5ER5A

Crystal structure of calcium-loaded s100b bound to sc1990
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
90
structure length
90
Chain Sequence
MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-B
publication title Novel protein-inhibitor interactions in site 3 of Ca(2+)-bound S100B as discovered by X-ray crystallography.
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein/inhibitor
total genus 32
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2015-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5er5A00
2LANA 1SPYA 2OTGB 1F4OA 3CR5X 2MAZA 4DRWA 3BUOB 1RFJA 4OCIA 3EVVA 3CR2A 2COLB 2LMUA 5AFPA 3QRXA 4MZLA 1DJYA 3LCPC 1CLBA 1EG3A 1ODBA 2CXJA 5I2QA 1YR5A 3NSIA 1XFXO 2F2OA 4CIDA 2WORA 3SG2A 1C7VA 3CR4X 3TZ1A 3VRQA 1KK7Y 1XO5A 4F0ZB 2GGZA 3A8RA 2P6BB 3KO0A 1XFYO 1EXRA 1QASA 5HLOA 1OMDA 1CDLA 2KYFA 4AOMA 4DS7A 1IKUA 1FI5A 5AEQA 2Y1NA 1PSBA 2OS8C 2PASA 4PE4A 1GQMA 4MRXA 2M3WA 1B4CA 1DJGA 1UHKA 2SASA 1ZMZA 3H4SE 3I5GB 3TS5C 2M7NA 1Q80A 3SG6A 3FWBA 1W7JB 3GK1A 3SG5A 1Y1AA 3OB1B 1WLMA 1XA5A 2Q91A 1QV1A 2F3YA 5KTYA 2JC2A 4N1FA 1DJXA 1WDCB 2ZN9A 1QTXA 4OKHA 4YGEB 4CLNA 1XFVO 2ZN8A 1EL4A 2H61C 4C0KA 1Y0VH 3LL8B 1FBVA 5K89A 4GAOA 3I5HB 3NSOA 4YRUA 5KU1A 2I2RE 5AANA 2R2IA 4N1GA 4YGCB 1Y1UA 3BYAA 1NCYA 1AVSA 2M1KB 1CFDA 4YGDB 1K9PA 2F8PA 2JULA 3KF9A 1JFJA 2EC6B 4HREE 1XK4C 1S36A 2Y4QA 2I18A 4R1EA 2IS9A 4ZCUA 3DD4A 2MLEC 1OMVA 3KPXA 4JWQA 1YRTB 1G33A 3SIBA 3AAKA 4A4CA 2F2PA 2LHIA 2M0RA 3FS7A 4ORAB 1B8LA 5AERA 5HKYA 1ZFSA 4PHNA 1OMRA 1K94A 4MZJA 1YUSA 3BXKA 2KFHA 3HCMA 1K9UA 1K90D 1A2XA 2JU0A 2KQYA 2L4IA 4OVNF 3ZNIA 2O5GA 1YX8A 3TUYC 1J7OA 1KCYA 1IQ3A 4P2YB 2K8MB 2PSRA 2L98A 1LA3A 1EJ3A 2OS8B 3FIAA 3PALA 1Y6WA 1F54A 2LUXA 2JNFA 1KFXL 1FPWA 1UP5A 1NX0A 1UWOA 2JT8A 3TS5B 4UPGA 2H61A 3BUMB 1XYDA 1H4BA 4I5NB 5CSNA 5FYXA 1PULA 3D10A 1TTXA 1UHHA 1S6IA 1KK8C 4ICBA 1F8HA 2GGMA 1IH0A 2O60A 4NQGA 4I5KA 3PN7B 1U5IA 2BECA 2B1UA 1XK4A 1OQPA 1D1OA 2CTNA 1CKKA 5GQQC 2OPOA 1UHNA 3K21A 4L9MA 1KFUS 4MBEA 4MVFA 2LMTA 1JBAA 2JTTA 3VGOA 1ALWA 1NCZA 2DOQA 1CNPA 3PLFB 2WC8A 4CFRA 1NWDA 1R6PA 1MWNA 2ZRSA 3SIAA 1U5IB 2LNKA 2LVJA 3DVEA 1EH2A 1RJVA 4GGFC 3I5IC 4A4BA 1QLSA 5ER4X 2H2KA 1JWDA 1S3PA 1V1GA 4GNKB 1CLLA 2JZIA 2KFFA 2KBIA 2LUCA 1GGZA 2KGBC 3BOWA 5PALA 3IQQA 4DUQA 1R2UA 2MHHA 2AUCA 2KQ6A 2EHBA 2EGDA 2LC5A 4OR9B 4YGAA 3EK8A 1QJTA 2KI4C 3RLZA 1B8RA 3F45A 1S5GZ 1ZOTB 1AHRA 4P5OE 1YVHA 3DVKA 3O78A 2RGIA 2PRUA 1QX5B 2HQ8A 1EG4A 4WQ2A 2Q4UA 1B9AA 1QVIY 3TUYB 1M31A 2I7AA 1OSAA 1LXFC 3BOWB 2JQ6A 4HRGA 3IQOA 1F4QA 4QJ5B 1F71A 4Q04A 1WY9A 1DJIA 1ZUZA 3TDIA 4PE7A 4DCKA 2NCPA 1NP8A 1DJHA 1VRKA 2LV7A 2F3ZA 2K7OA 1CMGA 2BL0C 5CSFA 2MLFC 1YRUB 3CS1A 2KAXA 3SG7A 1KK8B 1YUUA 3PFVA 4QJ4B 1S5GY 2KNEA 1LKJA 4M2OA 2LVKA 1PALA 3E3RA 4AQJA 4HRHA 1UUSA 1MXEA 2KOTA 4OV2A 2V53A 3BQ3A 3O4YA 2BBNA 1DF0A 1WRZA 2E30A 1PSRA 2KHNA 1M45A 1BF5A 4GGFA 1TNQA 2KGRA 4JPZB 3NSLA 5JOLA 1A03A 1W7IB 2LHLA 1KSMA 2D8NA 1S6CA 4PALA 2L0PA 3GK4X 1C7WA 4BY4A 1BR1B 1WRLA 3CZTX 3JTDC 1FW4A 2L4HA 4U8DA 1KWOB 1TCFA 1UHIA 1SYMA 5CPVA 4ZCVA 1NX2A 1CFCA 4YI9A 5I2LA 1BG1A 2LLTA 1SR6C 3A4UB 1DF0B 1IRJA 1X02A 4M2QA 1BOCA 1CM4A 1XVJA 1TRFA 3I5IB 2JWWA 1CMFA 4YI8A 1A29A 1MQ1A 1JC2A 1L2OC 1DT7B 1JF2A 2K2AA 5TNCA 3EK7A 1K93D 4IL1A 3DVMA 3WHTB 2SCPA 1ALVA 5CSIA 1NPQA 1QV0A 1AUIB 2JXLA 1KQMC 1OOJA 2JXCA 1CLMA 4AQIA 3AKAA 2HETA 2MA2A 2KAVA 3O2PA 3OX6A 4PHJA 2BE4A 2ZRTA 2LVVA 3AAJA 4C0JA 1SW8A 1UURA 1SKTA 1TNXA 1N0YA 1OE9B 4CFQA 1CFFA 3RM1A 3C1VA 1G8IA 2I94A 2NLNA 2M97A 2FCDA 2BL0B 2K2FA 1SY9A 2MJWB 2CCMA 2WCFA 1J7RA 3D0YA 2FOTA 5J3XA 1SK6D 1N2DA 2KI6D 4GBAA 4GFTA 1MF8B 2MRDA 3EVUA 1KQVA 1SMGA 3OP0A 3AKBA 1S6JA 2K61A 3DF0A 2G2BA 1AP4A 2K7DA 1NSHA 1KFUL 4PHMA 1BMOA 2F33A 5DKNA 2FJUB 2BKIB 2KSPA 2PMYA 2BBMA 1QLKA 3M0WA 3D0YB 1BODA 2L2EA 3JTDB 1WRKA 1IJ6A 1QX2A 1OZOA 1TCOB 4MZKA 5BPJA 2LE9B 4MN0A 4ORCB 3CWGA 3OHMB 4MRYA 4FQOA 3VRNA 1FI6A 1QVIZ 2KAYA 3BUXB 4PHKA 1CTRA 3O6BA 1DGUA 1K9KA 3DF0B 3NXAA 1H8BA 1N65A 5HKZA 3EK4A 1L2OB 1J7QA 1NCXA 2HF5A 4XYNA 1GGWA 2A4JA 1RROA 1BU3A 2AMIA 1B1GA 1A4PA 1V1FA 3OX5A 2M7LA 2NXQA 2M8UA 1BJFA 3LK1A 3EKHA 5HYDA 1SCMC 1KQMB 2E6WA 1RK9A 2HQWA 1M39A 4CPVA 2L50A 1CFPA 1JF0A 1FF1A 4MSPA 1YTZC 2LP3A 5DKQA 1IWQA 1JUOA 1F55A 1L7ZA 2M1UA 1MR8A 2L5XB 3FWCA 4YBHB 2LLSA 1JFKA 2ZNDA 5KSZA 1OZSA 2GV5A 1CB1A 3I5FC 5CSJA 1ZACA 1XFWO 2M9GA 2JOJA 4NDDA 1CM1A 2KFGA 4WQ3A 1J1EA 4ORBB 2KBMA 1NX1A 2Y1MA 5B8IB 4E68A 3EKJA 1J55A 1AJ4A 2ISDA 2MBXA 1QXPA 2NZ0A 3KHEA 4HSZA 2WCEA 1QATA 1WLZA 3JVTC 1C07A 1K2HA 1QIVA 2BKHB 2ZKMX 1DMOA 1B7TZ 2JT3A 1B8CA 5ER5A 4JQ0D 1IQ5A 1IGVA 3SG4A 2LCPA 1LA0A 2KDHA 3WHUB 1A75A 1S26D 1DTLA 1J7PA 3ZWHA 3PN7C 4NDBA 2WCBA 1AJ5A 1CDPA 3MSEB 2JTZA 3TDUA 1PVBA 5I8NA 4TNCA 5D7FA 1QS7A 4QJ3B 3KEVA 3DVJA 1IG5A 1M46A 1SRAA 2PVBA 2BCBA 4USLA 3TDZA 3WXAA 4GPLB 3NSKA 3OB2B 2CNPA 2KI4B 1A75B 1KSOA 1HQVA 1LVCD 1B7TY 1MUXA 1NYAA 1S1EA 2WOSA 2JPTA 1PVAA 2JT0A 4PE1A 1SCVA 2BCXA 3CLNA 4GUKA 2WNDA 4XJKA 1SCMB 1AK8A 1LINA 5HKWA 4BY5A 2HPSA 1BR4B 1M63B 2JNXA 1NIWA 5DKRA 1PRWA 2K7CA 1F70A 5JJGA 2TN4A 2BE6A 2OTGC 3VROA 3CGAA 3EVRA 4I5JA 4WRIA 3GOFA 4YGBB 1Y1XA 2JRFA 1RECA 2AAOA 3BUNB 1K8UA 1UHJA 2LVIA 1K95A 1DVIA 5F6TA 1RTP1 3I5FB 4MLWA 1CDMA 2QPTA 1QX7A 1DJWA 4FTGA 4XJKB 2G9BA 2FCEA 3LLEA 1SNLA 4GGNA 2CBLA 3PSRA 4N5XA 1JSAA 1IJ5A 2K0JA 3PATA 4DIRA 1TN4A 3SG3A 2KYCA 3VRPA 3WNXB 1BLQA 1RWYA 5HLVA 4ETOA 1SL9A 1YURA 2KI6C 4I5LB 2ZFDA 4C0LA 2VRGA 3BUWB 1G4YR 3JVTB 2LAPA 1MXLC 1B47A 2LLUA 1GJYA 3IF7A 5I2OA 3I5GC 4M2PA 1CDNA 1KFXS 1K96A 2CT9A 5AXIA 3PM8A 4NDCA 1YX7A 1TNPA 1HT9A 2Y5IA 2PALA 1PK0D 1SR6B 3ICBA 1WDCC 1YUTA 3SJSA 2K7BA 1TOPA 2ZNEA 1SL8A 2NCOA 1J1DA 1SBJA 2L51A 1QIWA 1NUBA 2LM5A 2M49B 4PDZA 1TIZA 3I5HC 3HX4A 1DGVA 1BT6A 2QACA 4PE0A 3CTNA 1NX3A 1XFUO 2BCAA 1KK7Z 1SL7A 1XFZO 1E8AA 1KWOC 2LP2A 1YVLA 3VRRA 1DJZA 3LK0A 5IBWA 1MHOA 4MEWA 2M29A 3GK2A 2EC6C 2LMVA 5D69A 1TNWA 4D1EA 5G08A 4PCWA
chains in the Genus database with same CATH superfamily
2LANA 1SPYA 2OTGB 1F4OA 3CR5X 3PJIA 2MAZA 4DRWA 3BUOB 3S0BA 1RFJA 4OCIA 3EVVA 3CR2A 2COLB 2LMUA 5AFPA 3QRXA 4MZLA 1DJYA 3LCPC 1CLBA 1EG3A 1ODBA 2CXJA 5I2QA 1YR5A 3NSIA 1XFXO 2F2OA 4CIDA 2WORA 3SG2A 1C7VA 3CR4X 3TZ1A 3DYEA 1KK7Y 3B6XA 1XO5A 3VRQA 4F0ZB 2GGZA 3A8RA 2P6BB 3KO0A 1XFYO 1EXRA 1QASA 5HLOA 1OMDA 1CDLA 2KYFA 4AOMA 4DS7A 1IKUA 1FI5A 5AEQA 2Y1NA 1PSBA 2OS8C 2PASA 3EG5B 4PE4A 1GQMA 4MRXA 2M3WA 1B4CA 1DJGA 5I94A 1UHKA 2SASA 1ZMZA 3H4SE 3I5GB 3TS5C 2M7NA 1Q80A 4INWA 3SG6A 3FWBA 1W7JB 3GK1A 3SG5A 3S0GA 1Y1AA 3OB1B 1WLMA 3L47A 1XA5A 1OOIX 1QV1A 1DELA 2F3YA 2Q91A 3B88A 3D78A 5KTYA 2JC2A 4N1FA 1DJXA 1WDCB 2ZN9A 1QTXA 4OKHA 4YGEB 4CLNA 1XFVO 2ZN8A 1EL4A 2H61C 4C0KA 1Y0VH 3LL8B 1FBVA 5K89A 4GAOA 3I5HB 3NSOA 4YRUA 5KU1A 2I2RE 5AANA 2R2IA 4N1GA 2KLEA 1GM0A 4YGCB 1Y1UA 3BYAA 1NCYA 3S0AA 1AVSA 2M1KB 1CFDA 3NHTA 1K9PA 4YGDB 2F8PA 2JULA 3CZ1A 3KF9A 3QMEA 1JFJA 1OOFA 2EC6B 4HREE 1XK4C 1S36A 2Y4QA 2I18A 4R1EA 2IS9A 4ZCUA 3DD4A 2MLEC 1OMVA 3KPXA 4JWQA 1YRTB 1G33A 3SIBA 3AAKA 3CABA 4A4CA 2F2PA 2LHIA 2M0RA 1W9ZA 3CZ2A 1B8LA 3FS7A 4ORAB 5AERA 5HKYA 1ZFSA 4PHNA 1OMRA 1K94A 4MZJA 1YUSA 2WCLA 3BXKA 1TWOA 2KFHA 3HCMA 1TUZA 1K9UA 1K90D 1A2XA 2JU0A 2KQYA 2L4IA 3K1EA 4OVNF 2O5GA 1YX8A 3ZNIA 3TUYC 1J7OA 1KCYA 1IQ3A 4P2YB 2K8MB 2PSRA 2L98A 1LA3A 1EJ3A 2OS8B 3FIAA 3PALA 1Y6WA 1F54A 2LUXA 2JNFA 1KFXL 1FPWA 1UP5A 1LS8A 5FI7A 1NX0A 1UWOA 2JT8A 3TS5B 4UPGA 2H61A 3BUMB 1XYDA 1H4BA 4I5NB 5CSNA 5FYXA 1PULA 3D10A 1TTXA 1UHHA 1S6IA 3Q8IA 3D73A 1KK8C 4ICBA 1F8HA 3NHIA 2GGMA 1IH0A 2O60A 4NQGA 4I5KA 3PN7B 1U5IA 2BECA 2B1UA 1XK4A 5D3OA 1OQPA 1D1OA 2CTNA 1CKKA 5GQQC 2OPOA 1UHNA 3K21A 4L9MA 1KFUS 3CYZA 4MBEA 2LMTA 4MVFA 2JTTA 3VGOA 1JBAA 1ALWA 1NCZA 2DOQA 3D77A 1CNPA 3BFBA 3PLFB 2WC8A 4CFRA 1NWDA 1R6PA 1MWNA 2ZRSA 3SIAA 1U5IB 1Z4HA 2LNKA 2LVJA 3DVEA 1EH2A 1RJVA 2KLDA 3CDNA 4GGFC 3I5IC 4A4BA 1QLSA 5ER4X 2H2KA 1JWDA 1S3PA 1V1GA 4KYNA 2YGUA 4GNKB 1CLLA 2JZIA 1OOHA 2KFFA 2KBIA 2LUCA 1GGZA 2KGBC 3BOWA 5PALA 3IQQA 4DUQA 1R2UA 2MHHA 2AUCA 2KQ6A 2EHBA 2EGDA 2LC5A 4OR9B 4YGAA 3EK8A 1QJTA 2KI4C 3O4XA 3RLZA 1B8RA 3SS4A 3F45A 1S5GZ 1ZOTB 1AHRA 4P5OE 1YVHA 2FJYA 3DVKA 3O78A 2RGIA 2PRUA 1QX5B 2HQ8A 1EG4A 3UNWA 5FI2A 4WQ2A 2Q4UA 3RZSA 1B9AA 1QVIY 3TUYB 1M31A 2I7AA 1OSAA 1XFRA 1LXFC 3BOWB 2JQ6A 4HRGA 3IQOA 1F4QA 4QJ5B 1F71A 4Q04A 1WY9A 1DJIA 1ZUZA 3UO9A 3TDIA 4PE7A 4DCKA 2NCPA 1NP8A 1DJHA 1VRKA 2LV7A 4INXA 2F3ZA 2K7OA 1CMGA 2BL0C 5CSFA 2MLFC 1YRUB 3CS1A 4OZDA 1DEKA 2KAXA 3SG7A 1KK8B 1YUUA 3PFVA 4QJ4B 1S5GY 2KNEA 1LKJA 4M2OA 2LVKA 1PALA 3E3RA 4AQJA 4HRHA 1UUSA 1MXEA 2KOTA 3CZ0A 2V53A 4OV2A 3BQ3A 3O4YA 2BBNA 1DF0A 1WRZA 2E30A 1PSRA 2KHNA 1M45A 1BF5A 2GTEA 4GGFA 1TNQA 2KGRA 4JPZB 2PQLA 3NSLA 5JOLA 1A03A 1W7IB 2LHLA 1KSMA 2D8NA 1S6CA 4PALA 2L0PA 3GK4X 1C7WA 4BY4A 1BR1B 1WRLA 3IVTA 3CZTX 3JTDC 1FW4A 2L4HA 4U8DA 1KWOB 1TCFA 1UHIA 1SYMA 5CPVA 4ZCVA 1NX2A 1T14A 4YI9A 5I2LA 3VB1A 1BG1A 1CFCA 2LLTA 1SR6C 3A4UB 1DF0B 1IRJA 1X02A 5HL1A 4M2QA 2PYQA 1CM4A 1XVJA 1TRFA 3I5IB 2JWWA 1CMFA 1BOCA 4YI8A 1A29A 1MQ1A 2L2CA 1JC2A 2P71A 1L2OC 1DT7B 1JF2A 2K2AA 5TNCA 2QDIA 3EK7A 1K93D 4IL1A 3R1PA 3DVMA 3WHTB 2SCPA 1ALVA 1QWVA 5CSIA 1NPQA 1QV0A 1AUIB 2JXLA 1KQMC 1OOJA 2WCKA 2JXCA 1CLMA 4AQIA 3AKAA 2HETA 2MA2A 2KAVA 3O2PA 3OX6A 4PHJA 3D74A 2BE4A 2ZRTA 2LVVA 3AAJA 4F7FA 4C0JA 1SW8A 4FQTA 1UURA 3L4LA 1SKTA 1TNXA 3FE6A 1N0YA 2H8VA 1OE9B 4CFQA 1CFFA 2BNXA 3C1VA 1G8IA 2I94A 2NLNA 2M97A 2FCDA 2BL0B 2K2FA 3N7HA 1SY9A 2MJWB 2CCMA 2WCFA 1J7RA 3D0YA 2FOTA 5J3XA 1SK6D 1N2DA 2KI6D 3FE9A 4GBAA 4GFTA 1MF8B 2MRDA 3EVUA 1KQVA 1SMGA 3OP0A 3R1OA 3AKBA 5EL2A 1OOGA 1S6JA 2K61A 3DF0A 2G2BA 1AP4A 2K7DA 1NSHA 1KFUL 4PHMA 1BMOA 2F33A 3B86A 5DKNA 2FJUB 2BKIB 2KSPA 2PMYA 2BBMA 2ERBA 2KPHA 1QLKA 3M0WA 3D0YB 1BODA 2L2EA 3JTDB 1WRKA 1IJ6A 1QX2A 1OZOA 1TCOB 3BFHA 3NGVA 2LE9B 4MN0A 5BPJA 1DC1A 4ORCB 3CWGA 5FI6A 3OHMB 4MRYA 4FQOA 3VRNA 1FI6A 1QVIZ 2KAYA 3BUXB 4PHKA 1CTRA 3DXLA 3O6BA 3OGNA 1IIOA 1DGUA 1K9KA 3DF0B 3NXAA 1H8BA 1N65A 5HKZA 3D76A 3EK4A 1L2OB 1J7QA 1NCXA 2HF5A 4XYNA 1GGWA 2A4JA 3SS5A 2QEBA 1RROA 1BU3A 3BFAA 2AMIA 1B1GA 1A4PA 3DZTA 3OBVA 1V1FA 3OX5A 2M7LA 2NXQA 2M8UA 1BJFA 3LK1A 1ORGA 3EKHA 5HYDA 1SCMC 1KQMB 2E6WA 1RK9A 2WC5A 2HQWA 1M39A 4CPVA 2L50A 1CFPA 1JF0A 2QEOA 1FF1A 4MSPA 1YTZC 2LP3A 5DKQA 1IWQA 1JUOA 1F55A 1L7ZA 2M1UA 1MR8A 2L5XB 3FWCA 4YBHB 2LLSA 1JFKA 2ZNDA 5KSZA 2QEHA 1OZSA 2GV5A 1CB1A 3I5FC 5CSJA 1ZACA 1XFWO 2M9GA 2JOJA 4NDDA 2QEVA 1CM1A 2KFGA 4WQ3A 1J1EA 4ORBB 2KBMA 1NX1A 2Y1MA 5B8IB 4E68A 3EKJA 1J55A 1AJ4A 2ISDA 2MBXA 1QXPA 2NZ0A 3KHEA 4HSZA 2WCEA 1QATA 1WLZA 3JVTC 1C07A 1K2HA 1P28A 1QIVA 4IJ7A 2BKHB 3SS3A 2ZKMX 1DMOA 1B7TZ 2JT3A 1B8CA 5ER5A 4JD9A 4JQ0D 1IQ5A 1OW4A 1SSEB 1IGVA 3SG4A 2LCPA 1LA0A 2KDHA 3WHUB 1A75A 1S26D 3PM2A 1DTLA 1J7PA 3ZWHA 3PN7C 4NDBA 2WCBA 1AJ5A 1CDPA 3MSEB 4PT1A 2JTZA 3TDUA 1Z2CB 3S0DA 1C3YA 1PVBA 5I8NA 4TNCA 5D7FA 1QS7A 4QJ3B 3KEVA 3DVJA 1IG5A 1M46A 1SRAA 2PVBA 2BCBA 4USLA 3TDZA 3WXAA 4GPLB 2WC6A 2WCMA 3NSKA 3OB2B 2CNPA 2KI4B 1A75B 1KSOA 1HQVA 1LVCD 1B7TY 1MUXA 1NYAA 1S1EA 2WOSA 2JPTA 1PVAA 1TUJA 2JT0A 2K60A 4PE1A 1SCVA 2BCXA 3CLNA 4GUKA 2WNDA 4XJKA 1SCMB 1AK8A 1LINA 5HKWA 4BY5A 2HPSA 1C3ZA 1BR4B 1M63B 2JNXA 3B7AA 1NIWA 5DKRA 1PRWA 2K7CA 1F70A 5JJGA 2TN4A 2BE6A 2OTGC 3VROA 3CGAA 3EVRA 4I5JA 4WRIA 3FE8A 3GOFA 4YGBB 3L4AA 1Y1XA 2JRFA 1RECA 2AAOA 2L5YA 3BUNB 1K8UA 1UHJA 2LVIA 1K95A 1DQEA 1DVIA 5F6TA 2P70A 1RTP1 3I5FB 4MLWA 1CDMA 2QPTA 1QX7A 1DJWA 4FTGA 4XJKB 2G9BA 2FCEA 3LLEA 1SNLA 4GGNA 2CBLA 3PSRA 4N5XA 1JSAA 3D75A 3S0FA 1IJ5A 2K0JA 3PATA 4DIRA 1TN4A 3SG3A 2KYCA 2BAPA 3VRPA 3WNXB 1BLQA 1RWYA 5HLVA 4ETOA 1SL9A 1YURA 2KI6C 4I5LB 2ZFDA 4C0LA 2VRGA 3BUWB 1G4YR 4JKTA 3JVTB 2LAPA 5DICA 2WCJA 1MXLC 1B47A 2LLUA 1GJYA 3IF7A 5I2OA 3I5GC 4M2PA 1CDNA 2JPOA 1KFXS 1K96A 2CT9A 5AXIA 3PM8A 4NDCA 1YX7A 1TNPA 1HT9A 2Y5IA 2PALA 1PK0D 1SR6B 3R72A 3BJHA 3ICBA 1WDCC 1YUTA 3SJSA 2K7BA 1TOPA 2ZNEA 1SL8A 2NCOA 3RM1A 1J1DA 3R1VA 3V2LA 1SBJA 2L51A 1QIWA 1NUBA 3DY9A 2LM5A 2M49B 4PDZA 1TIZA 3I5HC 3HX4A 1DGVA 1BT6A 2QACA 4PE0A 3CTNA 1NX3A 1XFUO 2BCAA 1KK7Z 1SL7A 2WCHA 1XFZO 1E8AA 4MZKA 1KWOC 2LP2A 1YVLA 3VRRA 1DJZA 3LK0A 5IBWA 1MHOA 4MEWA 2M29A 3GK2A 2EC6C 3B87A 2LMVA 5D69A 3S0EA 1TNWA 4D1EA 5G08A 4PCWA
chains in the Genus database with same CATH topology
2LANA 1SPYA 2OTGB 1F4OA 3CR5X 2MAZA 4DRWA 3BUOB 1RFJA 4OCIA 3EVVA 3CR2A 2COLB 2LMUA 5AFPA 3QRXA 4MZLA 1DJYA 3LCPC 1CLBA 1EG3A 1ODBA 2CXJA 5I2QA 1YR5A 3NSIA 1XFXO 2F2OA 4CIDA 2WORA 3SG2A 1C7VA 3CR4X 3TZ1A 3VRQA 1KK7Y 1XO5A 4F0ZB 2GGZA 3A8RA 2P6BB 3KO0A 1XFYO 1EXRA 1QASA 5HLOA 1OMDA 1CDLA 2KYFA 4AOMA 4DS7A 1IKUA 1FI5A 5AEQA 2Y1NA 1PSBA 2OS8C 2PASA 4PE4A 1GQMA 4MRXA 2M3WA 1B4CA 1DJGA 1UHKA 2SASA 1ZMZA 3H4SE 3I5GB 3TS5C 2M7NA 1Q80A 3SG6A 3FWBA 1W7JB 3GK1A 3SG5A 1Y1AA 3OB1B 1WLMA 1XA5A 2Q91A 1QV1A 2F3YA 5KTYA 2JC2A 4N1FA 1DJXA 1WDCB 2ZN9A 1QTXA 4OKHA 4YGEB 4CLNA 1XFVO 2ZN8A 1EL4A 2H61C 4C0KA 1Y0VH 3LL8B 1FBVA 5K89A 4GAOA 3I5HB 3NSOA 4YRUA 5KU1A 2I2RE 5AANA 2R2IA 4N1GA 4YGCB 1Y1UA 3BYAA 1NCYA 1AVSA 2M1KB 1CFDA 4YGDB 1K9PA 2F8PA 2JULA 3KF9A 1JFJA 2EC6B 4HREE 1XK4C 1S36A 2Y4QA 2I18A 4R1EA 2IS9A 4ZCUA 3DD4A 2MLEC 1OMVA 3KPXA 4JWQA 1YRTB 1G33A 3SIBA 3AAKA 4A4CA 2F2PA 2LHIA 2M0RA 3FS7A 4ORAB 1B8LA 5AERA 5HKYA 1ZFSA 4PHNA 1OMRA 1K94A 4MZJA 1YUSA 3BXKA 2KFHA 3HCMA 1K9UA 1K90D 1A2XA 2JU0A 2KQYA 2L4IA 4OVNF 3ZNIA 2O5GA 1YX8A 3TUYC 1J7OA 1KCYA 1IQ3A 4P2YB 2K8MB 2PSRA 2L98A 1LA3A 1EJ3A 2OS8B 3FIAA 3PALA 1Y6WA 1F54A 2LUXA 2JNFA 1KFXL 1FPWA 1UP5A 1NX0A 1UWOA 2JT8A 3TS5B 4UPGA 2H61A 3BUMB 1XYDA 1H4BA 4I5NB 5CSNA 5FYXA 1PULA 3D10A 1TTXA 1UHHA 1S6IA 1KK8C 4ICBA 1F8HA 2GGMA 1IH0A 2O60A 4NQGA 4I5KA 3PN7B 1U5IA 2BECA 2B1UA 1XK4A 1OQPA 1D1OA 2CTNA 1CKKA 5GQQC 2OPOA 1UHNA 3K21A 4L9MA 1KFUS 4MBEA 4MVFA 2LMTA 1JBAA 2JTTA 3VGOA 1ALWA 1NCZA 2DOQA 1CNPA 3PLFB 2WC8A 4CFRA 1NWDA 1R6PA 1MWNA 2ZRSA 3SIAA 1U5IB 2LNKA 2LVJA 3DVEA 1EH2A 1RJVA 4GGFC 3I5IC 4A4BA 1QLSA 5ER4X 2H2KA 1JWDA 1S3PA 1V1GA 4GNKB 1CLLA 2JZIA 2KFFA 2KBIA 2LUCA 1GGZA 2KGBC 3BOWA 5PALA 3IQQA 4DUQA 1R2UA 2MHHA 2AUCA 2KQ6A 2EHBA 2EGDA 2LC5A 4OR9B 4YGAA 3EK8A 1QJTA 2KI4C 3RLZA 1B8RA 3F45A 1S5GZ 1ZOTB 1AHRA 4P5OE 1YVHA 3DVKA 3O78A 2RGIA 2PRUA 1QX5B 2HQ8A 1EG4A 4WQ2A 2Q4UA 1B9AA 1QVIY 3TUYB 1M31A 2I7AA 1OSAA 1LXFC 3BOWB 2JQ6A 4HRGA 3IQOA 1F4QA 4QJ5B 1F71A 4Q04A 1WY9A 1DJIA 1ZUZA 3TDIA 4PE7A 4DCKA 2NCPA 1NP8A 1DJHA 1VRKA 2LV7A 2F3ZA 2K7OA 1CMGA 2BL0C 5CSFA 2MLFC 1YRUB 3CS1A 2KAXA 3SG7A 1KK8B 1YUUA 3PFVA 4QJ4B 1S5GY 2KNEA 1LKJA 4M2OA 2LVKA 1PALA 3E3RA 4AQJA 4HRHA 1UUSA 1MXEA 2KOTA 4OV2A 2V53A 3BQ3A 3O4YA 2BBNA 1DF0A 1WRZA 2E30A 1PSRA 2KHNA 1M45A 1BF5A 4GGFA 1TNQA 2KGRA 4JPZB 3NSLA 5JOLA 1A03A 1W7IB 2LHLA 1KSMA 2D8NA 1S6CA 4PALA 2L0PA 3GK4X 1C7WA 4BY4A 1BR1B 1WRLA 3CZTX 3JTDC 1FW4A 2L4HA 4U8DA 1KWOB 1TCFA 1UHIA 1SYMA 5CPVA 4ZCVA 1NX2A 1CFCA 4YI9A 5I2LA 1BG1A 2LLTA 1SR6C 3A4UB 1DF0B 1IRJA 1X02A 4M2QA 1BOCA 1CM4A 1XVJA 1TRFA 3I5IB 2JWWA 1CMFA 4YI8A 1A29A 1MQ1A 1JC2A 1L2OC 1DT7B 1JF2A 2K2AA 5TNCA 3EK7A 1K93D 4IL1A 3DVMA 3WHTB 2SCPA 1ALVA 5CSIA 1NPQA 1QV0A 1AUIB 2JXLA 1KQMC 1OOJA 2JXCA 1CLMA 4AQIA 3AKAA 2HETA 2MA2A 2KAVA 3O2PA 3OX6A 4PHJA 2BE4A 2ZRTA 2LVVA 3AAJA 4C0JA 1SW8A 1UURA 1SKTA 1TNXA 1N0YA 1OE9B 4CFQA 1CFFA 3RM1A 3C1VA 1G8IA 2I94A 2NLNA 2M97A 2FCDA 2BL0B 2K2FA 1SY9A 2MJWB 2CCMA 2WCFA 1J7RA 3D0YA 2FOTA 5J3XA 1SK6D 1N2DA 2KI6D 4GBAA 4GFTA 1MF8B 2MRDA 3EVUA 1KQVA 1SMGA 3OP0A 3AKBA 1S6JA 2K61A 3DF0A 2G2BA 1AP4A 2K7DA 1NSHA 1KFUL 4PHMA 1BMOA 2F33A 5DKNA 2FJUB 2BKIB 2KSPA 2PMYA 2BBMA 1QLKA 3M0WA 3D0YB 1BODA 2L2EA 3JTDB 1WRKA 1IJ6A 1QX2A 1OZOA 1TCOB 4MZKA 5BPJA 2LE9B 4MN0A 4ORCB 3CWGA 3OHMB 4MRYA 4FQOA 3VRNA 1FI6A 1QVIZ 2KAYA 3BUXB 4PHKA 1CTRA 3O6BA 1DGUA 1K9KA 3DF0B 3NXAA 1H8BA 1N65A 5HKZA 3EK4A 1L2OB 1J7QA 1NCXA 2HF5A 4XYNA 1GGWA 2A4JA 1RROA 1BU3A 2AMIA 1B1GA 1A4PA 1V1FA 3OX5A 2M7LA 2NXQA 2M8UA 1BJFA 3LK1A 3EKHA 5HYDA 1SCMC 1KQMB 2E6WA 1RK9A 2HQWA 1M39A 4CPVA 2L50A 1CFPA 1JF0A 1FF1A 4MSPA 1YTZC 2LP3A 5DKQA 1IWQA 1JUOA 1F55A 1L7ZA 2M1UA 1MR8A 2L5XB 3FWCA 4YBHB 2LLSA 1JFKA 2ZNDA 5KSZA 1OZSA 2GV5A 1CB1A 3I5FC 5CSJA 1ZACA 1XFWO 2M9GA 2JOJA 4NDDA 1CM1A 2KFGA 4WQ3A 1J1EA 4ORBB 2KBMA 1NX1A 2Y1MA 5B8IB 4E68A 3EKJA 1J55A 1AJ4A 2ISDA 2MBXA 1QXPA 2NZ0A 3KHEA 4HSZA 2WCEA 1QATA 1WLZA 3JVTC 1C07A 1K2HA 1QIVA 2BKHB 2ZKMX 1DMOA 1B7TZ 2JT3A 1B8CA 5ER5A 4JQ0D 1IQ5A 1IGVA 3SG4A 2LCPA 1LA0A 2KDHA 3WHUB 1A75A 1S26D 1DTLA 1J7PA 3ZWHA 3PN7C 4NDBA 2WCBA 1AJ5A 1CDPA 3MSEB 2JTZA 3TDUA 1PVBA 5I8NA 4TNCA 5D7FA 1QS7A 4QJ3B 3KEVA 3DVJA 1IG5A 1M46A 1SRAA 2PVBA 2BCBA 4USLA 3TDZA 3WXAA 4GPLB 3NSKA 3OB2B 2CNPA 2KI4B 1A75B 1KSOA 1HQVA 1LVCD 1B7TY 1MUXA 1NYAA 1S1EA 2WOSA 2JPTA 1PVAA 2JT0A 4PE1A 1SCVA 2BCXA 3CLNA 4GUKA 2WNDA 4XJKA 1SCMB 1AK8A 1LINA 5HKWA 4BY5A 2HPSA 1BR4B 1M63B 2JNXA 1NIWA 5DKRA 1PRWA 2K7CA 1F70A 5JJGA 2TN4A 2BE6A 2OTGC 3VROA 3CGAA 3EVRA 4I5JA 4WRIA 3GOFA 4YGBB 1Y1XA 2JRFA 1RECA 2AAOA 3BUNB 1K8UA 1UHJA 2LVIA 1K95A 1DVIA 5F6TA 1RTP1 3I5FB 4MLWA 1CDMA 2QPTA 1QX7A 1DJWA 4FTGA 4XJKB 2G9BA 2FCEA 3LLEA 1SNLA 4GGNA 2CBLA 3PSRA 4N5XA 1JSAA 1IJ5A 2K0JA 3PATA 4DIRA 1TN4A 3SG3A 2KYCA 3VRPA 3WNXB 1BLQA 1RWYA 5HLVA 4ETOA 1SL9A 1YURA 2KI6C 4I5LB 2ZFDA 4C0LA 2VRGA 3BUWB 1G4YR 3JVTB 2LAPA 1MXLC 1B47A 2LLUA 1GJYA 3IF7A 5I2OA 3I5GC 4M2PA 1CDNA 1KFXS 1K96A 2CT9A 5AXIA 3PM8A 4NDCA 1YX7A 1TNPA 1HT9A 2Y5IA 2PALA 1PK0D 1SR6B 3ICBA 1WDCC 1YUTA 3SJSA 2K7BA 1TOPA 2ZNEA 1SL8A 2NCOA 1J1DA 1SBJA 2L51A 1QIWA 1NUBA 2LM5A 2M49B 4PDZA 1TIZA 3I5HC 3HX4A 1DGVA 1BT6A 2QACA 4PE0A 3CTNA 1NX3A 1XFUO 2BCAA 1KK7Z 1SL7A 1XFZO 1E8AA 1KWOC 2LP2A 1YVLA 3VRRA 1DJZA 3LK0A 5IBWA 1MHOA 4MEWA 2M29A 3GK2A 2EC6C 2LMVA 5D69A 1TNWA 4D1EA 5G08A 4PCWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LAN A;  1SPY A;  2OTG B;  1F4O A;  3CR5 X;  2MAZ A;  4DRW A;  3BUO B;  1RFJ A;  4OCI A;  3EVV A;  3CR2 A;  2COL B;  2LMU A;  5AFP A;  3QRX A;  4MZL A;  1DJY A;  3LCP C;  1CLB A;  1EG3 A;  1ODB A;  2CXJ A;  5I2Q A;  1YR5 A;  3NSI A;  1XFX O;  2F2O A;  4CID A;  2WOR A;  3SG2 A;  1C7V A;  3CR4 X;  3TZ1 A;  3VRQ A;  1KK7 Y;  1XO5 A;  4F0Z B;  2GGZ A;  3A8R A;  2P6B B;  3KO0 A;  1XFY O;  1EXR A;  1QAS A;  5HLO A;  1OMD A;  1CDL A;  2KYF A;  4AOM A;  4DS7 A;  1IKU A;  1FI5 A;  5AEQ A;  2Y1N A;  1PSB A;  2OS8 C;  2PAS A;  4PE4 A;  1GQM A;  4MRX A;  2M3W A;  1B4C A;  1DJG A;  1UHK A;  2SAS A;  1ZMZ A;  3H4S E;  3I5G B;  3TS5 C;  2M7N A;  1Q80 A;  3SG6 A;  3FWB A;  1W7J B;  3GK1 A;  3SG5 A;  1Y1A A;  3OB1 B;  1WLM A;  1XA5 A;  2Q91 A;  1QV1 A;  2F3Y A;  5KTY A;  2JC2 A;  4N1F A;  1DJX A;  1WDC B;  2ZN9 A;  1QTX A;  4OKH A;  4YGE B;  4CLN A;  1XFV O;  2ZN8 A;  1EL4 A;  2H61 C;  4C0K A;  1Y0V H;  3LL8 B;  1FBV A;  5K89 A;  4GAO A;  3I5H B;  3NSO A;  4YRU A;  5KU1 A;  2I2R E;  5AAN A;  2R2I A;  4N1G A;  4YGC B;  1Y1U A;  3BYA A;  1NCY A;  1AVS A;  2M1K B;  1CFD A;  4YGD B;  1K9P A;  2F8P A;  2JUL A;  3KF9 A;  1JFJ A;  2EC6 B;  4HRE E;  1XK4 C;  1S36 A;  2Y4Q A;  2I18 A;  4R1E A;  2IS9 A;  4ZCU A;  3DD4 A;  2MLE C;  1OMV A;  3KPX A;  4JWQ A;  1YRT B;  1G33 A;  3SIB A;  3AAK A;  4A4C A;  2F2P A;  2LHI A;  2M0R A;  3FS7 A;  4ORA B;  1B8L A;  5AER A;  5HKY A;  1ZFS A;  4PHN A;  1OMR A;  1K94 A;  4MZJ A;  1YUS A;  3BXK A;  2KFH A;  3HCM A;  1K9U A;  1K90 D;  1A2X A;  2JU0 A;  2KQY A;  2L4I A;  4OVN F;  3ZNI A;  2O5G A;  1YX8 A;  3TUY C;  1J7O A;  1KCY A;  1IQ3 A;  4P2Y B;  2K8M B;  2PSR A;  2L98 A;  1LA3 A;  1EJ3 A;  2OS8 B;  3FIA A;  3PAL A;  1Y6W A;  1F54 A;  2LUX A;  2JNF A;  1KFX L;  1FPW A;  1UP5 A;  1NX0 A;  1UWO A;  2JT8 A;  3TS5 B;  4UPG A;  2H61 A;  3BUM B;  1XYD A;  1H4B A;  4I5N B;  5CSN A;  5FYX A;  1PUL A;  3D10 A;  1TTX A;  1UHH A;  1S6I A;  1KK8 C;  4ICB A;  1F8H A;  2GGM A;  1IH0 A;  2O60 A;  4NQG A;  4I5K A;  3PN7 B;  1U5I A;  2BEC A;  2B1U A;  1XK4 A;  1OQP A;  1D1O A;  2CTN A;  1CKK A;  5GQQ C;  2OPO A;  1UHN A;  3K21 A;  4L9M A;  1KFU S;  4MBE A;  4MVF A;  2LMT A;  1JBA A;  2JTT A;  3VGO A;  1ALW A;  1NCZ A;  2DOQ A;  1CNP A;  3PLF B;  2WC8 A;  4CFR A;  1NWD A;  1R6P A;  1MWN A;  2ZRS A;  3SIA A;  1U5I B;  2LNK A;  2LVJ A;  3DVE A;  1EH2 A;  1RJV A;  4GGF C;  3I5I C;  4A4B A;  1QLS A;  5ER4 X;  2H2K A;  1JWD A;  1S3P A;  1V1G A;  4GNK B;  1CLL A;  2JZI A;  2KFF A;  2KBI A;  2LUC A;  1GGZ A;  2KGB C;  3BOW A;  5PAL A;  3IQQ A;  4DUQ A;  1R2U A;  2MHH A;  2AUC A;  2KQ6 A;  2EHB A;  2EGD A;  2LC5 A;  4OR9 B;  4YGA A;  3EK8 A;  1QJT A;  2KI4 C;  3RLZ A;  1B8R A;  3F45 A;  1S5G Z;  1ZOT B;  1AHR A;  4P5O E;  1YVH A;  3DVK A;  3O78 A;  2RGI A;  2PRU A;  1QX5 B;  2HQ8 A;  1EG4 A;  4WQ2 A;  2Q4U A;  1B9A A;  1QVI Y;  3TUY B;  1M31 A;  2I7A A;  1OSA A;  1LXF C;  3BOW B;  2JQ6 A;  4HRG A;  3IQO A;  1F4Q A;  4QJ5 B;  1F71 A;  4Q04 A;  1WY9 A;  1DJI A;  1ZUZ A;  3TDI A;  4PE7 A;  4DCK A;  2NCP A;  1NP8 A;  1DJH A;  1VRK A;  2LV7 A;  2F3Z A;  2K7O A;  1CMG A;  2BL0 C;  5CSF A;  2MLF C;  1YRU B;  3CS1 A;  2KAX A;  3SG7 A;  1KK8 B;  1YUU A;  3PFV A;  4QJ4 B;  1S5G Y;  2KNE A;  1LKJ A;  4M2O A;  2LVK A;  1PAL A;  3E3R A;  4AQJ A;  4HRH A;  1UUS A;  1MXE A;  2KOT A;  4OV2 A;  2V53 A;  3BQ3 A;  3O4Y A;  2BBN A;  1DF0 A;  1WRZ A;  2E30 A;  1PSR A;  2KHN A;  1M45 A;  1BF5 A;  4GGF A;  1TNQ A;  2KGR A;  4JPZ B;  3NSL A;  5JOL A;  1A03 A;  1W7I B;  2LHL A;  1KSM A;  2D8N A;  1S6C A;  4PAL A;  2L0P A;  3GK4 X;  1C7W A;  4BY4 A;  1BR1 B;  1WRL A;  3CZT X;  3JTD C;  1FW4 A;  2L4H A;  4U8D A;  1KWO B;  1TCF A;  1UHI A;  1SYM A;  5CPV A;  4ZCV A;  1NX2 A;  1CFC A;  4YI9 A;  5I2L A;  1BG1 A;  2LLT A;  1SR6 C;  3A4U B;  1DF0 B;  1IRJ A;  1X02 A;  4M2Q A;  1BOC A;  1CM4 A;  1XVJ A;  1TRF A;  3I5I B;  2JWW A;  1CMF A;  4YI8 A;  1A29 A;  1MQ1 A;  1JC2 A;  1L2O C;  1DT7 B;  1JF2 A;  2K2A A;  5TNC A;  3EK7 A;  1K93 D;  4IL1 A;  3DVM A;  3WHT B;  2SCP A;  1ALV A;  5CSI A;  1NPQ A;  1QV0 A;  1AUI B;  2JXL A;  1KQM C;  1OOJ A;  2JXC A;  1CLM A;  4AQI A;  3AKA A;  2HET A;  2MA2 A;  2KAV A;  3O2P A;  3OX6 A;  4PHJ A;  2BE4 A;  2ZRT A;  2LVV A;  3AAJ A;  4C0J A;  1SW8 A;  1UUR A;  1SKT A;  1TNX A;  1N0Y A;  1OE9 B;  4CFQ A;  1CFF A;  3RM1 A;  3C1V A;  1G8I A;  2I94 A;  2NLN A;  2M97 A;  2FCD A;  2BL0 B;  2K2F A;  1SY9 A;  2MJW B;  2CCM A;  2WCF A;  1J7R A;  3D0Y A;  2FOT A;  5J3X A;  1SK6 D;  1N2D A;  2KI6 D;  4GBA A;  4GFT A;  1MF8 B;  2MRD A;  3EVU A;  1KQV A;  1SMG A;  3OP0 A;  3AKB A;  1S6J A;  2K61 A;  3DF0 A;  2G2B A;  1AP4 A;  2K7D A;  1NSH A;  1KFU L;  4PHM A;  1BMO A;  2F33 A;  5DKN A;  2FJU B;  2BKI B;  2KSP A;  2PMY A;  2BBM A;  1QLK A;  3M0W A;  3D0Y B;  1BOD A;  2L2E A;  3JTD B;  1WRK A;  1IJ6 A;  1QX2 A;  1OZO A;  1TCO B;  4MZK A;  5BPJ A;  2LE9 B;  4MN0 A;  4ORC B;  3CWG A;  3OHM B;  4MRY A;  4FQO A;  3VRN A;  1FI6 A;  1QVI Z;  2KAY A;  3BUX B;  4PHK A;  1CTR A;  3O6B A;  1DGU A;  1K9K A;  3DF0 B;  3NXA A;  1H8B A;  1N65 A;  5HKZ A;  3EK4 A;  1L2O B;  1J7Q A;  1NCX A;  2HF5 A;  4XYN A;  1GGW A;  2A4J A;  1RRO A;  1BU3 A;  2AMI A;  1B1G A;  1A4P A;  1V1F A;  3OX5 A;  2M7L A;  2NXQ A;  2M8U A;  1BJF A;  3LK1 A;  3EKH A;  5HYD A;  1SCM C;  1KQM B;  2E6W A;  1RK9 A;  2HQW A;  1M39 A;  4CPV A;  2L50 A;  1CFP A;  1JF0 A;  1FF1 A;  4MSP A;  1YTZ C;  2LP3 A;  5DKQ A;  1IWQ A;  1JUO A;  1F55 A;  1L7Z A;  2M1U A;  1MR8 A;  2L5X B;  3FWC A;  4YBH B;  2LLS A;  1JFK A;  2ZND A;  5KSZ A;  1OZS A;  2GV5 A;  1CB1 A;  3I5F C;  5CSJ A;  1ZAC A;  1XFW O;  2M9G A;  2JOJ A;  4NDD A;  1CM1 A;  2KFG A;  4WQ3 A;  1J1E A;  4ORB B;  2KBM A;  1NX1 A;  2Y1M A;  5B8I B;  4E68 A;  3EKJ A;  1J55 A;  1AJ4 A;  2ISD A;  2MBX A;  1QXP A;  2NZ0 A;  3KHE A;  4HSZ A;  2WCE A;  1QAT A;  1WLZ A;  3JVT C;  1C07 A;  1K2H A;  1QIV A;  2BKH B;  2ZKM X;  1DMO A;  1B7T Z;  2JT3 A;  1B8C A;  5ER5 A;  4JQ0 D;  1IQ5 A;  1IGV A;  3SG4 A;  2LCP A;  1LA0 A;  2KDH A;  3WHU B;  1A75 A;  1S26 D;  1DTL A;  1J7P A;  3ZWH A;  3PN7 C;  4NDB A;  2WCB A;  1AJ5 A;  1CDP A;  3MSE B;  2JTZ A;  3TDU A;  1PVB A;  5I8N A;  4TNC A;  5D7F A;  1QS7 A;  4QJ3 B;  3KEV A;  3DVJ A;  1IG5 A;  1M46 A;  1SRA A;  2PVB A;  2BCB A;  4USL A;  3TDZ A;  3WXA A;  4GPL B;  3NSK A;  3OB2 B;  2CNP A;  2KI4 B;  1A75 B;  1KSO A;  1HQV A;  1LVC D;  1B7T Y;  1MUX A;  1NYA A;  1S1E A;  2WOS A;  2JPT A;  1PVA A;  2JT0 A;  4PE1 A;  1SCV A;  2BCX A;  3CLN A;  4GUK A;  2WND A;  4XJK A;  1SCM B;  1AK8 A;  1LIN A;  5HKW A;  4BY5 A;  2HPS A;  1BR4 B;  1M63 B;  2JNX A;  1NIW A;  5DKR A;  1PRW A;  2K7C A;  1F70 A;  5JJG A;  2TN4 A;  2BE6 A;  2OTG C;  3VRO A;  3CGA A;  3EVR A;  4I5J A;  4WRI A;  3GOF A;  4YGB B;  1Y1X A;  2JRF A;  1REC A;  2AAO A;  3BUN B;  1K8U A;  1UHJ A;  2LVI A;  1K95 A;  1DVI A;  5F6T A;  1RTP 1;  3I5F B;  4MLW A;  1CDM A;  2QPT A;  1QX7 A;  1DJW A;  4FTG A;  4XJK B;  2G9B A;  2FCE A;  3LLE A;  1SNL A;  4GGN A;  2CBL A;  3PSR A;  4N5X A;  1JSA A;  1IJ5 A;  2K0J A;  3PAT A;  4DIR A;  1TN4 A;  3SG3 A;  2KYC A;  3VRP A;  3WNX B;  1BLQ A;  1RWY A;  5HLV A;  4ETO A;  1SL9 A;  1YUR A;  2KI6 C;  4I5L B;  2ZFD A;  4C0L A;  2VRG A;  3BUW B;  1G4Y R;  3JVT B;  2LAP A;  1MXL C;  1B47 A;  2LLU A;  1GJY A;  3IF7 A;  5I2O A;  3I5G C;  4M2P A;  1CDN A;  1KFX S;  1K96 A;  2CT9 A;  5AXI A;  3PM8 A;  4NDC A;  1YX7 A;  1TNP A;  1HT9 A;  2Y5I A;  2PAL A;  1PK0 D;  1SR6 B;  3ICB A;  1WDC C;  1YUT A;  3SJS A;  2K7B A;  1TOP A;  2ZNE A;  1SL8 A;  2NCO A;  1J1D A;  1SBJ A;  2L51 A;  1QIW A;  1NUB A;  2LM5 A;  2M49 B;  4PDZ A;  1TIZ A;  3I5H C;  3HX4 A;  1DGV A;  1BT6 A;  2QAC A;  4PE0 A;  3CTN A;  1NX3 A;  1XFU O;  2BCA A;  1KK7 Z;  1SL7 A;  1XFZ O;  1E8A A;  1KWO C;  2LP2 A;  1YVL A;  3VRR A;  1DJZ A;  3LK0 A;  5IBW A;  1MHO A;  4MEW A;  2M29 A;  3GK2 A;  2EC6 C;  2LMV A;  5D69 A;  1TNW A;  4D1E A;  5G08 A;  4PCW A; 
#chains in the Genus database with same CATH topology
 2LAN A;  1SPY A;  2OTG B;  1F4O A;  3CR5 X;  3PJI A;  2MAZ A;  4DRW A;  3BUO B;  3S0B A;  1RFJ A;  4OCI A;  3EVV A;  3CR2 A;  2COL B;  2LMU A;  5AFP A;  3QRX A;  4MZL A;  1DJY A;  3LCP C;  1CLB A;  1EG3 A;  1ODB A;  2CXJ A;  5I2Q A;  1YR5 A;  3NSI A;  1XFX O;  2F2O A;  4CID A;  2WOR A;  3SG2 A;  1C7V A;  3CR4 X;  3TZ1 A;  3DYE A;  1KK7 Y;  3B6X A;  1XO5 A;  3VRQ A;  4F0Z B;  2GGZ A;  3A8R A;  2P6B B;  3KO0 A;  1XFY O;  1EXR A;  1QAS A;  5HLO A;  1OMD A;  1CDL A;  2KYF A;  4AOM A;  4DS7 A;  1IKU A;  1FI5 A;  5AEQ A;  2Y1N A;  1PSB A;  2OS8 C;  2PAS A;  3EG5 B;  4PE4 A;  1GQM A;  4MRX A;  2M3W A;  1B4C A;  1DJG A;  5I94 A;  1UHK A;  2SAS A;  1ZMZ A;  3H4S E;  3I5G B;  3TS5 C;  2M7N A;  1Q80 A;  4INW A;  3SG6 A;  3FWB A;  1W7J B;  3GK1 A;  3SG5 A;  3S0G A;  1Y1A A;  3OB1 B;  1WLM A;  3L47 A;  1XA5 A;  1OOI X;  1QV1 A;  1DEL A;  2F3Y A;  2Q91 A;  3B88 A;  3D78 A;  5KTY A;  2JC2 A;  4N1F A;  1DJX A;  1WDC B;  2ZN9 A;  1QTX A;  4OKH A;  4YGE B;  4CLN A;  1XFV O;  2ZN8 A;  1EL4 A;  2H61 C;  4C0K A;  1Y0V H;  3LL8 B;  1FBV A;  5K89 A;  4GAO A;  3I5H B;  3NSO A;  4YRU A;  5KU1 A;  2I2R E;  5AAN A;  2R2I A;  4N1G A;  2KLE A;  1GM0 A;  4YGC B;  1Y1U A;  3BYA A;  1NCY A;  3S0A A;  1AVS A;  2M1K B;  1CFD A;  3NHT A;  1K9P A;  4YGD B;  2F8P A;  2JUL A;  3CZ1 A;  3KF9 A;  3QME A;  1JFJ A;  1OOF A;  2EC6 B;  4HRE E;  1XK4 C;  1S36 A;  2Y4Q A;  2I18 A;  4R1E A;  2IS9 A;  4ZCU A;  3DD4 A;  2MLE C;  1OMV A;  3KPX A;  4JWQ A;  1YRT B;  1G33 A;  3SIB A;  3AAK A;  3CAB A;  4A4C A;  2F2P A;  2LHI A;  2M0R A;  1W9Z A;  3CZ2 A;  1B8L A;  3FS7 A;  4ORA B;  5AER A;  5HKY A;  1ZFS A;  4PHN A;  1OMR A;  1K94 A;  4MZJ A;  1YUS A;  2WCL A;  3BXK A;  1TWO A;  2KFH A;  3HCM A;  1TUZ A;  1K9U A;  1K90 D;  1A2X A;  2JU0 A;  2KQY A;  2L4I A;  3K1E A;  4OVN F;  2O5G A;  1YX8 A;  3ZNI A;  3TUY C;  1J7O A;  1KCY A;  1IQ3 A;  4P2Y B;  2K8M B;  2PSR A;  2L98 A;  1LA3 A;  1EJ3 A;  2OS8 B;  3FIA A;  3PAL A;  1Y6W A;  1F54 A;  2LUX A;  2JNF A;  1KFX L;  1FPW A;  1UP5 A;  1LS8 A;  5FI7 A;  1NX0 A;  1UWO A;  2JT8 A;  3TS5 B;  4UPG A;  2H61 A;  3BUM B;  1XYD A;  1H4B A;  4I5N B;  5CSN A;  5FYX A;  1PUL A;  3D10 A;  1TTX A;  1UHH A;  1S6I A;  3Q8I A;  3D73 A;  1KK8 C;  4ICB A;  1F8H A;  3NHI A;  2GGM A;  1IH0 A;  2O60 A;  4NQG A;  4I5K A;  3PN7 B;  1U5I A;  2BEC A;  2B1U A;  1XK4 A;  5D3O A;  1OQP A;  1D1O A;  2CTN A;  1CKK A;  5GQQ C;  2OPO A;  1UHN A;  3K21 A;  4L9M A;  1KFU S;  3CYZ A;  4MBE A;  2LMT A;  4MVF A;  2JTT A;  3VGO A;  1JBA A;  1ALW A;  1NCZ A;  2DOQ A;  3D77 A;  1CNP A;  3BFB A;  3PLF B;  2WC8 A;  4CFR A;  1NWD A;  1R6P A;  1MWN A;  2ZRS A;  3SIA A;  1U5I B;  1Z4H A;  2LNK A;  2LVJ A;  3DVE A;  1EH2 A;  1RJV A;  2KLD A;  3CDN A;  4GGF C;  3I5I C;  4A4B A;  1QLS A;  5ER4 X;  2H2K A;  1JWD A;  1S3P A;  1V1G A;  4KYN A;  2YGU A;  4GNK B;  1CLL A;  2JZI A;  1OOH A;  2KFF A;  2KBI A;  2LUC A;  1GGZ A;  2KGB C;  3BOW A;  5PAL A;  3IQQ A;  4DUQ A;  1R2U A;  2MHH A;  2AUC A;  2KQ6 A;  2EHB A;  2EGD A;  2LC5 A;  4OR9 B;  4YGA A;  3EK8 A;  1QJT A;  2KI4 C;  3O4X A;  3RLZ A;  1B8R A;  3SS4 A;  3F45 A;  1S5G Z;  1ZOT B;  1AHR A;  4P5O E;  1YVH A;  2FJY A;  3DVK A;  3O78 A;  2RGI A;  2PRU A;  1QX5 B;  2HQ8 A;  1EG4 A;  3UNW A;  5FI2 A;  4WQ2 A;  2Q4U A;  3RZS A;  1B9A A;  1QVI Y;  3TUY B;  1M31 A;  2I7A A;  1OSA A;  1XFR A;  1LXF C;  3BOW B;  2JQ6 A;  4HRG A;  3IQO A;  1F4Q A;  4QJ5 B;  1F71 A;  4Q04 A;  1WY9 A;  1DJI A;  1ZUZ A;  3UO9 A;  3TDI A;  4PE7 A;  4DCK A;  2NCP A;  1NP8 A;  1DJH A;  1VRK A;  2LV7 A;  4INX A;  2F3Z A;  2K7O A;  1CMG A;  2BL0 C;  5CSF A;  2MLF C;  1YRU B;  3CS1 A;  4OZD A;  1DEK A;  2KAX A;  3SG7 A;  1KK8 B;  1YUU A;  3PFV A;  4QJ4 B;  1S5G Y;  2KNE A;  1LKJ A;  4M2O A;  2LVK A;  1PAL A;  3E3R A;  4AQJ A;  4HRH A;  1UUS A;  1MXE A;  2KOT A;  3CZ0 A;  2V53 A;  4OV2 A;  3BQ3 A;  3O4Y A;  2BBN A;  1DF0 A;  1WRZ A;  2E30 A;  1PSR A;  2KHN A;  1M45 A;  1BF5 A;  2GTE A;  4GGF A;  1TNQ A;  2KGR A;  4JPZ B;  2PQL A;  3NSL A;  5JOL A;  1A03 A;  1W7I B;  2LHL A;  1KSM A;  2D8N A;  1S6C A;  4PAL A;  2L0P A;  3GK4 X;  1C7W A;  4BY4 A;  1BR1 B;  1WRL A;  3IVT A;  3CZT X;  3JTD C;  1FW4 A;  2L4H A;  4U8D A;  1KWO B;  1TCF A;  1UHI A;  1SYM A;  5CPV A;  4ZCV A;  1NX2 A;  1T14 A;  4YI9 A;  5I2L A;  3VB1 A;  1BG1 A;  1CFC A;  2LLT A;  1SR6 C;  3A4U B;  1DF0 B;  1IRJ A;  1X02 A;  5HL1 A;  4M2Q A;  2PYQ A;  1CM4 A;  1XVJ A;  1TRF A;  3I5I B;  2JWW A;  1CMF A;  1BOC A;  4YI8 A;  1A29 A;  1MQ1 A;  2L2C A;  1JC2 A;  2P71 A;  1L2O C;  1DT7 B;  1JF2 A;  2K2A A;  5TNC A;  2QDI A;  3EK7 A;  1K93 D;  4IL1 A;  3R1P A;  3DVM A;  3WHT B;  2SCP A;  1ALV A;  1QWV A;  5CSI A;  1NPQ A;  1QV0 A;  1AUI B;  2JXL A;  1KQM C;  1OOJ A;  2WCK A;  2JXC A;  1CLM A;  4AQI A;  3AKA A;  2HET A;  2MA2 A;  2KAV A;  3O2P A;  3OX6 A;  4PHJ A;  3D74 A;  2BE4 A;  2ZRT A;  2LVV A;  3AAJ A;  4F7F A;  4C0J A;  1SW8 A;  4FQT A;  1UUR A;  3L4L A;  1SKT A;  1TNX A;  3FE6 A;  1N0Y A;  2H8V A;  1OE9 B;  4CFQ A;  1CFF A;  2BNX A;  3C1V A;  1G8I A;  2I94 A;  2NLN A;  2M97 A;  2FCD A;  2BL0 B;  2K2F A;  3N7H A;  1SY9 A;  2MJW B;  2CCM A;  2WCF A;  1J7R A;  3D0Y A;  2FOT A;  5J3X A;  1SK6 D;  1N2D A;  2KI6 D;  3FE9 A;  4GBA A;  4GFT A;  1MF8 B;  2MRD A;  3EVU A;  1KQV A;  1SMG A;  3OP0 A;  3R1O A;  3AKB A;  5EL2 A;  1OOG A;  1S6J A;  2K61 A;  3DF0 A;  2G2B A;  1AP4 A;  2K7D A;  1NSH A;  1KFU L;  4PHM A;  1BMO A;  2F33 A;  3B86 A;  5DKN A;  2FJU B;  2BKI B;  2KSP A;  2PMY A;  2BBM A;  2ERB A;  2KPH A;  1QLK A;  3M0W A;  3D0Y B;  1BOD A;  2L2E A;  3JTD B;  1WRK A;  1IJ6 A;  1QX2 A;  1OZO A;  1TCO B;  3BFH A;  3NGV A;  2LE9 B;  4MN0 A;  5BPJ A;  1DC1 A;  4ORC B;  3CWG A;  5FI6 A;  3OHM B;  4MRY A;  4FQO A;  3VRN A;  1FI6 A;  1QVI Z;  2KAY A;  3BUX B;  4PHK A;  1CTR A;  3DXL A;  3O6B A;  3OGN A;  1IIO A;  1DGU A;  1K9K A;  3DF0 B;  3NXA A;  1H8B A;  1N65 A;  5HKZ A;  3D76 A;  3EK4 A;  1L2O B;  1J7Q A;  1NCX A;  2HF5 A;  4XYN A;  1GGW A;  2A4J A;  3SS5 A;  2QEB A;  1RRO A;  1BU3 A;  3BFA A;  2AMI A;  1B1G A;  1A4P A;  3DZT A;  3OBV A;  1V1F A;  3OX5 A;  2M7L A;  2NXQ A;  2M8U A;  1BJF A;  3LK1 A;  1ORG A;  3EKH A;  5HYD A;  1SCM C;  1KQM B;  2E6W A;  1RK9 A;  2WC5 A;  2HQW A;  1M39 A;  4CPV A;  2L50 A;  1CFP A;  1JF0 A;  2QEO A;  1FF1 A;  4MSP A;  1YTZ C;  2LP3 A;  5DKQ A;  1IWQ A;  1JUO A;  1F55 A;  1L7Z A;  2M1U A;  1MR8 A;  2L5X B;  3FWC A;  4YBH B;  2LLS A;  1JFK A;  2ZND A;  5KSZ A;  2QEH A;  1OZS A;  2GV5 A;  1CB1 A;  3I5F C;  5CSJ A;  1ZAC A;  1XFW O;  2M9G A;  2JOJ A;  4NDD A;  2QEV A;  1CM1 A;  2KFG A;  4WQ3 A;  1J1E A;  4ORB B;  2KBM A;  1NX1 A;  2Y1M A;  5B8I B;  4E68 A;  3EKJ A;  1J55 A;  1AJ4 A;  2ISD A;  2MBX A;  1QXP A;  2NZ0 A;  3KHE A;  4HSZ A;  2WCE A;  1QAT A;  1WLZ A;  3JVT C;  1C07 A;  1K2H A;  1P28 A;  1QIV A;  4IJ7 A;  2BKH B;  3SS3 A;  2ZKM X;  1DMO A;  1B7T Z;  2JT3 A;  1B8C A;  5ER5 A;  4JD9 A;  4JQ0 D;  1IQ5 A;  1OW4 A;  1SSE B;  1IGV A;  3SG4 A;  2LCP A;  1LA0 A;  2KDH A;  3WHU B;  1A75 A;  1S26 D;  3PM2 A;  1DTL A;  1J7P A;  3ZWH A;  3PN7 C;  4NDB A;  2WCB A;  1AJ5 A;  1CDP A;  3MSE B;  4PT1 A;  2JTZ A;  3TDU A;  1Z2C B;  3S0D A;  1C3Y A;  1PVB A;  5I8N A;  4TNC A;  5D7F A;  1QS7 A;  4QJ3 B;  3KEV A;  3DVJ A;  1IG5 A;  1M46 A;  1SRA A;  2PVB A;  2BCB A;  4USL A;  3TDZ A;  3WXA A;  4GPL B;  2WC6 A;  2WCM A;  3NSK A;  3OB2 B;  2CNP A;  2KI4 B;  1A75 B;  1KSO A;  1HQV A;  1LVC D;  1B7T Y;  1MUX A;  1NYA A;  1S1E A;  2WOS A;  2JPT A;  1PVA A;  1TUJ A;  2JT0 A;  2K60 A;  4PE1 A;  1SCV A;  2BCX A;  3CLN A;  4GUK A;  2WND A;  4XJK A;  1SCM B;  1AK8 A;  1LIN A;  5HKW A;  4BY5 A;  2HPS A;  1C3Z A;  1BR4 B;  1M63 B;  2JNX A;  3B7A A;  1NIW A;  5DKR A;  1PRW A;  2K7C A;  1F70 A;  5JJG A;  2TN4 A;  2BE6 A;  2OTG C;  3VRO A;  3CGA A;  3EVR A;  4I5J A;  4WRI A;  3FE8 A;  3GOF A;  4YGB B;  3L4A A;  1Y1X A;  2JRF A;  1REC A;  2AAO A;  2L5Y A;  3BUN B;  1K8U A;  1UHJ A;  2LVI A;  1K95 A;  1DQE A;  1DVI A;  5F6T A;  2P70 A;  1RTP 1;  3I5F B;  4MLW A;  1CDM A;  2QPT A;  1QX7 A;  1DJW A;  4FTG A;  4XJK B;  2G9B A;  2FCE A;  3LLE A;  1SNL A;  4GGN A;  2CBL A;  3PSR A;  4N5X A;  1JSA A;  3D75 A;  3S0F A;  1IJ5 A;  2K0J A;  3PAT A;  4DIR A;  1TN4 A;  3SG3 A;  2KYC A;  2BAP A;  3VRP A;  3WNX B;  1BLQ A;  1RWY A;  5HLV A;  4ETO A;  1SL9 A;  1YUR A;  2KI6 C;  4I5L B;  2ZFD A;  4C0L A;  2VRG A;  3BUW B;  1G4Y R;  4JKT A;  3JVT B;  2LAP A;  5DIC A;  2WCJ A;  1MXL C;  1B47 A;  2LLU A;  1GJY A;  3IF7 A;  5I2O A;  3I5G C;  4M2P A;  1CDN A;  2JPO A;  1KFX S;  1K96 A;  2CT9 A;  5AXI A;  3PM8 A;  4NDC A;  1YX7 A;  1TNP A;  1HT9 A;  2Y5I A;  2PAL A;  1PK0 D;  1SR6 B;  3R72 A;  3BJH A;  3ICB A;  1WDC C;  1YUT A;  3SJS A;  2K7B A;  1TOP A;  2ZNE A;  1SL8 A;  2NCO A;  3RM1 A;  1J1D A;  3R1V A;  3V2L A;  1SBJ A;  2L51 A;  1QIW A;  1NUB A;  3DY9 A;  2LM5 A;  2M49 B;  4PDZ A;  1TIZ A;  3I5H C;  3HX4 A;  1DGV A;  1BT6 A;  2QAC A;  4PE0 A;  3CTN A;  1NX3 A;  1XFU O;  2BCA A;  1KK7 Z;  1SL7 A;  2WCH A;  1XFZ O;  1E8A A;  4MZK A;  1KWO C;  2LP2 A;  1YVL A;  3VRR A;  1DJZ A;  3LK0 A;  5IBW A;  1MHO A;  4MEW A;  2M29 A;  3GK2 A;  2EC6 C;  3B87 A;  2LMV A;  5D69 A;  3S0E A;  1TNW A;  4D1E A;  5G08 A;  4PCW A; 
#chains in the Genus database with same CATH homology
 2LAN A;  1SPY A;  2OTG B;  1F4O A;  3CR5 X;  2MAZ A;  4DRW A;  3BUO B;  1RFJ A;  4OCI A;  3EVV A;  3CR2 A;  2COL B;  2LMU A;  5AFP A;  3QRX A;  4MZL A;  1DJY A;  3LCP C;  1CLB A;  1EG3 A;  1ODB A;  2CXJ A;  5I2Q A;  1YR5 A;  3NSI A;  1XFX O;  2F2O A;  4CID A;  2WOR A;  3SG2 A;  1C7V A;  3CR4 X;  3TZ1 A;  3VRQ A;  1KK7 Y;  1XO5 A;  4F0Z B;  2GGZ A;  3A8R A;  2P6B B;  3KO0 A;  1XFY O;  1EXR A;  1QAS A;  5HLO A;  1OMD A;  1CDL A;  2KYF A;  4AOM A;  4DS7 A;  1IKU A;  1FI5 A;  5AEQ A;  2Y1N A;  1PSB A;  2OS8 C;  2PAS A;  4PE4 A;  1GQM A;  4MRX A;  2M3W A;  1B4C A;  1DJG A;  1UHK A;  2SAS A;  1ZMZ A;  3H4S E;  3I5G B;  3TS5 C;  2M7N A;  1Q80 A;  3SG6 A;  3FWB A;  1W7J B;  3GK1 A;  3SG5 A;  1Y1A A;  3OB1 B;  1WLM A;  1XA5 A;  2Q91 A;  1QV1 A;  2F3Y A;  5KTY A;  2JC2 A;  4N1F A;  1DJX A;  1WDC B;  2ZN9 A;  1QTX A;  4OKH A;  4YGE B;  4CLN A;  1XFV O;  2ZN8 A;  1EL4 A;  2H61 C;  4C0K A;  1Y0V H;  3LL8 B;  1FBV A;  5K89 A;  4GAO A;  3I5H B;  3NSO A;  4YRU A;  5KU1 A;  2I2R E;  5AAN A;  2R2I A;  4N1G A;  4YGC B;  1Y1U A;  3BYA A;  1NCY A;  1AVS A;  2M1K B;  1CFD A;  4YGD B;  1K9P A;  2F8P A;  2JUL A;  3KF9 A;  1JFJ A;  2EC6 B;  4HRE E;  1XK4 C;  1S36 A;  2Y4Q A;  2I18 A;  4R1E A;  2IS9 A;  4ZCU A;  3DD4 A;  2MLE C;  1OMV A;  3KPX A;  4JWQ A;  1YRT B;  1G33 A;  3SIB A;  3AAK A;  4A4C A;  2F2P A;  2LHI A;  2M0R A;  3FS7 A;  4ORA B;  1B8L A;  5AER A;  5HKY A;  1ZFS A;  4PHN A;  1OMR A;  1K94 A;  4MZJ A;  1YUS A;  3BXK A;  2KFH A;  3HCM A;  1K9U A;  1K90 D;  1A2X A;  2JU0 A;  2KQY A;  2L4I A;  4OVN F;  3ZNI A;  2O5G A;  1YX8 A;  3TUY C;  1J7O A;  1KCY A;  1IQ3 A;  4P2Y B;  2K8M B;  2PSR A;  2L98 A;  1LA3 A;  1EJ3 A;  2OS8 B;  3FIA A;  3PAL A;  1Y6W A;  1F54 A;  2LUX A;  2JNF A;  1KFX L;  1FPW A;  1UP5 A;  1NX0 A;  1UWO A;  2JT8 A;  3TS5 B;  4UPG A;  2H61 A;  3BUM B;  1XYD A;  1H4B A;  4I5N B;  5CSN A;  5FYX A;  1PUL A;  3D10 A;  1TTX A;  1UHH A;  1S6I A;  1KK8 C;  4ICB A;  1F8H A;  2GGM A;  1IH0 A;  2O60 A;  4NQG A;  4I5K A;  3PN7 B;  1U5I A;  2BEC A;  2B1U A;  1XK4 A;  1OQP A;  1D1O A;  2CTN A;  1CKK A;  5GQQ C;  2OPO A;  1UHN A;  3K21 A;  4L9M A;  1KFU S;  4MBE A;  4MVF A;  2LMT A;  1JBA A;  2JTT A;  3VGO A;  1ALW A;  1NCZ A;  2DOQ A;  1CNP A;  3PLF B;  2WC8 A;  4CFR A;  1NWD A;  1R6P A;  1MWN A;  2ZRS A;  3SIA A;  1U5I B;  2LNK A;  2LVJ A;  3DVE A;  1EH2 A;  1RJV A;  4GGF C;  3I5I C;  4A4B A;  1QLS A;  5ER4 X;  2H2K A;  1JWD A;  1S3P A;  1V1G A;  4GNK B;  1CLL A;  2JZI A;  2KFF A;  2KBI A;  2LUC A;  1GGZ A;  2KGB C;  3BOW A;  5PAL A;  3IQQ A;  4DUQ A;  1R2U A;  2MHH A;  2AUC A;  2KQ6 A;  2EHB A;  2EGD A;  2LC5 A;  4OR9 B;  4YGA A;  3EK8 A;  1QJT A;  2KI4 C;  3RLZ A;  1B8R A;  3F45 A;  1S5G Z;  1ZOT B;  1AHR A;  4P5O E;  1YVH A;  3DVK A;  3O78 A;  2RGI A;  2PRU A;  1QX5 B;  2HQ8 A;  1EG4 A;  4WQ2 A;  2Q4U A;  1B9A A;  1QVI Y;  3TUY B;  1M31 A;  2I7A A;  1OSA A;  1LXF C;  3BOW B;  2JQ6 A;  4HRG A;  3IQO A;  1F4Q A;  4QJ5 B;  1F71 A;  4Q04 A;  1WY9 A;  1DJI A;  1ZUZ A;  3TDI A;  4PE7 A;  4DCK A;  2NCP A;  1NP8 A;  1DJH A;  1VRK A;  2LV7 A;  2F3Z A;  2K7O A;  1CMG A;  2BL0 C;  5CSF A;  2MLF C;  1YRU B;  3CS1 A;  2KAX A;  3SG7 A;  1KK8 B;  1YUU A;  3PFV A;  4QJ4 B;  1S5G Y;  2KNE A;  1LKJ A;  4M2O A;  2LVK A;  1PAL A;  3E3R A;  4AQJ A;  4HRH A;  1UUS A;  1MXE A;  2KOT A;  4OV2 A;  2V53 A;  3BQ3 A;  3O4Y A;  2BBN A;  1DF0 A;  1WRZ A;  2E30 A;  1PSR A;  2KHN A;  1M45 A;  1BF5 A;  4GGF A;  1TNQ A;  2KGR A;  4JPZ B;  3NSL A;  5JOL A;  1A03 A;  1W7I B;  2LHL A;  1KSM A;  2D8N A;  1S6C A;  4PAL A;  2L0P A;  3GK4 X;  1C7W A;  4BY4 A;  1BR1 B;  1WRL A;  3CZT X;  3JTD C;  1FW4 A;  2L4H A;  4U8D A;  1KWO B;  1TCF A;  1UHI A;  1SYM A;  5CPV A;  4ZCV A;  1NX2 A;  1CFC A;  4YI9 A;  5I2L A;  1BG1 A;  2LLT A;  1SR6 C;  3A4U B;  1DF0 B;  1IRJ A;  1X02 A;  4M2Q A;  1BOC A;  1CM4 A;  1XVJ A;  1TRF A;  3I5I B;  2JWW A;  1CMF A;  4YI8 A;  1A29 A;  1MQ1 A;  1JC2 A;  1L2O C;  1DT7 B;  1JF2 A;  2K2A A;  5TNC A;  3EK7 A;  1K93 D;  4IL1 A;  3DVM A;  3WHT B;  2SCP A;  1ALV A;  5CSI A;  1NPQ A;  1QV0 A;  1AUI B;  2JXL A;  1KQM C;  1OOJ A;  2JXC A;  1CLM A;  4AQI A;  3AKA A;  2HET A;  2MA2 A;  2KAV A;  3O2P A;  3OX6 A;  4PHJ A;  2BE4 A;  2ZRT A;  2LVV A;  3AAJ A;  4C0J A;  1SW8 A;  1UUR A;  1SKT A;  1TNX A;  1N0Y A;  1OE9 B;  4CFQ A;  1CFF A;  3RM1 A;  3C1V A;  1G8I A;  2I94 A;  2NLN A;  2M97 A;  2FCD A;  2BL0 B;  2K2F A;  1SY9 A;  2MJW B;  2CCM A;  2WCF A;  1J7R A;  3D0Y A;  2FOT A;  5J3X A;  1SK6 D;  1N2D A;  2KI6 D;  4GBA A;  4GFT A;  1MF8 B;  2MRD A;  3EVU A;  1KQV A;  1SMG A;  3OP0 A;  3AKB A;  1S6J A;  2K61 A;  3DF0 A;  2G2B A;  1AP4 A;  2K7D A;  1NSH A;  1KFU L;  4PHM A;  1BMO A;  2F33 A;  5DKN A;  2FJU B;  2BKI B;  2KSP A;  2PMY A;  2BBM A;  1QLK A;  3M0W A;  3D0Y B;  1BOD A;  2L2E A;  3JTD B;  1WRK A;  1IJ6 A;  1QX2 A;  1OZO A;  1TCO B;  4MZK A;  5BPJ A;  2LE9 B;  4MN0 A;  4ORC B;  3CWG A;  3OHM B;  4MRY A;  4FQO A;  3VRN A;  1FI6 A;  1QVI Z;  2KAY A;  3BUX B;  4PHK A;  1CTR A;  3O6B A;  1DGU A;  1K9K A;  3DF0 B;  3NXA A;  1H8B A;  1N65 A;  5HKZ A;  3EK4 A;  1L2O B;  1J7Q A;  1NCX A;  2HF5 A;  4XYN A;  1GGW A;  2A4J A;  1RRO A;  1BU3 A;  2AMI A;  1B1G A;  1A4P A;  1V1F A;  3OX5 A;  2M7L A;  2NXQ A;  2M8U A;  1BJF A;  3LK1 A;  3EKH A;  5HYD A;  1SCM C;  1KQM B;  2E6W A;  1RK9 A;  2HQW A;  1M39 A;  4CPV A;  2L50 A;  1CFP A;  1JF0 A;  1FF1 A;  4MSP A;  1YTZ C;  2LP3 A;  5DKQ A;  1IWQ A;  1JUO A;  1F55 A;  1L7Z A;  2M1U A;  1MR8 A;  2L5X B;  3FWC A;  4YBH B;  2LLS A;  1JFK A;  2ZND A;  5KSZ A;  1OZS A;  2GV5 A;  1CB1 A;  3I5F C;  5CSJ A;  1ZAC A;  1XFW O;  2M9G A;  2JOJ A;  4NDD A;  1CM1 A;  2KFG A;  4WQ3 A;  1J1E A;  4ORB B;  2KBM A;  1NX1 A;  2Y1M A;  5B8I B;  4E68 A;  3EKJ A;  1J55 A;  1AJ4 A;  2ISD A;  2MBX A;  1QXP A;  2NZ0 A;  3KHE A;  4HSZ A;  2WCE A;  1QAT A;  1WLZ A;  3JVT C;  1C07 A;  1K2H A;  1QIV A;  2BKH B;  2ZKM X;  1DMO A;  1B7T Z;  2JT3 A;  1B8C A;  5ER5 A;  4JQ0 D;  1IQ5 A;  1IGV A;  3SG4 A;  2LCP A;  1LA0 A;  2KDH A;  3WHU B;  1A75 A;  1S26 D;  1DTL A;  1J7P A;  3ZWH A;  3PN7 C;  4NDB A;  2WCB A;  1AJ5 A;  1CDP A;  3MSE B;  2JTZ A;  3TDU A;  1PVB A;  5I8N A;  4TNC A;  5D7F A;  1QS7 A;  4QJ3 B;  3KEV A;  3DVJ A;  1IG5 A;  1M46 A;  1SRA A;  2PVB A;  2BCB A;  4USL A;  3TDZ A;  3WXA A;  4GPL B;  3NSK A;  3OB2 B;  2CNP A;  2KI4 B;  1A75 B;  1KSO A;  1HQV A;  1LVC D;  1B7T Y;  1MUX A;  1NYA A;  1S1E A;  2WOS A;  2JPT A;  1PVA A;  2JT0 A;  4PE1 A;  1SCV A;  2BCX A;  3CLN A;  4GUK A;  2WND A;  4XJK A;  1SCM B;  1AK8 A;  1LIN A;  5HKW A;  4BY5 A;  2HPS A;  1BR4 B;  1M63 B;  2JNX A;  1NIW A;  5DKR A;  1PRW A;  2K7C A;  1F70 A;  5JJG A;  2TN4 A;  2BE6 A;  2OTG C;  3VRO A;  3CGA A;  3EVR A;  4I5J A;  4WRI A;  3GOF A;  4YGB B;  1Y1X A;  2JRF A;  1REC A;  2AAO A;  3BUN B;  1K8U A;  1UHJ A;  2LVI A;  1K95 A;  1DVI A;  5F6T A;  1RTP 1;  3I5F B;  4MLW A;  1CDM A;  2QPT A;  1QX7 A;  1DJW A;  4FTG A;  4XJK B;  2G9B A;  2FCE A;  3LLE A;  1SNL A;  4GGN A;  2CBL A;  3PSR A;  4N5X A;  1JSA A;  1IJ5 A;  2K0J A;  3PAT A;  4DIR A;  1TN4 A;  3SG3 A;  2KYC A;  3VRP A;  3WNX B;  1BLQ A;  1RWY A;  5HLV A;  4ETO A;  1SL9 A;  1YUR A;  2KI6 C;  4I5L B;  2ZFD A;  4C0L A;  2VRG A;  3BUW B;  1G4Y R;  3JVT B;  2LAP A;  1MXL C;  1B47 A;  2LLU A;  1GJY A;  3IF7 A;  5I2O A;  3I5G C;  4M2P A;  1CDN A;  1KFX S;  1K96 A;  2CT9 A;  5AXI A;  3PM8 A;  4NDC A;  1YX7 A;  1TNP A;  1HT9 A;  2Y5I A;  2PAL A;  1PK0 D;  1SR6 B;  3ICB A;  1WDC C;  1YUT A;  3SJS A;  2K7B A;  1TOP A;  2ZNE A;  1SL8 A;  2NCO A;  1J1D A;  1SBJ A;  2L51 A;  1QIW A;  1NUB A;  2LM5 A;  2M49 B;  4PDZ A;  1TIZ A;  3I5H C;  3HX4 A;  1DGV A;  1BT6 A;  2QAC A;  4PE0 A;  3CTN A;  1NX3 A;  1XFU O;  2BCA A;  1KK7 Z;  1SL7 A;  1XFZ O;  1E8A A;  1KWO C;  2LP2 A;  1YVL A;  3VRR A;  1DJZ A;  3LK0 A;  5IBW A;  1MHO A;  4MEW A;  2M29 A;  3GK2 A;  2EC6 C;  2LMV A;  5D69 A;  1TNW A;  4D1E A;  5G08 A;  4PCW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...