QIVA 1QLSA 1WLMA 1QATA 5F6TA 2FJUB 3D0YB 2JQ6A 1LA0A 4PE0A 1K90D 1NPQA 3VGOA 4I5LB 4CIDA 4DCKA 2SASA 3GOFA 2CNPA 2PVBA 4YGAA 1RJVA 4F0ZB 1MQ1A 4PALA 2L0PA 3SG2A 2M7NA 3BUXB 3KPXA 4FQOA 3GK1A 4MZJA 1UHJA 1AJ5A 2BCXA 3NSOA 3SJSA 1GJYA 1MR8A 3EVRA 1U5IA 4AQJA 1E8AA 2LMUA 2WCBA 4ZCUA 1DJXA 1MHOA 3VRNA 2JXLA 3TDZA 2Y1MA 1Y0VH 1OE9B
chains in the Genus database with same CATH superfamily
2F3ZA 1AVSA 1QVIZ 4L9MA 5FI6A 3L47A 1MXLC 1NX1A 4INWA 1A29A 1TOPA 1YURA 1G4YR 4NQGA 3VRQA 5AERA 1S5GY 1B8LA 2ERBA 1J1DA 1CFFA 2WOSA 3ICBA 3BJHA 1ZACA 1B4CA 3CR5X 2JPTA 2WCFA 3O6BA 2M29A 4CLNA 1SRAA 2I18A 1F70A 1YX8A 3SIAA 3D73A 3CZ1A 1JF0A 1BG1A 2BBMA 2KNEA 1BLQA 2K8MB 1IGVA 3SG6A 1F8HA 2BKIB 2O60A 3I5FB 1OOFA 4R1EA 5D3OA 1F54A 1DJGA 3AKBA 1SCVA 3D10A 5DKRA 3E3RA 5DICA 4GNKB 1N2DA 1UUSA 3PFVA 1M45A 1T14A 3Q8IA 4JKTA 3SG5A 1OMDA 2AUCA 2JXCA 3I5FC 4PHNA 1RECA 4QJ3B 5G08A 2KFHA 2HETA 1BR1B 1F4OA 2QPTA 1K2HA 1IRJA 2JT3A 4OVNF 4BY5A 1A75A 1Y1XA 5AXIA 4DS7A 2BAPA 4ICBA 1UHIA 2F33A 2HPSA 2WORA 4NDBA 1DJWA 1IQ5A 2WNDA 3CZ0A 1J7RA 1K94A 2MA2A 2MHHA 3DF0A 3EG5B 3LCPC 3SS3A 1J7QA 4HRGA 3EKHA 2L5XB 1TNQA 4OV2A 3VB1A 2M7LA 2YGUA 1K9PA 2JNXA 4FQTA 1L2OB 1Z4HA 3NSLA 3DVEA 3A8RA 2EGDA 3O78A 1J55A 4YBHB 2E30A 2QEVA 5I8NA 1YX7A 2JWWA 2K7BA 3DVKA 3R1PA 3O4XA 1QJTA 1XYDA 2JC2A 3PSRA 2WC8A 4JWQA 3BFBA 1SBJA 3BOWA 3BUNB 3DVMA 5J3XA 3CABA 1L2OC 5BPJA 4I5JA 2L50A 1NSHA 1OOHA 4HRHA 2NLNA 1RFJA 1MUXA 4OKHA 1UP5A 1XFUO 1WY9A 2GTEA 2KBMA 2QACA 3JVTB 2LCPA 3C1VA 3LL8B 1CDMA 3FWBA 2HQWA 2OS8C 4A4CA 1BMOA 3PM2A 1S1EA 1M31A 1IJ5A 3DY9A 1ALWA 1A03A 1JC2A 2LHIA 5DKNA 2ZNDA 1YRTB 1NX2A 2MJWB 3A4UB 3JVTC 1PULA 2BCBA 2LVJA 4ORBB 2NCPA 2NZ0A 4OCIA 3O4YA 3BQ3A 4PE7A 4C0KA 4WQ2A 2OTGB 2A4JA 4IL1A 1NX3A 1KCYA 3HX4A 4YGBB 1DJZA 1RK9A 2HQ8A 4M2PA 4MRXA 4WQ3A 1GGZA 3DD4A 2K7OA 1CLBA 3FIAA 1C3ZA 5FYXA 1OZSA 2OTGC 4YI9A 4FTGA 4YI8A 1HT9A 2QDIA 1RROA 1B7TY 1EH2A 1M63B 1NX0A 1LINA 2BBNA 2M1UA 3PM8A 3D0YA 1R2UA 1LVCD 2JT8A 5D69A 3VRRA 3SS5A 3L4LA 1V1FA 2GV5A 1DJHA 4AOMA 2KI6C 3PATA 2MBXA 2JT0A 4XYNA 3BXKA 3CZTX 1C7WA 1JFJA 4WRIA 4HSZA 2LMVA 2KQ6A 4DRWA 3TUYB 3RLZA 4OR9B 2LNKA 1S36A 2D8NA 2EC6B 2TN4A 1OOJA 2ZNEA 2M8UA 3WNXB 2ZFDA 3VRPA 2F2OA 3QMEA 3I5GB 1ZUZA 2F8PA 2LLUA 4P2YB 3SIBA 3WHTB 5IBWA 1EJ3A 3TUYC 5HKZA 4GGNA 2L98A 2K2AA 4TNCA 3I5IB 2EC6C 4NDCA 1PVBA 4MEWA 4MN0A 3OHMB 5CSIA 4PHMA 2WCKA 2MAZA 1KK7Y 2LM5A 3H4SE 2JNFA 2H8VA 2KYFA 3KF9A 1PVAA 1EXRA 3OX5A 2KBIA 3I5GC 1CDPA 2COLB 1AHRA 2KGRA 5AANA 3I5IC 3CGAA 2ZRTA 4GGFC 1XK4C 1YUTA 3OGNA 1X02A 2KAVA 1WRLA 4M2OA 5CPVA 1M39A 1PALA 1CM1A 2L51A 4JQ0D 1VRKA 2Q91A 1SL8A 1DT7B 2M3WA 1ALVA 1A4PA 4KYNA 2LMTA 3KO0A 1K96A 1SW8A 3EK4A 4YGEB 1Y6WA 3IQQA 1CLMA 1BODA 2LE9B 4N1GA 2P71A 1PRWA 2ZN8A 2PASA 2LP2A 1K9KA 1OOIX 4YRUA 1ZFSA 2CT9A 1S5GZ 2FOTA 5AFPA 1D1OA 4QJ5B 4JPZB 1TUJA 1WRKA 1DJYA 1JFKA 2BKHB 1A2XA 1QV0A 4UPGA 4XJKB 2KOTA 4PDZA 3TDIA 1TIZA 3CLNA 1IG5A 3IVTA 1J7PA 3UNWA 3S0BA 4CPVA 2BL0B 1NUBA 1OMRA 1B9AA 2L4IA 2F2PA 2GGMA 1SCMB 2K7DA 3BFAA 3BUMB 2Q4UA 4QJ4B 5HKYA 1QIWA 3S0AA 2PSRA 2HF5A 1UWOA 2LLSA 1AUIB 1N65A 1QX5B 1QX7A 1QTXA 2BCAA 3QRXA 2BL0C 1YVLA 1B8RA 2M49B 3B88A 4PE1A 1DMOA 1CMFA 4D1EA 1SCMC 1SY9A 2CCMA 4C0LA 3GK2A 4PHKA 2VRGA 1AP4A 1F4QA 3EVUA 3OB2B 1DELA 2KFFA 3AKAA 4OZDA 2KHNA 1C3YA 1TUZA 1DVIA 1FW4A 1Y1AA 2OPOA 4AQIA 2AAOA 1Q80A 3FWCA 4PT1A 3FE9A 2SCPA 1TN4A 5I2QA 1HQVA 3SG3A 2BNXA 2WCJA 3PLFB 3OB1B 2O5GA 3OP0A 1ZOTB 5GQQC 1QLKA 1OZOA 1M46A 3B87A 2CBLA 5JJGA 4P5OE 1K93D 1JUOA 1DF0B 3AAKA 1KFUS 1MF8B 3B7AA 3BUWB 1JSAA 1BT6A 5HLOA 1MWNA 3D75A 1TNXA 1IIOA 1OW4A 1XFXO 2B1UA 5CSNA 2KI6D 1CM4A 2MLFC 1PK0D 1TNWA 2WC5A 2KLEA 2LVVA 2R2IA 2LAPA 2KSPA 1DGVA 2ZKMX 2L2EA 3N7HA 5KSZA 1IKUA 2GGZA 1XFYO 1UHKA 2P6BB 2ZN9A 4CFQA 2RGIA 1BOCA 1N0YA 2LV7A 3NHIA 4ETOA 1CDNA 3BYAA 3PJIA 1KSOA 2LC5A 4N5XA 3B6XA 3EK7A 1B1GA 4YGDB 2H61C 4CFRA 2WCLA 5I2OA 2PQLA 1CFDA 1DEKA 3F45A 4GAOA 2MLEC 2KFGA 1Y1UA 1JWDA 3NSIA 3SS4A 3SG4A 1GGWA 4DUQA 1QASA 1KK8B 1P28A 2MRDA 3KEVA 1H4BA 1IH0A 1SKTA 2LUXA 2M1KB 3MSEB 3NHTA 1DQEA 1LA3A 1W7JB 1NCXA 3CWGA 1AK8A 1YR5A 4C0JA 5PALA 3CTNA 1BR4B 2JU0A 3IF7A 1FPWA 1OMVA 1GQMA 2M0RA 1YUSA 1UURA 1BF5A 2K60A 5CSFA 1H8BA 1JF2A 2LVKA 1CDLA 3DZTA 1CB1A 1ORGA 2I94A 1QX2A 2P70A 1QV1A 1TTXA 3PALA 1SK6D 3EVVA 1NCZA 3K21A 1NP8A 1CMGA 1F55A 4N1FA 5I94A 1DTLA 2AMIA 4MBEA 1B7TZ 1RWYA 1KFXL 1QS7A 2JULA 2F3YA 1KSMA 2KQYA 3DVJA 3S0DA 2WCEA 3UO9A 1K8UA 1TRFA 5K89A 1XFZO 3D76A 3AAJA 5D7FA 2I2RE 1V1GA 1QVIY 2KAXA 1SNLA 2PALA 1YRUB 1CTRA 1XK4A 4GGFA 1MXEA 2K2FA 1XA5A 4JD9A 1WRZA 1SYMA 1U5IB 1NCYA 2KDHA 4USLA 4GBAA 3RZSA 2G2BA 4MZKA 3S0FA 1C07A 3JTDB 1Z2CB 3OBVA 2LLTA 1TWOA 2BECA 3D77A 2KGBC 1KQMB 3DXLA 3VROA 3S0GA 1J1EA 1SPYA 2G9BA 2I7AA 3D74A 1XFWO 5AEQA 1TCOB 3M0WA 1KK7Z 3IQOA 2K61A 3FE6A 2Y1NA 2CXJA 3R72A 3JTDC 3WXAA 3O2PA 1S26D 3CR2A 2NCOA 2LVIA 1EG4A 1KWOB 4MSPA 4ZCVA 3NSKA 1KQMC 1KQVA 4GUKA 4E68A 4MLWA 2WCMA 5KTYA 3EKJA 5HL1A 1CFPA 1IJ6A 1YTZC 1AJ4A 1QXPA 2K7CA 4MZLA 3B86A 1KWOC 3CS1A 4MVFA 4XJKA 3TZ1A 2CTNA 3FE8A 2V53A 1RTP1 2KYCA 4PE4A 1DC1A 1QWVA 1C7VA 5KU1A 4BY4A 1J7OA 3D78A 4Q04A 3CDNA 1BU3A 2ZRSA 3EK8A 1WLZA 2QEOA 2Y4QA 2FCDA 1SR6B 2E6WA 4A4BA 2PMYA 5TNCA 2LUCA 1G8IA 1NIWA 1S3PA 2K0JA 4GPLB 2LP3A 4IJ7A 2JTTA 3NGVA 5HKWA 1WDCB 1A75B 1K9UA 1BJFA 1PSRA 1IWQA 4MRYA 2L2CA 4DIRA 1CKKA 5ER4X 1SL9A 2DOQA 2KI4B 1FI6A 1IQ3A 1SR6C 3DF0B 4ORCB 4NDDA 5B8IB 3SG7A 4PHJA 3S0EA 1UHHA 1CFCA 1WDCC 2JTZA 4YGCB 4M2QA 3R1OA 1W9ZA 1XO5A 3ZWHA 2KI4C 1OOGA 3LLEA 1R6PA 2FCEA 1NWDA 3LK0A 1FF1A 2KPHA 1YVHA 3CYZA 4ORAB 3TDUA 3BOWB 1DF0A 3HCMA 2PYQA 2BE4A 1XFRA 3OX6A 2KAYA 4F7FA 4HREE 1CNPA 3WHUB 5JOLA 1G33A 1ODBA 2OS8B 5CSJA 2LANA 3ZNIA 1OSAA 1UHNA 1XFVO 2PRUA 3RM1A 1W7IB 5HYDA 3TS5B 1DJIA 1CLLA 2H61A 2FJYA 1XVJA 5FI2A 1SMGA 3R1VA 1FI5A 4I5KA 2H2KA 2ISDA 4U8DA 1YUUA 2WCHA 2IS9A 3LK1A 3DYEA 3PN7B 1L7ZA 1KFXS 2M9GA 1LKJA 2NXQA 3BFHA 4PCWA 5ER5A 2JZIA 5I2LA 3TS5C 1FBVA 3CR4X 3NXAA 1PSBA 1TNPA 1JBAA 3GK4X 1B8CA 1OQPA 4I5NB 5HLVA 2EHBA 1SL7A 1B47A 1S6IA 4GFTA 3I5HB 3FS7A 3PN7C 1TCFA 2Y5IA 3BUOB 1DGUA 1S6JA 2BE6A 2JRFA 3K1EA 1LXFC 1S6CA 2M97A 1K95A 1EL4A 1KK8C 2L5YA 2JOJA 2LHLA 2L4HA 3I5HC 1EG3A 1ZMZA 2QEHA 3KHEA 1F71A 4INXA 1KFUL 1NYAA 1QIVA 1QLSA 1WLMA 5DKQA 1QATA 5EL2A 5F6TA 2FJUB 3D0YB 2JQ6A 1LA0A 4PE0A 1K90D 1NPQA 3VGOA 4I5LB 4CIDA 4DCKA 2SASA 3L4AA 3GOFA 2CNPA 2PVBA 1SSEB 2QEBA 4YGAA 1RJVA 3CZ2A 3V2LA 5FI7A 1MQ1A 4PALA 4F0ZB 1LS8A 2L0PA 3SG2A 2M7NA 3BUXB 3KPXA 4FQOA 3GK1A 4MZJA 1UHJA 1AJ5A 2BCXA 3NSOA 3SJSA 2KLDA 1GM0A 1GJYA 2WC6A 1MR8A 3EVRA 1U5IA 2JPOA 4AQJA 1E8AA 2LMUA 2WCBA 4ZCUA 1DJXA 1MHOA 3VRNA 2JXLA 3TDZA 2Y1MA 1Y0VH 1OE9B
chains in the Genus database with same CATH topology
2F3ZA 1AVSA 1QVIZ 4L9MA 1MXLC 1NX1A 1A29A 1TOPA 1YURA 1G4YR 4NQGA 3VRQA 5AERA 1S5GY 1B8LA 1J1DA 1CFFA 2WOSA 3ICBA 1ZACA 1B4CA 3CR5X 2JPTA 2WCFA 3O6BA 2M29A 4CLNA 1SRAA 2I18A 1F70A 1YX8A 3SIAA 1JF0A 1BG1A 2BBMA 2KNEA 1BLQA 2K8MB 1IGVA 3SG6A 1F8HA 2BKIB 2O60A 3I5FB 1F54A 4R1EA 1DJGA 3AKBA 1SCVA 3D10A 5DKRA 3E3RA 4GNKB 1N2DA 1UUSA 3PFVA 1M45A 3SG5A 1OMDA 2AUCA 2JXCA 3I5FC 4PHNA 1RECA 4QJ3B 5G08A 2KFHA 2HETA 1BR1B 1F4OA 2QPTA 1K2HA 1IRJA 2JT3A 4OVNF 4BY5A 1A75A 1Y1XA 5AXIA 4DS7A 4ICBA 1UHIA 2F33A 2HPSA 2WORA 4NDBA 1DJWA 1IQ5A 2WNDA 1J7RA 1K94A 2MA2A 2MHHA 3DF0A 3LCPC 1J7QA 4HRGA 3EKHA 2L5XB 1TNQA 4OV2A 2M7LA 1K9PA 2JNXA 1L2OB 4YBHB 3NSLA 3DVEA 3A8RA 2EGDA 3O78A 1J55A 2E30A 5I8NA 1YX7A 2JWWA 2K7BA 3DVKA 1QJTA 1XYDA 2JC2A 3PSRA 2WC8A 4JWQA 1SBJA 3BOWA 3BUNB 3DVMA 5J3XA 1L2OC 5BPJA 4I5JA 2L50A 1NSHA 4HRHA 2NLNA 1RFJA 1MUXA 4OKHA 1UP5A 1XFUO 1WY9A 2KBMA 2QACA 3JVTB 2LCPA 3C1VA 3LL8B 1CDMA 3FWBA 2HQWA 2OS8C 4A4CA 1BMOA 1S1EA 1M31A 1IJ5A 1A03A 1ALWA 1JC2A 2LHIA 5DKNA 2ZNDA 1YRTB 1NX2A 2MJWB 3A4UB 3JVTC 1PULA 2BCBA 2LVJA 4ORBB 2NCPA 2NZ0A 4OCIA 3O4YA 3BQ3A 4PE7A 4C0KA 4WQ2A 2OTGB 2A4JA 4IL1A 1NX3A 1KCYA 3HX4A 4YGBB 1DJZA 1RK9A 2HQ8A 4M2PA 4MRXA 4WQ3A 1GGZA 3DD4A 2K7OA 1CLBA 3FIAA 5FYXA 1OZSA 2OTGC 4YI9A 4FTGA 4YI8A 1HT9A 1RROA 1B7TY 1EH2A 1M63B 1NX0A 1LINA 2BBNA 2M1UA 3PM8A 3D0YA 1R2UA 1LVCD 2JT8A 5D69A 3VRRA 1V1FA 2GV5A 1DJHA 4AOMA 2KI6C 3PATA 2MBXA 2JT0A 4XYNA 3BXKA 3CZTX 1C7WA 1JFJA 4WRIA 4HSZA 2LMVA 2KQ6A 4DRWA 3TUYB 3RLZA 4OR9B 2LNKA 1S36A 2D8NA 2EC6B 2TN4A 1OOJA 2ZNEA 2M8UA 3WNXB 2ZFDA 3VRPA 2F2OA 3I5GB 1ZUZA 2F8PA 2LLUA 4P2YB 3SIBA 3WHTB 5IBWA 1EJ3A 3TUYC 5HKZA 4GGNA 2L98A 2K2AA 4TNCA 3I5IB 2EC6C 4NDCA 1PVBA 4MEWA 4MN0A 3OHMB 5CSIA 4PHMA 2MAZA 1KK7Y 2LM5A 3H4SE 2JNFA 2KYFA 3KF9A 1PVAA 1EXRA 3OX5A 2KBIA 3I5GC 1CDPA 2COLB 1AHRA 2KGRA 5AANA 3I5IC 3CGAA 2ZRTA 4GGFC 1XK4C 1YUTA 1X02A 2KAVA 1WRLA 4M2OA 5CPVA 1M39A 1PALA 1CM1A 2L51A 4JQ0D 1VRKA 2Q91A 1SL8A 1DT7B 2M3WA 1ALVA 1A4PA 2LMTA 3KO0A 1K96A 1SW8A 3EK4A 4YGEB 1Y6WA 3IQQA 1CLMA 1BODA 2LE9B 4N1GA 1PRWA 2ZN8A 2PASA 2LP2A 1K9KA 4YRUA 1ZFSA 2CT9A 1S5GZ 2FOTA 5AFPA 1D1OA 4QJ5B 4JPZB 1WRKA 1DJYA 1JFKA 2BKHB 1A2XA 1QV0A 4UPGA 4XJKB 2KOTA 4PDZA 3TDIA 1TIZA 3CLNA 1IG5A 1J7PA 4CPVA 2BL0B 1NUBA 1OMRA 1B9AA 2L4IA 2F2PA 2GGMA 1SCMB 2K7DA 4QJ4B 3BUMB 2Q4UA 5HKYA 1QIWA 2PSRA 2HF5A 1UWOA 2LLSA 1AUIB 1N65A 1QX5B 1QX7A 1QTXA 2BCAA 3QRXA 2BL0C 1YVLA 1B8RA 2M49B 4PE1A 1DMOA 1CMFA 4D1EA 1SCMC 1SY9A 2CCMA 4C0LA 3GK2A 4PHKA 2VRGA 1AP4A 1F4QA 3EVUA 3OB2B 2KFFA 3AKAA 2KHNA 1DVIA 1FW4A 1Y1AA 2OPOA 4AQIA 2AAOA 1Q80A 3FWCA 2SCPA 1TN4A 5I2QA 1HQVA 3SG3A 3PLFB 3OB1B 2O5GA 3OP0A 1ZOTB 5GQQC 1QLKA 1OZOA 1M46A 2CBLA 5JJGA 4P5OE 1K93D 1JUOA 1DF0B 3AAKA 1KFUS 1MF8B 3BUWB 1JSAA 1BT6A 5HLOA 1MWNA 1TNXA 1XFXO 2B1UA 5CSNA 2KI6D 1CM4A 2MLFC 1PK0D 1TNWA 5KSZA 2LVVA 2R2IA 2LAPA 2KSPA 1DGVA 2ZKMX 2L2EA 1IKUA 2GGZA 1XFYO 1UHKA 2P6BB 2ZN9A 4CFQA 2RGIA 1BOCA 1N0YA 2LV7A 4ETOA 1CDNA 3BYAA 1KSOA 2LC5A 4N5XA 3EK7A 1B1GA 4YGDB 2H61C 4CFRA 5I2OA 1CFDA 3F45A 4GAOA 2MLEC 2KFGA 1Y1UA 1JWDA 3NSIA 3SG4A 1GGWA 4DUQA 1QASA 1KK8B 3KEVA 2MRDA 1H4BA 1IH0A 1SKTA 2LUXA 2M1KB 3MSEB 1LA3A 1W7JB 1NCXA 3CWGA 1AK8A 1YR5A 4C0JA 5PALA 3CTNA 1BR4B 2JU0A 3IF7A 1FPWA 1OMVA 1GQMA 2M0RA 1YUSA 1UURA 1BF5A 5CSFA 1H8BA 1JF2A 2LVKA 1CDLA 1CB1A 2I94A 1QX2A 1QV1A 1TTXA 3PALA 1SK6D 3EVVA 1NCZA 3K21A 1NP8A 1CMGA 1F55A 4N1FA 1DTLA 2AMIA 4MBEA 1B7TZ 1RWYA 1KFXL 1QS7A 2JULA 2F3YA 1KSMA 2KQYA 3DVJA 2WCEA 1K8UA 1TRFA 5K89A 1XFZO 3AAJA 5D7FA 2I2RE 1V1GA 1QVIY 2KAXA 1SNLA 2PALA 1YRUB 1CTRA 1XK4A 4GGFA 1MXEA 2K2FA 1XA5A 1WRZA 1SYMA 1U5IB 1NCYA 2KDHA 4USLA 4GBAA 1C07A 2G2BA 4MZKA 3JTDB 2LLTA 2BECA 2KGBC 1KQMB 3VROA 1J1EA 1SPYA 2G9BA 2I7AA 1XFWO 5AEQA 1TCOB 3M0WA 1KK7Z 3IQOA 2K61A 3WXAA 2Y1NA 2CXJA 3JTDC 3O2PA 1S26D 3CR2A 2NCOA 2LVIA 1EG4A 1KWOB 4MSPA 4ZCVA 3NSKA 1KQMC 1KQVA 4GUKA 4E68A 4MLWA 5KTYA 3EKJA 1CFPA 1IJ6A 1YTZC 1AJ4A 1QXPA 2K7CA 4MZLA 4MVFA 1KWOC 3CS1A 4XJKA 3TZ1A 2CTNA 2V53A 1RTP1 2KYCA 4PE4A 1C7VA 5KU1A 4BY4A 1J7OA 4Q04A 1BU3A 2ZRSA 3EK8A 1WLZA 2Y4QA 2FCDA 1SR6B 2E6WA 4A4BA 2PMYA 5TNCA 2LUCA 1G8IA 1NIWA 1S3PA 2K0JA 4GPLB 2LP3A 2JTTA 5HKWA 1WDCB 1A75B 1K9UA 1BJFA 1PSRA 1IWQA 4MRYA 4DIRA 1CKKA 5ER4X 1SL9A 2DOQA 2KI4B 1FI6A 1IQ3A 1SR6C 3DF0B 4ORCB 4NDDA 5B8IB 3SG7A 4PHJA 1UHHA 1CFCA 1WDCC 2JTZA 4YGCB 4M2QA 1XO5A 3ZWHA 2KI4C 3LLEA 1R6PA 2FCEA 1NWDA 3LK0A 1FF1A 4ORAB 1YVHA 3TDUA 3BOWB 1DF0A 3HCMA 3OX6A 2BE4A 2KAYA 1CNPA 4HREE 3WHUB 5JOLA 1G33A 1ODBA 2OS8B 5CSJA 2LANA 3ZNIA 1OSAA 1UHNA 1XFVO 2PRUA 3RM1A 1W7IB 5HYDA 3TS5B 1DJIA 1CLLA 2H61A 1XVJA 1SMGA 1FI5A 4I5KA 2H2KA 2ISDA 4U8DA 1YUUA 2IS9A 3LK1A 3PN7B 1L7ZA 1KFXS 2M9GA 1LKJA 2NXQA 4PCWA 5ER5A 5I2LA 2JZIA 3TS5C 1FBVA 3CR4X 3NXAA 1PSBA 1TNPA 1JBAA 3GK4X 1B8CA 1OQPA 4I5NB 5HLVA 2EHBA 1SL7A 1B47A 1S6IA 4GFTA 3I5HB 3FS7A 3PN7C 1TCFA 2Y5IA 3BUOB 1DGUA 1S6JA 2BE6A 2JRFA 1LXFC 1S6CA 2M97A 1K95A 1EL4A 1KK8C 2JOJA 2LHLA 2L4HA 3I5HC 1EG3A 1ZMZA 3KHEA 1F71A 5DKQA 1KFUL 1NYAA 1QIVA 1QLSA 1WLMA 1QATA 5F6TA 2FJUB 3D0YB 2JQ6A 1LA0A 4PE0A 1K90D 1NPQA 3VGOA 4I5LB 4CIDA 4DCKA 2SASA 3GOFA 2CNPA 2PVBA 4YGAA 1RJVA 4F0ZB 1MQ1A 4PALA 2L0PA 3SG2A 2M7NA 3BUXB 3KPXA 4FQOA 3GK1A 4MZJA 1UHJA 1AJ5A 2BCXA 3NSOA 3SJSA 1GJYA 1MR8A 3EVRA 1U5IA 4AQJA 1E8AA 2LMUA 2WCBA 4ZCUA 1DJXA 1MHOA 3VRNA 2JXLA 3TDZA 2Y1MA 1Y0VH 1OE9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F3Z A;  1AVS A;  1QVI Z;  4L9M A;  1MXL C;  1NX1 A;  1A29 A;  1TOP A;  1YUR A;  1G4Y R;  4NQG A;  3VRQ A;  5AER A;  1S5G Y;  1B8L A;  1J1D A;  1CFF A;  2WOS A;  3ICB A;  1ZAC A;  1B4C A;  3CR5 X;  2JPT A;  2WCF A;  3O6B A;  2M29 A;  4CLN A;  1SRA A;  2I18 A;  1F70 A;  1YX8 A;  3SIA A;  1JF0 A;  1BG1 A;  2BBM A;  2KNE A;  1BLQ A;  2K8M B;  1IGV A;  3SG6 A;  1F8H A;  2BKI B;  2O60 A;  3I5F B;  1F54 A;  4R1E A;  1DJG A;  3AKB A;  1SCV A;  3D10 A;  5DKR A;  3E3R A;  4GNK B;  1N2D A;  1UUS A;  3PFV A;  1M45 A;  3SG5 A;  1OMD A;  2AUC A;  2JXC A;  3I5F C;  4PHN A;  1REC A;  4QJ3 B;  5G08 A;  2KFH A;  2HET A;  1BR1 B;  1F4O A;  2QPT A;  1K2H A;  1IRJ A;  2JT3 A;  4OVN F;  4BY5 A;  1A75 A;  1Y1X A;  5AXI A;  4DS7 A;  4ICB A;  1UHI A;  2F33 A;  2HPS A;  2WOR A;  4NDB A;  1DJW A;  1IQ5 A;  2WND A;  1J7R A;  1K94 A;  2MA2 A;  2MHH A;  3DF0 A;  3LCP C;  1J7Q A;  4HRG A;  3EKH A;  2L5X B;  1TNQ A;  4OV2 A;  2M7L A;  1K9P A;  2JNX A;  1L2O B;  4YBH B;  3NSL A;  3DVE A;  3A8R A;  2EGD A;  3O78 A;  1J55 A;  2E30 A;  5I8N A;  1YX7 A;  2JWW A;  2K7B A;  3DVK A;  1QJT A;  1XYD A;  2JC2 A;  3PSR A;  2WC8 A;  4JWQ A;  1SBJ A;  3BOW A;  3BUN B;  3DVM A;  5J3X A;  1L2O C;  5BPJ A;  4I5J A;  2L50 A;  1NSH A;  4HRH A;  2NLN A;  1RFJ A;  1MUX A;  4OKH A;  1UP5 A;  1XFU O;  1WY9 A;  2KBM A;  2QAC A;  3JVT B;  2LCP A;  3C1V A;  3LL8 B;  1CDM A;  3FWB A;  2HQW A;  2OS8 C;  4A4C A;  1BMO A;  1S1E A;  1M31 A;  1IJ5 A;  1A03 A;  1ALW A;  1JC2 A;  2LHI A;  5DKN A;  2ZND A;  1YRT B;  1NX2 A;  2MJW B;  3A4U B;  3JVT C;  1PUL A;  2BCB A;  2LVJ A;  4ORB B;  2NCP A;  2NZ0 A;  4OCI A;  3O4Y A;  3BQ3 A;  4PE7 A;  4C0K A;  4WQ2 A;  2OTG B;  2A4J A;  4IL1 A;  1NX3 A;  1KCY A;  3HX4 A;  4YGB B;  1DJZ A;  1RK9 A;  2HQ8 A;  4M2P A;  4MRX A;  4WQ3 A;  1GGZ A;  3DD4 A;  2K7O A;  1CLB A;  3FIA A;  5FYX A;  1OZS A;  2OTG C;  4YI9 A;  4FTG A;  4YI8 A;  1HT9 A;  1RRO A;  1B7T Y;  1EH2 A;  1M63 B;  1NX0 A;  1LIN A;  2BBN A;  2M1U A;  3PM8 A;  3D0Y A;  1R2U A;  1LVC D;  2JT8 A;  5D69 A;  3VRR A;  1V1F A;  2GV5 A;  1DJH A;  4AOM A;  2KI6 C;  3PAT A;  2MBX A;  2JT0 A;  4XYN A;  3BXK A;  3CZT X;  1C7W A;  1JFJ A;  4WRI A;  4HSZ A;  2LMV A;  2KQ6 A;  4DRW A;  3TUY B;  3RLZ A;  4OR9 B;  2LNK A;  1S36 A;  2D8N A;  2EC6 B;  2TN4 A;  1OOJ A;  2ZNE A;  2M8U A;  3WNX B;  2ZFD A;  3VRP A;  2F2O A;  3I5G B;  1ZUZ A;  2F8P A;  2LLU A;  4P2Y B;  3SIB A;  3WHT B;  5IBW A;  1EJ3 A;  3TUY C;  5HKZ A;  4GGN A;  2L98 A;  2K2A A;  4TNC A;  3I5I B;  2EC6 C;  4NDC A;  1PVB A;  4MEW A;  4MN0 A;  3OHM B;  5CSI A;  4PHM A;  2MAZ A;  1KK7 Y;  2LM5 A;  3H4S E;  2JNF A;  2KYF A;  3KF9 A;  1PVA A;  1EXR A;  3OX5 A;  2KBI A;  3I5G C;  1CDP A;  2COL B;  1AHR A;  2KGR A;  5AAN A;  3I5I C;  3CGA A;  2ZRT A;  4GGF C;  1XK4 C;  1YUT A;  1X02 A;  2KAV A;  1WRL A;  4M2O A;  5CPV A;  1M39 A;  1PAL A;  1CM1 A;  2L51 A;  4JQ0 D;  1VRK A;  2Q91 A;  1SL8 A;  1DT7 B;  2M3W A;  1ALV A;  1A4P A;  2LMT A;  3KO0 A;  1K96 A;  1SW8 A;  3EK4 A;  4YGE B;  1Y6W A;  3IQQ A;  1CLM A;  1BOD A;  2LE9 B;  4N1G A;  1PRW A;  2ZN8 A;  2PAS A;  2LP2 A;  1K9K A;  4YRU A;  1ZFS A;  2CT9 A;  1S5G Z;  2FOT A;  5AFP A;  1D1O A;  4QJ5 B;  4JPZ B;  1WRK A;  1DJY A;  1JFK A;  2BKH B;  1A2X A;  1QV0 A;  4UPG A;  4XJK B;  2KOT A;  4PDZ A;  3TDI A;  1TIZ A;  3CLN A;  1IG5 A;  1J7P A;  4CPV A;  2BL0 B;  1NUB A;  1OMR A;  1B9A A;  2L4I A;  2F2P A;  2GGM A;  1SCM B;  2K7D A;  4QJ4 B;  3BUM B;  2Q4U A;  5HKY A;  1QIW A;  2PSR A;  2HF5 A;  1UWO A;  2LLS A;  1AUI B;  1N65 A;  1QX5 B;  1QX7 A;  1QTX A;  2BCA A;  3QRX A;  2BL0 C;  1YVL A;  1B8R A;  2M49 B;  4PE1 A;  1DMO A;  1CMF A;  4D1E A;  1SCM C;  1SY9 A;  2CCM A;  4C0L A;  3GK2 A;  4PHK A;  2VRG A;  1AP4 A;  1F4Q A;  3EVU A;  3OB2 B;  2KFF A;  3AKA A;  2KHN A;  1DVI A;  1FW4 A;  1Y1A A;  2OPO A;  4AQI A;  2AAO A;  1Q80 A;  3FWC A;  2SCP A;  1TN4 A;  5I2Q A;  1HQV A;  3SG3 A;  3PLF B;  3OB1 B;  2O5G A;  3OP0 A;  1ZOT B;  5GQQ C;  1QLK A;  1OZO A;  1M46 A;  2CBL A;  5JJG A;  4P5O E;  1K93 D;  1JUO A;  1DF0 B;  3AAK A;  1KFU S;  1MF8 B;  3BUW B;  1JSA A;  1BT6 A;  5HLO A;  1MWN A;  1TNX A;  1XFX O;  2B1U A;  5CSN A;  2KI6 D;  1CM4 A;  2MLF C;  1PK0 D;  1TNW A;  5KSZ A;  2LVV A;  2R2I A;  2LAP A;  2KSP A;  1DGV A;  2ZKM X;  2L2E A;  1IKU A;  2GGZ A;  1XFY O;  1UHK A;  2P6B B;  2ZN9 A;  4CFQ A;  2RGI A;  1BOC A;  1N0Y A;  2LV7 A;  4ETO A;  1CDN A;  3BYA A;  1KSO A;  2LC5 A;  4N5X A;  3EK7 A;  1B1G A;  4YGD B;  2H61 C;  4CFR A;  5I2O A;  1CFD A;  3F45 A;  4GAO A;  2MLE C;  2KFG A;  1Y1U A;  1JWD A;  3NSI A;  3SG4 A;  1GGW A;  4DUQ A;  1QAS A;  1KK8 B;  3KEV A;  2MRD A;  1H4B A;  1IH0 A;  1SKT A;  2LUX A;  2M1K B;  3MSE B;  1LA3 A;  1W7J B;  1NCX A;  3CWG A;  1AK8 A;  1YR5 A;  4C0J A;  5PAL A;  3CTN A;  1BR4 B;  2JU0 A;  3IF7 A;  1FPW A;  1OMV A;  1GQM A;  2M0R A;  1YUS A;  1UUR A;  1BF5 A;  5CSF A;  1H8B A;  1JF2 A;  2LVK A;  1CDL A;  1CB1 A;  2I94 A;  1QX2 A;  1QV1 A;  1TTX A;  3PAL A;  1SK6 D;  3EVV A;  1NCZ A;  3K21 A;  1NP8 A;  1CMG A;  1F55 A;  4N1F A;  1DTL A;  2AMI A;  4MBE A;  1B7T Z;  1RWY A;  1KFX L;  1QS7 A;  2JUL A;  2F3Y A;  1KSM A;  2KQY A;  3DVJ A;  2WCE A;  1K8U A;  1TRF A;  5K89 A;  1XFZ O;  3AAJ A;  5D7F A;  2I2R E;  1V1G A;  1QVI Y;  2KAX A;  1SNL A;  2PAL A;  1YRU B;  1CTR A;  1XK4 A;  4GGF A;  1MXE A;  2K2F A;  1XA5 A;  1WRZ A;  1SYM A;  1U5I B;  1NCY A;  2KDH A;  4USL A;  4GBA A;  1C07 A;  2G2B A;  4MZK A;  3JTD B;  2LLT A;  2BEC A;  2KGB C;  1KQM B;  3VRO A;  1J1E A;  1SPY A;  2G9B A;  2I7A A;  1XFW O;  5AEQ A;  1TCO B;  3M0W A;  1KK7 Z;  3IQO A;  2K61 A;  3WXA A;  2Y1N A;  2CXJ A;  3JTD C;  3O2P A;  1S26 D;  3CR2 A;  2NCO A;  2LVI A;  1EG4 A;  1KWO B;  4MSP A;  4ZCV A;  3NSK A;  1KQM C;  1KQV A;  4GUK A;  4E68 A;  4MLW A;  5KTY A;  3EKJ A;  1CFP A;  1IJ6 A;  1YTZ C;  1AJ4 A;  1QXP A;  2K7C A;  4MZL A;  4MVF A;  1KWO C;  3CS1 A;  4XJK A;  3TZ1 A;  2CTN A;  2V53 A;  1RTP 1;  2KYC A;  4PE4 A;  1C7V A;  5KU1 A;  4BY4 A;  1J7O A;  4Q04 A;  1BU3 A;  2ZRS A;  3EK8 A;  1WLZ A;  2Y4Q A;  2FCD A;  1SR6 B;  2E6W A;  4A4B A;  2PMY A;  5TNC A;  2LUC A;  1G8I A;  1NIW A;  1S3P A;  2K0J A;  4GPL B;  2LP3 A;  2JTT A;  5HKW A;  1WDC B;  1A75 B;  1K9U A;  1BJF A;  1PSR A;  1IWQ A;  4MRY A;  4DIR A;  1CKK A;  5ER4 X;  1SL9 A;  2DOQ A;  2KI4 B;  1FI6 A;  1IQ3 A;  1SR6 C;  3DF0 B;  4ORC B;  4NDD A;  5B8I B;  3SG7 A;  4PHJ A;  1UHH A;  1CFC A;  1WDC C;  2JTZ A;  4YGC B;  4M2Q A;  1XO5 A;  3ZWH A;  2KI4 C;  3LLE A;  1R6P A;  2FCE A;  1NWD A;  3LK0 A;  1FF1 A;  4ORA B;  1YVH A;  3TDU A;  3BOW B;  1DF0 A;  3HCM A;  3OX6 A;  2BE4 A;  2KAY A;  1CNP A;  4HRE E;  3WHU B;  5JOL A;  1G33 A;  1ODB A;  2OS8 B;  5CSJ A;  2LAN A;  3ZNI A;  1OSA A;  1UHN A;  1XFV O;  2PRU A;  3RM1 A;  1W7I B;  5HYD A;  3TS5 B;  1DJI A;  1CLL A;  2H61 A;  1XVJ A;  1SMG A;  1FI5 A;  4I5K A;  2H2K A;  2ISD A;  4U8D A;  1YUU A;  2IS9 A;  3LK1 A;  3PN7 B;  1L7Z A;  1KFX S;  2M9G A;  1LKJ A;  2NXQ A;  4PCW A;  5ER5 A;  5I2L A;  2JZI A;  3TS5 C;  1FBV A;  3CR4 X;  3NXA A;  1PSB A;  1TNP A;  1JBA A;  3GK4 X;  1B8C A;  1OQP A;  4I5N B;  5HLV A;  2EHB A;  1SL7 A;  1B47 A;  1S6I A;  4GFT A;  3I5H B;  3FS7 A;  3PN7 C;  1TCF A;  2Y5I A;  3BUO B;  1DGU A;  1S6J A;  2BE6 A;  2JRF A;  1LXF C;  1S6C A;  2M97 A;  1K95 A;  1EL4 A;  1KK8 C;  2JOJ A;  2LHL A;  2L4H A;  3I5H C;  1EG3 A;  1ZMZ A;  3KHE A;  1F71 A;  5DKQ A;  1KFU L;  1NYA A;  1QIV A;  1QLS A;  1WLM A;  1QAT A;  5F6T A;  2FJU B;  3D0Y B;  2JQ6 A;  1LA0 A;  4PE0 A;  1K90 D;  1NPQ A;  3VGO A;  4I5L B;  4CID A;  4DCK A;  2SAS A;  3GOF A;  2CNP A;  2PVB A;  4YGA A;  1RJV A;  4F0Z B;  1MQ1 A;  4PAL A;  2L0P A;  3SG2 A;  2M7N A;  3BUX B;  3KPX A;  4FQO A;  3GK1 A;  4MZJ A;  1UHJ A;  1AJ5 A;  2BCX A;  3NSO A;  3SJS A;  1GJY A;  1MR8 A;  3EVR A;  1U5I A;  4AQJ A;  1E8A A;  2LMU A;  2WCB A;  4ZCU A;  1DJX A;  1MHO A;  3VRN A;  2JXL A;  3TDZ A;  2Y1M A;  1Y0V H;  1OE9 B; 
#chains in the Genus database with same CATH topology
 2F3Z A;  1AVS A;  1QVI Z;  4L9M A;  5FI6 A;  3L47 A;  1MXL C;  1NX1 A;  4INW A;  1A29 A;  1TOP A;  1YUR A;  1G4Y R;  4NQG A;  3VRQ A;  5AER A;  1S5G Y;  1B8L A;  2ERB A;  1J1D A;  1CFF A;  2WOS A;  3ICB A;  3BJH A;  1ZAC A;  1B4C A;  3CR5 X;  2JPT A;  2WCF A;  3O6B A;  2M29 A;  4CLN A;  1SRA A;  2I18 A;  1F70 A;  1YX8 A;  3SIA A;  3D73 A;  3CZ1 A;  1JF0 A;  1BG1 A;  2BBM A;  2KNE A;  1BLQ A;  2K8M B;  1IGV A;  3SG6 A;  1F8H A;  2BKI B;  2O60 A;  3I5F B;  1OOF A;  4R1E A;  5D3O A;  1F54 A;  1DJG A;  3AKB A;  1SCV A;  3D10 A;  5DKR A;  3E3R A;  5DIC A;  4GNK B;  1N2D A;  1UUS A;  3PFV A;  1M45 A;  1T14 A;  3Q8I A;  4JKT A;  3SG5 A;  1OMD A;  2AUC A;  2JXC A;  3I5F C;  4PHN A;  1REC A;  4QJ3 B;  5G08 A;  2KFH A;  2HET A;  1BR1 B;  1F4O A;  2QPT A;  1K2H A;  1IRJ A;  2JT3 A;  4OVN F;  4BY5 A;  1A75 A;  1Y1X A;  5AXI A;  4DS7 A;  2BAP A;  4ICB A;  1UHI A;  2F33 A;  2HPS A;  2WOR A;  4NDB A;  1DJW A;  1IQ5 A;  2WND A;  3CZ0 A;  1J7R A;  1K94 A;  2MA2 A;  2MHH A;  3DF0 A;  3EG5 B;  3LCP C;  3SS3 A;  1J7Q A;  4HRG A;  3EKH A;  2L5X B;  1TNQ A;  4OV2 A;  3VB1 A;  2M7L A;  2YGU A;  1K9P A;  2JNX A;  4FQT A;  1L2O B;  1Z4H A;  3NSL A;  3DVE A;  3A8R A;  2EGD A;  3O78 A;  1J55 A;  4YBH B;  2E30 A;  2QEV A;  5I8N A;  1YX7 A;  2JWW A;  2K7B A;  3DVK A;  3R1P A;  3O4X A;  1QJT A;  1XYD A;  2JC2 A;  3PSR A;  2WC8 A;  4JWQ A;  3BFB A;  1SBJ A;  3BOW A;  3BUN B;  3DVM A;  5J3X A;  3CAB A;  1L2O C;  5BPJ A;  4I5J A;  2L50 A;  1NSH A;  1OOH A;  4HRH A;  2NLN A;  1RFJ A;  1MUX A;  4OKH A;  1UP5 A;  1XFU O;  1WY9 A;  2GTE A;  2KBM A;  2QAC A;  3JVT B;  2LCP A;  3C1V A;  3LL8 B;  1CDM A;  3FWB A;  2HQW A;  2OS8 C;  4A4C A;  1BMO A;  3PM2 A;  1S1E A;  1M31 A;  1IJ5 A;  3DY9 A;  1ALW A;  1A03 A;  1JC2 A;  2LHI A;  5DKN A;  2ZND A;  1YRT B;  1NX2 A;  2MJW B;  3A4U B;  3JVT C;  1PUL A;  2BCB A;  2LVJ A;  4ORB B;  2NCP A;  2NZ0 A;  4OCI A;  3O4Y A;  3BQ3 A;  4PE7 A;  4C0K A;  4WQ2 A;  2OTG B;  2A4J A;  4IL1 A;  1NX3 A;  1KCY A;  3HX4 A;  4YGB B;  1DJZ A;  1RK9 A;  2HQ8 A;  4M2P A;  4MRX A;  4WQ3 A;  1GGZ A;  3DD4 A;  2K7O A;  1CLB A;  3FIA A;  1C3Z A;  5FYX A;  1OZS A;  2OTG C;  4YI9 A;  4FTG A;  4YI8 A;  1HT9 A;  2QDI A;  1RRO A;  1B7T Y;  1EH2 A;  1M63 B;  1NX0 A;  1LIN A;  2BBN A;  2M1U A;  3PM8 A;  3D0Y A;  1R2U A;  1LVC D;  2JT8 A;  5D69 A;  3VRR A;  3SS5 A;  3L4L A;  1V1F A;  2GV5 A;  1DJH A;  4AOM A;  2KI6 C;  3PAT A;  2MBX A;  2JT0 A;  4XYN A;  3BXK A;  3CZT X;  1C7W A;  1JFJ A;  4WRI A;  4HSZ A;  2LMV A;  2KQ6 A;  4DRW A;  3TUY B;  3RLZ A;  4OR9 B;  2LNK A;  1S36 A;  2D8N A;  2EC6 B;  2TN4 A;  1OOJ A;  2ZNE A;  2M8U A;  3WNX B;  2ZFD A;  3VRP A;  2F2O A;  3QME A;  3I5G B;  1ZUZ A;  2F8P A;  2LLU A;  4P2Y B;  3SIB A;  3WHT B;  5IBW A;  1EJ3 A;  3TUY C;  5HKZ A;  4GGN A;  2L98 A;  2K2A A;  4TNC A;  3I5I B;  2EC6 C;  4NDC A;  1PVB A;  4MEW A;  4MN0 A;  3OHM B;  5CSI A;  4PHM A;  2WCK A;  2MAZ A;  1KK7 Y;  2LM5 A;  3H4S E;  2JNF A;  2H8V A;  2KYF A;  3KF9 A;  1PVA A;  1EXR A;  3OX5 A;  2KBI A;  3I5G C;  1CDP A;  2COL B;  1AHR A;  2KGR A;  5AAN A;  3I5I C;  3CGA A;  2ZRT A;  4GGF C;  1XK4 C;  1YUT A;  3OGN A;  1X02 A;  2KAV A;  1WRL A;  4M2O A;  5CPV A;  1M39 A;  1PAL A;  1CM1 A;  2L51 A;  4JQ0 D;  1VRK A;  2Q91 A;  1SL8 A;  1DT7 B;  2M3W A;  1ALV A;  1A4P A;  4KYN A;  2LMT A;  3KO0 A;  1K96 A;  1SW8 A;  3EK4 A;  4YGE B;  1Y6W A;  3IQQ A;  1CLM A;  1BOD A;  2LE9 B;  4N1G A;  2P71 A;  1PRW A;  2ZN8 A;  2PAS A;  2LP2 A;  1K9K A;  1OOI X;  4YRU A;  1ZFS A;  2CT9 A;  1S5G Z;  2FOT A;  5AFP A;  1D1O A;  4QJ5 B;  4JPZ B;  1TUJ A;  1WRK A;  1DJY A;  1JFK A;  2BKH B;  1A2X A;  1QV0 A;  4UPG A;  4XJK B;  2KOT A;  4PDZ A;  3TDI A;  1TIZ A;  3CLN A;  1IG5 A;  3IVT A;  1J7P A;  3UNW A;  3S0B A;  4CPV A;  2BL0 B;  1NUB A;  1OMR A;  1B9A A;  2L4I A;  2F2P A;  2GGM A;  1SCM B;  2K7D A;  3BFA A;  3BUM B;  2Q4U A;  4QJ4 B;  5HKY A;  1QIW A;  3S0A A;  2PSR A;  2HF5 A;  1UWO A;  2LLS A;  1AUI B;  1N65 A;  1QX5 B;  1QX7 A;  1QTX A;  2BCA A;  3QRX A;  2BL0 C;  1YVL A;  1B8R A;  2M49 B;  3B88 A;  4PE1 A;  1DMO A;  1CMF A;  4D1E A;  1SCM C;  1SY9 A;  2CCM A;  4C0L A;  3GK2 A;  4PHK A;  2VRG A;  1AP4 A;  1F4Q A;  3EVU A;  3OB2 B;  1DEL A;  2KFF A;  3AKA A;  4OZD A;  2KHN A;  1C3Y A;  1TUZ A;  1DVI A;  1FW4 A;  1Y1A A;  2OPO A;  4AQI A;  2AAO A;  1Q80 A;  3FWC A;  4PT1 A;  3FE9 A;  2SCP A;  1TN4 A;  5I2Q A;  1HQV A;  3SG3 A;  2BNX A;  2WCJ A;  3PLF B;  3OB1 B;  2O5G A;  3OP0 A;  1ZOT B;  5GQQ C;  1QLK A;  1OZO A;  1M46 A;  3B87 A;  2CBL A;  5JJG A;  4P5O E;  1K93 D;  1JUO A;  1DF0 B;  3AAK A;  1KFU S;  1MF8 B;  3B7A A;  3BUW B;  1JSA A;  1BT6 A;  5HLO A;  1MWN A;  3D75 A;  1TNX A;  1IIO A;  1OW4 A;  1XFX O;  2B1U A;  5CSN A;  2KI6 D;  1CM4 A;  2MLF C;  1PK0 D;  1TNW A;  2WC5 A;  2KLE A;  2LVV A;  2R2I A;  2LAP A;  2KSP A;  1DGV A;  2ZKM X;  2L2E A;  3N7H A;  5KSZ A;  1IKU A;  2GGZ A;  1XFY O;  1UHK A;  2P6B B;  2ZN9 A;  4CFQ A;  2RGI A;  1BOC A;  1N0Y A;  2LV7 A;  3NHI A;  4ETO A;  1CDN A;  3BYA A;  3PJI A;  1KSO A;  2LC5 A;  4N5X A;  3B6X A;  3EK7 A;  1B1G A;  4YGD B;  2H61 C;  4CFR A;  2WCL A;  5I2O A;  2PQL A;  1CFD A;  1DEK A;  3F45 A;  4GAO A;  2MLE C;  2KFG A;  1Y1U A;  1JWD A;  3NSI A;  3SS4 A;  3SG4 A;  1GGW A;  4DUQ A;  1QAS A;  1KK8 B;  1P28 A;  2MRD A;  3KEV A;  1H4B A;  1IH0 A;  1SKT A;  2LUX A;  2M1K B;  3MSE B;  3NHT A;  1DQE A;  1LA3 A;  1W7J B;  1NCX A;  3CWG A;  1AK8 A;  1YR5 A;  4C0J A;  5PAL A;  3CTN A;  1BR4 B;  2JU0 A;  3IF7 A;  1FPW A;  1OMV A;  1GQM A;  2M0R A;  1YUS A;  1UUR A;  1BF5 A;  2K60 A;  5CSF A;  1H8B A;  1JF2 A;  2LVK A;  1CDL A;  3DZT A;  1CB1 A;  1ORG A;  2I94 A;  1QX2 A;  2P70 A;  1QV1 A;  1TTX A;  3PAL A;  1SK6 D;  3EVV A;  1NCZ A;  3K21 A;  1NP8 A;  1CMG A;  1F55 A;  4N1F A;  5I94 A;  1DTL A;  2AMI A;  4MBE A;  1B7T Z;  1RWY A;  1KFX L;  1QS7 A;  2JUL A;  2F3Y A;  1KSM A;  2KQY A;  3DVJ A;  3S0D A;  2WCE A;  3UO9 A;  1K8U A;  1TRF A;  5K89 A;  1XFZ O;  3D76 A;  3AAJ A;  5D7F A;  2I2R E;  1V1G A;  1QVI Y;  2KAX A;  1SNL A;  2PAL A;  1YRU B;  1CTR A;  1XK4 A;  4GGF A;  1MXE A;  2K2F A;  1XA5 A;  4JD9 A;  1WRZ A;  1SYM A;  1U5I B;  1NCY A;  2KDH A;  4USL A;  4GBA A;  3RZS A;  2G2B A;  4MZK A;  3S0F A;  1C07 A;  3JTD B;  1Z2C B;  3OBV A;  2LLT A;  1TWO A;  2BEC A;  3D77 A;  2KGB C;  1KQM B;  3DXL A;  3VRO A;  3S0G A;  1J1E A;  1SPY A;  2G9B A;  2I7A A;  3D74 A;  1XFW O;  5AEQ A;  1TCO B;  3M0W A;  1KK7 Z;  3IQO A;  2K61 A;  3FE6 A;  2Y1N A;  2CXJ A;  3R72 A;  3JTD C;  3WXA A;  3O2P A;  1S26 D;  3CR2 A;  2NCO A;  2LVI A;  1EG4 A;  1KWO B;  4MSP A;  4ZCV A;  3NSK A;  1KQM C;  1KQV A;  4GUK A;  4E68 A;  4MLW A;  2WCM A;  5KTY A;  3EKJ A;  5HL1 A;  1CFP A;  1IJ6 A;  1YTZ C;  1AJ4 A;  1QXP A;  2K7C A;  4MZL A;  3B86 A;  1KWO C;  3CS1 A;  4MVF A;  4XJK A;  3TZ1 A;  2CTN A;  3FE8 A;  2V53 A;  1RTP 1;  2KYC A;  4PE4 A;  1DC1 A;  1QWV A;  1C7V A;  5KU1 A;  4BY4 A;  1J7O A;  3D78 A;  4Q04 A;  3CDN A;  1BU3 A;  2ZRS A;  3EK8 A;  1WLZ A;  2QEO A;  2Y4Q A;  2FCD A;  1SR6 B;  2E6W A;  4A4B A;  2PMY A;  5TNC A;  2LUC A;  1G8I A;  1NIW A;  1S3P A;  2K0J A;  4GPL B;  2LP3 A;  4IJ7 A;  2JTT A;  3NGV A;  5HKW A;  1WDC B;  1A75 B;  1K9U A;  1BJF A;  1PSR A;  1IWQ A;  4MRY A;  2L2C A;  4DIR A;  1CKK A;  5ER4 X;  1SL9 A;  2DOQ A;  2KI4 B;  1FI6 A;  1IQ3 A;  1SR6 C;  3DF0 B;  4ORC B;  4NDD A;  5B8I B;  3SG7 A;  4PHJ A;  3S0E A;  1UHH A;  1CFC A;  1WDC C;  2JTZ A;  4YGC B;  4M2Q A;  3R1O A;  1W9Z A;  1XO5 A;  3ZWH A;  2KI4 C;  1OOG A;  3LLE A;  1R6P A;  2FCE A;  1NWD A;  3LK0 A;  1FF1 A;  2KPH A;  1YVH A;  3CYZ A;  4ORA B;  3TDU A;  3BOW B;  1DF0 A;  3HCM A;  2PYQ A;  2BE4 A;  1XFR A;  3OX6 A;  2KAY A;  4F7F A;  4HRE E;  1CNP A;  3WHU B;  5JOL A;  1G33 A;  1ODB A;  2OS8 B;  5CSJ A;  2LAN A;  3ZNI A;  1OSA A;  1UHN A;  1XFV O;  2PRU A;  3RM1 A;  1W7I B;  5HYD A;  3TS5 B;  1DJI A;  1CLL A;  2H61 A;  2FJY A;  1XVJ A;  5FI2 A;  1SMG A;  3R1V A;  1FI5 A;  4I5K A;  2H2K A;  2ISD A;  4U8D A;  1YUU A;  2WCH A;  2IS9 A;  3LK1 A;  3DYE A;  3PN7 B;  1L7Z A;  1KFX S;  2M9G A;  1LKJ A;  2NXQ A;  3BFH A;  4PCW A;  5ER5 A;  2JZI A;  5I2L A;  3TS5 C;  1FBV A;  3CR4 X;  3NXA A;  1PSB A;  1TNP A;  1JBA A;  3GK4 X;  1B8C A;  1OQP A;  4I5N B;  5HLV A;  2EHB A;  1SL7 A;  1B47 A;  1S6I A;  4GFT A;  3I5H B;  3FS7 A;  3PN7 C;  1TCF A;  2Y5I A;  3BUO B;  1DGU A;  1S6J A;  2BE6 A;  2JRF A;  3K1E A;  1LXF C;  1S6C A;  2M97 A;  1K95 A;  1EL4 A;  1KK8 C;  2L5Y A;  2JOJ A;  2LHL A;  2L4H A;  3I5H C;  1EG3 A;  1ZMZ A;  2QEH A;  3KHE A;  1F71 A;  4INX A;  1KFU L;  1NYA A;  1QIV A;  1QLS A;  1WLM A;  5DKQ A;  1QAT A;  5EL2 A;  5F6T A;  2FJU B;  3D0Y B;  2JQ6 A;  1LA0 A;  4PE0 A;  1K90 D;  1NPQ A;  3VGO A;  4I5L B;  4CID A;  4DCK A;  2SAS A;  3L4A A;  3GOF A;  2CNP A;  2PVB A;  1SSE B;  2QEB A;  4YGA A;  1RJV A;  3CZ2 A;  3V2L A;  5FI7 A;  1MQ1 A;  4PAL A;  4F0Z B;  1LS8 A;  2L0P A;  3SG2 A;  2M7N A;  3BUX B;  3KPX A;  4FQO A;  3GK1 A;  4MZJ A;  1UHJ A;  1AJ5 A;  2BCX A;  3NSO A;  3SJS A;  2KLD A;  1GM0 A;  1GJY A;  2WC6 A;  1MR8 A;  3EVR A;  1U5I A;  2JPO A;  4AQJ A;  1E8A A;  2LMU A;  2WCB A;  4ZCU A;  1DJX A;  1MHO A;  3VRN A;  2JXL A;  3TDZ A;  2Y1M A;  1Y0V H;  1OE9 B; 
#chains in the Genus database with same CATH homology
 2F3Z A;  1AVS A;  1QVI Z;  4L9M A;  1MXL C;  1NX1 A;  1A29 A;  1TOP A;  1YUR A;  1G4Y R;  4NQG A;  3VRQ A;  5AER A;  1S5G Y;  1B8L A;  1J1D A;  1CFF A;  2WOS A;  3ICB A;  1ZAC A;  1B4C A;  3CR5 X;  2JPT A;  2WCF A;  3O6B A;  2M29 A;  4CLN A;  1SRA A;  2I18 A;  1F70 A;  1YX8 A;  3SIA A;  1JF0 A;  1BG1 A;  2BBM A;  2KNE A;  1BLQ A;  2K8M B;  1IGV A;  3SG6 A;  1F8H A;  2BKI B;  2O60 A;  3I5F B;  1F54 A;  4R1E A;  1DJG A;  3AKB A;  1SCV A;  3D10 A;  5DKR A;  3E3R A;  4GNK B;  1N2D A;  1UUS A;  3PFV A;  1M45 A;  3SG5 A;  1OMD A;  2AUC A;  2JXC A;  3I5F C;  4PHN A;  1REC A;  4QJ3 B;  5G08 A;  2KFH A;  2HET A;  1BR1 B;  1F4O A;  2QPT A;  1K2H A;  1IRJ A;  2JT3 A;  4OVN F;  4BY5 A;  1A75 A;  1Y1X A;  5AXI A;  4DS7 A;  4ICB A;  1UHI A;  2F33 A;  2HPS A;  2WOR A;  4NDB A;  1DJW A;  1IQ5 A;  2WND A;  1J7R A;  1K94 A;  2MA2 A;  2MHH A;  3DF0 A;  3LCP C;  1J7Q A;  4HRG A;  3EKH A;  2L5X B;  1TNQ A;  4OV2 A;  2M7L A;  1K9P A;  2JNX A;  1L2O B;  4YBH B;  3NSL A;  3DVE A;  3A8R A;  2EGD A;  3O78 A;  1J55 A;  2E30 A;  5I8N A;  1YX7 A;  2JWW A;  2K7B A;  3DVK A;  1QJT A;  1XYD A;  2JC2 A;  3PSR A;  2WC8 A;  4JWQ A;  1SBJ A;  3BOW A;  3BUN B;  3DVM A;  5J3X A;  1L2O C;  5BPJ A;  4I5J A;  2L50 A;  1NSH A;  4HRH A;  2NLN A;  1RFJ A;  1MUX A;  4OKH A;  1UP5 A;  1XFU O;  1WY9 A;  2KBM A;  2QAC A;  3JVT B;  2LCP A;  3C1V A;  3LL8 B;  1CDM A;  3FWB A;  2HQW A;  2OS8 C;  4A4C A;  1BMO A;  1S1E A;  1M31 A;  1IJ5 A;  1A03 A;  1ALW A;  1JC2 A;  2LHI A;  5DKN A;  2ZND A;  1YRT B;  1NX2 A;  2MJW B;  3A4U B;  3JVT C;  1PUL A;  2BCB A;  2LVJ A;  4ORB B;  2NCP A;  2NZ0 A;  4OCI A;  3O4Y A;  3BQ3 A;  4PE7 A;  4C0K A;  4WQ2 A;  2OTG B;  2A4J A;  4IL1 A;  1NX3 A;  1KCY A;  3HX4 A;  4YGB B;  1DJZ A;  1RK9 A;  2HQ8 A;  4M2P A;  4MRX A;  4WQ3 A;  1GGZ A;  3DD4 A;  2K7O A;  1CLB A;  3FIA A;  5FYX A;  1OZS A;  2OTG C;  4YI9 A;  4FTG A;  4YI8 A;  1HT9 A;  1RRO A;  1B7T Y;  1EH2 A;  1M63 B;  1NX0 A;  1LIN A;  2BBN A;  2M1U A;  3PM8 A;  3D0Y A;  1R2U A;  1LVC D;  2JT8 A;  5D69 A;  3VRR A;  1V1F A;  2GV5 A;  1DJH A;  4AOM A;  2KI6 C;  3PAT A;  2MBX A;  2JT0 A;  4XYN A;  3BXK A;  3CZT X;  1C7W A;  1JFJ A;  4WRI A;  4HSZ A;  2LMV A;  2KQ6 A;  4DRW A;  3TUY B;  3RLZ A;  4OR9 B;  2LNK A;  1S36 A;  2D8N A;  2EC6 B;  2TN4 A;  1OOJ A;  2ZNE A;  2M8U A;  3WNX B;  2ZFD A;  3VRP A;  2F2O A;  3I5G B;  1ZUZ A;  2F8P A;  2LLU A;  4P2Y B;  3SIB A;  3WHT B;  5IBW A;  1EJ3 A;  3TUY C;  5HKZ A;  4GGN A;  2L98 A;  2K2A A;  4TNC A;  3I5I B;  2EC6 C;  4NDC A;  1PVB A;  4MEW A;  4MN0 A;  3OHM B;  5CSI A;  4PHM A;  2MAZ A;  1KK7 Y;  2LM5 A;  3H4S E;  2JNF A;  2KYF A;  3KF9 A;  1PVA A;  1EXR A;  3OX5 A;  2KBI A;  3I5G C;  1CDP A;  2COL B;  1AHR A;  2KGR A;  5AAN A;  3I5I C;  3CGA A;  2ZRT A;  4GGF C;  1XK4 C;  1YUT A;  1X02 A;  2KAV A;  1WRL A;  4M2O A;  5CPV A;  1M39 A;  1PAL A;  1CM1 A;  2L51 A;  4JQ0 D;  1VRK A;  2Q91 A;  1SL8 A;  1DT7 B;  2M3W A;  1ALV A;  1A4P A;  2LMT A;  3KO0 A;  1K96 A;  1SW8 A;  3EK4 A;  4YGE B;  1Y6W A;  3IQQ A;  1CLM A;  1BOD A;  2LE9 B;  4N1G A;  1PRW A;  2ZN8 A;  2PAS A;  2LP2 A;  1K9K A;  4YRU A;  1ZFS A;  2CT9 A;  1S5G Z;  2FOT A;  5AFP A;  1D1O A;  4QJ5 B;  4JPZ B;  1WRK A;  1DJY A;  1JFK A;  2BKH B;  1A2X A;  1QV0 A;  4UPG A;  4XJK B;  2KOT A;  4PDZ A;  3TDI A;  1TIZ A;  3CLN A;  1IG5 A;  1J7P A;  4CPV A;  2BL0 B;  1NUB A;  1OMR A;  1B9A A;  2L4I A;  2F2P A;  2GGM A;  1SCM B;  2K7D A;  4QJ4 B;  3BUM B;  2Q4U A;  5HKY A;  1QIW A;  2PSR A;  2HF5 A;  1UWO A;  2LLS A;  1AUI B;  1N65 A;  1QX5 B;  1QX7 A;  1QTX A;  2BCA A;  3QRX A;  2BL0 C;  1YVL A;  1B8R A;  2M49 B;  4PE1 A;  1DMO A;  1CMF A;  4D1E A;  1SCM C;  1SY9 A;  2CCM A;  4C0L A;  3GK2 A;  4PHK A;  2VRG A;  1AP4 A;  1F4Q A;  3EVU A;  3OB2 B;  2KFF A;  3AKA A;  2KHN A;  1DVI A;  1FW4 A;  1Y1A A;  2OPO A;  4AQI A;  2AAO A;  1Q80 A;  3FWC A;  2SCP A;  1TN4 A;  5I2Q A;  1HQV A;  3SG3 A;  3PLF B;  3OB1 B;  2O5G A;  3OP0 A;  1ZOT B;  5GQQ C;  1QLK A;  1OZO A;  1M46 A;  2CBL A;  5JJG A;  4P5O E;  1K93 D;  1JUO A;  1DF0 B;  3AAK A;  1KFU S;  1MF8 B;  3BUW B;  1JSA A;  1BT6 A;  5HLO A;  1MWN A;  1TNX A;  1XFX O;  2B1U A;  5CSN A;  2KI6 D;  1CM4 A;  2MLF C;  1PK0 D;  1TNW A;  5KSZ A;  2LVV A;  2R2I A;  2LAP A;  2KSP A;  1DGV A;  2ZKM X;  2L2E A;  1IKU A;  2GGZ A;  1XFY O;  1UHK A;  2P6B B;  2ZN9 A;  4CFQ A;  2RGI A;  1BOC A;  1N0Y A;  2LV7 A;  4ETO A;  1CDN A;  3BYA A;  1KSO A;  2LC5 A;  4N5X A;  3EK7 A;  1B1G A;  4YGD B;  2H61 C;  4CFR A;  5I2O A;  1CFD A;  3F45 A;  4GAO A;  2MLE C;  2KFG A;  1Y1U A;  1JWD A;  3NSI A;  3SG4 A;  1GGW A;  4DUQ A;  1QAS A;  1KK8 B;  3KEV A;  2MRD A;  1H4B A;  1IH0 A;  1SKT A;  2LUX A;  2M1K B;  3MSE B;  1LA3 A;  1W7J B;  1NCX A;  3CWG A;  1AK8 A;  1YR5 A;  4C0J A;  5PAL A;  3CTN A;  1BR4 B;  2JU0 A;  3IF7 A;  1FPW A;  1OMV A;  1GQM A;  2M0R A;  1YUS A;  1UUR A;  1BF5 A;  5CSF A;  1H8B A;  1JF2 A;  2LVK A;  1CDL A;  1CB1 A;  2I94 A;  1QX2 A;  1QV1 A;  1TTX A;  3PAL A;  1SK6 D;  3EVV A;  1NCZ A;  3K21 A;  1NP8 A;  1CMG A;  1F55 A;  4N1F A;  1DTL A;  2AMI A;  4MBE A;  1B7T Z;  1RWY A;  1KFX L;  1QS7 A;  2JUL A;  2F3Y A;  1KSM A;  2KQY A;  3DVJ A;  2WCE A;  1K8U A;  1TRF A;  5K89 A;  1XFZ O;  3AAJ A;  5D7F A;  2I2R E;  1V1G A;  1QVI Y;  2KAX A;  1SNL A;  2PAL A;  1YRU B;  1CTR A;  1XK4 A;  4GGF A;  1MXE A;  2K2F A;  1XA5 A;  1WRZ A;  1SYM A;  1U5I B;  1NCY A;  2KDH A;  4USL A;  4GBA A;  1C07 A;  2G2B A;  4MZK A;  3JTD B;  2LLT A;  2BEC A;  2KGB C;  1KQM B;  3VRO A;  1J1E A;  1SPY A;  2G9B A;  2I7A A;  1XFW O;  5AEQ A;  1TCO B;  3M0W A;  1KK7 Z;  3IQO A;  2K61 A;  3WXA A;  2Y1N A;  2CXJ A;  3JTD C;  3O2P A;  1S26 D;  3CR2 A;  2NCO A;  2LVI A;  1EG4 A;  1KWO B;  4MSP A;  4ZCV A;  3NSK A;  1KQM C;  1KQV A;  4GUK A;  4E68 A;  4MLW A;  5KTY A;  3EKJ A;  1CFP A;  1IJ6 A;  1YTZ C;  1AJ4 A;  1QXP A;  2K7C A;  4MZL A;  4MVF A;  1KWO C;  3CS1 A;  4XJK A;  3TZ1 A;  2CTN A;  2V53 A;  1RTP 1;  2KYC A;  4PE4 A;  1C7V A;  5KU1 A;  4BY4 A;  1J7O A;  4Q04 A;  1BU3 A;  2ZRS A;  3EK8 A;  1WLZ A;  2Y4Q A;  2FCD A;  1SR6 B;  2E6W A;  4A4B A;  2PMY A;  5TNC A;  2LUC A;  1G8I A;  1NIW A;  1S3P A;  2K0J A;  4GPL B;  2LP3 A;  2JTT A;  5HKW A;  1WDC B;  1A75 B;  1K9U A;  1BJF A;  1PSR A;  1IWQ A;  4MRY A;  4DIR A;  1CKK A;  5ER4 X;  1SL9 A;  2DOQ A;  2KI4 B;  1FI6 A;  1IQ3 A;  1SR6 C;  3DF0 B;  4ORC B;  4NDD A;  5B8I B;  3SG7 A;  4PHJ A;  1UHH A;  1CFC A;  1WDC C;  2JTZ A;  4YGC B;  4M2Q A;  1XO5 A;  3ZWH A;  2KI4 C;  3LLE A;  1R6P A;  2FCE A;  1NWD A;  3LK0 A;  1FF1 A;  4ORA B;  1YVH A;  3TDU A;  3BOW B;  1DF0 A;  3HCM A;  3OX6 A;  2BE4 A;  2KAY A;  1CNP A;  4HRE E;  3WHU B;  5JOL A;  1G33 A;  1ODB A;  2OS8 B;  5CSJ A;  2LAN A;  3ZNI A;  1OSA A;  1UHN A;  1XFV O;  2PRU A;  3RM1 A;  1W7I B;  5HYD A;  3TS5 B;  1DJI A;  1CLL A;  2H61 A;  1XVJ A;  1SMG A;  1FI5 A;  4I5K A;  2H2K A;  2ISD A;  4U8D A;  1YUU A;  2IS9 A;  3LK1 A;  3PN7 B;  1L7Z A;  1KFX S;  2M9G A;  1LKJ A;  2NXQ A;  4PCW A;  5ER5 A;  5I2L A;  2JZI A;  3TS5 C;  1FBV A;  3CR4 X;  3NXA A;  1PSB A;  1TNP A;  1JBA A;  3GK4 X;  1B8C A;  1OQP A;  4I5N B;  5HLV A;  2EHB A;  1SL7 A;  1B47 A;  1S6I A;  4GFT A;  3I5H B;  3FS7 A;  3PN7 C;  1TCF A;  2Y5I A;  3BUO B;  1DGU A;  1S6J A;  2BE6 A;  2JRF A;  1LXF C;  1S6C A;  2M97 A;  1K95 A;  1EL4 A;  1KK8 C;  2JOJ A;  2LHL A;  2L4H A;  3I5H C;  1EG3 A;  1ZMZ A;  3KHE A;  1F71 A;  5DKQ A;  1KFU L;  1NYA A;  1QIV A;  1QLS A;  1WLM A;  1QAT A;  5F6T A;  2FJU B;  3D0Y B;  2JQ6 A;  1LA0 A;  4PE0 A;  1K90 D;  1NPQ A;  3VGO A;  4I5L B;  4CID A;  4DCK A;  2SAS A;  3GOF A;  2CNP A;  2PVB A;  4YGA A;  1RJV A;  4F0Z B;  1MQ1 A;  4PAL A;  2L0P A;  3SG2 A;  2M7N A;  3BUX B;  3KPX A;  4FQO A;  3GK1 A;  4MZJ A;  1UHJ A;  1AJ5 A;  2BCX A;  3NSO A;  3SJS A;  1GJY A;  1MR8 A;  3EVR A;  1U5I A;  4AQJ A;  1E8A A;  2LMU A;  2WCB A;  4ZCU A;  1DJX A;  1MHO A;  3VRN A;  2JXL A;  3TDZ A;  2Y1M A;  1Y0V H;  1OE9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...