2LMUA

Androcam at high calcium
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
147
structure length
147
Chain Sequence
SELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQDLIAEAENNNNGQLNFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFISPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calmodulin-related protein 97A
publication title Structure of androcam supports specialized interactions with myosin VI.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Metal binding protein
total genus 40
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2011-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2lmuA01
1J7OA 2BKIB 1BLQA 1EG4A 2BCAA 2MHHA 1DJGA 1JC2A 2AUCA 3DVEA 3IQOA 1F8HA 4QJ4B 2JPTA 3VROA 1MXEA 2FCDA 1IRJA 5I2QA 2IS9A 2Y4QA 2LP3A 5AXIA 2PMYA 1B8RA 1TCOB 1FW4A 1MXLC 1WRLA 1CLBA 1DJYA 4PE4A 2BL0C 2KFGA 1DT7B 2Y1MA 4MZLA 1N0YA 2LM5A 2M29A 4ZCVA 5ER4X 2MLFC 3EVUA 1AJ4A 1KFUL 2OS8B 1PALA 1QTXA 1CLMA 2BCXA 2K7OA 4OV2A 2CTNA 2NCPA 1CDLA 4OCIA 1S6JA 3CZTX 2Q4UA 1GGWA 1Y6WA 1FBVA 5HYDA 1YTZC 4TNCA 3A8RA 5ER5A 2PSRA 2KAYA 2PVBA 3I5FB 4F0ZB 3BQ3A 3BUNB 1XFWO 1PVAA 4ORCB 1E8AA 5CSJA 3FWCA 2F2PA 1SCMC 4N1FA 1N65A 1LA0A 1QX5B 4M2OA 2COLB 1XFXO 2I2RE 2WCBA 4CLNA 3D0YB 2I94A 1NPQA 2LNKA 2ZRSA 4GUKA 4M2QA 4MSPA 4XJKB 3WHUB 1Q80A 1SK6D 2LANA 2WNDA 1QLKA 2EC6C 2BBNA 2LC5A 1DGVA 4L9MA 2PRUA 2H61C 2GV5A 2JT0A 1QIVA 1F71A 1TN4A 3SG3A 2M8UA 4U8DA 1SW8A 3RM1A 2G9BA 5HKWA 5JOLA 1V1FA 2NLNA 3I5HC 1QASA 2JT8A 1TIZA 2Y1NA 4HRHA 4QJ5B 1S5GY 2M1KB 3GOFA 1TOPA 2ZFDA 4JWQA 3EK7A 1F4QA 4DRWA 3TDIA 1VRKA 3EK8A 1J55A 2Y5IA 1EG3A 1OQPA 1KWOC 2ZKMX 1N2DA 4P2YB 4A4BA 3CGAA 1YUSA 2MJWB 1F54A 1K8UA 1EXRA 3BUOB 1BR4B 2LVIA 1NUBA 2KGRA 2LHIA 2LVKA 1TNWA 4JQ0D 4BY4A 2BL0B 1K2HA 3SJSA 1YX8A 3CR5X 3PSRA 2K2AA 3D10A 1A75A 1G4YR 2LP2A 1YR5A 1XK4C 2WC8A 2LE9B 1KQMC 2HQ8A 2L5XB 1K90D 1LINA 2JC2A 1B9AA 2LUCA 4WQ3A 2L2EA 1FI6A 1H4BA 2FJUB 1KK7Z 1XYDA 2JULA 2K0JA 1C7VA 1F70A 4N1GA 1SL8A 1JF0A 1MHOA 1CDNA 1FI5A 1GQMA 2L98A 1TCFA 1BMOA 3GK4X 5FYXA 2KSPA 1W7JB 2EGDA 1PRWA 3LL8B 1JFJA 1SCMB 1UHNA 4JPZB 5DKRA 1CM1A 2E30A 2BKHB 1BU3A 2MLEC 3AKBA 1SBJA 2F2OA 1NX2A 1L7ZA 5TNCA 3SIAA 1DF0A 3C1VA 2BE4A 5KTYA 2AAOA 1S1EA 2BBMA 4GGNA 1ALVA 3SG4A 1QXPA 4OR9B 2KGBC 1FF1A 1B4CA 1S26D 3DVMA 1SR6B 1M31A 2SASA 1YX7A 2JTZA 3CS1A 4ORBB 2CCMA 1BOCA 1IH0A 2CBLA 1CDMA 1HQVA 2F33A 2M7LA 5AERA 1NSHA 2TN4A 1K9PA 4AQJA 1NX0A 1KFXL 4Q04A 4NQGA 1UHJA 1ZFSA 2LMTA 3PALA 1XFZO 1NCYA 2NZ0A 2OTGC 2OPOA 1SPYA 1EL4A 1U5IB 2PASA 1NWDA 1QJTA 4GNKB 4MZKA 2M1UA 3K21A 2R2IA 1J7QA 3NSIA 2K7CA 2DOQA 3O2PA 4FQOA 4ICBA 1L2OB 2ZN8A 1CFDA 1ZOTB 1QATA 2O5GA 1G33A 2ZNDA 3KPXA 1SYMA 5PALA 5B8IB 1DVIA 1NCZA 5BPJA 1AJ5A 3H4SE 1CFPA 1ZMZA 4CFQA 3DD4A 1CLLA 4MN0A 2MA2A 2K8MB 3BOWB 3BUWB 3CR4X 3LLEA 2JXCA 2KBMA 2LMUA 3D0YA 1DMOA 4XJKA 1JWDA 3PN7C 2GGZA 3AAJA 3VRNA 3TUYB 1A29A 4YRUA 4HREE 2E6WA 1YVLA 1QVIY 1K9KA 3FWBA 3SG2A 4XYNA 2KNEA 4PCWA 1YVHA 3I5IB 1WY9A 1ZACA 3OX5A 1JF2A 4MVFA 1RFJA 4QJ3B 1Y0VH 3E3RA 1D1OA 3VRRA 5I8NA 1NCXA 1PULA 5J3XA 2JZIA 3NSKA 1B7TY 1S36A 3JTDC 1TNPA 1SKTA 1UUSA 1WLMA 1R2UA 5IBWA 1B47A 1AUIB 1KSMA 3AAKA 3PLFB 1IKUA 4PHJA 1WDCC 4WRIA 3IF7A 2JQ6A 1K93D 2JNXA 1OE9B 1UP5A 4MBEA 1R6PA 4NDDA 2KYCA 2JT3A 4MRXA 3OHMB 4D1EA 1QLSA 1IQ5A 1OMDA 1V1GA 2OTGB 2I7AA 1DJXA 3DF0B 2LLSA 5D69A 1TRFA 2O60A 1QV0A 2L51A 3QRXA 2F8PA 3AKAA 3O78A 1TNQA 1NX1A 1WRZA 1SL7A 4PE0A 1JBAA 5HKYA 1RJVA 2I18A 1Y1XA 2M97A 2G2BA 1K9UA 2KAXA 2LUXA 2FCEA 1CTRA 1QS7A 4DIRA 2HF5A 3EVVA 4I5NB 1Y1UA 3CLNA 1IWQA 4NDCA 4GAOA 5I2OA 2M7NA 4OKHA 1AK8A 2LAPA 1AP4A 1LKJA 2M9GA 4C0LA 1RK9A 5AEQA 1NP8A 2M0RA 1DJIA 1LXFC 2QACA 3TDUA 2L4IA 1GGZA 1B8LA 1XFVO 2M3WA 2ZN9A 1YURA 5CSIA 4MEWA 1NYAA 4YGCB 1IQ3A 3OX6A 2V53A 2Q91A 1RTP1 4AQIA 1UHHA 1KK7Y 3O6BA 2CXJA 2HPSA 5HLVA 2ISDA 3LK1A 2B1UA 3ZNIA 1YUTA 1TNXA 4MRYA 1OMRA 1B8CA 3I5FC 4IL1A 2A4JA 3ICBA 2GGMA 5K89A 2EC6B 3KF9A 3ZWHA 4GGFA 4M2PA 5G08A 4CPVA 1OZOA 3KO0A 2KFHA 4PHKA 1KCYA 1KFXS 1W7IB 1H8BA 3VRPA 1M63B 3EKJA 3OP0A 1BF5A 1PK0D 3I5GC 1CNPA 1QX2A 2HETA 2LMVA 3JTDB 1U5IA 1YRUB 4MLWA 2JU0A 5DKNA 2KQ6A 3VRQA 3I5HB 3PFVA 2FOTA 5F6TA 2LLUA 2BE6A 1WDCB 2ZRTA 1FPWA 2KQYA 1HT9A 2L0PA 1KWOB 2ZNEA 3SG6A 2KYFA 2K7BA 1UURA 3OB1B 1KFUS 1CFFA 2D8NA 1CKKA 1WRKA 5AANA 1C07A 2BCBA 3LK0A 2PALA 2JTTA 2AMIA 3BOWA 1J7RA 1DTLA 4GFTA 3FIAA 4DCKA 5KU1A 2M49B 4HRGA 1JSAA 1QX7A 1EH2A 4YGEB 1RWYA 1KK8C 2KBIA 2KAVA 2LVJA 3GK1A 1KQMB 4DUQA 2JRFA 1NIWA 5HKZA 4CIDA 4PHNA 3VGOA 1CMFA 2P6BB 3BUXB 2CNPA 2WOSA 3M0WA 3BYAA 2KI4C 2F3YA 2KDHA 1DGUA 4GBAA 1RECA 4FTGA 1BODA 3NXAA 4I5JA 1F55A 1KQVA 1ODBA 1S6IA 1SCVA 5CSFA 2LLTA 1A03A 2L4HA 3RLZA 3TDZA 1DJZA 1QVIZ 1K94A 1M46A 1SNLA 4DS7A 1YUUA 3SIBA 3TS5C 1WLZA 1M39A 1XA5A 2NCOA 3JVTC 3PM8A 5D7FA 2LHLA 1YRTB 3PATA 1SL9A 4YBHB 4CFRA 3OB2B 3BXKA 1K95A 1XVJA 1AHRA 1MR8A 3IQQA 4R1EA 3WXAA 2KI6D 3BUMB 1K96A 4MZJA 1XFUO 3NSLA 5AFPA 1CMGA 2KOTA 3WHTB 1PSBA 4YI8A 1OSAA 4I5KA 2RGIA 3SG5A 1CFCA 3CR2A 4NDBA 1IG5A 4ORAB 3I5GB 1B7TZ 3DF0A 1NX3A 2H2KA 1S5GZ 3HCMA 1XFYO 4GPLB 1SR6C 4WQ2A 3TZ1A 2HQWA 1XO5A 3EVRA 2SCPA 2VRGA 3O4YA 2KHNA 1DJWA 3KEVA 1IJ6A 3LCPC 4YI9A 3GK2A 2NXQA 4UPGA 1IGVA 2KFFA 3EK4A 2MAZA 2LCPA 1BR1B 4GGFC 5CPVA 3DVJA 2LVVA 2K2FA 2CT9A 2WCFA 1KSOA 1UHIA 4N5XA 1A2XA 2WORA 4AOMA 1TTXA 4PHMA 4C0JA 4BY5A 1PSRA 2WCEA 4OVNF 1SMGA 2KI6C 1G8IA 1J7PA 1C7WA 1KK8B 1S6CA 4YGDB 4PE1A 3EKHA 1L2OC 5GQQC 4A4CA 1JFKA 1UWOA 2L50A 4C0KA 1BG1A 1MF8B 2KI4B 4HSZA 2OS8C 2QPTA 3FS7A 5JJGA 3PN7B 4ETOA 1IJ5A 4USLA 5CSNA 1ALWA 4PALA 3CTNA 1MWNA 4YGBB 1CM4A 2LV7A 3MSEB 1OZSA 2JXLA 1EJ3A 1MQ1A 2H61A 3TS5B 1A75B 3CWGA 1ZUZA 1BJFA 3JVTB 3WNXB 1LA3A 5HLOA 1PVBA 2BECA 2MRDA 3TUYC 1MUXA 2K61A 1A4PA 3KHEA 1M45A 4I5LB 2F3ZA 1J1DA 1SY9A 4PDZA 3NSOA 1UHKA 1BT6A 3I5IC 4P5OE 1QV1A 1B1GA 1SRAA 2EHBA 1F4OA 1X02A 1QIWA 1JUOA 4ZCUA 2JNFA 2JWWA 4YGAA 1GJYA 2MBXA 4E68A 1LVCD 2JOJA 5KSZA 3HX4A 1J1EA 1RROA 5I2LA 1DJHA 1DF0B 2K7DA 1Y1AA 3SG7A 5DKQA 4PE7A 1OOJA 1CB1A 3DVKA 1CDPA 1AVSA 1OMVA 1S3PA 1XK4A 3A4UB 3F45A
chains in the Genus database with same CATH superfamily
1J7OA 2BKIB 1BLQA 1EG4A 1ORGA 2BCAA 2MHHA 1DJGA 1JC2A 2AUCA 3DVEA 3IQOA 1F8HA 3L47A 4QJ4B 2JPTA 3VROA 2JPOA 3OGNA 2WCJA 1MXEA 2FCDA 1IRJA 5I2QA 2IS9A 2Y4QA 2LP3A 5AXIA 2PMYA 1B8RA 1TCOB 1FW4A 1MXLC 1WRLA 1CLBA 1DJYA 4PE4A 2BL0C 2KFGA 1DT7B 2Y1MA 4MZLA 1N0YA 2LM5A 2M29A 4ZCVA 5ER4X 2MLFC 3EVUA 1AJ4A 1KFUL 3BFAA 2L5YA 2OS8B 1PALA 1QTXA 1CLMA 2BCXA 2K7OA 4OV2A 2CTNA 2NCPA 1CDLA 4OCIA 1S6JA 3B7AA 3CZTX 2Q4UA 3UNWA 1GGWA 1Y6WA 3D77A 1FBVA 5HYDA 1YTZC 4TNCA 3A8RA 5ER5A 2PSRA 5FI2A 2KAYA 2PVBA 3I5FB 4F0ZB 3BQ3A 3BUNB 1XFWO 1PVAA 4ORCB 4OZDA 1E8AA 5HL1A 3N7HA 5CSJA 3FWCA 2F2PA 1SCMC 4N1FA 1N65A 3S0FA 1LA0A 1QX5B 3D78A 4M2OA 2COLB 2QEHA 1XFXO 2I2RE 2WCBA 4CLNA 3D0YB 2I94A 1NPQA 2LNKA 2ZRSA 4GUKA 4M2QA 4MSPA 4XJKB 2YGUA 3D74A 3WHUB 1Q80A 1SK6D 2LANA 2WNDA 1QLKA 2EC6C 2BBNA 3B87A 2LC5A 3EG5B 1DGVA 3QMEA 4L9MA 2PRUA 3L4AA 2H61C 2GV5A 2JT0A 1QIVA 1F71A 1TN4A 3SG3A 2M8UA 4U8DA 4PT1A 1SW8A 3RM1A 2G9BA 5HKWA 5JOLA 1V1FA 2NLNA 3I5HC 1DEKA 1QASA 1TIZA 2JT8A 2Y1NA 3O4XA 1S5GY 4HRHA 4QJ5B 2M1KB 3GOFA 1TOPA 2ZFDA 4JWQA 3EK7A 1F4QA 4DRWA 2QEVA 3TDIA 1VRKA 3EK8A 1J55A 2Y5IA 1EG3A 1OQPA 2K60A 1KWOC 2ZKMX 1N2DA 4P2YB 2WCHA 3CGAA 1YUSA 2MJWB 4A4BA 4F7FA 1F54A 1TWOA 1K8UA 1EXRA 3BUOB 1BR4B 3S0DA 2LVIA 3CDNA 1NUBA 2KGRA 2LHIA 2LVKA 1TNWA 4JQ0D 1DQEA 4BY4A 2BL0B 1K2HA 3SJSA 1YX8A 3CR5X 2L2CA 3PSRA 2K2AA 3D10A 1A75A 1G4YR 1DC1A 2LP2A 1YR5A 1XK4C 2WC8A 2LE9B 1KQMC 2HQ8A 2L5XB 1K90D 1LINA 2JC2A 3D76A 1B9AA 2LUCA 4WQ3A 2L2EA 1FI6A 1H4BA 1Z2CB 2FJUB 1KK7Z 1TUZA 1XYDA 2JULA 2K0JA 1C7VA 1F70A 4N1GA 1SL8A 1JF0A 1MHOA 1CDNA 1FI5A 1GQMA 2L98A 1TCFA 1BMOA 3GK4X 5FYXA 2KSPA 1W7JB 2EGDA 1PRWA 3RZSA 3LL8B 1JFJA 3B6XA 3NGVA 1SCMB 1UHNA 5DICA 4JPZB 5DKRA 1CM1A 2E30A 2BKHB 1BU3A 2MLEC 3AKBA 1SBJA 2F2OA 1NX2A 1L7ZA 5TNCA 3SIAA 1DF0A 3C1VA 2BE4A 5KTYA 2AAOA 1S1EA 2BBMA 4GGNA 5FI7A 3S0EA 1ALVA 3SG4A 1QXPA 4OR9B 2KGBC 3CYZA 1FF1A 1B4CA 1S26D 3DVMA 1SR6B 3V2LA 1M31A 2SASA 1YX7A 2JTZA 3CS1A 3PM2A 2CCMA 3L4LA 4ORBB 1BOCA 1IH0A 2CBLA 1CDMA 1HQVA 2F33A 2M7LA 1Z4HA 5AERA 1NSHA 2KPHA 2TN4A 1K9PA 4AQJA 1NX0A 1KFXL 4Q04A 4NQGA 1UHJA 1ZFSA 2LMTA 3PALA 1XFZO 2P71A 1NCYA 2NZ0A 2OTGC 2OPOA 1SPYA 1EL4A 1U5IB 2PASA 1NWDA 1QJTA 4GNKB 4MZKA 2M1UA 3K21A 3B88A 2R2IA 1J7QA 3NSIA 2K7CA 2DOQA 3FE6A 3O2PA 4FQOA 4ICBA 1L2OB 2ZN8A 1CFDA 1ZOTB 1QATA 2O5GA 1G33A 2ZNDA 3D75A 3KPXA 1SYMA 5PALA 1LS8A 5B8IB 1DVIA 1NCZA 5BPJA 1AJ5A 3H4SE 1CFPA 1ZMZA 4CFQA 3DD4A 3BJHA 1C3ZA 1CLLA 4MN0A 2MA2A 2K8MB 3BOWB 3BUWB 3CR4X 3LLEA 2JXCA 2KBMA 2LMUA 3D0YA 1DMOA 4XJKA 3D73A 3R72A 1TUJA 3PN7C 2GGZA 3AAJA 3VRNA 1JWDA 3TUYB 1A29A 4YRUA 4HREE 2E6WA 1YVLA 1QVIY 1K9KA 3FWBA 3SG2A 4XYNA 2KNEA 4PCWA 1YVHA 3I5IB 1WY9A 1ZACA 3OX5A 1JF2A 4MVFA 1RFJA 4QJ3B 1Y0VH 3E3RA 5I94A 1IIOA 2PQLA 1D1OA 3S0AA 3VRRA 5I8NA 1NCXA 1PULA 5J3XA 2JZIA 3NSKA 1B7TY 1S36A 3JTDC 1TNPA 1SKTA 1UUSA 1WLMA 1R2UA 5IBWA 1B47A 1AUIB 1KSMA 3AAKA 3PLFB 1IKUA 4PHJA 1WDCC 4WRIA 3IF7A 2JQ6A 1K93D 2JNXA 1OE9B 1UP5A 4MBEA 1R6PA 4NDDA 2KYCA 2JT3A 4MRXA 3OHMB 3SS3A 4D1EA 1QLSA 1IQ5A 1OMDA 1OW4A 1V1GA 2BNXA 5EL2A 2OTGB 2I7AA 1DJXA 3DF0B 2LLSA 5D69A 3CZ0A 4FQTA 2H8VA 1TRFA 1SSEB 2O60A 1QV0A 2L51A 3QRXA 2F8PA 3AKAA 3O78A 3S0GA 1TNQA 1NX1A 1WRZA 1SL7A 4PE0A 3IVTA 1JBAA 5HKYA 1RJVA 2I18A 1Y1XA 2M97A 3NHIA 2G2BA 1K9UA 2KAXA 2LUXA 2FCEA 1CTRA 1QS7A 2WC5A 4DIRA 2GTEA 2HF5A 3EVVA 4I5NB 3BFBA 1Y1UA 3CLNA 1IWQA 4NDCA 4GAOA 5I2OA 3SS4A 2M7NA 4OKHA 3VB1A 1AK8A 2LAPA 1AP4A 1LKJA 2M9GA 4C0LA 1RK9A 5AEQA 1NP8A 2M0RA 1DJIA 1LXFC 2QACA 3TDUA 2L4IA 1GGZA 1B8LA 1XFVO 2M3WA 2ZN9A 1YURA 5CSIA 4MEWA 1NYAA 4YGCB 3UO9A 1IQ3A 3OX6A 4KYNA 2V53A 2Q91A 1RTP1 4AQIA 1UHHA 3OBVA 1KK7Y 3O6BA 2CXJA 2HPSA 5HLVA 2ISDA 3LK1A 2B1UA 3ZNIA 1YUTA 1TNXA 4MRYA 1OMRA 1B8CA 3I5FC 3NHTA 4IL1A 2A4JA 3ICBA 2GGMA 2WC6A 5K89A 2EC6B 3KF9A 3ZWHA 4GGFA 4M2PA 5G08A 4CPVA 1OZOA 3KO0A 2KFHA 4PHKA 1KCYA 1KFXS 1W7IB 4IJ7A 3VRPA 1M63B 3EKJA 3OP0A 1H8BA 1BF5A 1PK0D 3I5GC 1C3YA 1QX2A 1CNPA 2HETA 2LMVA 3JTDB 1U5IA 1YRUB 4MLWA 2JU0A 5DKNA 1P28A 2KQ6A 3VRQA 1GM0A 3I5HB 3PFVA 2PYQA 2FOTA 5F6TA 2LLUA 3SS5A 2BE6A 1WDCB 2ZRTA 1FPWA 2KQYA 1HT9A 2L0PA 1KWOB 2ZNEA 3SG6A 2KYFA 2K7BA 1OOGA 1UURA 3OB1B 1KFUS 1CFFA 2D8NA 1CKKA 1WRKA 1OOIX 5AANA 2WCMA 1C07A 2BCBA 3LK0A 2PALA 2JTTA 2AMIA 3BOWA 1J7RA 1DTLA 4GFTA 3FIAA 4DCKA 5KU1A 2M49B 4HRGA 1JSAA 1QX7A 1EH2A 4YGEB 1RWYA 1DELA 1KK8C 2KBIA 2KAVA 2LVJA 3GK1A 1KQMB 4DUQA 2JRFA 1NIWA 2QEOA 5HKZA 4PHNA 3VGOA 4CIDA 1CMFA 2P6BB 3BUXB 2CNPA 2WOSA 3M0WA 3BYAA 2KI4C 2F3YA 2KDHA 2P70A 1DGUA 3DZTA 4GBAA 1RECA 4FTGA 1BODA 3NXAA 4I5JA 1F55A 1KQVA 1ODBA 1S6IA 1SCVA 5CSFA 2LLTA 1A03A 2L4HA 3RLZA 3TDZA 4JD9A 1DJZA 1QVIZ 1K94A 1M46A 1SNLA 4DS7A 1YUUA 3SIBA 2KLDA 3TS5C 1WLZA 1M39A 1XA5A 2NCOA 2KLEA 3JVTC 3PM8A 5D7FA 2LHLA 1YRTB 3PATA 1SL9A 4YBHB 4CFRA 3OB2B 3BXKA 1K95A 1XVJA 1AHRA 1MR8A 3IQQA 4R1EA 3WXAA 2KI6D 3BUMB 2FJYA 1K96A 4MZJA 1XFUO 3NSLA 5AFPA 1CMGA 2KOTA 3WHTB 1PSBA 4YI8A 1OSAA 4I5KA 2RGIA 3SG5A 1CFCA 3CZ1A 3CR2A 4NDBA 5D3OA 1IG5A 1XFRA 4ORAB 3I5GB 3DYEA 1B7TZ 3DF0A 1NX3A 2H2KA 1S5GZ 3HCMA 1XFYO 4GPLB 1SR6C 4INWA 4WQ2A 3TZ1A 2HQWA 1XO5A 3EVRA 2SCPA 2VRGA 3R1OA 3O4YA 2KHNA 1DJWA 3KEVA 1IJ6A 3LCPC 4YI9A 3GK2A 2NXQA 4UPGA 1IGVA 2KFFA 3EK4A 2MAZA 2LCPA 1BR1B 4GGFC 5CPVA 3DVJA 1OOHA 2LVVA 3Q8IA 2K2FA 2WCLA 2CT9A 2WCFA 1KSOA 1UHIA 4N5XA 1A2XA 2WORA 3CZ2A 4AOMA 1TTXA 4PHMA 2BAPA 4BY5A 1PSRA 4C0JA 2WCEA 4OVNF 2QEBA 3K1EA 1SMGA 2KI6C 1G8IA 1OOFA 1J7PA 1C7WA 1KK8B 1S6CA 4YGDB 3S0BA 4PE1A 3EKHA 1L2OC 5GQQC 4A4CA 1JFKA 1UWOA 2L50A 4C0KA 1BG1A 3DY9A 1MF8B 2KI4B 4HSZA 2OS8C 2QPTA 3FS7A 3R1VA 5FI6A 5JJGA 3DXLA 3PN7B 4ETOA 1IJ5A 4USLA 5CSNA 1W9ZA 1ALWA 4PALA 3FE9A 3CTNA 1MWNA 3CABA 4YGBB 1CM4A 2LV7A 3MSEB 1OZSA 2JXLA 1EJ3A 1MQ1A 2H61A 3TS5B 1A75B 3CWGA 1ZUZA 1BJFA 3JVTB 3WNXB 1LA3A 5HLOA 1PVBA 2BECA 2QDIA 1T14A 2MRDA 3TUYC 1MUXA 2K61A 1A4PA 3KHEA 1M45A 4I5LB 2F3ZA 1J1DA 1SY9A 3R1PA 4PDZA 3NSOA 1UHKA 2WCKA 3B86A 4INXA 1BT6A 3I5IC 4P5OE 1QV1A 1B1GA 1SRAA 2EHBA 1F4OA 1X02A 1QIWA 1JUOA 2ERBA 4ZCUA 2JNFA 2JWWA 4YGAA 1GJYA 2MBXA 4E68A 1LVCD 3PJIA 2JOJA 3BFHA 5KSZA 3FE8A 3HX4A 4JKTA 1J1EA 1RROA 5I2LA 1DJHA 1DF0B 2K7DA 1Y1AA 3SG7A 5DKQA 4PE7A 1OOJA 1CB1A 1QWVA 1CDPA 1AVSA 1OMVA 1S3PA 3DVKA 1XK4A 3A4UB 3F45A
chains in the Genus database with same CATH topology
1J7OA 2BKIB 1BLQA 1EG4A 2BCAA 2MHHA 1DJGA 1JC2A 2AUCA 3DVEA 3IQOA 1F8HA 4QJ4B 2JPTA 3VROA 1MXEA 2FCDA 1IRJA 5I2QA 2IS9A 2Y4QA 2LP3A 5AXIA 2PMYA 1B8RA 1TCOB 1FW4A 1MXLC 1WRLA 1CLBA 1DJYA 4PE4A 2BL0C 2KFGA 1DT7B 2Y1MA 4MZLA 1N0YA 2LM5A 2M29A 4ZCVA 5ER4X 2MLFC 3EVUA 1AJ4A 1KFUL 2OS8B 1PALA 1QTXA 1CLMA 2BCXA 2K7OA 4OV2A 2CTNA 2NCPA 1CDLA 4OCIA 1S6JA 3CZTX 2Q4UA 1GGWA 1Y6WA 1FBVA 5HYDA 1YTZC 4TNCA 3A8RA 5ER5A 2PSRA 2KAYA 2PVBA 3I5FB 4F0ZB 3BQ3A 3BUNB 1XFWO 1PVAA 4ORCB 1E8AA 5CSJA 3FWCA 2F2PA 1SCMC 4N1FA 1N65A 1LA0A 1QX5B 4M2OA 2COLB 1XFXO 2I2RE 2WCBA 4CLNA 3D0YB 2I94A 1NPQA 2LNKA 2ZRSA 4GUKA 4M2QA 4MSPA 4XJKB 3WHUB 1Q80A 1SK6D 2LANA 2WNDA 1QLKA 2EC6C 2BBNA 2LC5A 1DGVA 4L9MA 2PRUA 2H61C 2GV5A 2JT0A 1QIVA 1F71A 1TN4A 3SG3A 2M8UA 4U8DA 1SW8A 3RM1A 2G9BA 5HKWA 5JOLA 1V1FA 2NLNA 3I5HC 1QASA 2JT8A 1TIZA 2Y1NA 4HRHA 4QJ5B 1S5GY 2M1KB 3GOFA 1TOPA 2ZFDA 4JWQA 3EK7A 1F4QA 4DRWA 3TDIA 1VRKA 3EK8A 1J55A 2Y5IA 1EG3A 1OQPA 1KWOC 2ZKMX 1N2DA 4P2YB 4A4BA 3CGAA 1YUSA 2MJWB 1F54A 1K8UA 1EXRA 3BUOB 1BR4B 2LVIA 1NUBA 2KGRA 2LHIA 2LVKA 1TNWA 4JQ0D 4BY4A 2BL0B 1K2HA 3SJSA 1YX8A 3CR5X 3PSRA 2K2AA 3D10A 1A75A 1G4YR 2LP2A 1YR5A 1XK4C 2WC8A 2LE9B 1KQMC 2HQ8A 2L5XB 1K90D 1LINA 2JC2A 1B9AA 2LUCA 4WQ3A 2L2EA 1FI6A 1H4BA 2FJUB 1KK7Z 1XYDA 2JULA 2K0JA 1C7VA 1F70A 4N1GA 1SL8A 1JF0A 1MHOA 1CDNA 1FI5A 1GQMA 2L98A 1TCFA 1BMOA 3GK4X 5FYXA 2KSPA 1W7JB 2EGDA 1PRWA 3LL8B 1JFJA 1SCMB 1UHNA 4JPZB 5DKRA 1CM1A 2E30A 2BKHB 1BU3A 2MLEC 3AKBA 1SBJA 2F2OA 1NX2A 1L7ZA 5TNCA 3SIAA 1DF0A 3C1VA 2BE4A 5KTYA 2AAOA 1S1EA 2BBMA 4GGNA 1ALVA 3SG4A 1QXPA 4OR9B 2KGBC 1FF1A 1B4CA 1S26D 3DVMA 1SR6B 1M31A 2SASA 1YX7A 2JTZA 3CS1A 4ORBB 2CCMA 1BOCA 1IH0A 2CBLA 1CDMA 1HQVA 2F33A 2M7LA 5AERA 1NSHA 2TN4A 1K9PA 4AQJA 1NX0A 1KFXL 4Q04A 4NQGA 1UHJA 1ZFSA 2LMTA 3PALA 1XFZO 1NCYA 2NZ0A 2OTGC 2OPOA 1SPYA 1EL4A 1U5IB 2PASA 1NWDA 1QJTA 4GNKB 4MZKA 2M1UA 3K21A 2R2IA 1J7QA 3NSIA 2K7CA 2DOQA 3O2PA 4FQOA 4ICBA 1L2OB 2ZN8A 1CFDA 1ZOTB 1QATA 2O5GA 1G33A 2ZNDA 3KPXA 1SYMA 5PALA 5B8IB 1DVIA 1NCZA 5BPJA 1AJ5A 3H4SE 1CFPA 1ZMZA 4CFQA 3DD4A 1CLLA 4MN0A 2MA2A 2K8MB 3BOWB 3BUWB 3CR4X 3LLEA 2JXCA 2KBMA 2LMUA 3D0YA 1DMOA 4XJKA 1JWDA 3PN7C 2GGZA 3AAJA 3VRNA 3TUYB 1A29A 4YRUA 4HREE 2E6WA 1YVLA 1QVIY 1K9KA 3FWBA 3SG2A 4XYNA 2KNEA 4PCWA 1YVHA 3I5IB 1WY9A 1ZACA 3OX5A 1JF2A 4MVFA 1RFJA 4QJ3B 1Y0VH 3E3RA 1D1OA 3VRRA 5I8NA 1NCXA 1PULA 5J3XA 2JZIA 3NSKA 1B7TY 1S36A 3JTDC 1TNPA 1SKTA 1UUSA 1WLMA 1R2UA 5IBWA 1B47A 1AUIB 1KSMA 3AAKA 3PLFB 1IKUA 4PHJA 1WDCC 4WRIA 3IF7A 2JQ6A 1K93D 2JNXA 1OE9B 1UP5A 4MBEA 1R6PA 4NDDA 2KYCA 2JT3A 4MRXA 3OHMB 4D1EA 1QLSA 1IQ5A 1OMDA 1V1GA 2OTGB 2I7AA 1DJXA 3DF0B 2LLSA 5D69A 1TRFA 2O60A 1QV0A 2L51A 3QRXA 2F8PA 3AKAA 3O78A 1TNQA 1NX1A 1WRZA 1SL7A 4PE0A 1JBAA 5HKYA 1RJVA 2I18A 1Y1XA 2M97A 2G2BA 1K9UA 2KAXA 2LUXA 2FCEA 1CTRA 1QS7A 4DIRA 2HF5A 3EVVA 4I5NB 1Y1UA 3CLNA 1IWQA 4NDCA 4GAOA 5I2OA 2M7NA 4OKHA 1AK8A 2LAPA 1AP4A 1LKJA 2M9GA 4C0LA 1RK9A 5AEQA 1NP8A 2M0RA 1DJIA 1LXFC 2QACA 3TDUA 2L4IA 1GGZA 1B8LA 1XFVO 2M3WA 2ZN9A 1YURA 5CSIA 4MEWA 1NYAA 4YGCB 1IQ3A 3OX6A 2V53A 2Q91A 1RTP1 4AQIA 1UHHA 1KK7Y 3O6BA 2CXJA 2HPSA 5HLVA 2ISDA 3LK1A 2B1UA 3ZNIA 1YUTA 1TNXA 4MRYA 1OMRA 1B8CA 3I5FC 4IL1A 2A4JA 3ICBA 2GGMA 5K89A 2EC6B 3KF9A 3ZWHA 4GGFA 4M2PA 5G08A 4CPVA 1OZOA 3KO0A 2KFHA 4PHKA 1KCYA 1KFXS 1W7IB 1H8BA 3VRPA 1M63B 3EKJA 3OP0A 1BF5A 1PK0D 3I5GC 1CNPA 1QX2A 2HETA 2LMVA 3JTDB 1U5IA 1YRUB 4MLWA 2JU0A 5DKNA 2KQ6A 3VRQA 3I5HB 3PFVA 2FOTA 5F6TA 2LLUA 2BE6A 1WDCB 2ZRTA 1FPWA 2KQYA 1HT9A 2L0PA 1KWOB 2ZNEA 3SG6A 2KYFA 2K7BA 1UURA 3OB1B 1KFUS 1CFFA 2D8NA 1CKKA 1WRKA 5AANA 1C07A 2BCBA 3LK0A 2PALA 2JTTA 2AMIA 3BOWA 1J7RA 1DTLA 4GFTA 3FIAA 4DCKA 5KU1A 2M49B 4HRGA 1JSAA 1QX7A 1EH2A 4YGEB 1RWYA 1KK8C 2KBIA 2KAVA 2LVJA 3GK1A 1KQMB 4DUQA 2JRFA 1NIWA 5HKZA 4CIDA 4PHNA 3VGOA 1CMFA 2P6BB 3BUXB 2CNPA 2WOSA 3M0WA 3BYAA 2KI4C 2F3YA 2KDHA 1DGUA 4GBAA 1RECA 4FTGA 1BODA 3NXAA 4I5JA 1F55A 1KQVA 1ODBA 1S6IA 1SCVA 5CSFA 2LLTA 1A03A 2L4HA 3RLZA 3TDZA 1DJZA 1QVIZ 1K94A 1M46A 1SNLA 4DS7A 1YUUA 3SIBA 3TS5C 1WLZA 1M39A 1XA5A 2NCOA 3JVTC 3PM8A 5D7FA 2LHLA 1YRTB 3PATA 1SL9A 4YBHB 4CFRA 3OB2B 3BXKA 1K95A 1XVJA 1AHRA 1MR8A 3IQQA 4R1EA 3WXAA 2KI6D 3BUMB 1K96A 4MZJA 1XFUO 3NSLA 5AFPA 1CMGA 2KOTA 3WHTB 1PSBA 4YI8A 1OSAA 4I5KA 2RGIA 3SG5A 1CFCA 3CR2A 4NDBA 1IG5A 4ORAB 3I5GB 1B7TZ 3DF0A 1NX3A 2H2KA 1S5GZ 3HCMA 1XFYO 4GPLB 1SR6C 4WQ2A 3TZ1A 2HQWA 1XO5A 3EVRA 2SCPA 2VRGA 3O4YA 2KHNA 1DJWA 3KEVA 1IJ6A 3LCPC 4YI9A 3GK2A 2NXQA 4UPGA 1IGVA 2KFFA 3EK4A 2MAZA 2LCPA 1BR1B 4GGFC 5CPVA 3DVJA 2LVVA 2K2FA 2CT9A 2WCFA 1KSOA 1UHIA 4N5XA 1A2XA 2WORA 4AOMA 1TTXA 4PHMA 4C0JA 4BY5A 1PSRA 2WCEA 4OVNF 1SMGA 2KI6C 1G8IA 1J7PA 1C7WA 1KK8B 1S6CA 4YGDB 4PE1A 3EKHA 1L2OC 5GQQC 4A4CA 1JFKA 1UWOA 2L50A 4C0KA 1BG1A 1MF8B 2KI4B 4HSZA 2OS8C 2QPTA 3FS7A 5JJGA 3PN7B 4ETOA 1IJ5A 4USLA 5CSNA 1ALWA 4PALA 3CTNA 1MWNA 4YGBB 1CM4A 2LV7A 3MSEB 1OZSA 2JXLA 1EJ3A 1MQ1A 2H61A 3TS5B 1A75B 3CWGA 1ZUZA 1BJFA 3JVTB 3WNXB 1LA3A 5HLOA 1PVBA 2BECA 2MRDA 3TUYC 1MUXA 2K61A 1A4PA 3KHEA 1M45A 4I5LB 2F3ZA 1J1DA 1SY9A 4PDZA 3NSOA 1UHKA 1BT6A 3I5IC 4P5OE 1QV1A 1B1GA 1SRAA 2EHBA 1F4OA 1X02A 1QIWA 1JUOA 4ZCUA 2JNFA 2JWWA 4YGAA 1GJYA 2MBXA 4E68A 1LVCD 2JOJA 5KSZA 3HX4A 1J1EA 1RROA 5I2LA 1DJHA 1DF0B 2K7DA 1Y1AA 3SG7A 5DKQA 4PE7A 1OOJA 1CB1A 3DVKA 1CDPA 1AVSA 1OMVA 1S3PA 1XK4A 3A4UB 3F45A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J7O A;  2BKI B;  1BLQ A;  1EG4 A;  2BCA A;  2MHH A;  1DJG A;  1JC2 A;  2AUC A;  3DVE A;  3IQO A;  1F8H A;  4QJ4 B;  2JPT A;  3VRO A;  1MXE A;  2FCD A;  1IRJ A;  5I2Q A;  2IS9 A;  2Y4Q A;  2LP3 A;  5AXI A;  2PMY A;  1B8R A;  1TCO B;  1FW4 A;  1MXL C;  1WRL A;  1CLB A;  1DJY A;  4PE4 A;  2BL0 C;  2KFG A;  1DT7 B;  2Y1M A;  4MZL A;  1N0Y A;  2LM5 A;  2M29 A;  4ZCV A;  5ER4 X;  2MLF C;  3EVU A;  1AJ4 A;  1KFU L;  2OS8 B;  1PAL A;  1QTX A;  1CLM A;  2BCX A;  2K7O A;  4OV2 A;  2CTN A;  2NCP A;  1CDL A;  4OCI A;  1S6J A;  3CZT X;  2Q4U A;  1GGW A;  1Y6W A;  1FBV A;  5HYD A;  1YTZ C;  4TNC A;  3A8R A;  5ER5 A;  2PSR A;  2KAY A;  2PVB A;  3I5F B;  4F0Z B;  3BQ3 A;  3BUN B;  1XFW O;  1PVA A;  4ORC B;  1E8A A;  5CSJ A;  3FWC A;  2F2P A;  1SCM C;  4N1F A;  1N65 A;  1LA0 A;  1QX5 B;  4M2O A;  2COL B;  1XFX O;  2I2R E;  2WCB A;  4CLN A;  3D0Y B;  2I94 A;  1NPQ A;  2LNK A;  2ZRS A;  4GUK A;  4M2Q A;  4MSP A;  4XJK B;  3WHU B;  1Q80 A;  1SK6 D;  2LAN A;  2WND A;  1QLK A;  2EC6 C;  2BBN A;  2LC5 A;  1DGV A;  4L9M A;  2PRU A;  2H61 C;  2GV5 A;  2JT0 A;  1QIV A;  1F71 A;  1TN4 A;  3SG3 A;  2M8U A;  4U8D A;  1SW8 A;  3RM1 A;  2G9B A;  5HKW A;  5JOL A;  1V1F A;  2NLN A;  3I5H C;  1QAS A;  2JT8 A;  1TIZ A;  2Y1N A;  4HRH A;  4QJ5 B;  1S5G Y;  2M1K B;  3GOF A;  1TOP A;  2ZFD A;  4JWQ A;  3EK7 A;  1F4Q A;  4DRW A;  3TDI A;  1VRK A;  3EK8 A;  1J55 A;  2Y5I A;  1EG3 A;  1OQP A;  1KWO C;  2ZKM X;  1N2D A;  4P2Y B;  4A4B A;  3CGA A;  1YUS A;  2MJW B;  1F54 A;  1K8U A;  1EXR A;  3BUO B;  1BR4 B;  2LVI A;  1NUB A;  2KGR A;  2LHI A;  2LVK A;  1TNW A;  4JQ0 D;  4BY4 A;  2BL0 B;  1K2H A;  3SJS A;  1YX8 A;  3CR5 X;  3PSR A;  2K2A A;  3D10 A;  1A75 A;  1G4Y R;  2LP2 A;  1YR5 A;  1XK4 C;  2WC8 A;  2LE9 B;  1KQM C;  2HQ8 A;  2L5X B;  1K90 D;  1LIN A;  2JC2 A;  1B9A A;  2LUC A;  4WQ3 A;  2L2E A;  1FI6 A;  1H4B A;  2FJU B;  1KK7 Z;  1XYD A;  2JUL A;  2K0J A;  1C7V A;  1F70 A;  4N1G A;  1SL8 A;  1JF0 A;  1MHO A;  1CDN A;  1FI5 A;  1GQM A;  2L98 A;  1TCF A;  1BMO A;  3GK4 X;  5FYX A;  2KSP A;  1W7J B;  2EGD A;  1PRW A;  3LL8 B;  1JFJ A;  1SCM B;  1UHN A;  4JPZ B;  5DKR A;  1CM1 A;  2E30 A;  2BKH B;  1BU3 A;  2MLE C;  3AKB A;  1SBJ A;  2F2O A;  1NX2 A;  1L7Z A;  5TNC A;  3SIA A;  1DF0 A;  3C1V A;  2BE4 A;  5KTY A;  2AAO A;  1S1E A;  2BBM A;  4GGN A;  1ALV A;  3SG4 A;  1QXP A;  4OR9 B;  2KGB C;  1FF1 A;  1B4C A;  1S26 D;  3DVM A;  1SR6 B;  1M31 A;  2SAS A;  1YX7 A;  2JTZ A;  3CS1 A;  4ORB B;  2CCM A;  1BOC A;  1IH0 A;  2CBL A;  1CDM A;  1HQV A;  2F33 A;  2M7L A;  5AER A;  1NSH A;  2TN4 A;  1K9P A;  4AQJ A;  1NX0 A;  1KFX L;  4Q04 A;  4NQG A;  1UHJ A;  1ZFS A;  2LMT A;  3PAL A;  1XFZ O;  1NCY A;  2NZ0 A;  2OTG C;  2OPO A;  1SPY A;  1EL4 A;  1U5I B;  2PAS A;  1NWD A;  1QJT A;  4GNK B;  4MZK A;  2M1U A;  3K21 A;  2R2I A;  1J7Q A;  3NSI A;  2K7C A;  2DOQ A;  3O2P A;  4FQO A;  4ICB A;  1L2O B;  2ZN8 A;  1CFD A;  1ZOT B;  1QAT A;  2O5G A;  1G33 A;  2ZND A;  3KPX A;  1SYM A;  5PAL A;  5B8I B;  1DVI A;  1NCZ A;  5BPJ A;  1AJ5 A;  3H4S E;  1CFP A;  1ZMZ A;  4CFQ A;  3DD4 A;  1CLL A;  4MN0 A;  2MA2 A;  2K8M B;  3BOW B;  3BUW B;  3CR4 X;  3LLE A;  2JXC A;  2KBM A;  2LMU A;  3D0Y A;  1DMO A;  4XJK A;  1JWD A;  3PN7 C;  2GGZ A;  3AAJ A;  3VRN A;  3TUY B;  1A29 A;  4YRU A;  4HRE E;  2E6W A;  1YVL A;  1QVI Y;  1K9K A;  3FWB A;  3SG2 A;  4XYN A;  2KNE A;  4PCW A;  1YVH A;  3I5I B;  1WY9 A;  1ZAC A;  3OX5 A;  1JF2 A;  4MVF A;  1RFJ A;  4QJ3 B;  1Y0V H;  3E3R A;  1D1O A;  3VRR A;  5I8N A;  1NCX A;  1PUL A;  5J3X A;  2JZI A;  3NSK A;  1B7T Y;  1S36 A;  3JTD C;  1TNP A;  1SKT A;  1UUS A;  1WLM A;  1R2U A;  5IBW A;  1B47 A;  1AUI B;  1KSM A;  3AAK A;  3PLF B;  1IKU A;  4PHJ A;  1WDC C;  4WRI A;  3IF7 A;  2JQ6 A;  1K93 D;  2JNX A;  1OE9 B;  1UP5 A;  4MBE A;  1R6P A;  4NDD A;  2KYC A;  2JT3 A;  4MRX A;  3OHM B;  4D1E A;  1QLS A;  1IQ5 A;  1OMD A;  1V1G A;  2OTG B;  2I7A A;  1DJX A;  3DF0 B;  2LLS A;  5D69 A;  1TRF A;  2O60 A;  1QV0 A;  2L51 A;  3QRX A;  2F8P A;  3AKA A;  3O78 A;  1TNQ A;  1NX1 A;  1WRZ A;  1SL7 A;  4PE0 A;  1JBA A;  5HKY A;  1RJV A;  2I18 A;  1Y1X A;  2M97 A;  2G2B A;  1K9U A;  2KAX A;  2LUX A;  2FCE A;  1CTR A;  1QS7 A;  4DIR A;  2HF5 A;  3EVV A;  4I5N B;  1Y1U A;  3CLN A;  1IWQ A;  4NDC A;  4GAO A;  5I2O A;  2M7N A;  4OKH A;  1AK8 A;  2LAP A;  1AP4 A;  1LKJ A;  2M9G A;  4C0L A;  1RK9 A;  5AEQ A;  1NP8 A;  2M0R A;  1DJI A;  1LXF C;  2QAC A;  3TDU A;  2L4I A;  1GGZ A;  1B8L A;  1XFV O;  2M3W A;  2ZN9 A;  1YUR A;  5CSI A;  4MEW A;  1NYA A;  4YGC B;  1IQ3 A;  3OX6 A;  2V53 A;  2Q91 A;  1RTP 1;  4AQI A;  1UHH A;  1KK7 Y;  3O6B A;  2CXJ A;  2HPS A;  5HLV A;  2ISD A;  3LK1 A;  2B1U A;  3ZNI A;  1YUT A;  1TNX A;  4MRY A;  1OMR A;  1B8C A;  3I5F C;  4IL1 A;  2A4J A;  3ICB A;  2GGM A;  5K89 A;  2EC6 B;  3KF9 A;  3ZWH A;  4GGF A;  4M2P A;  5G08 A;  4CPV A;  1OZO A;  3KO0 A;  2KFH A;  4PHK A;  1KCY A;  1KFX S;  1W7I B;  1H8B A;  3VRP A;  1M63 B;  3EKJ A;  3OP0 A;  1BF5 A;  1PK0 D;  3I5G C;  1CNP A;  1QX2 A;  2HET A;  2LMV A;  3JTD B;  1U5I A;  1YRU B;  4MLW A;  2JU0 A;  5DKN A;  2KQ6 A;  3VRQ A;  3I5H B;  3PFV A;  2FOT A;  5F6T A;  2LLU A;  2BE6 A;  1WDC B;  2ZRT A;  1FPW A;  2KQY A;  1HT9 A;  2L0P A;  1KWO B;  2ZNE A;  3SG6 A;  2KYF A;  2K7B A;  1UUR A;  3OB1 B;  1KFU S;  1CFF A;  2D8N A;  1CKK A;  1WRK A;  5AAN A;  1C07 A;  2BCB A;  3LK0 A;  2PAL A;  2JTT A;  2AMI A;  3BOW A;  1J7R A;  1DTL A;  4GFT A;  3FIA A;  4DCK A;  5KU1 A;  2M49 B;  4HRG A;  1JSA A;  1QX7 A;  1EH2 A;  4YGE B;  1RWY A;  1KK8 C;  2KBI A;  2KAV A;  2LVJ A;  3GK1 A;  1KQM B;  4DUQ A;  2JRF A;  1NIW A;  5HKZ A;  4CID A;  4PHN A;  3VGO A;  1CMF A;  2P6B B;  3BUX B;  2CNP A;  2WOS A;  3M0W A;  3BYA A;  2KI4 C;  2F3Y A;  2KDH A;  1DGU A;  4GBA A;  1REC A;  4FTG A;  1BOD A;  3NXA A;  4I5J A;  1F55 A;  1KQV A;  1ODB A;  1S6I A;  1SCV A;  5CSF A;  2LLT A;  1A03 A;  2L4H A;  3RLZ A;  3TDZ A;  1DJZ A;  1QVI Z;  1K94 A;  1M46 A;  1SNL A;  4DS7 A;  1YUU A;  3SIB A;  3TS5 C;  1WLZ A;  1M39 A;  1XA5 A;  2NCO A;  3JVT C;  3PM8 A;  5D7F A;  2LHL A;  1YRT B;  3PAT A;  1SL9 A;  4YBH B;  4CFR A;  3OB2 B;  3BXK A;  1K95 A;  1XVJ A;  1AHR A;  1MR8 A;  3IQQ A;  4R1E A;  3WXA A;  2KI6 D;  3BUM B;  1K96 A;  4MZJ A;  1XFU O;  3NSL A;  5AFP A;  1CMG A;  2KOT A;  3WHT B;  1PSB A;  4YI8 A;  1OSA A;  4I5K A;  2RGI A;  3SG5 A;  1CFC A;  3CR2 A;  4NDB A;  1IG5 A;  4ORA B;  3I5G B;  1B7T Z;  3DF0 A;  1NX3 A;  2H2K A;  1S5G Z;  3HCM A;  1XFY O;  4GPL B;  1SR6 C;  4WQ2 A;  3TZ1 A;  2HQW A;  1XO5 A;  3EVR A;  2SCP A;  2VRG A;  3O4Y A;  2KHN A;  1DJW A;  3KEV A;  1IJ6 A;  3LCP C;  4YI9 A;  3GK2 A;  2NXQ A;  4UPG A;  1IGV A;  2KFF A;  3EK4 A;  2MAZ A;  2LCP A;  1BR1 B;  4GGF C;  5CPV A;  3DVJ A;  2LVV A;  2K2F A;  2CT9 A;  2WCF A;  1KSO A;  1UHI A;  4N5X A;  1A2X A;  2WOR A;  4AOM A;  1TTX A;  4PHM A;  4C0J A;  4BY5 A;  1PSR A;  2WCE A;  4OVN F;  1SMG A;  2KI6 C;  1G8I A;  1J7P A;  1C7W A;  1KK8 B;  1S6C A;  4YGD B;  4PE1 A;  3EKH A;  1L2O C;  5GQQ C;  4A4C A;  1JFK A;  1UWO A;  2L50 A;  4C0K A;  1BG1 A;  1MF8 B;  2KI4 B;  4HSZ A;  2OS8 C;  2QPT A;  3FS7 A;  5JJG A;  3PN7 B;  4ETO A;  1IJ5 A;  4USL A;  5CSN A;  1ALW A;  4PAL A;  3CTN A;  1MWN A;  4YGB B;  1CM4 A;  2LV7 A;  3MSE B;  1OZS A;  2JXL A;  1EJ3 A;  1MQ1 A;  2H61 A;  3TS5 B;  1A75 B;  3CWG A;  1ZUZ A;  1BJF A;  3JVT B;  3WNX B;  1LA3 A;  5HLO A;  1PVB A;  2BEC A;  2MRD A;  3TUY C;  1MUX A;  2K61 A;  1A4P A;  3KHE A;  1M45 A;  4I5L B;  2F3Z A;  1J1D A;  1SY9 A;  4PDZ A;  3NSO A;  1UHK A;  1BT6 A;  3I5I C;  4P5O E;  1QV1 A;  1B1G A;  1SRA A;  2EHB A;  1F4O A;  1X02 A;  1QIW A;  1JUO A;  4ZCU A;  2JNF A;  2JWW A;  4YGA A;  1GJY A;  2MBX A;  4E68 A;  1LVC D;  2JOJ A;  5KSZ A;  3HX4 A;  1J1E A;  1RRO A;  5I2L A;  1DJH A;  1DF0 B;  2K7D A;  1Y1A A;  3SG7 A;  5DKQ A;  4PE7 A;  1OOJ A;  1CB1 A;  3DVK A;  1CDP A;  1AVS A;  1OMV A;  1S3P A;  1XK4 A;  3A4U B;  3F45 A; 
#chains in the Genus database with same CATH topology
 1J7O A;  2BKI B;  1BLQ A;  1EG4 A;  1ORG A;  2BCA A;  2MHH A;  1DJG A;  1JC2 A;  2AUC A;  3DVE A;  3IQO A;  1F8H A;  3L47 A;  4QJ4 B;  2JPT A;  3VRO A;  2JPO A;  3OGN A;  2WCJ A;  1MXE A;  2FCD A;  1IRJ A;  5I2Q A;  2IS9 A;  2Y4Q A;  2LP3 A;  5AXI A;  2PMY A;  1B8R A;  1TCO B;  1FW4 A;  1MXL C;  1WRL A;  1CLB A;  1DJY A;  4PE4 A;  2BL0 C;  2KFG A;  1DT7 B;  2Y1M A;  4MZL A;  1N0Y A;  2LM5 A;  2M29 A;  4ZCV A;  5ER4 X;  2MLF C;  3EVU A;  1AJ4 A;  1KFU L;  3BFA A;  2L5Y A;  2OS8 B;  1PAL A;  1QTX A;  1CLM A;  2BCX A;  2K7O A;  4OV2 A;  2CTN A;  2NCP A;  1CDL A;  4OCI A;  1S6J A;  3B7A A;  3CZT X;  2Q4U A;  3UNW A;  1GGW A;  1Y6W A;  3D77 A;  1FBV A;  5HYD A;  1YTZ C;  4TNC A;  3A8R A;  5ER5 A;  2PSR A;  5FI2 A;  2KAY A;  2PVB A;  3I5F B;  4F0Z B;  3BQ3 A;  3BUN B;  1XFW O;  1PVA A;  4ORC B;  4OZD A;  1E8A A;  5HL1 A;  3N7H A;  5CSJ A;  3FWC A;  2F2P A;  1SCM C;  4N1F A;  1N65 A;  3S0F A;  1LA0 A;  1QX5 B;  3D78 A;  4M2O A;  2COL B;  2QEH A;  1XFX O;  2I2R E;  2WCB A;  4CLN A;  3D0Y B;  2I94 A;  1NPQ A;  2LNK A;  2ZRS A;  4GUK A;  4M2Q A;  4MSP A;  4XJK B;  2YGU A;  3D74 A;  3WHU B;  1Q80 A;  1SK6 D;  2LAN A;  2WND A;  1QLK A;  2EC6 C;  2BBN A;  3B87 A;  2LC5 A;  3EG5 B;  1DGV A;  3QME A;  4L9M A;  2PRU A;  3L4A A;  2H61 C;  2GV5 A;  2JT0 A;  1QIV A;  1F71 A;  1TN4 A;  3SG3 A;  2M8U A;  4U8D A;  4PT1 A;  1SW8 A;  3RM1 A;  2G9B A;  5HKW A;  5JOL A;  1V1F A;  2NLN A;  3I5H C;  1DEK A;  1QAS A;  1TIZ A;  2JT8 A;  2Y1N A;  3O4X A;  1S5G Y;  4HRH A;  4QJ5 B;  2M1K B;  3GOF A;  1TOP A;  2ZFD A;  4JWQ A;  3EK7 A;  1F4Q A;  4DRW A;  2QEV A;  3TDI A;  1VRK A;  3EK8 A;  1J55 A;  2Y5I A;  1EG3 A;  1OQP A;  2K60 A;  1KWO C;  2ZKM X;  1N2D A;  4P2Y B;  2WCH A;  3CGA A;  1YUS A;  2MJW B;  4A4B A;  4F7F A;  1F54 A;  1TWO A;  1K8U A;  1EXR A;  3BUO B;  1BR4 B;  3S0D A;  2LVI A;  3CDN A;  1NUB A;  2KGR A;  2LHI A;  2LVK A;  1TNW A;  4JQ0 D;  1DQE A;  4BY4 A;  2BL0 B;  1K2H A;  3SJS A;  1YX8 A;  3CR5 X;  2L2C A;  3PSR A;  2K2A A;  3D10 A;  1A75 A;  1G4Y R;  1DC1 A;  2LP2 A;  1YR5 A;  1XK4 C;  2WC8 A;  2LE9 B;  1KQM C;  2HQ8 A;  2L5X B;  1K90 D;  1LIN A;  2JC2 A;  3D76 A;  1B9A A;  2LUC A;  4WQ3 A;  2L2E A;  1FI6 A;  1H4B A;  1Z2C B;  2FJU B;  1KK7 Z;  1TUZ A;  1XYD A;  2JUL A;  2K0J A;  1C7V A;  1F70 A;  4N1G A;  1SL8 A;  1JF0 A;  1MHO A;  1CDN A;  1FI5 A;  1GQM A;  2L98 A;  1TCF A;  1BMO A;  3GK4 X;  5FYX A;  2KSP A;  1W7J B;  2EGD A;  1PRW A;  3RZS A;  3LL8 B;  1JFJ A;  3B6X A;  3NGV A;  1SCM B;  1UHN A;  5DIC A;  4JPZ B;  5DKR A;  1CM1 A;  2E30 A;  2BKH B;  1BU3 A;  2MLE C;  3AKB A;  1SBJ A;  2F2O A;  1NX2 A;  1L7Z A;  5TNC A;  3SIA A;  1DF0 A;  3C1V A;  2BE4 A;  5KTY A;  2AAO A;  1S1E A;  2BBM A;  4GGN A;  5FI7 A;  3S0E A;  1ALV A;  3SG4 A;  1QXP A;  4OR9 B;  2KGB C;  3CYZ A;  1FF1 A;  1B4C A;  1S26 D;  3DVM A;  1SR6 B;  3V2L A;  1M31 A;  2SAS A;  1YX7 A;  2JTZ A;  3CS1 A;  3PM2 A;  2CCM A;  3L4L A;  4ORB B;  1BOC A;  1IH0 A;  2CBL A;  1CDM A;  1HQV A;  2F33 A;  2M7L A;  1Z4H A;  5AER A;  1NSH A;  2KPH A;  2TN4 A;  1K9P A;  4AQJ A;  1NX0 A;  1KFX L;  4Q04 A;  4NQG A;  1UHJ A;  1ZFS A;  2LMT A;  3PAL A;  1XFZ O;  2P71 A;  1NCY A;  2NZ0 A;  2OTG C;  2OPO A;  1SPY A;  1EL4 A;  1U5I B;  2PAS A;  1NWD A;  1QJT A;  4GNK B;  4MZK A;  2M1U A;  3K21 A;  3B88 A;  2R2I A;  1J7Q A;  3NSI A;  2K7C A;  2DOQ A;  3FE6 A;  3O2P A;  4FQO A;  4ICB A;  1L2O B;  2ZN8 A;  1CFD A;  1ZOT B;  1QAT A;  2O5G A;  1G33 A;  2ZND A;  3D75 A;  3KPX A;  1SYM A;  5PAL A;  1LS8 A;  5B8I B;  1DVI A;  1NCZ A;  5BPJ A;  1AJ5 A;  3H4S E;  1CFP A;  1ZMZ A;  4CFQ A;  3DD4 A;  3BJH A;  1C3Z A;  1CLL A;  4MN0 A;  2MA2 A;  2K8M B;  3BOW B;  3BUW B;  3CR4 X;  3LLE A;  2JXC A;  2KBM A;  2LMU A;  3D0Y A;  1DMO A;  4XJK A;  3D73 A;  3R72 A;  1TUJ A;  3PN7 C;  2GGZ A;  3AAJ A;  3VRN A;  1JWD A;  3TUY B;  1A29 A;  4YRU A;  4HRE E;  2E6W A;  1YVL A;  1QVI Y;  1K9K A;  3FWB A;  3SG2 A;  4XYN A;  2KNE A;  4PCW A;  1YVH A;  3I5I B;  1WY9 A;  1ZAC A;  3OX5 A;  1JF2 A;  4MVF A;  1RFJ A;  4QJ3 B;  1Y0V H;  3E3R A;  5I94 A;  1IIO A;  2PQL A;  1D1O A;  3S0A A;  3VRR A;  5I8N A;  1NCX A;  1PUL A;  5J3X A;  2JZI A;  3NSK A;  1B7T Y;  1S36 A;  3JTD C;  1TNP A;  1SKT A;  1UUS A;  1WLM A;  1R2U A;  5IBW A;  1B47 A;  1AUI B;  1KSM A;  3AAK A;  3PLF B;  1IKU A;  4PHJ A;  1WDC C;  4WRI A;  3IF7 A;  2JQ6 A;  1K93 D;  2JNX A;  1OE9 B;  1UP5 A;  4MBE A;  1R6P A;  4NDD A;  2KYC A;  2JT3 A;  4MRX A;  3OHM B;  3SS3 A;  4D1E A;  1QLS A;  1IQ5 A;  1OMD A;  1OW4 A;  1V1G A;  2BNX A;  5EL2 A;  2OTG B;  2I7A A;  1DJX A;  3DF0 B;  2LLS A;  5D69 A;  3CZ0 A;  4FQT A;  2H8V A;  1TRF A;  1SSE B;  2O60 A;  1QV0 A;  2L51 A;  3QRX A;  2F8P A;  3AKA A;  3O78 A;  3S0G A;  1TNQ A;  1NX1 A;  1WRZ A;  1SL7 A;  4PE0 A;  3IVT A;  1JBA A;  5HKY A;  1RJV A;  2I18 A;  1Y1X A;  2M97 A;  3NHI A;  2G2B A;  1K9U A;  2KAX A;  2LUX A;  2FCE A;  1CTR A;  1QS7 A;  2WC5 A;  4DIR A;  2GTE A;  2HF5 A;  3EVV A;  4I5N B;  3BFB A;  1Y1U A;  3CLN A;  1IWQ A;  4NDC A;  4GAO A;  5I2O A;  3SS4 A;  2M7N A;  4OKH A;  3VB1 A;  1AK8 A;  2LAP A;  1AP4 A;  1LKJ A;  2M9G A;  4C0L A;  1RK9 A;  5AEQ A;  1NP8 A;  2M0R A;  1DJI A;  1LXF C;  2QAC A;  3TDU A;  2L4I A;  1GGZ A;  1B8L A;  1XFV O;  2M3W A;  2ZN9 A;  1YUR A;  5CSI A;  4MEW A;  1NYA A;  4YGC B;  3UO9 A;  1IQ3 A;  3OX6 A;  4KYN A;  2V53 A;  2Q91 A;  1RTP 1;  4AQI A;  1UHH A;  3OBV A;  1KK7 Y;  3O6B A;  2CXJ A;  2HPS A;  5HLV A;  2ISD A;  3LK1 A;  2B1U A;  3ZNI A;  1YUT A;  1TNX A;  4MRY A;  1OMR A;  1B8C A;  3I5F C;  3NHT A;  4IL1 A;  2A4J A;  3ICB A;  2GGM A;  2WC6 A;  5K89 A;  2EC6 B;  3KF9 A;  3ZWH A;  4GGF A;  4M2P A;  5G08 A;  4CPV A;  1OZO A;  3KO0 A;  2KFH A;  4PHK A;  1KCY A;  1KFX S;  1W7I B;  4IJ7 A;  3VRP A;  1M63 B;  3EKJ A;  3OP0 A;  1H8B A;  1BF5 A;  1PK0 D;  3I5G C;  1C3Y A;  1QX2 A;  1CNP A;  2HET A;  2LMV A;  3JTD B;  1U5I A;  1YRU B;  4MLW A;  2JU0 A;  5DKN A;  1P28 A;  2KQ6 A;  3VRQ A;  1GM0 A;  3I5H B;  3PFV A;  2PYQ A;  2FOT A;  5F6T A;  2LLU A;  3SS5 A;  2BE6 A;  1WDC B;  2ZRT A;  1FPW A;  2KQY A;  1HT9 A;  2L0P A;  1KWO B;  2ZNE A;  3SG6 A;  2KYF A;  2K7B A;  1OOG A;  1UUR A;  3OB1 B;  1KFU S;  1CFF A;  2D8N A;  1CKK A;  1WRK A;  1OOI X;  5AAN A;  2WCM A;  1C07 A;  2BCB A;  3LK0 A;  2PAL A;  2JTT A;  2AMI A;  3BOW A;  1J7R A;  1DTL A;  4GFT A;  3FIA A;  4DCK A;  5KU1 A;  2M49 B;  4HRG A;  1JSA A;  1QX7 A;  1EH2 A;  4YGE B;  1RWY A;  1DEL A;  1KK8 C;  2KBI A;  2KAV A;  2LVJ A;  3GK1 A;  1KQM B;  4DUQ A;  2JRF A;  1NIW A;  2QEO A;  5HKZ A;  4PHN A;  3VGO A;  4CID A;  1CMF A;  2P6B B;  3BUX B;  2CNP A;  2WOS A;  3M0W A;  3BYA A;  2KI4 C;  2F3Y A;  2KDH A;  2P70 A;  1DGU A;  3DZT A;  4GBA A;  1REC A;  4FTG A;  1BOD A;  3NXA A;  4I5J A;  1F55 A;  1KQV A;  1ODB A;  1S6I A;  1SCV A;  5CSF A;  2LLT A;  1A03 A;  2L4H A;  3RLZ A;  3TDZ A;  4JD9 A;  1DJZ A;  1QVI Z;  1K94 A;  1M46 A;  1SNL A;  4DS7 A;  1YUU A;  3SIB A;  2KLD A;  3TS5 C;  1WLZ A;  1M39 A;  1XA5 A;  2NCO A;  2KLE A;  3JVT C;  3PM8 A;  5D7F A;  2LHL A;  1YRT B;  3PAT A;  1SL9 A;  4YBH B;  4CFR A;  3OB2 B;  3BXK A;  1K95 A;  1XVJ A;  1AHR A;  1MR8 A;  3IQQ A;  4R1E A;  3WXA A;  2KI6 D;  3BUM B;  2FJY A;  1K96 A;  4MZJ A;  1XFU O;  3NSL A;  5AFP A;  1CMG A;  2KOT A;  3WHT B;  1PSB A;  4YI8 A;  1OSA A;  4I5K A;  2RGI A;  3SG5 A;  1CFC A;  3CZ1 A;  3CR2 A;  4NDB A;  5D3O A;  1IG5 A;  1XFR A;  4ORA B;  3I5G B;  3DYE A;  1B7T Z;  3DF0 A;  1NX3 A;  2H2K A;  1S5G Z;  3HCM A;  1XFY O;  4GPL B;  1SR6 C;  4INW A;  4WQ2 A;  3TZ1 A;  2HQW A;  1XO5 A;  3EVR A;  2SCP A;  2VRG A;  3R1O A;  3O4Y A;  2KHN A;  1DJW A;  3KEV A;  1IJ6 A;  3LCP C;  4YI9 A;  3GK2 A;  2NXQ A;  4UPG A;  1IGV A;  2KFF A;  3EK4 A;  2MAZ A;  2LCP A;  1BR1 B;  4GGF C;  5CPV A;  3DVJ A;  1OOH A;  2LVV A;  3Q8I A;  2K2F A;  2WCL A;  2CT9 A;  2WCF A;  1KSO A;  1UHI A;  4N5X A;  1A2X A;  2WOR A;  3CZ2 A;  4AOM A;  1TTX A;  4PHM A;  2BAP A;  4BY5 A;  1PSR A;  4C0J A;  2WCE A;  4OVN F;  2QEB A;  3K1E A;  1SMG A;  2KI6 C;  1G8I A;  1OOF A;  1J7P A;  1C7W A;  1KK8 B;  1S6C A;  4YGD B;  3S0B A;  4PE1 A;  3EKH A;  1L2O C;  5GQQ C;  4A4C A;  1JFK A;  1UWO A;  2L50 A;  4C0K A;  1BG1 A;  3DY9 A;  1MF8 B;  2KI4 B;  4HSZ A;  2OS8 C;  2QPT A;  3FS7 A;  3R1V A;  5FI6 A;  5JJG A;  3DXL A;  3PN7 B;  4ETO A;  1IJ5 A;  4USL A;  5CSN A;  1W9Z A;  1ALW A;  4PAL A;  3FE9 A;  3CTN A;  1MWN A;  3CAB A;  4YGB B;  1CM4 A;  2LV7 A;  3MSE B;  1OZS A;  2JXL A;  1EJ3 A;  1MQ1 A;  2H61 A;  3TS5 B;  1A75 B;  3CWG A;  1ZUZ A;  1BJF A;  3JVT B;  3WNX B;  1LA3 A;  5HLO A;  1PVB A;  2BEC A;  2QDI A;  1T14 A;  2MRD A;  3TUY C;  1MUX A;  2K61 A;  1A4P A;  3KHE A;  1M45 A;  4I5L B;  2F3Z A;  1J1D A;  1SY9 A;  3R1P A;  4PDZ A;  3NSO A;  1UHK A;  2WCK A;  3B86 A;  4INX A;  1BT6 A;  3I5I C;  4P5O E;  1QV1 A;  1B1G A;  1SRA A;  2EHB A;  1F4O A;  1X02 A;  1QIW A;  1JUO A;  2ERB A;  4ZCU A;  2JNF A;  2JWW A;  4YGA A;  1GJY A;  2MBX A;  4E68 A;  1LVC D;  3PJI A;  2JOJ A;  3BFH A;  5KSZ A;  3FE8 A;  3HX4 A;  4JKT A;  1J1E A;  1RRO A;  5I2L A;  1DJH A;  1DF0 B;  2K7D A;  1Y1A A;  3SG7 A;  5DKQ A;  4PE7 A;  1OOJ A;  1CB1 A;  1QWV A;  1CDP A;  1AVS A;  1OMV A;  1S3P A;  3DVK A;  1XK4 A;  3A4U B;  3F45 A; 
#chains in the Genus database with same CATH homology
 1J7O A;  2BKI B;  1BLQ A;  1EG4 A;  2BCA A;  2MHH A;  1DJG A;  1JC2 A;  2AUC A;  3DVE A;  3IQO A;  1F8H A;  4QJ4 B;  2JPT A;  3VRO A;  1MXE A;  2FCD A;  1IRJ A;  5I2Q A;  2IS9 A;  2Y4Q A;  2LP3 A;  5AXI A;  2PMY A;  1B8R A;  1TCO B;  1FW4 A;  1MXL C;  1WRL A;  1CLB A;  1DJY A;  4PE4 A;  2BL0 C;  2KFG A;  1DT7 B;  2Y1M A;  4MZL A;  1N0Y A;  2LM5 A;  2M29 A;  4ZCV A;  5ER4 X;  2MLF C;  3EVU A;  1AJ4 A;  1KFU L;  2OS8 B;  1PAL A;  1QTX A;  1CLM A;  2BCX A;  2K7O A;  4OV2 A;  2CTN A;  2NCP A;  1CDL A;  4OCI A;  1S6J A;  3CZT X;  2Q4U A;  1GGW A;  1Y6W A;  1FBV A;  5HYD A;  1YTZ C;  4TNC A;  3A8R A;  5ER5 A;  2PSR A;  2KAY A;  2PVB A;  3I5F B;  4F0Z B;  3BQ3 A;  3BUN B;  1XFW O;  1PVA A;  4ORC B;  1E8A A;  5CSJ A;  3FWC A;  2F2P A;  1SCM C;  4N1F A;  1N65 A;  1LA0 A;  1QX5 B;  4M2O A;  2COL B;  1XFX O;  2I2R E;  2WCB A;  4CLN A;  3D0Y B;  2I94 A;  1NPQ A;  2LNK A;  2ZRS A;  4GUK A;  4M2Q A;  4MSP A;  4XJK B;  3WHU B;  1Q80 A;  1SK6 D;  2LAN A;  2WND A;  1QLK A;  2EC6 C;  2BBN A;  2LC5 A;  1DGV A;  4L9M A;  2PRU A;  2H61 C;  2GV5 A;  2JT0 A;  1QIV A;  1F71 A;  1TN4 A;  3SG3 A;  2M8U A;  4U8D A;  1SW8 A;  3RM1 A;  2G9B A;  5HKW A;  5JOL A;  1V1F A;  2NLN A;  3I5H C;  1QAS A;  2JT8 A;  1TIZ A;  2Y1N A;  4HRH A;  4QJ5 B;  1S5G Y;  2M1K B;  3GOF A;  1TOP A;  2ZFD A;  4JWQ A;  3EK7 A;  1F4Q A;  4DRW A;  3TDI A;  1VRK A;  3EK8 A;  1J55 A;  2Y5I A;  1EG3 A;  1OQP A;  1KWO C;  2ZKM X;  1N2D A;  4P2Y B;  4A4B A;  3CGA A;  1YUS A;  2MJW B;  1F54 A;  1K8U A;  1EXR A;  3BUO B;  1BR4 B;  2LVI A;  1NUB A;  2KGR A;  2LHI A;  2LVK A;  1TNW A;  4JQ0 D;  4BY4 A;  2BL0 B;  1K2H A;  3SJS A;  1YX8 A;  3CR5 X;  3PSR A;  2K2A A;  3D10 A;  1A75 A;  1G4Y R;  2LP2 A;  1YR5 A;  1XK4 C;  2WC8 A;  2LE9 B;  1KQM C;  2HQ8 A;  2L5X B;  1K90 D;  1LIN A;  2JC2 A;  1B9A A;  2LUC A;  4WQ3 A;  2L2E A;  1FI6 A;  1H4B A;  2FJU B;  1KK7 Z;  1XYD A;  2JUL A;  2K0J A;  1C7V A;  1F70 A;  4N1G A;  1SL8 A;  1JF0 A;  1MHO A;  1CDN A;  1FI5 A;  1GQM A;  2L98 A;  1TCF A;  1BMO A;  3GK4 X;  5FYX A;  2KSP A;  1W7J B;  2EGD A;  1PRW A;  3LL8 B;  1JFJ A;  1SCM B;  1UHN A;  4JPZ B;  5DKR A;  1CM1 A;  2E30 A;  2BKH B;  1BU3 A;  2MLE C;  3AKB A;  1SBJ A;  2F2O A;  1NX2 A;  1L7Z A;  5TNC A;  3SIA A;  1DF0 A;  3C1V A;  2BE4 A;  5KTY A;  2AAO A;  1S1E A;  2BBM A;  4GGN A;  1ALV A;  3SG4 A;  1QXP A;  4OR9 B;  2KGB C;  1FF1 A;  1B4C A;  1S26 D;  3DVM A;  1SR6 B;  1M31 A;  2SAS A;  1YX7 A;  2JTZ A;  3CS1 A;  4ORB B;  2CCM A;  1BOC A;  1IH0 A;  2CBL A;  1CDM A;  1HQV A;  2F33 A;  2M7L A;  5AER A;  1NSH A;  2TN4 A;  1K9P A;  4AQJ A;  1NX0 A;  1KFX L;  4Q04 A;  4NQG A;  1UHJ A;  1ZFS A;  2LMT A;  3PAL A;  1XFZ O;  1NCY A;  2NZ0 A;  2OTG C;  2OPO A;  1SPY A;  1EL4 A;  1U5I B;  2PAS A;  1NWD A;  1QJT A;  4GNK B;  4MZK A;  2M1U A;  3K21 A;  2R2I A;  1J7Q A;  3NSI A;  2K7C A;  2DOQ A;  3O2P A;  4FQO A;  4ICB A;  1L2O B;  2ZN8 A;  1CFD A;  1ZOT B;  1QAT A;  2O5G A;  1G33 A;  2ZND A;  3KPX A;  1SYM A;  5PAL A;  5B8I B;  1DVI A;  1NCZ A;  5BPJ A;  1AJ5 A;  3H4S E;  1CFP A;  1ZMZ A;  4CFQ A;  3DD4 A;  1CLL A;  4MN0 A;  2MA2 A;  2K8M B;  3BOW B;  3BUW B;  3CR4 X;  3LLE A;  2JXC A;  2KBM A;  2LMU A;  3D0Y A;  1DMO A;  4XJK A;  1JWD A;  3PN7 C;  2GGZ A;  3AAJ A;  3VRN A;  3TUY B;  1A29 A;  4YRU A;  4HRE E;  2E6W A;  1YVL A;  1QVI Y;  1K9K A;  3FWB A;  3SG2 A;  4XYN A;  2KNE A;  4PCW A;  1YVH A;  3I5I B;  1WY9 A;  1ZAC A;  3OX5 A;  1JF2 A;  4MVF A;  1RFJ A;  4QJ3 B;  1Y0V H;  3E3R A;  1D1O A;  3VRR A;  5I8N A;  1NCX A;  1PUL A;  5J3X A;  2JZI A;  3NSK A;  1B7T Y;  1S36 A;  3JTD C;  1TNP A;  1SKT A;  1UUS A;  1WLM A;  1R2U A;  5IBW A;  1B47 A;  1AUI B;  1KSM A;  3AAK A;  3PLF B;  1IKU A;  4PHJ A;  1WDC C;  4WRI A;  3IF7 A;  2JQ6 A;  1K93 D;  2JNX A;  1OE9 B;  1UP5 A;  4MBE A;  1R6P A;  4NDD A;  2KYC A;  2JT3 A;  4MRX A;  3OHM B;  4D1E A;  1QLS A;  1IQ5 A;  1OMD A;  1V1G A;  2OTG B;  2I7A A;  1DJX A;  3DF0 B;  2LLS A;  5D69 A;  1TRF A;  2O60 A;  1QV0 A;  2L51 A;  3QRX A;  2F8P A;  3AKA A;  3O78 A;  1TNQ A;  1NX1 A;  1WRZ A;  1SL7 A;  4PE0 A;  1JBA A;  5HKY A;  1RJV A;  2I18 A;  1Y1X A;  2M97 A;  2G2B A;  1K9U A;  2KAX A;  2LUX A;  2FCE A;  1CTR A;  1QS7 A;  4DIR A;  2HF5 A;  3EVV A;  4I5N B;  1Y1U A;  3CLN A;  1IWQ A;  4NDC A;  4GAO A;  5I2O A;  2M7N A;  4OKH A;  1AK8 A;  2LAP A;  1AP4 A;  1LKJ A;  2M9G A;  4C0L A;  1RK9 A;  5AEQ A;  1NP8 A;  2M0R A;  1DJI A;  1LXF C;  2QAC A;  3TDU A;  2L4I A;  1GGZ A;  1B8L A;  1XFV O;  2M3W A;  2ZN9 A;  1YUR A;  5CSI A;  4MEW A;  1NYA A;  4YGC B;  1IQ3 A;  3OX6 A;  2V53 A;  2Q91 A;  1RTP 1;  4AQI A;  1UHH A;  1KK7 Y;  3O6B A;  2CXJ A;  2HPS A;  5HLV A;  2ISD A;  3LK1 A;  2B1U A;  3ZNI A;  1YUT A;  1TNX A;  4MRY A;  1OMR A;  1B8C A;  3I5F C;  4IL1 A;  2A4J A;  3ICB A;  2GGM A;  5K89 A;  2EC6 B;  3KF9 A;  3ZWH A;  4GGF A;  4M2P A;  5G08 A;  4CPV A;  1OZO A;  3KO0 A;  2KFH A;  4PHK A;  1KCY A;  1KFX S;  1W7I B;  1H8B A;  3VRP A;  1M63 B;  3EKJ A;  3OP0 A;  1BF5 A;  1PK0 D;  3I5G C;  1CNP A;  1QX2 A;  2HET A;  2LMV A;  3JTD B;  1U5I A;  1YRU B;  4MLW A;  2JU0 A;  5DKN A;  2KQ6 A;  3VRQ A;  3I5H B;  3PFV A;  2FOT A;  5F6T A;  2LLU A;  2BE6 A;  1WDC B;  2ZRT A;  1FPW A;  2KQY A;  1HT9 A;  2L0P A;  1KWO B;  2ZNE A;  3SG6 A;  2KYF A;  2K7B A;  1UUR A;  3OB1 B;  1KFU S;  1CFF A;  2D8N A;  1CKK A;  1WRK A;  5AAN A;  1C07 A;  2BCB A;  3LK0 A;  2PAL A;  2JTT A;  2AMI A;  3BOW A;  1J7R A;  1DTL A;  4GFT A;  3FIA A;  4DCK A;  5KU1 A;  2M49 B;  4HRG A;  1JSA A;  1QX7 A;  1EH2 A;  4YGE B;  1RWY A;  1KK8 C;  2KBI A;  2KAV A;  2LVJ A;  3GK1 A;  1KQM B;  4DUQ A;  2JRF A;  1NIW A;  5HKZ A;  4CID A;  4PHN A;  3VGO A;  1CMF A;  2P6B B;  3BUX B;  2CNP A;  2WOS A;  3M0W A;  3BYA A;  2KI4 C;  2F3Y A;  2KDH A;  1DGU A;  4GBA A;  1REC A;  4FTG A;  1BOD A;  3NXA A;  4I5J A;  1F55 A;  1KQV A;  1ODB A;  1S6I A;  1SCV A;  5CSF A;  2LLT A;  1A03 A;  2L4H A;  3RLZ A;  3TDZ A;  1DJZ A;  1QVI Z;  1K94 A;  1M46 A;  1SNL A;  4DS7 A;  1YUU A;  3SIB A;  3TS5 C;  1WLZ A;  1M39 A;  1XA5 A;  2NCO A;  3JVT C;  3PM8 A;  5D7F A;  2LHL A;  1YRT B;  3PAT A;  1SL9 A;  4YBH B;  4CFR A;  3OB2 B;  3BXK A;  1K95 A;  1XVJ A;  1AHR A;  1MR8 A;  3IQQ A;  4R1E A;  3WXA A;  2KI6 D;  3BUM B;  1K96 A;  4MZJ A;  1XFU O;  3NSL A;  5AFP A;  1CMG A;  2KOT A;  3WHT B;  1PSB A;  4YI8 A;  1OSA A;  4I5K A;  2RGI A;  3SG5 A;  1CFC A;  3CR2 A;  4NDB A;  1IG5 A;  4ORA B;  3I5G B;  1B7T Z;  3DF0 A;  1NX3 A;  2H2K A;  1S5G Z;  3HCM A;  1XFY O;  4GPL B;  1SR6 C;  4WQ2 A;  3TZ1 A;  2HQW A;  1XO5 A;  3EVR A;  2SCP A;  2VRG A;  3O4Y A;  2KHN A;  1DJW A;  3KEV A;  1IJ6 A;  3LCP C;  4YI9 A;  3GK2 A;  2NXQ A;  4UPG A;  1IGV A;  2KFF A;  3EK4 A;  2MAZ A;  2LCP A;  1BR1 B;  4GGF C;  5CPV A;  3DVJ A;  2LVV A;  2K2F A;  2CT9 A;  2WCF A;  1KSO A;  1UHI A;  4N5X A;  1A2X A;  2WOR A;  4AOM A;  1TTX A;  4PHM A;  4C0J A;  4BY5 A;  1PSR A;  2WCE A;  4OVN F;  1SMG A;  2KI6 C;  1G8I A;  1J7P A;  1C7W A;  1KK8 B;  1S6C A;  4YGD B;  4PE1 A;  3EKH A;  1L2O C;  5GQQ C;  4A4C A;  1JFK A;  1UWO A;  2L50 A;  4C0K A;  1BG1 A;  1MF8 B;  2KI4 B;  4HSZ A;  2OS8 C;  2QPT A;  3FS7 A;  5JJG A;  3PN7 B;  4ETO A;  1IJ5 A;  4USL A;  5CSN A;  1ALW A;  4PAL A;  3CTN A;  1MWN A;  4YGB B;  1CM4 A;  2LV7 A;  3MSE B;  1OZS A;  2JXL A;  1EJ3 A;  1MQ1 A;  2H61 A;  3TS5 B;  1A75 B;  3CWG A;  1ZUZ A;  1BJF A;  3JVT B;  3WNX B;  1LA3 A;  5HLO A;  1PVB A;  2BEC A;  2MRD A;  3TUY C;  1MUX A;  2K61 A;  1A4P A;  3KHE A;  1M45 A;  4I5L B;  2F3Z A;  1J1D A;  1SY9 A;  4PDZ A;  3NSO A;  1UHK A;  1BT6 A;  3I5I C;  4P5O E;  1QV1 A;  1B1G A;  1SRA A;  2EHB A;  1F4O A;  1X02 A;  1QIW A;  1JUO A;  4ZCU A;  2JNF A;  2JWW A;  4YGA A;  1GJY A;  2MBX A;  4E68 A;  1LVC D;  2JOJ A;  5KSZ A;  3HX4 A;  1J1E A;  1RRO A;  5I2L A;  1DJH A;  1DF0 B;  2K7D A;  1Y1A A;  3SG7 A;  5DKQ A;  4PE7 A;  1OOJ A;  1CB1 A;  3DVK A;  1CDP A;  1AVS A;  1OMV A;  1S3P A;  1XK4 A;  3A4U B;  3F45 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...