2LMUA

Androcam at high calcium
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
147
structure length
147
Chain Sequence
b'SELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQDLIAEAENNNNGQLNFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFISPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calmodulin-related protein 97A
publication title Structure of androcam supports specialized interactions with myosin VI.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Metal binding protein
total genus 40
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2011-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2lmuA01
1U5IA 3ICBA 3RLZA 1F70A 2K61A 1EXRA 1UP5A 4U8DA 2BE4A 3I5HC 5B8IB 2HQWA 1KFXL 2PSRA 2GGZA 1XO5A 2LV7A 2F33A 2LMUA 2KAXA 1M39A 2M7LA 1TNPA 2SCPA 2FJUB 1SKTA 2CTNA 2JOJA 3EVRA 1SCMC 2JC2A 1EL4A 1KQMC 2M49B 3PSRA 3JTDC 2K7BA 3OB1B 4N5XA 1Y1UA 4MRXA 3WHUB 2MRDA 2NCOA 3EVUA 1OQPA 2P6BB 4NDCA 4WQ2A 1GGWA 5FYXA 4AQJA 5TNCA 2JRFA 2ZFDA 5JJGA 1L2OB 1KQMB 3OP0A 2OPOA 1J1DA 1IKUA 4Q04A 4CLNA 2AUCA 1SR6C 1J7OA 2M1KB 1S5GY 1OOJA 2HPSA 4TNCA 1N0YA 2Y4QA 1SR6B 2FOTA 1PK0D 2PRUA 1SYMA 1QATA 1OMRA 4C0LA 2KHNA 1NYAA 2KGBC 4PHNA 1BMOA 1R2UA 3AAJA 3SG4A 1OMVA 1OZOA 1PRWA 4GUKA 1DJYA 1TOPA 2Q91A 1SPYA 4ICBA 1YTZC 1JBAA 2LAPA 3D10A 5ER4X 1Y1XA 1IQ5A 1S26D 3F45A 4PALA 3LK1A 1WLMA 2VRGA 1QX5B 3EVVA 4DS7A 4MBEA 3BYAA 2L0PA 1MXLC 1NX3A 1NX2A 1VRKA 4YI9A 1FI5A 1J55A 1DF0B 2BCAA 4MZKA 3GK2A 1OZSA 4YGDB 1RROA 2LMTA 4I5KA 2JNXA 1JF0A 4F0ZB 2QPTA 1B7TY 1IG5A 1LVCD 2ZKMX 2LLTA 2LM5A 1MXEA 2CXJA 1SBJA 1A4PA 3IF7A 1CM1A 3LK0A 1H4BA 2KAVA 4M2PA 3VRRA 3NSKA 2KQ6A 5I2QA 1YR5A 3NSOA 4YGCB 1G8IA 2KOTA 3DVJA 5J3XA 1ZMZA 1YX7A 1S1EA 2WC8A 1K9PA 4PHKA 4ORAB 1FI6A 2BL0C 2H61C 3NSLA 1BU3A 4QJ5B 3ZWHA 1PULA 3C1VA 2L4IA 3AKBA 2BL0B 1CFPA 2JTZA 4CPVA 4JWQA 1QVIY 2KAYA 5CSFA 2EC6B 1F55A 1YUUA 2M3WA 3PALA 1KWOC 3CWGA 3TDUA 4HRGA 3I5GC 1D1OA 3EK7A 2G2BA 2JULA 4OV2A 1KWOB 2B1UA 1XFXO 3KEVA 3I5GB 2L50A 1CDNA 2K7CA 1SY9A 2V53A 4HSZA 1MR8A 5HKYA 1RTP1 3JVTC 2WORA 1IGVA 3OX6A 2MHHA 1BF5A 1KK8B 1UURA 5KSZA 2K2FA 4A4CA 3AKAA 4MLWA 2LVIA 4MVFA 3JVTB 2LHLA 1B1GA 2LANA 1DMOA 1NP8A 1SL8A 2LP3A 1UHKA 3CZTX 1RWYA 4JQ0D 5AXIA 2WCBA 3DD4A 2ZRSA 3DVMA 1QXPA 2JT8A 3FWCA 4QJ3B 1FBVA 3VRPA 2E30A 1C07A 2LC5A 1R6PA 1RFJA 2L98A 2HETA 1ZUZA 2F2PA 3LL8B 1XFYO 4C0JA 3A4UB 1CMFA 1IJ6A 4YRUA 2A4JA 2Y1MA 1PALA 2CCMA 3KPXA 2K2AA 1QIWA 4FTGA 1L2OC 1NCYA 1SCVA 4CIDA 2JPTA 1DJZA 2PASA 2ZN9A 2KI6C 1B8LA 2DOQA 4BY5A 3BUXB 1F54A 3CTNA 4OKHA 1W7IB 1M46A 3CR5X 1KFUL 4I5LB 1FW4A 4PHMA 4GBAA 1ZFSA 4DCKA 2JU0A 1DJWA 2PVBA 1TTXA 2LE9B 1SW8A 3GK4X 1J7QA 3KO0A 3SIAA 3PLFB 1AJ5A 3AAKA 2ZRTA 2K0JA 3DVKA 1X02A 1M31A 4NDDA 2JQ6A 1B47A 1IH0A 2MLFC 1BOCA 4M2OA 3TDIA 1M63B 2BE6A 4P5OE 1JC2A 1TNXA 4PE1A 1A29A 2JWWA 1YRTB 1W7JB 2R2IA 1LKJA 1WRKA 1TIZA 1NX0A 2F3ZA 3D0YB 3SG6A 4E68A 1EH2A 3RM1A 2JXLA 1YRUB 2MA2A 1K9KA 1NX1A 4JPZB 2HF5A 2QACA 1A03A 2ISDA 4OVNF 1CDLA 3CGAA 4A4BA 2LVVA 1K93D 2CNPA 5CPVA 1PVBA 1CFFA 1WY9A 1ALVA 2BKHB 5CSIA 1K95A 2L2EA 3M0WA 5DKNA 3EK8A 4ZCVA 5ER5A 5I2LA 1F71A 3BOWB 4DRWA 5JOLA 2EC6C 2M0RA 4I5NB 4DIRA 1NPQA 2SASA 2TN4A 1XFVO 2CBLA 1YX8A 2O5GA 2KFGA 3OHMB 1CMGA 4NQGA 3GOFA 2L51A 3BQ3A 1G33A 1SK6D 1RECA 1HQVA 2FCEA 1K8UA 2WCEA 3SG2A 1C7VA 1J7PA 1EG3A 1OE9B 3I5FB 3SG3A 2F2OA 5AANA 1V1FA 1XFUO 5IBWA 3WNXB 4N1GA 1L7ZA 3D0YA 1CTRA 1S3PA 1XK4C 2ZN8A 4PDZA 1SL9A 4MZJA 4YBHB 2G9BA 5D7FA 4YGEB 1FPWA 1IWQA 1KK8C 2K8MB 5CSJA 1AP4A 1EJ3A 1SL7A 4NDBA 3QRXA 1DGUA 5G08A 1UHIA 3LCPC 5HKWA 2HQ8A 5HKZA 4ORBB 2L4HA 4CFRA 3O6BA 1XFWO 2M97A 4XYNA 3ZNIA 4C0KA 4CFQA 1WDCC 5K89A 1KK7Z 3IQOA 3BOWA 3VGOA 1RJVA 2KGRA 2LHIA 3H4SE 2LMVA 3PN7B 3OB2B 2LUCA 1UHHA 1QTXA 1Y0VH 2KYFA 2JT0A 1WDCB 1J7RA 1NUBA 1XA5A 4OCIA 4USLA 1CFDA 1BLQA 4ORCB 3BUNB 3PFVA 3TS5B 1K90D 1MQ1A 1KFUS 2KFFA 1UHNA 2KYCA 3MSEB 4YI8A 1DVIA 1QS7A 1KSMA 1ZACA 2K7OA 2LUXA 4GNKB 3E3RA 1CLBA 2I18A 1TNWA 2Q4UA 1GQMA 1MHOA 1AJ4A 1NWDA 2WCFA 2BKIB 4PE7A 1N65A 4XJKB 4UPGA 1CM4A 1V1GA 2KI4C 1B9AA 1LA0A 5AERA 1F4QA 2WOSA 1BR1B 5DKRA 2JTTA 3NSIA 4D1EA 1K94A 1QX7A 2BECA 4MRYA 4QJ4B 1HT9A 1TN4A 1YVHA 1XK4A 3K21A 1S6IA 2KI4B 1MF8B 3VRQA 1NCZA 1AUIB 1CFCA 1UUSA 2JT3A 1DJHA 2K7DA 1CKKA 2AAOA 1AK8A 1JF2A 4MEWA 1CNPA 2MLEC 4PE4A 2KBIA 1FF1A 4YGBB 5PALA 4YGAA 1QV1A 3A8RA 1S6CA 1A2XA 1GGZA 4PE0A 1LA3A 2GGMA 4WRIA 3CR2A 1QASA 4WQ3A 1TCFA 2LVJA 3FIAA 4MSPA 3I5HB 5D69A 2F3YA 3BUMB 2M29A 5HLVA 1B8RA 1MUXA 2AMIA 1S5GZ 2KNEA 2D8NA 2LLUA 1QX2A 3KHEA 3O78A 2ZNDA 4XJKA 2BBMA 3DVEA 1QLKA 1YUSA 1XFZO 2KSPA 5GQQC 1KSOA 1SCMB 3PM8A 5KTYA 2NLNA 4MN0A 1GJYA 3JTDB 1QLSA 1SNLA 5CSNA 1F8HA 1IQ3A 4GGFA 1OMDA 1F4OA 5AEQA 1EG4A 1JFJA 2OTGC 2RGIA 2F8PA 1LINA 2EHBA 3TUYC 1CLLA 3CS1A 1DT7B 1C7WA 1IJ5A 2MJWB 3KF9A 1KCYA 2OS8C 2LCPA 5F6TA 3PATA 2OTGB 3GK1A 1XVJA 1KQVA 3TUYB 2LNKA 1N2DA 2OS8B 5AFPA 1S6JA 1B7TZ 2KI6D 4IL1A 1NSHA 2JNFA 1RK9A 2GV5A 1CDPA 4PHJA 2L5XB 2LVKA 3IQQA 3WHTB 1AVSA 2KFHA 1LXFC 1QIVA 3CLNA 4OR9B 4N1FA 4GPLB 2H2KA 1QJTA 4MZLA 3SIBA 1OSAA 1Y6WA 1XYDA 3O4YA 2E6WA 4HRHA 1NIWA 1WRLA 1DGVA 2IS9A 3OX5A 2MBXA 5BPJA 1WLZA 2I94A 1ALWA 3I5FC 1K96A 1BT6A 2ZNEA 4R1EA 2LLSA 4GFTA 1A75B 3HCMA 4PCWA 5DKQA 2M1UA 3DF0B 2I2RE 2EGDA 5I8NA 2JZIA 2Y1NA 1M45A 5KU1A 1IRJA 4FQOA 1BJFA 1JUOA 2FCDA 1BG1A 1QVIZ 1SMGA 1B8CA 1S36A 2NZ0A 1JWDA 1JSAA 1UWOA 3FWBA 2CT9A 3O2PA 1ZOTB 1TRFA 2MAZA 1J1EA 1QV0A 1ODBA 3LLEA 4P2YB 3VRNA 2O60A 2NXQA 3PN7C 5HLOA 1JFKA 2I7AA 1K9UA 1SRAA 3SG7A 3BXKA 1BODA 2LP2A 3CR4X 1U5IB 3FS7A 5I2OA 3BUOB 1CB1A 1YURA 4HREE 2PMYA 1G4YR 3TS5C 1YUTA 4DUQA 3SG5A 1DF0A 1K2HA 4ETOA 4M2QA 3WXAA 1TNQA 2M7NA 1PSBA 3HX4A 4ZCUA 1E8AA 2KDHA 2WNDA 3I5IC 1A75A 3TZ1A 3EK4A 2BBNA 1KFXS 3DF0A 2NCPA 3NXAA 4AOMA 1CLMA 2JXCA 1KK7Y 2PALA 4AQIA 1MWNA 2COLB 1Y1AA 4BY4A 1UHJA 3I5IB 4GAOA 1DTLA 3EKHA 4GGNA 1DJXA 1Q80A 1TCOB 1DJIA 4I5JA 1H8BA 2KBMA 1WRZA 2BCXA 4GGFC 4L9MA 3SJSA 1AHRA 2KQYA 1PSRA 3EKJA 2Y5IA 3VROA 2M8UA 3TDZA 1CDMA 2H61A 1BR4B 1PVAA 2M9GA 2BCBA 1B4CA 3BUWB 5HYDA 1YVLA 1DJGA 1NCXA
chains in the Genus database with same CATH superfamily
1U5IA 3ICBA 3RLZA 1F70A 2K61A 1EXRA 1UP5A 4U8DA 2BE4A 3I5HC 5B8IB 2HQWA 1IIOA 1KFXL 2PSRA 3DXLA 2GGZA 1XO5A 2LV7A 2F33A 2LMUA 2KAXA 1M39A 2M7LA 1TNPA 2SCPA 2FJUB 3S0AA 1SKTA 2CTNA 2JOJA 3EVRA 3S0DA 1SCMC 2JC2A 1EL4A 2QEVA 1KQMC 2M49B 3B6XA 3PSRA 2GTEA 3JTDC 2K7BA 3OB1B 4N5XA 1Y1UA 4MRXA 3WHUB 2MRDA 2NCOA 3EVUA 1OQPA 2P6BB 4NDCA 4WQ2A 1GGWA 5FYXA 4AQJA 5TNCA 2JRFA 2ZFDA 5JJGA 1L2OB 1KQMB 3CZ0A 3OP0A 3Q8IA 2OPOA 1J1DA 2FJYA 4Q04A 1IKUA 4CLNA 4OZDA 2AUCA 1SR6C 1J7OA 2M1KB 1S5GY 1OOJA 3RZSA 2HPSA 4TNCA 1N0YA 2Y4QA 1W9ZA 1SR6B 2FOTA 1PK0D 2PRUA 1SYMA 1QATA 1OMRA 4C0LA 2KHNA 1NYAA 3CZ2A 2KGBC 3V2LA 4PHNA 1BMOA 1R2UA 3AAJA 3SG4A 4FQTA 1OMVA 1OZOA 1PRWA 4GUKA 1DJYA 1OOFA 1TOPA 2Q91A 1SPYA 4ICBA 1YTZC 1JBAA 2LAPA 2WCHA 3D10A 1TWOA 5ER4X 2WC6A 1Y1XA 1IQ5A 1S26D 3F45A 4PALA 3LK1A 1WLMA 2VRGA 1QX5B 3EVVA 4DS7A 4MBEA 3BYAA 2L0PA 1MXLC 1NX3A 1NX2A 1VRKA 4YI9A 1FI5A 1J55A 1DF0B 2BCAA 4MZKA 3GK2A 1OZSA 4YGDB 1RROA 2LMTA 4I5KA 2JNXA 1JF0A 4F0ZB 2QPTA 1B7TY 1IG5A 1LVCD 2ZKMX 2LLTA 3FE8A 2LM5A 1MXEA 2CXJA 1SBJA 1A4PA 3IF7A 1CM1A 3LK0A 1H4BA 3DZTA 3L47A 1GM0A 2KAVA 3R1OA 4M2PA 3VRRA 5HL1A 3NSKA 2KQ6A 5I2QA 1YR5A 3NSOA 4YGCB 1G8IA 2KOTA 3DVJA 5J3XA 1ZMZA 1YX7A 1S1EA 2WC8A 1K9PA 4PHKA 3IVTA 4ORAB 1FI6A 2BL0C 2H61C 3NSLA 1BU3A 4QJ5B 1OOGA 3ZWHA 3S0FA 1PULA 3C1VA 2L4IA 3AKBA 2BL0B 1CFPA 2JTZA 4CPVA 4JWQA 1QVIY 2KAYA 5CSFA 2EC6B 1F55A 1OW4A 1YUUA 2M3WA 3PALA 1KWOC 3CWGA 3TDUA 2JPOA 4HRGA 2KPHA 3I5GC 1D1OA 3EK7A 2BNXA 2G2BA 2JULA 4OV2A 1KWOB 2B1UA 1XFXO 3KEVA 3I5GB 2L50A 1CDNA 2K7CA 1SY9A 2V53A 3D76A 4HSZA 1MR8A 5HKYA 1RTP1 3BFAA 3JVTC 5DICA 2WORA 1IGVA 3OX6A 4F7FA 2MHHA 1BF5A 1KK8B 1UURA 3BFHA 5KSZA 2K2FA 4A4CA 3CABA 1XFRA 3AKAA 3BJHA 4MLWA 2LVIA 4MVFA 3JVTB 2LHLA 1B1GA 2LANA 1DMOA 1NP8A 1SL8A 2LP3A 1UHKA 3CZTX 1RWYA 4JQ0D 5AXIA 2WCBA 3DD4A 2ZRSA 3DVMA 1QXPA 2JT8A 2P70A 3FWCA 1FBVA 4QJ3B 2E30A 3VB1A 3VRPA 2LC5A 1R6PA 1C07A 1RFJA 3CDNA 2WCKA 2L98A 2HETA 1ZUZA 2F2PA 3LL8B 1XFYO 3R1PA 4C0JA 3A4UB 1CMFA 1IJ6A 4YRUA 2A4JA 2Y1MA 1PALA 2CCMA 3KPXA 2K2AA 1QIWA 4FTGA 1L2OC 3BFBA 1NCYA 1SCVA 4CIDA 2JPTA 1DJZA 3SS3A 2PASA 2ZN9A 2KI6C 1B8LA 2DOQA 4BY5A 3BUXB 1F54A 3CTNA 3D78A 4OKHA 1W7IB 1M46A 3CR5X 1KFUL 4I5LB 1FW4A 4PHMA 4GBAA 1ZFSA 4DCKA 2JU0A 1C3ZA 1DJWA 2PYQA 2PVBA 1TTXA 2LE9B 1SW8A 3GK4X 3FE6A 1J7QA 3KO0A 3SIAA 3PLFB 1AJ5A 3AAKA 3O4XA 2ZRTA 2K0JA 3DVKA 1X02A 1M31A 4NDDA 2JQ6A 1B47A 1Z4HA 5FI2A 1IH0A 2MLFC 1BOCA 4M2OA 1DELA 3TDIA 1M63B 2BE6A 4P5OE 1JC2A 1TNXA 4PE1A 3S0EA 1A29A 2JWWA 1OOIX 1YRTB 1W7JB 2R2IA 3PJIA 1LKJA 1WRKA 1TIZA 1NX0A 2F3ZA 3D0YB 3SG6A 4E68A 1EH2A 3RM1A 2JXLA 1YRUB 2MA2A 1K9KA 1NX1A 3NHIA 2HF5A 2QACA 4JPZB 1A03A 2ISDA 4OVNF 1CDLA 3CGAA 4A4BA 2LVVA 1K93D 2CNPA 5CPVA 1PVBA 1CFFA 1WY9A 1ALVA 2BKHB 5CSIA 1K95A 2L2EA 3M0WA 5DKNA 3EK8A 4ZCVA 5ER5A 5I2LA 1F71A 3BOWB 4DRWA 5JOLA 2EC6C 4INWA 2M0RA 4I5NB 4DIRA 1NPQA 2SASA 2TN4A 1XFVO 2CBLA 1YX8A 2O5GA 2KFGA 2BAPA 3NGVA 3OHMB 3K1EA 3L4AA 1CMGA 1P28A 4NQGA 3GOFA 2L51A 3BQ3A 1G33A 1SK6D 1RECA 1HQVA 2FCEA 1K8UA 1QWVA 2WCEA 3SG2A 1C7VA 1EG3A 1OE9B 3D75A 1J7PA 3I5FB 3SG3A 2F2OA 5AANA 1V1FA 1XFUO 5IBWA 3WNXB 4N1GA 1L7ZA 3D0YA 1CTRA 1S3PA 1XK4C 2ZN8A 4PDZA 1SL9A 5FI7A 4MZJA 4YBHB 2G9BA 3OGNA 5D7FA 4YGEB 1FPWA 1IWQA 1DC1A 1KK8C 2K8MB 5CSJA 1AP4A 2QEBA 1EJ3A 1SL7A 4NDBA 3QRXA 1DGUA 5G08A 1UHIA 3LCPC 5HKWA 2HQ8A 5HKZA 4ORBB 2L4HA 4CFRA 3O6BA 1XFWO 2M97A 4XYNA 3ZNIA 4C0KA 4CFQA 1WDCC 5K89A 1KK7Z 3IQOA 3BOWA 3VGOA 1RJVA 2ERBA 2KGRA 2LHIA 3H4SE 2LMVA 3PN7B 2WCLA 3OB2B 4IJ7A 2LUCA 1UHHA 1QTXA 1Y0VH 2KYFA 2JT0A 1WDCB 1T14A 1J7RA 1NUBA 1XA5A 3D73A 1CFDA 4OCIA 4USLA 4ORCB 3BUNB 3PFVA 3TS5B 1K90D 1MQ1A 1KFUS 2KFFA 1BLQA 3R1VA 1UHNA 2KYCA 3MSEB 4YI8A 1DVIA 1QS7A 3S0BA 1KSMA 1ZACA 2K7OA 2LUXA 4GNKB 3E3RA 2WCJA 1CLBA 2I18A 1TNWA 2Q4UA 1GQMA 1MHOA 1AJ4A 1NWDA 2WCFA 2BKIB 4PE7A 1N65A 4XJKB 4UPGA 1CM4A 1V1GA 2KI4C 1B9AA 1LA0A 2YGUA 5AERA 1F4QA 2WOSA 1BR1B 5DKRA 2JTTA 3NSIA 4D1EA 1K94A 4JKTA 1QX7A 2BECA 4MRYA 4QJ4B 1HT9A 1TN4A 1YVHA 1XK4A 3N7HA 2H8VA 3K21A 1S6IA 2KI4B 1MF8B 1DEKA 3VRQA 1NCZA 1AUIB 1CFCA 1UUSA 2JT3A 1DJHA 2K7DA 1CKKA 4KYNA 2AAOA 1AK8A 1JF2A 4MEWA 1CNPA 2MLEC 4PE4A 2KBIA 1FF1A 4YGBB 1DQEA 5PALA 2PQLA 3UO9A 4YGAA 1QV1A 3A8RA 1S6CA 1A2XA 1GGZA 4PE0A 1LA3A 2GGMA 4WRIA 3CR2A 1QASA 3SS4A 4WQ3A 1TCFA 2LVJA 3FIAA 4MSPA 3I5HB 3D74A 5D69A 3B7AA 2F3YA 3BUMB 2M29A 5HLVA 1B8RA 1MUXA 2AMIA 5D3OA 4PT1A 1S5GZ 1C3YA 2KNEA 2D8NA 2LLUA 1QX2A 3KHEA 3O78A 2ZNDA 2KLEA 4XJKA 2BBMA 3DVEA 1QLKA 1YUSA 1XFZO 2KSPA 5GQQC 1KSOA 1SCMB 3PM8A 5KTYA 2NLNA 4MN0A 1GJYA 1SSEB 1QLSA 3JTDB 1SNLA 5FI6A 5CSNA 1F8HA 1IQ3A 4GGFA 1OMDA 1F4OA 5AEQA 1EG4A 1JFJA 2OTGC 2RGIA 2F8PA 1LINA 2EHBA 3TUYC 3SS5A 1CLLA 3CS1A 1DT7B 3R72A 1C7WA 1IJ5A 2MJWB 3KF9A 1KCYA 2OS8C 2LCPA 5F6TA 3PATA 2OTGB 1TUJA 3GK1A 1XVJA 1KQVA 3TUYB 2LNKA 3FE9A 1N2DA 2OS8B 5AFPA 1S6JA 1B7TZ 2KI6D 4IL1A 5I94A 1NSHA 2JNFA 1RK9A 2GV5A 1CDPA 4PHJA 2L5XB 2LVKA 3IQQA 3WHTB 1AVSA 2KFHA 1LXFC 2P71A 1QIVA 2KLDA 3CLNA 4OR9B 3NHTA 4GPLB 2H2KA 4N1FA 1QJTA 4MZLA 3SIBA 1OSAA 1Y6WA 1XYDA 3O4YA 2E6WA 4HRHA 1NIWA 1WRLA 1DGVA 2IS9A 3OX5A 2MBXA 5BPJA 1WLZA 2I94A 1ALWA 2QDIA 3I5FC 1K96A 4INXA 5EL2A 1BT6A 3DYEA 3PM2A 2ZNEA 4R1EA 2LLSA 3OBVA 4GFTA 1A75B 3HCMA 4PCWA 5DKQA 3S0GA 2M1UA 3B86A 3DF0B 2I2RE 2EGDA 5I8NA 2JZIA 2Y1NA 1M45A 5KU1A 1IRJA 2WC5A 4FQOA 1BJFA 1JUOA 2FCDA 1BG1A 1QVIZ 1SMGA 1B8CA 1S36A 2NZ0A 1JWDA 1ORGA 1JSAA 1UWOA 3D77A 3FWBA 2CT9A 3O2PA 1ZOTB 3EG5B 1TRFA 2MAZA 1J1EA 1OOHA 1QV0A 3QMEA 1ODBA 3LLEA 4P2YB 3VRNA 2O60A 2NXQA 3PN7C 5HLOA 1JFKA 2I7AA 1K9UA 1SRAA 3DY9A 3SG7A 3BXKA 1BODA 2LP2A 3CR4X 1U5IB 3FS7A 3L4LA 3BUOB 5I2OA 1YURA 4HREE 2QEOA 1CB1A 1LS8A 2PMYA 1G4YR 3TS5C 1YUTA 4DUQA 3SG5A 1DF0A 3CYZA 1K2HA 4ETOA 4M2QA 3B88A 3WXAA 1TNQA 2M7NA 1PSBA 3HX4A 4ZCUA 1E8AA 2KDHA 2WNDA 3I5IC 1A75A 2QEHA 3TZ1A 3EK4A 2BBNA 2WCMA 1KFXS 3DF0A 2NCPA 3NXAA 4AOMA 1CLMA 2JXCA 1KK7Y 2PALA 4AQIA 1MWNA 1TUZA 2COLB 1Y1AA 4BY4A 1UHJA 3I5IB 3B87A 4GAOA 1DTLA 3EKHA 4GGNA 1DJXA 4JD9A 1Q80A 1TCOB 1DJIA 4I5JA 1H8BA 2KBMA 1WRZA 2BCXA 4GGFC 4L9MA 3SJSA 1AHRA 3UNWA 2KQYA 1PSRA 3EKJA 3CZ1A 2L5YA 2Y5IA 1Z2CB 3VROA 2M8UA 3TDZA 1CDMA 2H61A 1BR4B 1PVAA 2M9GA 2BCBA 1B4CA 3BUWB 5HYDA 1YVLA 2K60A 2L2CA 1DJGA 1NCXA
chains in the Genus database with same CATH topology
1U5IA 3ICBA 3RLZA 1F70A 2K61A 1EXRA 1UP5A 4U8DA 2BE4A 3I5HC 5B8IB 2HQWA 1KFXL 2PSRA 2GGZA 1XO5A 2LV7A 2F33A 2LMUA 2KAXA 1M39A 2M7LA 1TNPA 2SCPA 2FJUB 1SKTA 2CTNA 2JOJA 3EVRA 1SCMC 2JC2A 1EL4A 1KQMC 2M49B 3PSRA 3JTDC 2K7BA 3OB1B 4N5XA 1Y1UA 4MRXA 3WHUB 2MRDA 2NCOA 3EVUA 1OQPA 2P6BB 4NDCA 4WQ2A 1GGWA 5FYXA 4AQJA 5TNCA 2JRFA 2ZFDA 5JJGA 1L2OB 1KQMB 3OP0A 2OPOA 1J1DA 1IKUA 4Q04A 4CLNA 2AUCA 1SR6C 1J7OA 2M1KB 1S5GY 1OOJA 2HPSA 4TNCA 1N0YA 2Y4QA 1SR6B 2FOTA 1PK0D 2PRUA 1SYMA 1QATA 1OMRA 4C0LA 2KHNA 1NYAA 2KGBC 4PHNA 1BMOA 1R2UA 3AAJA 3SG4A 1OMVA 1OZOA 1PRWA 4GUKA 1DJYA 1TOPA 2Q91A 1SPYA 4ICBA 1YTZC 1JBAA 2LAPA 3D10A 5ER4X 1Y1XA 1IQ5A 1S26D 3F45A 4PALA 3LK1A 1WLMA 2VRGA 1QX5B 3EVVA 4DS7A 4MBEA 3BYAA 2L0PA 1MXLC 1NX3A 1NX2A 1VRKA 4YI9A 1FI5A 1J55A 1DF0B 2BCAA 4MZKA 3GK2A 1OZSA 4YGDB 1RROA 2LMTA 4I5KA 2JNXA 1JF0A 4F0ZB 2QPTA 1B7TY 1IG5A 1LVCD 2ZKMX 2LLTA 2LM5A 1MXEA 2CXJA 1SBJA 1A4PA 3IF7A 1CM1A 3LK0A 1H4BA 2KAVA 4M2PA 3VRRA 3NSKA 2KQ6A 5I2QA 1YR5A 3NSOA 4YGCB 1G8IA 2KOTA 3DVJA 5J3XA 1ZMZA 1YX7A 1S1EA 2WC8A 1K9PA 4PHKA 4ORAB 1FI6A 2BL0C 2H61C 3NSLA 1BU3A 4QJ5B 3ZWHA 1PULA 3C1VA 2L4IA 3AKBA 2BL0B 1CFPA 2JTZA 4CPVA 4JWQA 1QVIY 2KAYA 5CSFA 2EC6B 1F55A 1YUUA 2M3WA 3PALA 1KWOC 3CWGA 3TDUA 4HRGA 3I5GC 1D1OA 3EK7A 2G2BA 2JULA 4OV2A 1KWOB 2B1UA 1XFXO 3KEVA 3I5GB 2L50A 1CDNA 2K7CA 1SY9A 2V53A 4HSZA 1MR8A 5HKYA 1RTP1 3JVTC 2WORA 1IGVA 3OX6A 2MHHA 1BF5A 1KK8B 1UURA 5KSZA 2K2FA 4A4CA 3AKAA 4MLWA 2LVIA 4MVFA 3JVTB 2LHLA 1B1GA 2LANA 1DMOA 1NP8A 1SL8A 2LP3A 1UHKA 3CZTX 1RWYA 4JQ0D 5AXIA 2WCBA 3DD4A 2ZRSA 3DVMA 1QXPA 2JT8A 3FWCA 4QJ3B 1FBVA 3VRPA 2E30A 1C07A 2LC5A 1R6PA 1RFJA 2L98A 2HETA 1ZUZA 2F2PA 3LL8B 1XFYO 4C0JA 3A4UB 1CMFA 1IJ6A 4YRUA 2A4JA 2Y1MA 1PALA 2CCMA 3KPXA 2K2AA 1QIWA 4FTGA 1L2OC 1NCYA 1SCVA 4CIDA 2JPTA 1DJZA 2PASA 2ZN9A 2KI6C 1B8LA 2DOQA 4BY5A 3BUXB 1F54A 3CTNA 4OKHA 1W7IB 1M46A 3CR5X 1KFUL 4I5LB 1FW4A 4PHMA 4GBAA 1ZFSA 4DCKA 2JU0A 1DJWA 2PVBA 1TTXA 2LE9B 1SW8A 3GK4X 1J7QA 3KO0A 3SIAA 3PLFB 1AJ5A 3AAKA 2ZRTA 2K0JA 3DVKA 1X02A 1M31A 4NDDA 2JQ6A 1B47A 1IH0A 2MLFC 1BOCA 4M2OA 3TDIA 1M63B 2BE6A 4P5OE 1JC2A 1TNXA 4PE1A 1A29A 2JWWA 1YRTB 1W7JB 2R2IA 1LKJA 1WRKA 1TIZA 1NX0A 2F3ZA 3D0YB 3SG6A 4E68A 1EH2A 3RM1A 2JXLA 1YRUB 2MA2A 1K9KA 1NX1A 4JPZB 2HF5A 2QACA 1A03A 2ISDA 4OVNF 1CDLA 3CGAA 4A4BA 2LVVA 1K93D 2CNPA 5CPVA 1PVBA 1CFFA 1WY9A 1ALVA 2BKHB 5CSIA 1K95A 2L2EA 3M0WA 5DKNA 3EK8A 4ZCVA 5ER5A 5I2LA 1F71A 3BOWB 4DRWA 5JOLA 2EC6C 2M0RA 4I5NB 4DIRA 1NPQA 2SASA 2TN4A 1XFVO 2CBLA 1YX8A 2O5GA 2KFGA 3OHMB 1CMGA 4NQGA 3GOFA 2L51A 3BQ3A 1G33A 1SK6D 1RECA 1HQVA 2FCEA 1K8UA 2WCEA 3SG2A 1C7VA 1J7PA 1EG3A 1OE9B 3I5FB 3SG3A 2F2OA 5AANA 1V1FA 1XFUO 5IBWA 3WNXB 4N1GA 1L7ZA 3D0YA 1CTRA 1S3PA 1XK4C 2ZN8A 4PDZA 1SL9A 4MZJA 4YBHB 2G9BA 5D7FA 4YGEB 1FPWA 1IWQA 1KK8C 2K8MB 5CSJA 1AP4A 1EJ3A 1SL7A 4NDBA 3QRXA 1DGUA 5G08A 1UHIA 3LCPC 5HKWA 2HQ8A 5HKZA 4ORBB 2L4HA 4CFRA 3O6BA 1XFWO 2M97A 4XYNA 3ZNIA 4C0KA 4CFQA 1WDCC 5K89A 1KK7Z 3IQOA 3BOWA 3VGOA 1RJVA 2KGRA 2LHIA 3H4SE 2LMVA 3PN7B 3OB2B 2LUCA 1UHHA 1QTXA 1Y0VH 2KYFA 2JT0A 1WDCB 1J7RA 1NUBA 1XA5A 4OCIA 4USLA 1CFDA 1BLQA 4ORCB 3BUNB 3PFVA 3TS5B 1K90D 1MQ1A 1KFUS 2KFFA 1UHNA 2KYCA 3MSEB 4YI8A 1DVIA 1QS7A 1KSMA 1ZACA 2K7OA 2LUXA 4GNKB 3E3RA 1CLBA 2I18A 1TNWA 2Q4UA 1GQMA 1MHOA 1AJ4A 1NWDA 2WCFA 2BKIB 4PE7A 1N65A 4XJKB 4UPGA 1CM4A 1V1GA 2KI4C 1B9AA 1LA0A 5AERA 1F4QA 2WOSA 1BR1B 5DKRA 2JTTA 3NSIA 4D1EA 1K94A 1QX7A 2BECA 4MRYA 4QJ4B 1HT9A 1TN4A 1YVHA 1XK4A 3K21A 1S6IA 2KI4B 1MF8B 3VRQA 1NCZA 1AUIB 1CFCA 1UUSA 2JT3A 1DJHA 2K7DA 1CKKA 2AAOA 1AK8A 1JF2A 4MEWA 1CNPA 2MLEC 4PE4A 2KBIA 1FF1A 4YGBB 5PALA 4YGAA 1QV1A 3A8RA 1S6CA 1A2XA 1GGZA 4PE0A 1LA3A 2GGMA 4WRIA 3CR2A 1QASA 4WQ3A 1TCFA 2LVJA 3FIAA 4MSPA 3I5HB 5D69A 2F3YA 3BUMB 2M29A 5HLVA 1B8RA 1MUXA 2AMIA 1S5GZ 2KNEA 2D8NA 2LLUA 1QX2A 3KHEA 3O78A 2ZNDA 4XJKA 2BBMA 3DVEA 1QLKA 1YUSA 1XFZO 2KSPA 5GQQC 1KSOA 1SCMB 3PM8A 5KTYA 2NLNA 4MN0A 1GJYA 3JTDB 1QLSA 1SNLA 5CSNA 1F8HA 1IQ3A 4GGFA 1OMDA 1F4OA 5AEQA 1EG4A 1JFJA 2OTGC 2RGIA 2F8PA 1LINA 2EHBA 3TUYC 1CLLA 3CS1A 1DT7B 1C7WA 1IJ5A 2MJWB 3KF9A 1KCYA 2OS8C 2LCPA 5F6TA 3PATA 2OTGB 3GK1A 1XVJA 1KQVA 3TUYB 2LNKA 1N2DA 2OS8B 5AFPA 1S6JA 1B7TZ 2KI6D 4IL1A 1NSHA 2JNFA 1RK9A 2GV5A 1CDPA 4PHJA 2L5XB 2LVKA 3IQQA 3WHTB 1AVSA 2KFHA 1LXFC 1QIVA 3CLNA 4OR9B 4N1FA 4GPLB 2H2KA 1QJTA 4MZLA 3SIBA 1OSAA 1Y6WA 1XYDA 3O4YA 2E6WA 4HRHA 1NIWA 1WRLA 1DGVA 2IS9A 3OX5A 2MBXA 5BPJA 1WLZA 2I94A 1ALWA 3I5FC 1K96A 1BT6A 2ZNEA 4R1EA 2LLSA 4GFTA 1A75B 3HCMA 4PCWA 5DKQA 2M1UA 3DF0B 2I2RE 2EGDA 5I8NA 2JZIA 2Y1NA 1M45A 5KU1A 1IRJA 4FQOA 1BJFA 1JUOA 2FCDA 1BG1A 1QVIZ 1SMGA 1B8CA 1S36A 2NZ0A 1JWDA 1JSAA 1UWOA 3FWBA 2CT9A 3O2PA 1ZOTB 1TRFA 2MAZA 1J1EA 1QV0A 1ODBA 3LLEA 4P2YB 3VRNA 2O60A 2NXQA 3PN7C 5HLOA 1JFKA 2I7AA 1K9UA 1SRAA 3SG7A 3BXKA 1BODA 2LP2A 3CR4X 1U5IB 3FS7A 5I2OA 3BUOB 1CB1A 1YURA 4HREE 2PMYA 1G4YR 3TS5C 1YUTA 4DUQA 3SG5A 1DF0A 1K2HA 4ETOA 4M2QA 3WXAA 1TNQA 2M7NA 1PSBA 3HX4A 4ZCUA 1E8AA 2KDHA 2WNDA 3I5IC 1A75A 3TZ1A 3EK4A 2BBNA 1KFXS 3DF0A 2NCPA 3NXAA 4AOMA 1CLMA 2JXCA 1KK7Y 2PALA 4AQIA 1MWNA 2COLB 1Y1AA 4BY4A 1UHJA 3I5IB 4GAOA 1DTLA 3EKHA 4GGNA 1DJXA 1Q80A 1TCOB 1DJIA 4I5JA 1H8BA 2KBMA 1WRZA 2BCXA 4GGFC 4L9MA 3SJSA 1AHRA 2KQYA 1PSRA 3EKJA 2Y5IA 3VROA 2M8UA 3TDZA 1CDMA 2H61A 1BR4B 1PVAA 2M9GA 2BCBA 1B4CA 3BUWB 5HYDA 1YVLA 1DJGA 1NCXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U5I A;  3ICB A;  3RLZ A;  1F70 A;  2K61 A;  1EXR A;  1UP5 A;  4U8D A;  2BE4 A;  3I5H C;  5B8I B;  2HQW A;  1KFX L;  2PSR A;  2GGZ A;  1XO5 A;  2LV7 A;  2F33 A;  2LMU A;  2KAX A;  1M39 A;  2M7L A;  1TNP A;  2SCP A;  2FJU B;  1SKT A;  2CTN A;  2JOJ A;  3EVR A;  1SCM C;  2JC2 A;  1EL4 A;  1KQM C;  2M49 B;  3PSR A;  3JTD C;  2K7B A;  3OB1 B;  4N5X A;  1Y1U A;  4MRX A;  3WHU B;  2MRD A;  2NCO A;  3EVU A;  1OQP A;  2P6B B;  4NDC A;  4WQ2 A;  1GGW A;  5FYX A;  4AQJ A;  5TNC A;  2JRF A;  2ZFD A;  5JJG A;  1L2O B;  1KQM B;  3OP0 A;  2OPO A;  1J1D A;  1IKU A;  4Q04 A;  4CLN A;  2AUC A;  1SR6 C;  1J7O A;  2M1K B;  1S5G Y;  1OOJ A;  2HPS A;  4TNC A;  1N0Y A;  2Y4Q A;  1SR6 B;  2FOT A;  1PK0 D;  2PRU A;  1SYM A;  1QAT A;  1OMR A;  4C0L A;  2KHN A;  1NYA A;  2KGB C;  4PHN A;  1BMO A;  1R2U A;  3AAJ A;  3SG4 A;  1OMV A;  1OZO A;  1PRW A;  4GUK A;  1DJY A;  1TOP A;  2Q91 A;  1SPY A;  4ICB A;  1YTZ C;  1JBA A;  2LAP A;  3D10 A;  5ER4 X;  1Y1X A;  1IQ5 A;  1S26 D;  3F45 A;  4PAL A;  3LK1 A;  1WLM A;  2VRG A;  1QX5 B;  3EVV A;  4DS7 A;  4MBE A;  3BYA A;  2L0P A;  1MXL C;  1NX3 A;  1NX2 A;  1VRK A;  4YI9 A;  1FI5 A;  1J55 A;  1DF0 B;  2BCA A;  4MZK A;  3GK2 A;  1OZS A;  4YGD B;  1RRO A;  2LMT A;  4I5K A;  2JNX A;  1JF0 A;  4F0Z B;  2QPT A;  1B7T Y;  1IG5 A;  1LVC D;  2ZKM X;  2LLT A;  2LM5 A;  1MXE A;  2CXJ A;  1SBJ A;  1A4P A;  3IF7 A;  1CM1 A;  3LK0 A;  1H4B A;  2KAV A;  4M2P A;  3VRR A;  3NSK A;  2KQ6 A;  5I2Q A;  1YR5 A;  3NSO A;  4YGC B;  1G8I A;  2KOT A;  3DVJ A;  5J3X A;  1ZMZ A;  1YX7 A;  1S1E A;  2WC8 A;  1K9P A;  4PHK A;  4ORA B;  1FI6 A;  2BL0 C;  2H61 C;  3NSL A;  1BU3 A;  4QJ5 B;  3ZWH A;  1PUL A;  3C1V A;  2L4I A;  3AKB A;  2BL0 B;  1CFP A;  2JTZ A;  4CPV A;  4JWQ A;  1QVI Y;  2KAY A;  5CSF A;  2EC6 B;  1F55 A;  1YUU A;  2M3W A;  3PAL A;  1KWO C;  3CWG A;  3TDU A;  4HRG A;  3I5G C;  1D1O A;  3EK7 A;  2G2B A;  2JUL A;  4OV2 A;  1KWO B;  2B1U A;  1XFX O;  3KEV A;  3I5G B;  2L50 A;  1CDN A;  2K7C A;  1SY9 A;  2V53 A;  4HSZ A;  1MR8 A;  5HKY A;  1RTP 1;  3JVT C;  2WOR A;  1IGV A;  3OX6 A;  2MHH A;  1BF5 A;  1KK8 B;  1UUR A;  5KSZ A;  2K2F A;  4A4C A;  3AKA A;  4MLW A;  2LVI A;  4MVF A;  3JVT B;  2LHL A;  1B1G A;  2LAN A;  1DMO A;  1NP8 A;  1SL8 A;  2LP3 A;  1UHK A;  3CZT X;  1RWY A;  4JQ0 D;  5AXI A;  2WCB A;  3DD4 A;  2ZRS A;  3DVM A;  1QXP A;  2JT8 A;  3FWC A;  4QJ3 B;  1FBV A;  3VRP A;  2E30 A;  1C07 A;  2LC5 A;  1R6P A;  1RFJ A;  2L98 A;  2HET A;  1ZUZ A;  2F2P A;  3LL8 B;  1XFY O;  4C0J A;  3A4U B;  1CMF A;  1IJ6 A;  4YRU A;  2A4J A;  2Y1M A;  1PAL A;  2CCM A;  3KPX A;  2K2A A;  1QIW A;  4FTG A;  1L2O C;  1NCY A;  1SCV A;  4CID A;  2JPT A;  1DJZ A;  2PAS A;  2ZN9 A;  2KI6 C;  1B8L A;  2DOQ A;  4BY5 A;  3BUX B;  1F54 A;  3CTN A;  4OKH A;  1W7I B;  1M46 A;  3CR5 X;  1KFU L;  4I5L B;  1FW4 A;  4PHM A;  4GBA A;  1ZFS A;  4DCK A;  2JU0 A;  1DJW A;  2PVB A;  1TTX A;  2LE9 B;  1SW8 A;  3GK4 X;  1J7Q A;  3KO0 A;  3SIA A;  3PLF B;  1AJ5 A;  3AAK A;  2ZRT A;  2K0J A;  3DVK A;  1X02 A;  1M31 A;  4NDD A;  2JQ6 A;  1B47 A;  1IH0 A;  2MLF C;  1BOC A;  4M2O A;  3TDI A;  1M63 B;  2BE6 A;  4P5O E;  1JC2 A;  1TNX A;  4PE1 A;  1A29 A;  2JWW A;  1YRT B;  1W7J B;  2R2I A;  1LKJ A;  1WRK A;  1TIZ A;  1NX0 A;  2F3Z A;  3D0Y B;  3SG6 A;  4E68 A;  1EH2 A;  3RM1 A;  2JXL A;  1YRU B;  2MA2 A;  1K9K A;  1NX1 A;  4JPZ B;  2HF5 A;  2QAC A;  1A03 A;  2ISD A;  4OVN F;  1CDL A;  3CGA A;  4A4B A;  2LVV A;  1K93 D;  2CNP A;  5CPV A;  1PVB A;  1CFF A;  1WY9 A;  1ALV A;  2BKH B;  5CSI A;  1K95 A;  2L2E A;  3M0W A;  5DKN A;  3EK8 A;  4ZCV A;  5ER5 A;  5I2L A;  1F71 A;  3BOW B;  4DRW A;  5JOL A;  2EC6 C;  2M0R A;  4I5N B;  4DIR A;  1NPQ A;  2SAS A;  2TN4 A;  1XFV O;  2CBL A;  1YX8 A;  2O5G A;  2KFG A;  3OHM B;  1CMG A;  4NQG A;  3GOF A;  2L51 A;  3BQ3 A;  1G33 A;  1SK6 D;  1REC A;  1HQV A;  2FCE A;  1K8U A;  2WCE A;  3SG2 A;  1C7V A;  1J7P A;  1EG3 A;  1OE9 B;  3I5F B;  3SG3 A;  2F2O A;  5AAN A;  1V1F A;  1XFU O;  5IBW A;  3WNX B;  4N1G A;  1L7Z A;  3D0Y A;  1CTR A;  1S3P A;  1XK4 C;  2ZN8 A;  4PDZ A;  1SL9 A;  4MZJ A;  4YBH B;  2G9B A;  5D7F A;  4YGE B;  1FPW A;  1IWQ A;  1KK8 C;  2K8M B;  5CSJ A;  1AP4 A;  1EJ3 A;  1SL7 A;  4NDB A;  3QRX A;  1DGU A;  5G08 A;  1UHI A;  3LCP C;  5HKW A;  2HQ8 A;  5HKZ A;  4ORB B;  2L4H A;  4CFR A;  3O6B A;  1XFW O;  2M97 A;  4XYN A;  3ZNI A;  4C0K A;  4CFQ A;  1WDC C;  5K89 A;  1KK7 Z;  3IQO A;  3BOW A;  3VGO A;  1RJV A;  2KGR A;  2LHI A;  3H4S E;  2LMV A;  3PN7 B;  3OB2 B;  2LUC A;  1UHH A;  1QTX A;  1Y0V H;  2KYF A;  2JT0 A;  1WDC B;  1J7R A;  1NUB A;  1XA5 A;  4OCI A;  4USL A;  1CFD A;  1BLQ A;  4ORC B;  3BUN B;  3PFV A;  3TS5 B;  1K90 D;  1MQ1 A;  1KFU S;  2KFF A;  1UHN A;  2KYC A;  3MSE B;  4YI8 A;  1DVI A;  1QS7 A;  1KSM A;  1ZAC A;  2K7O A;  2LUX A;  4GNK B;  3E3R A;  1CLB A;  2I18 A;  1TNW A;  2Q4U A;  1GQM A;  1MHO A;  1AJ4 A;  1NWD A;  2WCF A;  2BKI B;  4PE7 A;  1N65 A;  4XJK B;  4UPG A;  1CM4 A;  1V1G A;  2KI4 C;  1B9A A;  1LA0 A;  5AER A;  1F4Q A;  2WOS A;  1BR1 B;  5DKR A;  2JTT A;  3NSI A;  4D1E A;  1K94 A;  1QX7 A;  2BEC A;  4MRY A;  4QJ4 B;  1HT9 A;  1TN4 A;  1YVH A;  1XK4 A;  3K21 A;  1S6I A;  2KI4 B;  1MF8 B;  3VRQ A;  1NCZ A;  1AUI B;  1CFC A;  1UUS A;  2JT3 A;  1DJH A;  2K7D A;  1CKK A;  2AAO A;  1AK8 A;  1JF2 A;  4MEW A;  1CNP A;  2MLE C;  4PE4 A;  2KBI A;  1FF1 A;  4YGB B;  5PAL A;  4YGA A;  1QV1 A;  3A8R A;  1S6C A;  1A2X A;  1GGZ A;  4PE0 A;  1LA3 A;  2GGM A;  4WRI A;  3CR2 A;  1QAS A;  4WQ3 A;  1TCF A;  2LVJ A;  3FIA A;  4MSP A;  3I5H B;  5D69 A;  2F3Y A;  3BUM B;  2M29 A;  5HLV A;  1B8R A;  1MUX A;  2AMI A;  1S5G Z;  2KNE A;  2D8N A;  2LLU A;  1QX2 A;  3KHE A;  3O78 A;  2ZND A;  4XJK A;  2BBM A;  3DVE A;  1QLK A;  1YUS A;  1XFZ O;  2KSP A;  5GQQ C;  1KSO A;  1SCM B;  3PM8 A;  5KTY A;  2NLN A;  4MN0 A;  1GJY A;  3JTD B;  1QLS A;  1SNL A;  5CSN A;  1F8H A;  1IQ3 A;  4GGF A;  1OMD A;  1F4O A;  5AEQ A;  1EG4 A;  1JFJ A;  2OTG C;  2RGI A;  2F8P A;  1LIN A;  2EHB A;  3TUY C;  1CLL A;  3CS1 A;  1DT7 B;  1C7W A;  1IJ5 A;  2MJW B;  3KF9 A;  1KCY A;  2OS8 C;  2LCP A;  5F6T A;  3PAT A;  2OTG B;  3GK1 A;  1XVJ A;  1KQV A;  3TUY B;  2LNK A;  1N2D A;  2OS8 B;  5AFP A;  1S6J A;  1B7T Z;  2KI6 D;  4IL1 A;  1NSH A;  2JNF A;  1RK9 A;  2GV5 A;  1CDP A;  4PHJ A;  2L5X B;  2LVK A;  3IQQ A;  3WHT B;  1AVS A;  2KFH A;  1LXF C;  1QIV A;  3CLN A;  4OR9 B;  4N1F A;  4GPL B;  2H2K A;  1QJT A;  4MZL A;  3SIB A;  1OSA A;  1Y6W A;  1XYD A;  3O4Y A;  2E6W A;  4HRH A;  1NIW A;  1WRL A;  1DGV A;  2IS9 A;  3OX5 A;  2MBX A;  5BPJ A;  1WLZ A;  2I94 A;  1ALW A;  3I5F C;  1K96 A;  1BT6 A;  2ZNE A;  4R1E A;  2LLS A;  4GFT A;  1A75 B;  3HCM A;  4PCW A;  5DKQ A;  2M1U A;  3DF0 B;  2I2R E;  2EGD A;  5I8N A;  2JZI A;  2Y1N A;  1M45 A;  5KU1 A;  1IRJ A;  4FQO A;  1BJF A;  1JUO A;  2FCD A;  1BG1 A;  1QVI Z;  1SMG A;  1B8C A;  1S36 A;  2NZ0 A;  1JWD A;  1JSA A;  1UWO A;  3FWB A;  2CT9 A;  3O2P A;  1ZOT B;  1TRF A;  2MAZ A;  1J1E A;  1QV0 A;  1ODB A;  3LLE A;  4P2Y B;  3VRN A;  2O60 A;  2NXQ A;  3PN7 C;  5HLO A;  1JFK A;  2I7A A;  1K9U A;  1SRA A;  3SG7 A;  3BXK A;  1BOD A;  2LP2 A;  3CR4 X;  1U5I B;  3FS7 A;  5I2O A;  3BUO B;  1CB1 A;  1YUR A;  4HRE E;  2PMY A;  1G4Y R;  3TS5 C;  1YUT A;  4DUQ A;  3SG5 A;  1DF0 A;  1K2H A;  4ETO A;  4M2Q A;  3WXA A;  1TNQ A;  2M7N A;  1PSB A;  3HX4 A;  4ZCU A;  1E8A A;  2KDH A;  2WND A;  3I5I C;  1A75 A;  3TZ1 A;  3EK4 A;  2BBN A;  1KFX S;  3DF0 A;  2NCP A;  3NXA A;  4AOM A;  1CLM A;  2JXC A;  1KK7 Y;  2PAL A;  4AQI A;  1MWN A;  2COL B;  1Y1A A;  4BY4 A;  1UHJ A;  3I5I B;  4GAO A;  1DTL A;  3EKH A;  4GGN A;  1DJX A;  1Q80 A;  1TCO B;  1DJI A;  4I5J A;  1H8B A;  2KBM A;  1WRZ A;  2BCX A;  4GGF C;  4L9M A;  3SJS A;  1AHR A;  2KQY A;  1PSR A;  3EKJ A;  2Y5I A;  3VRO A;  2M8U A;  3TDZ A;  1CDM A;  2H61 A;  1BR4 B;  1PVA A;  2M9G A;  2BCB A;  1B4C A;  3BUW B;  5HYD A;  1YVL A;  1DJG A;  1NCX A; 
#chains in the Genus database with same CATH topology
 1U5I A;  3ICB A;  3RLZ A;  1F70 A;  2K61 A;  1EXR A;  1UP5 A;  4U8D A;  2BE4 A;  3I5H C;  5B8I B;  2HQW A;  1IIO A;  1KFX L;  2PSR A;  3DXL A;  2GGZ A;  1XO5 A;  2LV7 A;  2F33 A;  2LMU A;  2KAX A;  1M39 A;  2M7L A;  1TNP A;  2SCP A;  2FJU B;  3S0A A;  1SKT A;  2CTN A;  2JOJ A;  3EVR A;  3S0D A;  1SCM C;  2JC2 A;  1EL4 A;  2QEV A;  1KQM C;  2M49 B;  3B6X A;  3PSR A;  2GTE A;  3JTD C;  2K7B A;  3OB1 B;  4N5X A;  1Y1U A;  4MRX A;  3WHU B;  2MRD A;  2NCO A;  3EVU A;  1OQP A;  2P6B B;  4NDC A;  4WQ2 A;  1GGW A;  5FYX A;  4AQJ A;  5TNC A;  2JRF A;  2ZFD A;  5JJG A;  1L2O B;  1KQM B;  3CZ0 A;  3OP0 A;  3Q8I A;  2OPO A;  1J1D A;  2FJY A;  4Q04 A;  1IKU A;  4CLN A;  4OZD A;  2AUC A;  1SR6 C;  1J7O A;  2M1K B;  1S5G Y;  1OOJ A;  3RZS A;  2HPS A;  4TNC A;  1N0Y A;  2Y4Q A;  1W9Z A;  1SR6 B;  2FOT A;  1PK0 D;  2PRU A;  1SYM A;  1QAT A;  1OMR A;  4C0L A;  2KHN A;  1NYA A;  3CZ2 A;  2KGB C;  3V2L A;  4PHN A;  1BMO A;  1R2U A;  3AAJ A;  3SG4 A;  4FQT A;  1OMV A;  1OZO A;  1PRW A;  4GUK A;  1DJY A;  1OOF A;  1TOP A;  2Q91 A;  1SPY A;  4ICB A;  1YTZ C;  1JBA A;  2LAP A;  2WCH A;  3D10 A;  1TWO A;  5ER4 X;  2WC6 A;  1Y1X A;  1IQ5 A;  1S26 D;  3F45 A;  4PAL A;  3LK1 A;  1WLM A;  2VRG A;  1QX5 B;  3EVV A;  4DS7 A;  4MBE A;  3BYA A;  2L0P A;  1MXL C;  1NX3 A;  1NX2 A;  1VRK A;  4YI9 A;  1FI5 A;  1J55 A;  1DF0 B;  2BCA A;  4MZK A;  3GK2 A;  1OZS A;  4YGD B;  1RRO A;  2LMT A;  4I5K A;  2JNX A;  1JF0 A;  4F0Z B;  2QPT A;  1B7T Y;  1IG5 A;  1LVC D;  2ZKM X;  2LLT A;  3FE8 A;  2LM5 A;  1MXE A;  2CXJ A;  1SBJ A;  1A4P A;  3IF7 A;  1CM1 A;  3LK0 A;  1H4B A;  3DZT A;  3L47 A;  1GM0 A;  2KAV A;  3R1O A;  4M2P A;  3VRR A;  5HL1 A;  3NSK A;  2KQ6 A;  5I2Q A;  1YR5 A;  3NSO A;  4YGC B;  1G8I A;  2KOT A;  3DVJ A;  5J3X A;  1ZMZ A;  1YX7 A;  1S1E A;  2WC8 A;  1K9P A;  4PHK A;  3IVT A;  4ORA B;  1FI6 A;  2BL0 C;  2H61 C;  3NSL A;  1BU3 A;  4QJ5 B;  1OOG A;  3ZWH A;  3S0F A;  1PUL A;  3C1V A;  2L4I A;  3AKB A;  2BL0 B;  1CFP A;  2JTZ A;  4CPV A;  4JWQ A;  1QVI Y;  2KAY A;  5CSF A;  2EC6 B;  1F55 A;  1OW4 A;  1YUU A;  2M3W A;  3PAL A;  1KWO C;  3CWG A;  3TDU A;  2JPO A;  4HRG A;  2KPH A;  3I5G C;  1D1O A;  3EK7 A;  2BNX A;  2G2B A;  2JUL A;  4OV2 A;  1KWO B;  2B1U A;  1XFX O;  3KEV A;  3I5G B;  2L50 A;  1CDN A;  2K7C A;  1SY9 A;  2V53 A;  3D76 A;  4HSZ A;  1MR8 A;  5HKY A;  1RTP 1;  3BFA A;  3JVT C;  5DIC A;  2WOR A;  1IGV A;  3OX6 A;  4F7F A;  2MHH A;  1BF5 A;  1KK8 B;  1UUR A;  3BFH A;  5KSZ A;  2K2F A;  4A4C A;  3CAB A;  1XFR A;  3AKA A;  3BJH A;  4MLW A;  2LVI A;  4MVF A;  3JVT B;  2LHL A;  1B1G A;  2LAN A;  1DMO A;  1NP8 A;  1SL8 A;  2LP3 A;  1UHK A;  3CZT X;  1RWY A;  4JQ0 D;  5AXI A;  2WCB A;  3DD4 A;  2ZRS A;  3DVM A;  1QXP A;  2JT8 A;  2P70 A;  3FWC A;  1FBV A;  4QJ3 B;  2E30 A;  3VB1 A;  3VRP A;  2LC5 A;  1R6P A;  1C07 A;  1RFJ A;  3CDN A;  2WCK A;  2L98 A;  2HET A;  1ZUZ A;  2F2P A;  3LL8 B;  1XFY O;  3R1P A;  4C0J A;  3A4U B;  1CMF A;  1IJ6 A;  4YRU A;  2A4J A;  2Y1M A;  1PAL A;  2CCM A;  3KPX A;  2K2A A;  1QIW A;  4FTG A;  1L2O C;  3BFB A;  1NCY A;  1SCV A;  4CID A;  2JPT A;  1DJZ A;  3SS3 A;  2PAS A;  2ZN9 A;  2KI6 C;  1B8L A;  2DOQ A;  4BY5 A;  3BUX B;  1F54 A;  3CTN A;  3D78 A;  4OKH A;  1W7I B;  1M46 A;  3CR5 X;  1KFU L;  4I5L B;  1FW4 A;  4PHM A;  4GBA A;  1ZFS A;  4DCK A;  2JU0 A;  1C3Z A;  1DJW A;  2PYQ A;  2PVB A;  1TTX A;  2LE9 B;  1SW8 A;  3GK4 X;  3FE6 A;  1J7Q A;  3KO0 A;  3SIA A;  3PLF B;  1AJ5 A;  3AAK A;  3O4X A;  2ZRT A;  2K0J A;  3DVK A;  1X02 A;  1M31 A;  4NDD A;  2JQ6 A;  1B47 A;  1Z4H A;  5FI2 A;  1IH0 A;  2MLF C;  1BOC A;  4M2O A;  1DEL A;  3TDI A;  1M63 B;  2BE6 A;  4P5O E;  1JC2 A;  1TNX A;  4PE1 A;  3S0E A;  1A29 A;  2JWW A;  1OOI X;  1YRT B;  1W7J B;  2R2I A;  3PJI A;  1LKJ A;  1WRK A;  1TIZ A;  1NX0 A;  2F3Z A;  3D0Y B;  3SG6 A;  4E68 A;  1EH2 A;  3RM1 A;  2JXL A;  1YRU B;  2MA2 A;  1K9K A;  1NX1 A;  3NHI A;  2HF5 A;  2QAC A;  4JPZ B;  1A03 A;  2ISD A;  4OVN F;  1CDL A;  3CGA A;  4A4B A;  2LVV A;  1K93 D;  2CNP A;  5CPV A;  1PVB A;  1CFF A;  1WY9 A;  1ALV A;  2BKH B;  5CSI A;  1K95 A;  2L2E A;  3M0W A;  5DKN A;  3EK8 A;  4ZCV A;  5ER5 A;  5I2L A;  1F71 A;  3BOW B;  4DRW A;  5JOL A;  2EC6 C;  4INW A;  2M0R A;  4I5N B;  4DIR A;  1NPQ A;  2SAS A;  2TN4 A;  1XFV O;  2CBL A;  1YX8 A;  2O5G A;  2KFG A;  2BAP A;  3NGV A;  3OHM B;  3K1E A;  3L4A A;  1CMG A;  1P28 A;  4NQG A;  3GOF A;  2L51 A;  3BQ3 A;  1G33 A;  1SK6 D;  1REC A;  1HQV A;  2FCE A;  1K8U A;  1QWV A;  2WCE A;  3SG2 A;  1C7V A;  1EG3 A;  1OE9 B;  3D75 A;  1J7P A;  3I5F B;  3SG3 A;  2F2O A;  5AAN A;  1V1F A;  1XFU O;  5IBW A;  3WNX B;  4N1G A;  1L7Z A;  3D0Y A;  1CTR A;  1S3P A;  1XK4 C;  2ZN8 A;  4PDZ A;  1SL9 A;  5FI7 A;  4MZJ A;  4YBH B;  2G9B A;  3OGN A;  5D7F A;  4YGE B;  1FPW A;  1IWQ A;  1DC1 A;  1KK8 C;  2K8M B;  5CSJ A;  1AP4 A;  2QEB A;  1EJ3 A;  1SL7 A;  4NDB A;  3QRX A;  1DGU A;  5G08 A;  1UHI A;  3LCP C;  5HKW A;  2HQ8 A;  5HKZ A;  4ORB B;  2L4H A;  4CFR A;  3O6B A;  1XFW O;  2M97 A;  4XYN A;  3ZNI A;  4C0K A;  4CFQ A;  1WDC C;  5K89 A;  1KK7 Z;  3IQO A;  3BOW A;  3VGO A;  1RJV A;  2ERB A;  2KGR A;  2LHI A;  3H4S E;  2LMV A;  3PN7 B;  2WCL A;  3OB2 B;  4IJ7 A;  2LUC A;  1UHH A;  1QTX A;  1Y0V H;  2KYF A;  2JT0 A;  1WDC B;  1T14 A;  1J7R A;  1NUB A;  1XA5 A;  3D73 A;  1CFD A;  4OCI A;  4USL A;  4ORC B;  3BUN B;  3PFV A;  3TS5 B;  1K90 D;  1MQ1 A;  1KFU S;  2KFF A;  1BLQ A;  3R1V A;  1UHN A;  2KYC A;  3MSE B;  4YI8 A;  1DVI A;  1QS7 A;  3S0B A;  1KSM A;  1ZAC A;  2K7O A;  2LUX A;  4GNK B;  3E3R A;  2WCJ A;  1CLB A;  2I18 A;  1TNW A;  2Q4U A;  1GQM A;  1MHO A;  1AJ4 A;  1NWD A;  2WCF A;  2BKI B;  4PE7 A;  1N65 A;  4XJK B;  4UPG A;  1CM4 A;  1V1G A;  2KI4 C;  1B9A A;  1LA0 A;  2YGU A;  5AER A;  1F4Q A;  2WOS A;  1BR1 B;  5DKR A;  2JTT A;  3NSI A;  4D1E A;  1K94 A;  4JKT A;  1QX7 A;  2BEC A;  4MRY A;  4QJ4 B;  1HT9 A;  1TN4 A;  1YVH A;  1XK4 A;  3N7H A;  2H8V A;  3K21 A;  1S6I A;  2KI4 B;  1MF8 B;  1DEK A;  3VRQ A;  1NCZ A;  1AUI B;  1CFC A;  1UUS A;  2JT3 A;  1DJH A;  2K7D A;  1CKK A;  4KYN A;  2AAO A;  1AK8 A;  1JF2 A;  4MEW A;  1CNP A;  2MLE C;  4PE4 A;  2KBI A;  1FF1 A;  4YGB B;  1DQE A;  5PAL A;  2PQL A;  3UO9 A;  4YGA A;  1QV1 A;  3A8R A;  1S6C A;  1A2X A;  1GGZ A;  4PE0 A;  1LA3 A;  2GGM A;  4WRI A;  3CR2 A;  1QAS A;  3SS4 A;  4WQ3 A;  1TCF A;  2LVJ A;  3FIA A;  4MSP A;  3I5H B;  3D74 A;  5D69 A;  3B7A A;  2F3Y A;  3BUM B;  2M29 A;  5HLV A;  1B8R A;  1MUX A;  2AMI A;  5D3O A;  4PT1 A;  1S5G Z;  1C3Y A;  2KNE A;  2D8N A;  2LLU A;  1QX2 A;  3KHE A;  3O78 A;  2ZND A;  2KLE A;  4XJK A;  2BBM A;  3DVE A;  1QLK A;  1YUS A;  1XFZ O;  2KSP A;  5GQQ C;  1KSO A;  1SCM B;  3PM8 A;  5KTY A;  2NLN A;  4MN0 A;  1GJY A;  1SSE B;  1QLS A;  3JTD B;  1SNL A;  5FI6 A;  5CSN A;  1F8H A;  1IQ3 A;  4GGF A;  1OMD A;  1F4O A;  5AEQ A;  1EG4 A;  1JFJ A;  2OTG C;  2RGI A;  2F8P A;  1LIN A;  2EHB A;  3TUY C;  3SS5 A;  1CLL A;  3CS1 A;  1DT7 B;  3R72 A;  1C7W A;  1IJ5 A;  2MJW B;  3KF9 A;  1KCY A;  2OS8 C;  2LCP A;  5F6T A;  3PAT A;  2OTG B;  1TUJ A;  3GK1 A;  1XVJ A;  1KQV A;  3TUY B;  2LNK A;  3FE9 A;  1N2D A;  2OS8 B;  5AFP A;  1S6J A;  1B7T Z;  2KI6 D;  4IL1 A;  5I94 A;  1NSH A;  2JNF A;  1RK9 A;  2GV5 A;  1CDP A;  4PHJ A;  2L5X B;  2LVK A;  3IQQ A;  3WHT B;  1AVS A;  2KFH A;  1LXF C;  2P71 A;  1QIV A;  2KLD A;  3CLN A;  4OR9 B;  3NHT A;  4GPL B;  2H2K A;  4N1F A;  1QJT A;  4MZL A;  3SIB A;  1OSA A;  1Y6W A;  1XYD A;  3O4Y A;  2E6W A;  4HRH A;  1NIW A;  1WRL A;  1DGV A;  2IS9 A;  3OX5 A;  2MBX A;  5BPJ A;  1WLZ A;  2I94 A;  1ALW A;  2QDI A;  3I5F C;  1K96 A;  4INX A;  5EL2 A;  1BT6 A;  3DYE A;  3PM2 A;  2ZNE A;  4R1E A;  2LLS A;  3OBV A;  4GFT A;  1A75 B;  3HCM A;  4PCW A;  5DKQ A;  3S0G A;  2M1U A;  3B86 A;  3DF0 B;  2I2R E;  2EGD A;  5I8N A;  2JZI A;  2Y1N A;  1M45 A;  5KU1 A;  1IRJ A;  2WC5 A;  4FQO A;  1BJF A;  1JUO A;  2FCD A;  1BG1 A;  1QVI Z;  1SMG A;  1B8C A;  1S36 A;  2NZ0 A;  1JWD A;  1ORG A;  1JSA A;  1UWO A;  3D77 A;  3FWB A;  2CT9 A;  3O2P A;  1ZOT B;  3EG5 B;  1TRF A;  2MAZ A;  1J1E A;  1OOH A;  1QV0 A;  3QME A;  1ODB A;  3LLE A;  4P2Y B;  3VRN A;  2O60 A;  2NXQ A;  3PN7 C;  5HLO A;  1JFK A;  2I7A A;  1K9U A;  1SRA A;  3DY9 A;  3SG7 A;  3BXK A;  1BOD A;  2LP2 A;  3CR4 X;  1U5I B;  3FS7 A;  3L4L A;  3BUO B;  5I2O A;  1YUR A;  4HRE E;  2QEO A;  1CB1 A;  1LS8 A;  2PMY A;  1G4Y R;  3TS5 C;  1YUT A;  4DUQ A;  3SG5 A;  1DF0 A;  3CYZ A;  1K2H A;  4ETO A;  4M2Q A;  3B88 A;  3WXA A;  1TNQ A;  2M7N A;  1PSB A;  3HX4 A;  4ZCU A;  1E8A A;  2KDH A;  2WND A;  3I5I C;  1A75 A;  2QEH A;  3TZ1 A;  3EK4 A;  2BBN A;  2WCM A;  1KFX S;  3DF0 A;  2NCP A;  3NXA A;  4AOM A;  1CLM A;  2JXC A;  1KK7 Y;  2PAL A;  4AQI A;  1MWN A;  1TUZ A;  2COL B;  1Y1A A;  4BY4 A;  1UHJ A;  3I5I B;  3B87 A;  4GAO A;  1DTL A;  3EKH A;  4GGN A;  1DJX A;  4JD9 A;  1Q80 A;  1TCO B;  1DJI A;  4I5J A;  1H8B A;  2KBM A;  1WRZ A;  2BCX A;  4GGF C;  4L9M A;  3SJS A;  1AHR A;  3UNW A;  2KQY A;  1PSR A;  3EKJ A;  3CZ1 A;  2L5Y A;  2Y5I A;  1Z2C B;  3VRO A;  2M8U A;  3TDZ A;  1CDM A;  2H61 A;  1BR4 B;  1PVA A;  2M9G A;  2BCB A;  1B4C A;  3BUW B;  5HYD A;  1YVL A;  2K60 A;  2L2C A;  1DJG A;  1NCX A; 
#chains in the Genus database with same CATH homology
 1U5I A;  3ICB A;  3RLZ A;  1F70 A;  2K61 A;  1EXR A;  1UP5 A;  4U8D A;  2BE4 A;  3I5H C;  5B8I B;  2HQW A;  1KFX L;  2PSR A;  2GGZ A;  1XO5 A;  2LV7 A;  2F33 A;  2LMU A;  2KAX A;  1M39 A;  2M7L A;  1TNP A;  2SCP A;  2FJU B;  1SKT A;  2CTN A;  2JOJ A;  3EVR A;  1SCM C;  2JC2 A;  1EL4 A;  1KQM C;  2M49 B;  3PSR A;  3JTD C;  2K7B A;  3OB1 B;  4N5X A;  1Y1U A;  4MRX A;  3WHU B;  2MRD A;  2NCO A;  3EVU A;  1OQP A;  2P6B B;  4NDC A;  4WQ2 A;  1GGW A;  5FYX A;  4AQJ A;  5TNC A;  2JRF A;  2ZFD A;  5JJG A;  1L2O B;  1KQM B;  3OP0 A;  2OPO A;  1J1D A;  1IKU A;  4Q04 A;  4CLN A;  2AUC A;  1SR6 C;  1J7O A;  2M1K B;  1S5G Y;  1OOJ A;  2HPS A;  4TNC A;  1N0Y A;  2Y4Q A;  1SR6 B;  2FOT A;  1PK0 D;  2PRU A;  1SYM A;  1QAT A;  1OMR A;  4C0L A;  2KHN A;  1NYA A;  2KGB C;  4PHN A;  1BMO A;  1R2U A;  3AAJ A;  3SG4 A;  1OMV A;  1OZO A;  1PRW A;  4GUK A;  1DJY A;  1TOP A;  2Q91 A;  1SPY A;  4ICB A;  1YTZ C;  1JBA A;  2LAP A;  3D10 A;  5ER4 X;  1Y1X A;  1IQ5 A;  1S26 D;  3F45 A;  4PAL A;  3LK1 A;  1WLM A;  2VRG A;  1QX5 B;  3EVV A;  4DS7 A;  4MBE A;  3BYA A;  2L0P A;  1MXL C;  1NX3 A;  1NX2 A;  1VRK A;  4YI9 A;  1FI5 A;  1J55 A;  1DF0 B;  2BCA A;  4MZK A;  3GK2 A;  1OZS A;  4YGD B;  1RRO A;  2LMT A;  4I5K A;  2JNX A;  1JF0 A;  4F0Z B;  2QPT A;  1B7T Y;  1IG5 A;  1LVC D;  2ZKM X;  2LLT A;  2LM5 A;  1MXE A;  2CXJ A;  1SBJ A;  1A4P A;  3IF7 A;  1CM1 A;  3LK0 A;  1H4B A;  2KAV A;  4M2P A;  3VRR A;  3NSK A;  2KQ6 A;  5I2Q A;  1YR5 A;  3NSO A;  4YGC B;  1G8I A;  2KOT A;  3DVJ A;  5J3X A;  1ZMZ A;  1YX7 A;  1S1E A;  2WC8 A;  1K9P A;  4PHK A;  4ORA B;  1FI6 A;  2BL0 C;  2H61 C;  3NSL A;  1BU3 A;  4QJ5 B;  3ZWH A;  1PUL A;  3C1V A;  2L4I A;  3AKB A;  2BL0 B;  1CFP A;  2JTZ A;  4CPV A;  4JWQ A;  1QVI Y;  2KAY A;  5CSF A;  2EC6 B;  1F55 A;  1YUU A;  2M3W A;  3PAL A;  1KWO C;  3CWG A;  3TDU A;  4HRG A;  3I5G C;  1D1O A;  3EK7 A;  2G2B A;  2JUL A;  4OV2 A;  1KWO B;  2B1U A;  1XFX O;  3KEV A;  3I5G B;  2L50 A;  1CDN A;  2K7C A;  1SY9 A;  2V53 A;  4HSZ A;  1MR8 A;  5HKY A;  1RTP 1;  3JVT C;  2WOR A;  1IGV A;  3OX6 A;  2MHH A;  1BF5 A;  1KK8 B;  1UUR A;  5KSZ A;  2K2F A;  4A4C A;  3AKA A;  4MLW A;  2LVI A;  4MVF A;  3JVT B;  2LHL A;  1B1G A;  2LAN A;  1DMO A;  1NP8 A;  1SL8 A;  2LP3 A;  1UHK A;  3CZT X;  1RWY A;  4JQ0 D;  5AXI A;  2WCB A;  3DD4 A;  2ZRS A;  3DVM A;  1QXP A;  2JT8 A;  3FWC A;  4QJ3 B;  1FBV A;  3VRP A;  2E30 A;  1C07 A;  2LC5 A;  1R6P A;  1RFJ A;  2L98 A;  2HET A;  1ZUZ A;  2F2P A;  3LL8 B;  1XFY O;  4C0J A;  3A4U B;  1CMF A;  1IJ6 A;  4YRU A;  2A4J A;  2Y1M A;  1PAL A;  2CCM A;  3KPX A;  2K2A A;  1QIW A;  4FTG A;  1L2O C;  1NCY A;  1SCV A;  4CID A;  2JPT A;  1DJZ A;  2PAS A;  2ZN9 A;  2KI6 C;  1B8L A;  2DOQ A;  4BY5 A;  3BUX B;  1F54 A;  3CTN A;  4OKH A;  1W7I B;  1M46 A;  3CR5 X;  1KFU L;  4I5L B;  1FW4 A;  4PHM A;  4GBA A;  1ZFS A;  4DCK A;  2JU0 A;  1DJW A;  2PVB A;  1TTX A;  2LE9 B;  1SW8 A;  3GK4 X;  1J7Q A;  3KO0 A;  3SIA A;  3PLF B;  1AJ5 A;  3AAK A;  2ZRT A;  2K0J A;  3DVK A;  1X02 A;  1M31 A;  4NDD A;  2JQ6 A;  1B47 A;  1IH0 A;  2MLF C;  1BOC A;  4M2O A;  3TDI A;  1M63 B;  2BE6 A;  4P5O E;  1JC2 A;  1TNX A;  4PE1 A;  1A29 A;  2JWW A;  1YRT B;  1W7J B;  2R2I A;  1LKJ A;  1WRK A;  1TIZ A;  1NX0 A;  2F3Z A;  3D0Y B;  3SG6 A;  4E68 A;  1EH2 A;  3RM1 A;  2JXL A;  1YRU B;  2MA2 A;  1K9K A;  1NX1 A;  4JPZ B;  2HF5 A;  2QAC A;  1A03 A;  2ISD A;  4OVN F;  1CDL A;  3CGA A;  4A4B A;  2LVV A;  1K93 D;  2CNP A;  5CPV A;  1PVB A;  1CFF A;  1WY9 A;  1ALV A;  2BKH B;  5CSI A;  1K95 A;  2L2E A;  3M0W A;  5DKN A;  3EK8 A;  4ZCV A;  5ER5 A;  5I2L A;  1F71 A;  3BOW B;  4DRW A;  5JOL A;  2EC6 C;  2M0R A;  4I5N B;  4DIR A;  1NPQ A;  2SAS A;  2TN4 A;  1XFV O;  2CBL A;  1YX8 A;  2O5G A;  2KFG A;  3OHM B;  1CMG A;  4NQG A;  3GOF A;  2L51 A;  3BQ3 A;  1G33 A;  1SK6 D;  1REC A;  1HQV A;  2FCE A;  1K8U A;  2WCE A;  3SG2 A;  1C7V A;  1J7P A;  1EG3 A;  1OE9 B;  3I5F B;  3SG3 A;  2F2O A;  5AAN A;  1V1F A;  1XFU O;  5IBW A;  3WNX B;  4N1G A;  1L7Z A;  3D0Y A;  1CTR A;  1S3P A;  1XK4 C;  2ZN8 A;  4PDZ A;  1SL9 A;  4MZJ A;  4YBH B;  2G9B A;  5D7F A;  4YGE B;  1FPW A;  1IWQ A;  1KK8 C;  2K8M B;  5CSJ A;  1AP4 A;  1EJ3 A;  1SL7 A;  4NDB A;  3QRX A;  1DGU A;  5G08 A;  1UHI A;  3LCP C;  5HKW A;  2HQ8 A;  5HKZ A;  4ORB B;  2L4H A;  4CFR A;  3O6B A;  1XFW O;  2M97 A;  4XYN A;  3ZNI A;  4C0K A;  4CFQ A;  1WDC C;  5K89 A;  1KK7 Z;  3IQO A;  3BOW A;  3VGO A;  1RJV A;  2KGR A;  2LHI A;  3H4S E;  2LMV A;  3PN7 B;  3OB2 B;  2LUC A;  1UHH A;  1QTX A;  1Y0V H;  2KYF A;  2JT0 A;  1WDC B;  1J7R A;  1NUB A;  1XA5 A;  4OCI A;  4USL A;  1CFD A;  1BLQ A;  4ORC B;  3BUN B;  3PFV A;  3TS5 B;  1K90 D;  1MQ1 A;  1KFU S;  2KFF A;  1UHN A;  2KYC A;  3MSE B;  4YI8 A;  1DVI A;  1QS7 A;  1KSM A;  1ZAC A;  2K7O A;  2LUX A;  4GNK B;  3E3R A;  1CLB A;  2I18 A;  1TNW A;  2Q4U A;  1GQM A;  1MHO A;  1AJ4 A;  1NWD A;  2WCF A;  2BKI B;  4PE7 A;  1N65 A;  4XJK B;  4UPG A;  1CM4 A;  1V1G A;  2KI4 C;  1B9A A;  1LA0 A;  5AER A;  1F4Q A;  2WOS A;  1BR1 B;  5DKR A;  2JTT A;  3NSI A;  4D1E A;  1K94 A;  1QX7 A;  2BEC A;  4MRY A;  4QJ4 B;  1HT9 A;  1TN4 A;  1YVH A;  1XK4 A;  3K21 A;  1S6I A;  2KI4 B;  1MF8 B;  3VRQ A;  1NCZ A;  1AUI B;  1CFC A;  1UUS A;  2JT3 A;  1DJH A;  2K7D A;  1CKK A;  2AAO A;  1AK8 A;  1JF2 A;  4MEW A;  1CNP A;  2MLE C;  4PE4 A;  2KBI A;  1FF1 A;  4YGB B;  5PAL A;  4YGA A;  1QV1 A;  3A8R A;  1S6C A;  1A2X A;  1GGZ A;  4PE0 A;  1LA3 A;  2GGM A;  4WRI A;  3CR2 A;  1QAS A;  4WQ3 A;  1TCF A;  2LVJ A;  3FIA A;  4MSP A;  3I5H B;  5D69 A;  2F3Y A;  3BUM B;  2M29 A;  5HLV A;  1B8R A;  1MUX A;  2AMI A;  1S5G Z;  2KNE A;  2D8N A;  2LLU A;  1QX2 A;  3KHE A;  3O78 A;  2ZND A;  4XJK A;  2BBM A;  3DVE A;  1QLK A;  1YUS A;  1XFZ O;  2KSP A;  5GQQ C;  1KSO A;  1SCM B;  3PM8 A;  5KTY A;  2NLN A;  4MN0 A;  1GJY A;  3JTD B;  1QLS A;  1SNL A;  5CSN A;  1F8H A;  1IQ3 A;  4GGF A;  1OMD A;  1F4O A;  5AEQ A;  1EG4 A;  1JFJ A;  2OTG C;  2RGI A;  2F8P A;  1LIN A;  2EHB A;  3TUY C;  1CLL A;  3CS1 A;  1DT7 B;  1C7W A;  1IJ5 A;  2MJW B;  3KF9 A;  1KCY A;  2OS8 C;  2LCP A;  5F6T A;  3PAT A;  2OTG B;  3GK1 A;  1XVJ A;  1KQV A;  3TUY B;  2LNK A;  1N2D A;  2OS8 B;  5AFP A;  1S6J A;  1B7T Z;  2KI6 D;  4IL1 A;  1NSH A;  2JNF A;  1RK9 A;  2GV5 A;  1CDP A;  4PHJ A;  2L5X B;  2LVK A;  3IQQ A;  3WHT B;  1AVS A;  2KFH A;  1LXF C;  1QIV A;  3CLN A;  4OR9 B;  4N1F A;  4GPL B;  2H2K A;  1QJT A;  4MZL A;  3SIB A;  1OSA A;  1Y6W A;  1XYD A;  3O4Y A;  2E6W A;  4HRH A;  1NIW A;  1WRL A;  1DGV A;  2IS9 A;  3OX5 A;  2MBX A;  5BPJ A;  1WLZ A;  2I94 A;  1ALW A;  3I5F C;  1K96 A;  1BT6 A;  2ZNE A;  4R1E A;  2LLS A;  4GFT A;  1A75 B;  3HCM A;  4PCW A;  5DKQ A;  2M1U A;  3DF0 B;  2I2R E;  2EGD A;  5I8N A;  2JZI A;  2Y1N A;  1M45 A;  5KU1 A;  1IRJ A;  4FQO A;  1BJF A;  1JUO A;  2FCD A;  1BG1 A;  1QVI Z;  1SMG A;  1B8C A;  1S36 A;  2NZ0 A;  1JWD A;  1JSA A;  1UWO A;  3FWB A;  2CT9 A;  3O2P A;  1ZOT B;  1TRF A;  2MAZ A;  1J1E A;  1QV0 A;  1ODB A;  3LLE A;  4P2Y B;  3VRN A;  2O60 A;  2NXQ A;  3PN7 C;  5HLO A;  1JFK A;  2I7A A;  1K9U A;  1SRA A;  3SG7 A;  3BXK A;  1BOD A;  2LP2 A;  3CR4 X;  1U5I B;  3FS7 A;  5I2O A;  3BUO B;  1CB1 A;  1YUR A;  4HRE E;  2PMY A;  1G4Y R;  3TS5 C;  1YUT A;  4DUQ A;  3SG5 A;  1DF0 A;  1K2H A;  4ETO A;  4M2Q A;  3WXA A;  1TNQ A;  2M7N A;  1PSB A;  3HX4 A;  4ZCU A;  1E8A A;  2KDH A;  2WND A;  3I5I C;  1A75 A;  3TZ1 A;  3EK4 A;  2BBN A;  1KFX S;  3DF0 A;  2NCP A;  3NXA A;  4AOM A;  1CLM A;  2JXC A;  1KK7 Y;  2PAL A;  4AQI A;  1MWN A;  2COL B;  1Y1A A;  4BY4 A;  1UHJ A;  3I5I B;  4GAO A;  1DTL A;  3EKH A;  4GGN A;  1DJX A;  1Q80 A;  1TCO B;  1DJI A;  4I5J A;  1H8B A;  2KBM A;  1WRZ A;  2BCX A;  4GGF C;  4L9M A;  3SJS A;  1AHR A;  2KQY A;  1PSR A;  3EKJ A;  2Y5I A;  3VRO A;  2M8U A;  3TDZ A;  1CDM A;  2H61 A;  1BR4 B;  1PVA A;  2M9G A;  2BCB A;  1B4C A;  3BUW B;  5HYD A;  1YVL A;  1DJG A;  1NCX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...