5ER5A

Crystal structure of calcium-loaded s100b bound to sc1990
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
90
structure length
90
Chain Sequence
MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein/inhibitor
molecule keywords Protein S100-B
publication title Novel protein-inhibitor interactions in site 3 of Ca(2+)-bound S100B as discovered by X-ray crystallography.
pubmed doi rcsb
source organism Bos taurus
total genus 32
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2015-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5er5A00
2BCAA 5ER5A 2L51A 3BOWB 2M49B 5I8NA 5D7FA 3NSOA 4YI8A 1OE9B 3KHEA 3TZ1A 1EG3A 4PALA 2Q91A 3BXKA 3OX5A 2LVIA 2JXCA 1F4OA 1L2OB 2KGBC 4GGFC 4U8DA 5KSZA 1RTP1 1MXEA 2K2FA 2LP3A 5FYXA 2NLNA 2LC5A 1MF8B 5ER4X 2P6BB 4MZKA 1PK0D 1X02A 1A75B 1DGUA 2LVKA 2PSRA 1N2DA 4ZCUA 2K2AA 1FF1A 4HSZA 2M8UA 1IWQA 3JTDB 4CLNA 5I2OA 2FCDA 3OB2B 1NX1A 1YUTA 1DMOA 1TNPA 1M39A 1Y6WA 1ALVA 1NPQA 1S1EA 1U5IB 4CFRA 2M3WA 2QPTA 2HPSA 2F2PA 4MN0A 1VRKA 3AKBA 3SG3A 4PHJA 3I5GC 4PE1A 3JVTB 4L9MA 4HREE 2Y5IA 2M7LA 1NP8A 2LMVA 1KK7Y 5HKWA 1M46A 3LCPC 1BR4B 4I5KA 2K8MB 1HQVA 2M9GA 3BUNB 1EXRA 1MWNA 1QTXA 2JTZA 3CR5X 1L7ZA 1XK4A 2MRDA 5HLVA 2M1KB 2KBIA 2ZRTA 2NCPA 4AQIA 3CTNA 5JJGA 2JZIA 4FQOA 4CPVA 1M45A 2ZKMX 1S6JA 1A4PA 1CLLA 3O2PA 1CDMA 1N65A 1F54A 2GGZA 2KDHA 3OHMB 1S6CA 1M63B 2CBLA 3CS1A 1JF0A 2E6WA 1ZACA 2JNFA 2TN4A 1Y1AA 1D1OA 3M0WA 2HETA 1SR6C 1AP4A 1LVCD 3GK4X 1CB1A 1SL8A 1SW8A 1DJXA 3TS5B 1DJHA 2BE4A 1F55A 2LHLA 1LA0A 2I18A 1IQ3A 1SKTA 1HT9A 3A4UB 3EVVA 1J7PA 1QS7A 1YRUB 1UHJA 1QATA 5AERA 5I2LA 2LUCA 2M0RA 4A4CA 4NQGA 4ICBA 1QJTA 5HKZA 1FPWA 1J1EA 3DVEA 1CM4A 1YVHA 2HQ8A 2F3YA 4OR9B 4ZCVA 1RROA 1BOCA 1QX7A 1F71A 1SCVA 4QJ4B 4DRWA 4P2YB 1UP5A 2M1UA 4GUKA 1OMDA 1SK6D 5I2QA 2LHIA 1FI5A 2WORA 3OX6A 1DJYA 2PVBA 3KEVA 4MZJA 3SG4A 2JQ6A 4WQ2A 2KAXA 4DUQA 1R2UA 1SR6B 2H61A 1NUBA 1WRLA 2EGDA 2IS9A 1RWYA 2L4IA 4PHKA 5DKQA 4Q04A 2I2RE 1FW4A 1WLMA 1KFXS 3TUYC 2SCPA 1IGVA 4ORAB 4YGBB 2BBNA 1B47A 1N0YA 2G9BA 1DF0A 1KFUS 1W7JB 1UHKA 1QX2A 2H2KA 2OTGC 4WQ3A 1B8LA 4MBEA 4XYNA 1QV0A 3F45A 1B7TZ 1K8UA 3SG2A 4PHNA 5BPJA 3WHUB 2V53A 4CIDA 1XYDA 4WRIA 2WOSA 2Y4QA 4ETOA 2BKIB 1FBVA 2MLEC 2KGRA 3FWCA 1XVJA 2KI4C 2BKHB 4I5NB 5GQQC 1B8RA 5KTYA 1NX2A 1S5GZ 3IQOA 2PMYA 3KPXA 5HKYA 2KAVA 2GGMA 1J55A 1KFXL 2JTTA 2KNEA 4JWQA 1C7WA 3PLFB 4QJ5B 1K9KA 3LK0A 3H4SE 1S36A 1NX0A 2MLFC 4DIRA 1RFJA 2K7DA 2O5GA 3BOWA 2KFHA 3RM1A 1QIWA 1SYMA 3VRPA 1EL4A 1JFKA 2GV5A 3EKJA 1B8CA 2LE9B 2KQ6A 2Q4UA 4HRHA 2Y1NA 2BE6A 2KBMA 2LV7A 3I5HC 2PASA 2KYFA 2PALA 1KSMA 3SJSA 4MVFA 5B8IB 2EC6B 1ZMZA 1A75A 1WRKA 3I5IB 1K90D 2WCFA 4UPGA 1LA3A 1BODA 2M29A 3DD4A 1U5IA 2I94A 2KI4B 1ZUZA 2LLTA 3QRXA 1AVSA 3WNXB 2JPTA 2OS8C 1A2XA 3FS7A 4YBHB 1CFFA 4YGDB 1AJ4A 1QVIZ 2F2OA 1M31A 2CNPA 2BL0C 1DJGA 1JF2A 3SIBA 2E30A 4DS7A 1PSRA 5IBWA 1B7TY 1AHRA 3DVKA 3PATA 3C1VA 4PE0A 4A4BA 1KQMC 1C07A 2FCEA 2JULA 3GK2A 3PN7C 2WCEA 3SG6A 3LLEA 1XO5A 1S26D 1S6IA 1JC2A 2LMUA 1QIVA 2K7OA 4PDZA 4NDBA 3ZNIA 2K7CA 2F33A 4GGFA 3RLZA 3KO0A 2LANA 1S5GY 3I5HB 5TNCA 3TDZA 2AMIA 3BUOB 1A03A 3VGOA 2BBMA 1KWOC 4I5LB 1UURA 1GGWA 4OKHA 1TRFA 1B9AA 1IJ5A 2LLUA 4PCWA 2JU0A 1WY9A 4M2QA 4OV2A 3I5GB 1CDPA 1JBAA 1TTXA 1G33A 2NXQA 4HRGA 1JUOA 3SG7A 1SL7A 1CMFA 1QLSA 1K9UA 2M97A 1H4BA 4GAOA 3EK7A 5CSJA 3DVMA 2KYCA 1QXPA 2M7NA 4PHMA 1KQMB 1UHIA 1QLKA 3BUWB 2HF5A 1Y1UA 1UUSA 1CDNA 2LM5A 1V1GA 1GGZA 1NCZA 1AUIB 1F8HA 1SMGA 1S3PA 2LLSA 1F4QA 1TCOB 4YGAA 1QVIY 3EVUA 2ISDA 1K96A 3BUXB 2I7AA 1K9PA 1YVLA 1KWOB 3WHTB 4OVNF 3CLNA 4GNKB 2JRFA 1PVBA 2ZN8A 1JSAA 1YUSA 2F3ZA 3VRQA 3IF7A 2ZNDA 1YX8A 1EJ3A 1WDCC 3EK4A 2CCMA 1DTLA 4C0JA 2F8PA 2L50A 2CT9A 4NDCA 3SIAA 1BT6A 1ODBA 3PALA 1OQPA 1J7OA 1GQMA 5DKRA 1BLQA 4PE7A 4N1GA 1ZFSA 3GOFA 2K0JA 5CSFA 1QX5B 1JFJA 1QASA 1BF5A 2JXLA 2EHBA 3D0YB 4R1EA 1B1GA 2FOTA 1CMGA 2MAZA 4M2PA 4D1EA 1AK8A 5PALA 1R6PA 2KI6C 2LNKA 5HLOA 3K21A 1ZOTB 1V1FA 1CFPA 4GFTA 3CR2A 1YTZC 4PE4A 4ORBB 1TOPA 1KCYA 1DT7B 1TNQA 3DF0B 1K2HA 4XJKB 1YUUA 2KSPA 1K95A 1CKKA 1CNPA 1IRJA 1CM1A 1G4YR 4QJ3B 3I5FC 3JTDC 1KFUL 1UHNA 1WDCB 5CSNA 2O60A 1UHHA 1NWDA 3TUYB 2JT0A 1OOJA 3GK1A 1CLMA 1TCFA 1EH2A 2R2IA 1K94A 1RK9A 3NXAA 3NSKA 2CTNA 1IH0A 2OTGB 1BJFA 4ORCB 5F6TA 4FTGA 1UWOA 1XK4C 2AAOA 1DJZA 3TDUA 1DGVA 1TNWA 1CFDA 3ICBA 5DKNA 1LKJA 1OSAA 2K7BA 3IQQA 4IL1A 2LP2A 4YGCB 1CFCA 3AAJA 2KQYA 4YGEB 2ZNEA 2CXJA 1BG1A 3PSRA 3AKAA 1IJ6A 1NIWA 2JWWA 2D8NA 2L98A 3MSEB 4JQ0D 1XFXO 3NSLA 1SL9A 2MBXA 2JT8A 1G8IA 4JPZB 4P5OE 1J7QA 2L5XB 1FI6A 1PALA 1Y0VH 3I5FB 1PSBA 3PFVA 4N5XA 2AUCA 1SRAA 1OMVA 1NCXA 3SG5A 5K89A 1PRWA 4I5JA 3TS5C 3ZWHA 4AQJA 2B1UA 1EG4A 2WNDA 1KSOA 1WRZA 1KQVA 1B4CA 3HCMA 4USLA 2FJUB 3KF9A 5D69A 4M2OA 3CR4X 1C7VA 4MEWA 2LVJA 5HYDA 2JNXA 3HX4A 1H8BA 2WCBA 2LAPA 2KFFA 2PRUA 2KFGA 1XFYO 2HQWA 2KI6D 1BR1B 1NX3A 1PVAA 1MUXA 1AJ5A 4MZLA 3CZTX 4TNCA 2KOTA 2NCOA 1IQ5A 2OS8B 1QV1A 4F0ZB 4YI9A 1MXLC 2DOQA 1NYAA 2BCBA 1BU3A 1E8AA 2KAYA 2L2EA 2MA2A 2BL0B 1BMOA 1LXFC 2LVVA 1ALWA 3NSIA 1J7RA 1KK8C 1OZSA 2H61C 2K61A 3EK8A 1WLZA 1SCMC 3EKHA 5CSIA 3TDIA 3BQ3A 3WXAA 1CTRA 2BCXA 3PN7B 1TIZA 3BUMB 3CGAA 4MSPA 2JC2A 3AAKA 1SNLA 1XFZO 4OCIA 2LCPA 1DJWA 1LINA 5J3XA 1TN4A 2BECA 5AEQA 5AXIA 1J1DA 4GBAA 3LL8B 2QACA 3A8RA 5G08A 1YR5A 1A29A 2OPOA 5KU1A 4CFQA 1W7IB 2ZRSA 3EVRA 1CLBA 1Q80A 4BY5A 2A4JA 2L0PA 3BYAA 1PULA 1K93D 4C0LA 4DCKA 2L4HA 3O4YA 1TNXA 1YURA 1XFWO 1XFVO 4BY4A 1RECA 1F70A 1XA5A 2VRGA 1KK8B 1GJYA 1SBJA 1SCMB 3D10A 5AANA 4MRXA 1JWDA 1OZOA 3FWBA 2MJWB 1Y1XA 4NDDA 1MQ1A 2MHHA 4MRYA 1CDLA 1SY9A 3E3RA 2SASA 3D0YA 1DF0B 2Y1MA 3O6BA 1YRTB 2JT3A 1SPYA 2COLB 1XFUO 2LUXA 2ZN9A 1L2OC 4GGNA 1IKUA 1DJIA 2LMTA 3OB1B 4YRUA 1NCYA 1KK7Z 4GPLB 5AFPA 2KHNA 3DVJA 4MLWA 3VROA 4C0KA 1MR8A 3VRRA 5JOLA 3DF0A 3LK1A 4XJKA 1YX7A 2EC6C 3CWGA 3I5IC 4N1FA 1MHOA 2G2BA 2RGIA 3VRNA 3O78A 1NSHA 1OMRA 2JOJA 3FIAA 5CPVA 2ZFDA 4AOMA 3JVTC 1IG5A 3PM8A 4E68A 1DVIA 1RJVA 2NZ0A 2WC8A 3OP0A
chains in the Genus database with same CATH superfamily
2BCAA 5ER5A 2L51A 3BOWB 2M49B 5I8NA 5D7FA 3NSOA 4YI8A 1OE9B 3KHEA 3TZ1A 1EG3A 4PALA 2Q91A 3BXKA 3OX5A 2LVIA 2JXCA 1F4OA 1L2OB 2KGBC 4GGFC 4U8DA 5KSZA 1RTP1 3FE9A 1MXEA 3K1EA 2K2FA 2LP3A 5FYXA 2NLNA 2LC5A 1MF8B 5ER4X 2P6BB 4MZKA 1PK0D 1X02A 1A75B 1DGUA 2LVKA 2PSRA 1N2DA 4ZCUA 3FE8A 2K2AA 1FF1A 4HSZA 2M8UA 1IWQA 3JTDB 4CLNA 5I2OA 2FCDA 3OB2B 1NX1A 1YUTA 1DMOA 1TNPA 1M39A 1Y6WA 1ALVA 1NPQA 1S1EA 1U5IB 4CFRA 2QEOA 2M3WA 2QPTA 2HPSA 2F2PA 4MN0A 1VRKA 3AKBA 3SG3A 1P28A 4PHJA 3I5GC 4PE1A 3JVTB 4L9MA 4HREE 2Y5IA 2M7LA 1NP8A 2LMVA 1KK7Y 5HKWA 3S0FA 1M46A 3LCPC 1BR4B 3R1OA 4I5KA 2K8MB 1HQVA 2M9GA 3BUNB 1EXRA 3O4XA 1MWNA 1QTXA 2JTZA 3CR5X 1L7ZA 1XK4A 2MRDA 5HLVA 2M1KB 2KBIA 4INXA 2ZRTA 2NCPA 4AQIA 3CTNA 5JJGA 2JZIA 4FQOA 4CPVA 1M45A 2BNXA 2ZKMX 1S6JA 3L4AA 1A4PA 1CLLA 3O2PA 1CDMA 1N65A 1F54A 2GGZA 2KDHA 3OHMB 1S6CA 2QEVA 1M63B 2CBLA 3CS1A 1JF0A 2E6WA 1ZACA 2JNFA 2TN4A 1Y1AA 1D1OA 3M0WA 2HETA 1SR6C 1AP4A 1LVCD 3GK4X 1CB1A 2QEHA 1QWVA 1SL8A 1SW8A 1DJXA 3R1PA 3TS5B 1DJHA 2BE4A 1F55A 2LHLA 1LA0A 2I18A 3S0BA 1SKTA 1HT9A 3A4UB 3EVVA 1IQ3A 1J7PA 3CZ0A 1QS7A 1YRUB 1UHJA 1QATA 5AERA 5I2LA 2KPHA 2LUCA 2M0RA 4A4CA 4NQGA 4ICBA 1QJTA 5HKZA 1FPWA 1J1EA 3DVEA 3BJHA 1CM4A 1YVHA 2HQ8A 2P71A 2F3YA 4OR9B 4ZCVA 1RROA 1BOCA 1QX7A 1F71A 1SCVA 4QJ4B 4DRWA 4P2YB 1UP5A 2M1UA 4GUKA 1OMDA 1SK6D 5I2QA 2LHIA 1LS8A 1FI5A 2WORA 3OX6A 1DJYA 2PVBA 3Q8IA 3KEVA 4MZJA 3SG4A 2JQ6A 4WQ2A 2KAXA 4DUQA 1R2UA 1SR6B 2H61A 5FI2A 1NUBA 1WRLA 2EGDA 2IS9A 1RWYA 2L4IA 4PHKA 5DKQA 4Q04A 2I2RE 1FW4A 1WLMA 1KFXS 3TUYC 2SCPA 1IGVA 4ORAB 4YGBB 2BBNA 1B47A 1N0YA 2G9BA 1DF0A 1KFUS 1W7JB 2PYQA 1UHKA 1QX2A 2H2KA 3B86A 2OTGC 4WQ3A 1B8LA 4MBEA 4XYNA 1QV0A 3F45A 1B7TZ 1K8UA 3SG2A 4PHNA 5BPJA 3WHUB 2V53A 4CIDA 1XYDA 2L5YA 4WRIA 2WOSA 2Y4QA 3UNWA 2BKIB 4ETOA 3IVTA 1FBVA 3EG5B 3S0AA 2MLEC 2KGRA 3FWCA 1XVJA 2KI4C 2BKHB 4I5NB 5D3OA 5GQQC 1B8RA 1OOGA 5KTYA 1NX2A 1S5GZ 3IQOA 2PMYA 3KPXA 5HKYA 2KAVA 2GGMA 1J55A 1KFXL 2JTTA 2KNEA 4JWQA 1C7WA 3PLFB 4QJ5B 1K9KA 3CABA 3LK0A 3H4SE 1S36A 1NX0A 2MLFC 4DIRA 1RFJA 2K7DA 2O5GA 3BFHA 2KFHA 3BOWA 3D73A 3NHTA 4INWA 1QIWA 1SYMA 1Z2CB 3RM1A 3VRPA 4F7FA 1EL4A 1JFKA 2GV5A 3EKJA 1B8CA 2LE9B 2ERBA 2KQ6A 2Q4UA 3BFAA 4HRHA 2Y1NA 2QEBA 2BE6A 2KBMA 2LV7A 3I5HC 2PASA 2KYFA 2PALA 1KSMA 3R72A 4MVFA 3SJSA 5B8IB 2EC6B 1ZMZA 1A75A 1WRKA 3I5IB 1K90D 2WCFA 4UPGA 1LA3A 1BODA 2M29A 3OGNA 1SSEB 3DD4A 1U5IA 2I94A 2KI4B 1ZUZA 2YGUA 2LLTA 3QRXA 1AVSA 3WNXB 2JPTA 2OS8C 1A2XA 3FS7A 4YBHB 1CFFA 4YGDB 1AJ4A 1QVIZ 2F2OA 1M31A 2CNPA 1DJGA 2BL0C 1JF2A 2H8VA 3SIBA 2E30A 4DS7A 1PSRA 3SS3A 3D78A 5IBWA 5I94A 1B7TY 1AHRA 3DVKA 3PATA 3C1VA 4PE0A 4A4BA 1KQMC 1C07A 2FCEA 2JULA 3GK2A 3PN7C 2WCEA 3SG6A 3LLEA 1XO5A 2WC6A 1S26D 1S6IA 1JC2A 2LMUA 1QIVA 2K7OA 3UO9A 4PDZA 4NDBA 3ZNIA 2K7CA 2F33A 4GGFA 3RLZA 3KO0A 1ORGA 2LANA 1S5GY 3I5HB 5TNCA 3TDZA 2AMIA 3BUOB 4JKTA 1A03A 3VGOA 2BBMA 1KWOC 4I5LB 1UURA 1GGWA 4OKHA 1TRFA 1B9AA 1IJ5A 2LLUA 2PQLA 4PCWA 2GTEA 1WY9A 2JU0A 4M2QA 4KYNA 4OV2A 3B88A 3I5GB 1CDPA 1JBAA 3RZSA 3B7AA 1TTXA 1G33A 2NXQA 2WCJA 1JUOA 4HRGA 3SG7A 1SL7A 1CMFA 1QLSA 1K9UA 2M97A 1H4BA 4GAOA 3EK7A 5CSJA 3DVMA 2KYCA 1QXPA 2M7NA 4PHMA 1KQMB 1UHIA 1QLKA 3L4LA 3BUWB 1C3ZA 2HF5A 1Y1UA 1UUSA 1CDNA 2LM5A 1V1GA 1GGZA 1NCZA 1AUIB 1F8HA 1SMGA 1S3PA 2LLSA 3D74A 1F4QA 1TCOB 4YGAA 1QVIY 3EVUA 2ISDA 4IJ7A 1K96A 3BUXB 2I7AA 1K9PA 1YVLA 1KWOB 3WHTB 4OVNF 3CLNA 1DELA 4GNKB 2JRFA 1PVBA 2ZN8A 1JSAA 1YUSA 2F3ZA 3VRQA 3IF7A 2ZNDA 2WCLA 1YX8A 1EJ3A 1WDCC 3EK4A 2CCMA 1DTLA 4C0JA 5HL1A 2F8PA 2L50A 1TUJA 2CT9A 4NDCA 3SIAA 1BT6A 1ODBA 1TWOA 3PALA 1OQPA 1DC1A 1J7OA 1GQMA 5DKRA 1BLQA 4PE7A 3D76A 4N1GA 1ZFSA 1Z4HA 2K0JA 3GOFA 1QX5B 5CSFA 1JFJA 1QASA 3CYZA 1BF5A 2JXLA 5DICA 3D75A 2EHBA 3D0YB 4R1EA 1B1GA 2FOTA 1CMGA 2MAZA 4M2PA 4D1EA 1AK8A 5PALA 1R6PA 2KI6C 2LNKA 5HLOA 3K21A 1ZOTB 1V1FA 1CFPA 4GFTA 3CR2A 1YTZC 4PE4A 4ORBB 1TOPA 1KCYA 3B87A 1DT7B 1TNQA 2WCHA 3DF0B 1K2HA 4XJKB 1YUUA 3SS5A 2KSPA 1K95A 1CKKA 1CNPA 1IRJA 1CM1A 1G4YR 3DYEA 3I5FC 3QMEA 3JTDC 1KFUL 1UHNA 4QJ3B 1WDCB 5CSNA 2O60A 1UHHA 1NWDA 3TUYB 2JT0A 1OOJA 3GK1A 1CLMA 1TCFA 1EH2A 2R2IA 1K94A 1RK9A 3NXAA 3NSKA 2CTNA 1IH0A 2OTGB 1BJFA 2FJYA 4ORCB 5F6TA 4FTGA 1UWOA 1XK4C 2AAOA 1DJZA 3N7HA 3TDUA 1DGVA 1TNWA 1CFDA 3ICBA 3O6BA 5FI6A 5DKNA 1LKJA 1OSAA 2K7BA 3CZ1A 3IQQA 2LP2A 4IL1A 4YGCB 1CFCA 3AAJA 5EL2A 2KQYA 3B6XA 2ZNEA 2CXJA 4YGEB 1BG1A 3PSRA 3S0DA 3AKAA 1IJ6A 1NIWA 2JWWA 2D8NA 2L98A 3MSEB 4JQ0D 1XFXO 3NSLA 1DEKA 1SL9A 2MBXA 2JT8A 1G8IA 4JPZB 2WCMA 4P5OE 1J7QA 2L5XB 1FI6A 1PALA 1Y0VH 3I5FB 1PSBA 3PFVA 3S0EA 4N5XA 2AUCA 3DZTA 3CZ2A 1SRAA 1OMVA 1NCXA 3SG5A 5K89A 1PRWA 4I5JA 3TS5C 3ZWHA 3FE6A 4AQJA 2B1UA 1EG4A 2WNDA 3NGVA 1KSOA 1WRZA 1KQVA 3DY9A 1B4CA 3HCMA 4USLA 2FJUB 3KF9A 4OZDA 5D69A 4M2OA 1GM0A 3CR4X 2KLEA 4MEWA 1C7VA 2LVJA 5HYDA 2JNXA 3HX4A 1H8BA 2WCBA 2LAPA 1OW4A 2KFFA 2PRUA 2KFGA 3V2LA 1XFYO 2HQWA 2KI6D 1BR1B 1NX3A 1PVAA 1MUXA 1AJ5A 4MZLA 1T14A 3CZTX 4TNCA 2KOTA 1OOHA 2NCOA 1IQ5A 2OS8B 1QV1A 4F0ZB 4YI9A 1MXLC 2DOQA 1NYAA 1BU3A 2BCBA 1E8AA 2KAYA 2L2EA 2MA2A 2BL0B 1BMOA 1LXFC 2LVVA 1ALWA 3NSIA 4PT1A 1J7RA 1KK8C 1OZSA 2H61C 2K61A 2WC5A 3EK8A 1WLZA 3OBVA 1SCMC 3EKHA 3PM2A 3D77A 3BQ3A 5CSIA 3TDIA 3WXAA 1CTRA 2BCXA 3PN7B 1TIZA 1OOIX 3BUMB 3CGAA 4MSPA 2JC2A 3AAKA 1SNLA 1XFZO 4OCIA 2LCPA 1DJWA 1LINA 3NHIA 1TN4A 5J3XA 1C3YA 2BECA 5AEQA 5AXIA 1J1DA 4GBAA 3LL8B 3VB1A 1IIOA 2QACA 3A8RA 5FI7A 5G08A 1YR5A 1A29A 2OPOA 5KU1A 4CFQA 3S0GA 1W7IB 2ZRSA 3EVRA 2K60A 1CLBA 2JPOA 1Q80A 4BY5A 2A4JA 2KLDA 2L0PA 1DQEA 3BYAA 3SS4A 1PULA 1K93D 4C0LA 4DCKA 2L4HA 3O4YA 1TNXA 1YURA 1XFWO 1XFVO 4BY4A 2QDIA 1RECA 1W9ZA 1F70A 1XA5A 1TUZA 2VRGA 4JD9A 1KK8B 1GJYA 1SBJA 1SCMB 3D10A 5AANA 2L2CA 4MRXA 3BFBA 1JWDA 1OZOA 3FWBA 2MJWB 1Y1XA 4NDDA 1MQ1A 2MHHA 4MRYA 1CDLA 1SY9A 3E3RA 2SASA 3D0YA 1DF0B 1OOFA 2Y1MA 1YRTB 2JT3A 1SPYA 2COLB 1XFUO 2LUXA 2ZN9A 1L2OC 4GGNA 1IKUA 1DJIA 2LMTA 3OB1B 4YRUA 1NCYA 1KK7Z 3R1VA 4GPLB 5AFPA 3DXLA 2KHNA 3DVJA 2WCKA 4MLWA 3VROA 4C0KA 1MR8A 3VRRA 3CDNA 5JOLA 3DF0A 3LK1A 3PJIA 4FQTA 4XJKA 2P70A 1YX7A 2EC6C 3CWGA 3I5IC 2BAPA 4N1FA 1MHOA 1XFRA 2G2BA 2RGIA 3VRNA 3O78A 1NSHA 1OMRA 2JOJA 3FIAA 5CPVA 2ZFDA 3L47A 4AOMA 3JVTC 1IG5A 3PM8A 4E68A 1DVIA 1RJVA 2NZ0A 2WC8A 3OP0A
chains in the Genus database with same CATH topology
2BCAA 5ER5A 2L51A 3BOWB 2M49B 5I8NA 5D7FA 3NSOA 4YI8A 1OE9B 3KHEA 3TZ1A 1EG3A 4PALA 2Q91A 3BXKA 3OX5A 2LVIA 2JXCA 1F4OA 1L2OB 2KGBC 4GGFC 4U8DA 5KSZA 1RTP1 1MXEA 2K2FA 2LP3A 5FYXA 2NLNA 2LC5A 1MF8B 5ER4X 2P6BB 4MZKA 1PK0D 1X02A 1A75B 1DGUA 2LVKA 2PSRA 1N2DA 4ZCUA 2K2AA 1FF1A 4HSZA 2M8UA 1IWQA 3JTDB 4CLNA 5I2OA 2FCDA 3OB2B 1NX1A 1YUTA 1DMOA 1TNPA 1M39A 1Y6WA 1ALVA 1NPQA 1S1EA 1U5IB 4CFRA 2M3WA 2QPTA 2HPSA 2F2PA 4MN0A 1VRKA 3AKBA 3SG3A 4PHJA 3I5GC 4PE1A 3JVTB 4L9MA 4HREE 2Y5IA 2M7LA 1NP8A 2LMVA 1KK7Y 5HKWA 1M46A 3LCPC 1BR4B 4I5KA 2K8MB 1HQVA 2M9GA 3BUNB 1EXRA 1MWNA 1QTXA 2JTZA 3CR5X 1L7ZA 1XK4A 2MRDA 5HLVA 2M1KB 2KBIA 2ZRTA 2NCPA 4AQIA 3CTNA 5JJGA 2JZIA 4FQOA 4CPVA 1M45A 2ZKMX 1S6JA 1A4PA 1CLLA 3O2PA 1CDMA 1N65A 1F54A 2GGZA 2KDHA 3OHMB 1S6CA 1M63B 2CBLA 3CS1A 1JF0A 2E6WA 1ZACA 2JNFA 2TN4A 1Y1AA 1D1OA 3M0WA 2HETA 1SR6C 1AP4A 1LVCD 3GK4X 1CB1A 1SL8A 1SW8A 1DJXA 3TS5B 1DJHA 2BE4A 1F55A 2LHLA 1LA0A 2I18A 1IQ3A 1SKTA 1HT9A 3A4UB 3EVVA 1J7PA 1QS7A 1YRUB 1UHJA 1QATA 5AERA 5I2LA 2LUCA 2M0RA 4A4CA 4NQGA 4ICBA 1QJTA 5HKZA 1FPWA 1J1EA 3DVEA 1CM4A 1YVHA 2HQ8A 2F3YA 4OR9B 4ZCVA 1RROA 1BOCA 1QX7A 1F71A 1SCVA 4QJ4B 4DRWA 4P2YB 1UP5A 2M1UA 4GUKA 1OMDA 1SK6D 5I2QA 2LHIA 1FI5A 2WORA 3OX6A 1DJYA 2PVBA 3KEVA 4MZJA 3SG4A 2JQ6A 4WQ2A 2KAXA 4DUQA 1R2UA 1SR6B 2H61A 1NUBA 1WRLA 2EGDA 2IS9A 1RWYA 2L4IA 4PHKA 5DKQA 4Q04A 2I2RE 1FW4A 1WLMA 1KFXS 3TUYC 2SCPA 1IGVA 4ORAB 4YGBB 2BBNA 1B47A 1N0YA 2G9BA 1DF0A 1KFUS 1W7JB 1UHKA 1QX2A 2H2KA 2OTGC 4WQ3A 1B8LA 4MBEA 4XYNA 1QV0A 3F45A 1B7TZ 1K8UA 3SG2A 4PHNA 5BPJA 3WHUB 2V53A 4CIDA 1XYDA 4WRIA 2WOSA 2Y4QA 4ETOA 2BKIB 1FBVA 2MLEC 2KGRA 3FWCA 1XVJA 2KI4C 2BKHB 4I5NB 5GQQC 1B8RA 5KTYA 1NX2A 1S5GZ 3IQOA 2PMYA 3KPXA 5HKYA 2KAVA 2GGMA 1J55A 1KFXL 2JTTA 2KNEA 4JWQA 1C7WA 3PLFB 4QJ5B 1K9KA 3LK0A 3H4SE 1S36A 1NX0A 2MLFC 4DIRA 1RFJA 2K7DA 2O5GA 3BOWA 2KFHA 3RM1A 1QIWA 1SYMA 3VRPA 1EL4A 1JFKA 2GV5A 3EKJA 1B8CA 2LE9B 2KQ6A 2Q4UA 4HRHA 2Y1NA 2BE6A 2KBMA 2LV7A 3I5HC 2PASA 2KYFA 2PALA 1KSMA 3SJSA 4MVFA 5B8IB 2EC6B 1ZMZA 1A75A 1WRKA 3I5IB 1K90D 2WCFA 4UPGA 1LA3A 1BODA 2M29A 3DD4A 1U5IA 2I94A 2KI4B 1ZUZA 2LLTA 3QRXA 1AVSA 3WNXB 2JPTA 2OS8C 1A2XA 3FS7A 4YBHB 1CFFA 4YGDB 1AJ4A 1QVIZ 2F2OA 1M31A 2CNPA 2BL0C 1DJGA 1JF2A 3SIBA 2E30A 4DS7A 1PSRA 5IBWA 1B7TY 1AHRA 3DVKA 3PATA 3C1VA 4PE0A 4A4BA 1KQMC 1C07A 2FCEA 2JULA 3GK2A 3PN7C 2WCEA 3SG6A 3LLEA 1XO5A 1S26D 1S6IA 1JC2A 2LMUA 1QIVA 2K7OA 4PDZA 4NDBA 3ZNIA 2K7CA 2F33A 4GGFA 3RLZA 3KO0A 2LANA 1S5GY 3I5HB 5TNCA 3TDZA 2AMIA 3BUOB 1A03A 3VGOA 2BBMA 1KWOC 4I5LB 1UURA 1GGWA 4OKHA 1TRFA 1B9AA 1IJ5A 2LLUA 4PCWA 2JU0A 1WY9A 4M2QA 4OV2A 3I5GB 1CDPA 1JBAA 1TTXA 1G33A 2NXQA 4HRGA 1JUOA 3SG7A 1SL7A 1CMFA 1QLSA 1K9UA 2M97A 1H4BA 4GAOA 3EK7A 5CSJA 3DVMA 2KYCA 1QXPA 2M7NA 4PHMA 1KQMB 1UHIA 1QLKA 3BUWB 2HF5A 1Y1UA 1UUSA 1CDNA 2LM5A 1V1GA 1GGZA 1NCZA 1AUIB 1F8HA 1SMGA 1S3PA 2LLSA 1F4QA 1TCOB 4YGAA 1QVIY 3EVUA 2ISDA 1K96A 3BUXB 2I7AA 1K9PA 1YVLA 1KWOB 3WHTB 4OVNF 3CLNA 4GNKB 2JRFA 1PVBA 2ZN8A 1JSAA 1YUSA 2F3ZA 3VRQA 3IF7A 2ZNDA 1YX8A 1EJ3A 1WDCC 3EK4A 2CCMA 1DTLA 4C0JA 2F8PA 2L50A 2CT9A 4NDCA 3SIAA 1BT6A 1ODBA 3PALA 1OQPA 1J7OA 1GQMA 5DKRA 1BLQA 4PE7A 4N1GA 1ZFSA 3GOFA 2K0JA 5CSFA 1QX5B 1JFJA 1QASA 1BF5A 2JXLA 2EHBA 3D0YB 4R1EA 1B1GA 2FOTA 1CMGA 2MAZA 4M2PA 4D1EA 1AK8A 5PALA 1R6PA 2KI6C 2LNKA 5HLOA 3K21A 1ZOTB 1V1FA 1CFPA 4GFTA 3CR2A 1YTZC 4PE4A 4ORBB 1TOPA 1KCYA 1DT7B 1TNQA 3DF0B 1K2HA 4XJKB 1YUUA 2KSPA 1K95A 1CKKA 1CNPA 1IRJA 1CM1A 1G4YR 4QJ3B 3I5FC 3JTDC 1KFUL 1UHNA 1WDCB 5CSNA 2O60A 1UHHA 1NWDA 3TUYB 2JT0A 1OOJA 3GK1A 1CLMA 1TCFA 1EH2A 2R2IA 1K94A 1RK9A 3NXAA 3NSKA 2CTNA 1IH0A 2OTGB 1BJFA 4ORCB 5F6TA 4FTGA 1UWOA 1XK4C 2AAOA 1DJZA 3TDUA 1DGVA 1TNWA 1CFDA 3ICBA 5DKNA 1LKJA 1OSAA 2K7BA 3IQQA 4IL1A 2LP2A 4YGCB 1CFCA 3AAJA 2KQYA 4YGEB 2ZNEA 2CXJA 1BG1A 3PSRA 3AKAA 1IJ6A 1NIWA 2JWWA 2D8NA 2L98A 3MSEB 4JQ0D 1XFXO 3NSLA 1SL9A 2MBXA 2JT8A 1G8IA 4JPZB 4P5OE 1J7QA 2L5XB 1FI6A 1PALA 1Y0VH 3I5FB 1PSBA 3PFVA 4N5XA 2AUCA 1SRAA 1OMVA 1NCXA 3SG5A 5K89A 1PRWA 4I5JA 3TS5C 3ZWHA 4AQJA 2B1UA 1EG4A 2WNDA 1KSOA 1WRZA 1KQVA 1B4CA 3HCMA 4USLA 2FJUB 3KF9A 5D69A 4M2OA 3CR4X 1C7VA 4MEWA 2LVJA 5HYDA 2JNXA 3HX4A 1H8BA 2WCBA 2LAPA 2KFFA 2PRUA 2KFGA 1XFYO 2HQWA 2KI6D 1BR1B 1NX3A 1PVAA 1MUXA 1AJ5A 4MZLA 3CZTX 4TNCA 2KOTA 2NCOA 1IQ5A 2OS8B 1QV1A 4F0ZB 4YI9A 1MXLC 2DOQA 1NYAA 2BCBA 1BU3A 1E8AA 2KAYA 2L2EA 2MA2A 2BL0B 1BMOA 1LXFC 2LVVA 1ALWA 3NSIA 1J7RA 1KK8C 1OZSA 2H61C 2K61A 3EK8A 1WLZA 1SCMC 3EKHA 5CSIA 3TDIA 3BQ3A 3WXAA 1CTRA 2BCXA 3PN7B 1TIZA 3BUMB 3CGAA 4MSPA 2JC2A 3AAKA 1SNLA 1XFZO 4OCIA 2LCPA 1DJWA 1LINA 5J3XA 1TN4A 2BECA 5AEQA 5AXIA 1J1DA 4GBAA 3LL8B 2QACA 3A8RA 5G08A 1YR5A 1A29A 2OPOA 5KU1A 4CFQA 1W7IB 2ZRSA 3EVRA 1CLBA 1Q80A 4BY5A 2A4JA 2L0PA 3BYAA 1PULA 1K93D 4C0LA 4DCKA 2L4HA 3O4YA 1TNXA 1YURA 1XFWO 1XFVO 4BY4A 1RECA 1F70A 1XA5A 2VRGA 1KK8B 1GJYA 1SBJA 1SCMB 3D10A 5AANA 4MRXA 1JWDA 1OZOA 3FWBA 2MJWB 1Y1XA 4NDDA 1MQ1A 2MHHA 4MRYA 1CDLA 1SY9A 3E3RA 2SASA 3D0YA 1DF0B 2Y1MA 3O6BA 1YRTB 2JT3A 1SPYA 2COLB 1XFUO 2LUXA 2ZN9A 1L2OC 4GGNA 1IKUA 1DJIA 2LMTA 3OB1B 4YRUA 1NCYA 1KK7Z 4GPLB 5AFPA 2KHNA 3DVJA 4MLWA 3VROA 4C0KA 1MR8A 3VRRA 5JOLA 3DF0A 3LK1A 4XJKA 1YX7A 2EC6C 3CWGA 3I5IC 4N1FA 1MHOA 2G2BA 2RGIA 3VRNA 3O78A 1NSHA 1OMRA 2JOJA 3FIAA 5CPVA 2ZFDA 4AOMA 3JVTC 1IG5A 3PM8A 4E68A 1DVIA 1RJVA 2NZ0A 2WC8A 3OP0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BCA A;  5ER5 A;  2L51 A;  3BOW B;  2M49 B;  5I8N A;  5D7F A;  3NSO A;  4YI8 A;  1OE9 B;  3KHE A;  3TZ1 A;  1EG3 A;  4PAL A;  2Q91 A;  3BXK A;  3OX5 A;  2LVI A;  2JXC A;  1F4O A;  1L2O B;  2KGB C;  4GGF C;  4U8D A;  5KSZ A;  1RTP 1;  1MXE A;  2K2F A;  2LP3 A;  5FYX A;  2NLN A;  2LC5 A;  1MF8 B;  5ER4 X;  2P6B B;  4MZK A;  1PK0 D;  1X02 A;  1A75 B;  1DGU A;  2LVK A;  2PSR A;  1N2D A;  4ZCU A;  2K2A A;  1FF1 A;  4HSZ A;  2M8U A;  1IWQ A;  3JTD B;  4CLN A;  5I2O A;  2FCD A;  3OB2 B;  1NX1 A;  1YUT A;  1DMO A;  1TNP A;  1M39 A;  1Y6W A;  1ALV A;  1NPQ A;  1S1E A;  1U5I B;  4CFR A;  2M3W A;  2QPT A;  2HPS A;  2F2P A;  4MN0 A;  1VRK A;  3AKB A;  3SG3 A;  4PHJ A;  3I5G C;  4PE1 A;  3JVT B;  4L9M A;  4HRE E;  2Y5I A;  2M7L A;  1NP8 A;  2LMV A;  1KK7 Y;  5HKW A;  1M46 A;  3LCP C;  1BR4 B;  4I5K A;  2K8M B;  1HQV A;  2M9G A;  3BUN B;  1EXR A;  1MWN A;  1QTX A;  2JTZ A;  3CR5 X;  1L7Z A;  1XK4 A;  2MRD A;  5HLV A;  2M1K B;  2KBI A;  2ZRT A;  2NCP A;  4AQI A;  3CTN A;  5JJG A;  2JZI A;  4FQO A;  4CPV A;  1M45 A;  2ZKM X;  1S6J A;  1A4P A;  1CLL A;  3O2P A;  1CDM A;  1N65 A;  1F54 A;  2GGZ A;  2KDH A;  3OHM B;  1S6C A;  1M63 B;  2CBL A;  3CS1 A;  1JF0 A;  2E6W A;  1ZAC A;  2JNF A;  2TN4 A;  1Y1A A;  1D1O A;  3M0W A;  2HET A;  1SR6 C;  1AP4 A;  1LVC D;  3GK4 X;  1CB1 A;  1SL8 A;  1SW8 A;  1DJX A;  3TS5 B;  1DJH A;  2BE4 A;  1F55 A;  2LHL A;  1LA0 A;  2I18 A;  1IQ3 A;  1SKT A;  1HT9 A;  3A4U B;  3EVV A;  1J7P A;  1QS7 A;  1YRU B;  1UHJ A;  1QAT A;  5AER A;  5I2L A;  2LUC A;  2M0R A;  4A4C A;  4NQG A;  4ICB A;  1QJT A;  5HKZ A;  1FPW A;  1J1E A;  3DVE A;  1CM4 A;  1YVH A;  2HQ8 A;  2F3Y A;  4OR9 B;  4ZCV A;  1RRO A;  1BOC A;  1QX7 A;  1F71 A;  1SCV A;  4QJ4 B;  4DRW A;  4P2Y B;  1UP5 A;  2M1U A;  4GUK A;  1OMD A;  1SK6 D;  5I2Q A;  2LHI A;  1FI5 A;  2WOR A;  3OX6 A;  1DJY A;  2PVB A;  3KEV A;  4MZJ A;  3SG4 A;  2JQ6 A;  4WQ2 A;  2KAX A;  4DUQ A;  1R2U A;  1SR6 B;  2H61 A;  1NUB A;  1WRL A;  2EGD A;  2IS9 A;  1RWY A;  2L4I A;  4PHK A;  5DKQ A;  4Q04 A;  2I2R E;  1FW4 A;  1WLM A;  1KFX S;  3TUY C;  2SCP A;  1IGV A;  4ORA B;  4YGB B;  2BBN A;  1B47 A;  1N0Y A;  2G9B A;  1DF0 A;  1KFU S;  1W7J B;  1UHK A;  1QX2 A;  2H2K A;  2OTG C;  4WQ3 A;  1B8L A;  4MBE A;  4XYN A;  1QV0 A;  3F45 A;  1B7T Z;  1K8U A;  3SG2 A;  4PHN A;  5BPJ A;  3WHU B;  2V53 A;  4CID A;  1XYD A;  4WRI A;  2WOS A;  2Y4Q A;  4ETO A;  2BKI B;  1FBV A;  2MLE C;  2KGR A;  3FWC A;  1XVJ A;  2KI4 C;  2BKH B;  4I5N B;  5GQQ C;  1B8R A;  5KTY A;  1NX2 A;  1S5G Z;  3IQO A;  2PMY A;  3KPX A;  5HKY A;  2KAV A;  2GGM A;  1J55 A;  1KFX L;  2JTT A;  2KNE A;  4JWQ A;  1C7W A;  3PLF B;  4QJ5 B;  1K9K A;  3LK0 A;  3H4S E;  1S36 A;  1NX0 A;  2MLF C;  4DIR A;  1RFJ A;  2K7D A;  2O5G A;  3BOW A;  2KFH A;  3RM1 A;  1QIW A;  1SYM A;  3VRP A;  1EL4 A;  1JFK A;  2GV5 A;  3EKJ A;  1B8C A;  2LE9 B;  2KQ6 A;  2Q4U A;  4HRH A;  2Y1N A;  2BE6 A;  2KBM A;  2LV7 A;  3I5H C;  2PAS A;  2KYF A;  2PAL A;  1KSM A;  3SJS A;  4MVF A;  5B8I B;  2EC6 B;  1ZMZ A;  1A75 A;  1WRK A;  3I5I B;  1K90 D;  2WCF A;  4UPG A;  1LA3 A;  1BOD A;  2M29 A;  3DD4 A;  1U5I A;  2I94 A;  2KI4 B;  1ZUZ A;  2LLT A;  3QRX A;  1AVS A;  3WNX B;  2JPT A;  2OS8 C;  1A2X A;  3FS7 A;  4YBH B;  1CFF A;  4YGD B;  1AJ4 A;  1QVI Z;  2F2O A;  1M31 A;  2CNP A;  2BL0 C;  1DJG A;  1JF2 A;  3SIB A;  2E30 A;  4DS7 A;  1PSR A;  5IBW A;  1B7T Y;  1AHR A;  3DVK A;  3PAT A;  3C1V A;  4PE0 A;  4A4B A;  1KQM C;  1C07 A;  2FCE A;  2JUL A;  3GK2 A;  3PN7 C;  2WCE A;  3SG6 A;  3LLE A;  1XO5 A;  1S26 D;  1S6I A;  1JC2 A;  2LMU A;  1QIV A;  2K7O A;  4PDZ A;  4NDB A;  3ZNI A;  2K7C A;  2F33 A;  4GGF A;  3RLZ A;  3KO0 A;  2LAN A;  1S5G Y;  3I5H B;  5TNC A;  3TDZ A;  2AMI A;  3BUO B;  1A03 A;  3VGO A;  2BBM A;  1KWO C;  4I5L B;  1UUR A;  1GGW A;  4OKH A;  1TRF A;  1B9A A;  1IJ5 A;  2LLU A;  4PCW A;  2JU0 A;  1WY9 A;  4M2Q A;  4OV2 A;  3I5G B;  1CDP A;  1JBA A;  1TTX A;  1G33 A;  2NXQ A;  4HRG A;  1JUO A;  3SG7 A;  1SL7 A;  1CMF A;  1QLS A;  1K9U A;  2M97 A;  1H4B A;  4GAO A;  3EK7 A;  5CSJ A;  3DVM A;  2KYC A;  1QXP A;  2M7N A;  4PHM A;  1KQM B;  1UHI A;  1QLK A;  3BUW B;  2HF5 A;  1Y1U A;  1UUS A;  1CDN A;  2LM5 A;  1V1G A;  1GGZ A;  1NCZ A;  1AUI B;  1F8H A;  1SMG A;  1S3P A;  2LLS A;  1F4Q A;  1TCO B;  4YGA A;  1QVI Y;  3EVU A;  2ISD A;  1K96 A;  3BUX B;  2I7A A;  1K9P A;  1YVL A;  1KWO B;  3WHT B;  4OVN F;  3CLN A;  4GNK B;  2JRF A;  1PVB A;  2ZN8 A;  1JSA A;  1YUS A;  2F3Z A;  3VRQ A;  3IF7 A;  2ZND A;  1YX8 A;  1EJ3 A;  1WDC C;  3EK4 A;  2CCM A;  1DTL A;  4C0J A;  2F8P A;  2L50 A;  2CT9 A;  4NDC A;  3SIA A;  1BT6 A;  1ODB A;  3PAL A;  1OQP A;  1J7O A;  1GQM A;  5DKR A;  1BLQ A;  4PE7 A;  4N1G A;  1ZFS A;  3GOF A;  2K0J A;  5CSF A;  1QX5 B;  1JFJ A;  1QAS A;  1BF5 A;  2JXL A;  2EHB A;  3D0Y B;  4R1E A;  1B1G A;  2FOT A;  1CMG A;  2MAZ A;  4M2P A;  4D1E A;  1AK8 A;  5PAL A;  1R6P A;  2KI6 C;  2LNK A;  5HLO A;  3K21 A;  1ZOT B;  1V1F A;  1CFP A;  4GFT A;  3CR2 A;  1YTZ C;  4PE4 A;  4ORB B;  1TOP A;  1KCY A;  1DT7 B;  1TNQ A;  3DF0 B;  1K2H A;  4XJK B;  1YUU A;  2KSP A;  1K95 A;  1CKK A;  1CNP A;  1IRJ A;  1CM1 A;  1G4Y R;  4QJ3 B;  3I5F C;  3JTD C;  1KFU L;  1UHN A;  1WDC B;  5CSN A;  2O60 A;  1UHH A;  1NWD A;  3TUY B;  2JT0 A;  1OOJ A;  3GK1 A;  1CLM A;  1TCF A;  1EH2 A;  2R2I A;  1K94 A;  1RK9 A;  3NXA A;  3NSK A;  2CTN A;  1IH0 A;  2OTG B;  1BJF A;  4ORC B;  5F6T A;  4FTG A;  1UWO A;  1XK4 C;  2AAO A;  1DJZ A;  3TDU A;  1DGV A;  1TNW A;  1CFD A;  3ICB A;  5DKN A;  1LKJ A;  1OSA A;  2K7B A;  3IQQ A;  4IL1 A;  2LP2 A;  4YGC B;  1CFC A;  3AAJ A;  2KQY A;  4YGE B;  2ZNE A;  2CXJ A;  1BG1 A;  3PSR A;  3AKA A;  1IJ6 A;  1NIW A;  2JWW A;  2D8N A;  2L98 A;  3MSE B;  4JQ0 D;  1XFX O;  3NSL A;  1SL9 A;  2MBX A;  2JT8 A;  1G8I A;  4JPZ B;  4P5O E;  1J7Q A;  2L5X B;  1FI6 A;  1PAL A;  1Y0V H;  3I5F B;  1PSB A;  3PFV A;  4N5X A;  2AUC A;  1SRA A;  1OMV A;  1NCX A;  3SG5 A;  5K89 A;  1PRW A;  4I5J A;  3TS5 C;  3ZWH A;  4AQJ A;  2B1U A;  1EG4 A;  2WND A;  1KSO A;  1WRZ A;  1KQV A;  1B4C A;  3HCM A;  4USL A;  2FJU B;  3KF9 A;  5D69 A;  4M2O A;  3CR4 X;  1C7V A;  4MEW A;  2LVJ A;  5HYD A;  2JNX A;  3HX4 A;  1H8B A;  2WCB A;  2LAP A;  2KFF A;  2PRU A;  2KFG A;  1XFY O;  2HQW A;  2KI6 D;  1BR1 B;  1NX3 A;  1PVA A;  1MUX A;  1AJ5 A;  4MZL A;  3CZT X;  4TNC A;  2KOT A;  2NCO A;  1IQ5 A;  2OS8 B;  1QV1 A;  4F0Z B;  4YI9 A;  1MXL C;  2DOQ A;  1NYA A;  2BCB A;  1BU3 A;  1E8A A;  2KAY A;  2L2E A;  2MA2 A;  2BL0 B;  1BMO A;  1LXF C;  2LVV A;  1ALW A;  3NSI A;  1J7R A;  1KK8 C;  1OZS A;  2H61 C;  2K61 A;  3EK8 A;  1WLZ A;  1SCM C;  3EKH A;  5CSI A;  3TDI A;  3BQ3 A;  3WXA A;  1CTR A;  2BCX A;  3PN7 B;  1TIZ A;  3BUM B;  3CGA A;  4MSP A;  2JC2 A;  3AAK A;  1SNL A;  1XFZ O;  4OCI A;  2LCP A;  1DJW A;  1LIN A;  5J3X A;  1TN4 A;  2BEC A;  5AEQ A;  5AXI A;  1J1D A;  4GBA A;  3LL8 B;  2QAC A;  3A8R A;  5G08 A;  1YR5 A;  1A29 A;  2OPO A;  5KU1 A;  4CFQ A;  1W7I B;  2ZRS A;  3EVR A;  1CLB A;  1Q80 A;  4BY5 A;  2A4J A;  2L0P A;  3BYA A;  1PUL A;  1K93 D;  4C0L A;  4DCK A;  2L4H A;  3O4Y A;  1TNX A;  1YUR A;  1XFW O;  1XFV O;  4BY4 A;  1REC A;  1F70 A;  1XA5 A;  2VRG A;  1KK8 B;  1GJY A;  1SBJ A;  1SCM B;  3D10 A;  5AAN A;  4MRX A;  1JWD A;  1OZO A;  3FWB A;  2MJW B;  1Y1X A;  4NDD A;  1MQ1 A;  2MHH A;  4MRY A;  1CDL A;  1SY9 A;  3E3R A;  2SAS A;  3D0Y A;  1DF0 B;  2Y1M A;  3O6B A;  1YRT B;  2JT3 A;  1SPY A;  2COL B;  1XFU O;  2LUX A;  2ZN9 A;  1L2O C;  4GGN A;  1IKU A;  1DJI A;  2LMT A;  3OB1 B;  4YRU A;  1NCY A;  1KK7 Z;  4GPL B;  5AFP A;  2KHN A;  3DVJ A;  4MLW A;  3VRO A;  4C0K A;  1MR8 A;  3VRR A;  5JOL A;  3DF0 A;  3LK1 A;  4XJK A;  1YX7 A;  2EC6 C;  3CWG A;  3I5I C;  4N1F A;  1MHO A;  2G2B A;  2RGI A;  3VRN A;  3O78 A;  1NSH A;  1OMR A;  2JOJ A;  3FIA A;  5CPV A;  2ZFD A;  4AOM A;  3JVT C;  1IG5 A;  3PM8 A;  4E68 A;  1DVI A;  1RJV A;  2NZ0 A;  2WC8 A;  3OP0 A; 
#chains in the Genus database with same CATH topology
 2BCA A;  5ER5 A;  2L51 A;  3BOW B;  2M49 B;  5I8N A;  5D7F A;  3NSO A;  4YI8 A;  1OE9 B;  3KHE A;  3TZ1 A;  1EG3 A;  4PAL A;  2Q91 A;  3BXK A;  3OX5 A;  2LVI A;  2JXC A;  1F4O A;  1L2O B;  2KGB C;  4GGF C;  4U8D A;  5KSZ A;  1RTP 1;  3FE9 A;  1MXE A;  3K1E A;  2K2F A;  2LP3 A;  5FYX A;  2NLN A;  2LC5 A;  1MF8 B;  5ER4 X;  2P6B B;  4MZK A;  1PK0 D;  1X02 A;  1A75 B;  1DGU A;  2LVK A;  2PSR A;  1N2D A;  4ZCU A;  3FE8 A;  2K2A A;  1FF1 A;  4HSZ A;  2M8U A;  1IWQ A;  3JTD B;  4CLN A;  5I2O A;  2FCD A;  3OB2 B;  1NX1 A;  1YUT A;  1DMO A;  1TNP A;  1M39 A;  1Y6W A;  1ALV A;  1NPQ A;  1S1E A;  1U5I B;  4CFR A;  2QEO A;  2M3W A;  2QPT A;  2HPS A;  2F2P A;  4MN0 A;  1VRK A;  3AKB A;  3SG3 A;  1P28 A;  4PHJ A;  3I5G C;  4PE1 A;  3JVT B;  4L9M A;  4HRE E;  2Y5I A;  2M7L A;  1NP8 A;  2LMV A;  1KK7 Y;  5HKW A;  3S0F A;  1M46 A;  3LCP C;  1BR4 B;  3R1O A;  4I5K A;  2K8M B;  1HQV A;  2M9G A;  3BUN B;  1EXR A;  3O4X A;  1MWN A;  1QTX A;  2JTZ A;  3CR5 X;  1L7Z A;  1XK4 A;  2MRD A;  5HLV A;  2M1K B;  2KBI A;  4INX A;  2ZRT A;  2NCP A;  4AQI A;  3CTN A;  5JJG A;  2JZI A;  4FQO A;  4CPV A;  1M45 A;  2BNX A;  2ZKM X;  1S6J A;  3L4A A;  1A4P A;  1CLL A;  3O2P A;  1CDM A;  1N65 A;  1F54 A;  2GGZ A;  2KDH A;  3OHM B;  1S6C A;  2QEV A;  1M63 B;  2CBL A;  3CS1 A;  1JF0 A;  2E6W A;  1ZAC A;  2JNF A;  2TN4 A;  1Y1A A;  1D1O A;  3M0W A;  2HET A;  1SR6 C;  1AP4 A;  1LVC D;  3GK4 X;  1CB1 A;  2QEH A;  1QWV A;  1SL8 A;  1SW8 A;  1DJX A;  3R1P A;  3TS5 B;  1DJH A;  2BE4 A;  1F55 A;  2LHL A;  1LA0 A;  2I18 A;  3S0B A;  1SKT A;  1HT9 A;  3A4U B;  3EVV A;  1IQ3 A;  1J7P A;  3CZ0 A;  1QS7 A;  1YRU B;  1UHJ A;  1QAT A;  5AER A;  5I2L A;  2KPH A;  2LUC A;  2M0R A;  4A4C A;  4NQG A;  4ICB A;  1QJT A;  5HKZ A;  1FPW A;  1J1E A;  3DVE A;  3BJH A;  1CM4 A;  1YVH A;  2HQ8 A;  2P71 A;  2F3Y A;  4OR9 B;  4ZCV A;  1RRO A;  1BOC A;  1QX7 A;  1F71 A;  1SCV A;  4QJ4 B;  4DRW A;  4P2Y B;  1UP5 A;  2M1U A;  4GUK A;  1OMD A;  1SK6 D;  5I2Q A;  2LHI A;  1LS8 A;  1FI5 A;  2WOR A;  3OX6 A;  1DJY A;  2PVB A;  3Q8I A;  3KEV A;  4MZJ A;  3SG4 A;  2JQ6 A;  4WQ2 A;  2KAX A;  4DUQ A;  1R2U A;  1SR6 B;  2H61 A;  5FI2 A;  1NUB A;  1WRL A;  2EGD A;  2IS9 A;  1RWY A;  2L4I A;  4PHK A;  5DKQ A;  4Q04 A;  2I2R E;  1FW4 A;  1WLM A;  1KFX S;  3TUY C;  2SCP A;  1IGV A;  4ORA B;  4YGB B;  2BBN A;  1B47 A;  1N0Y A;  2G9B A;  1DF0 A;  1KFU S;  1W7J B;  2PYQ A;  1UHK A;  1QX2 A;  2H2K A;  3B86 A;  2OTG C;  4WQ3 A;  1B8L A;  4MBE A;  4XYN A;  1QV0 A;  3F45 A;  1B7T Z;  1K8U A;  3SG2 A;  4PHN A;  5BPJ A;  3WHU B;  2V53 A;  4CID A;  1XYD A;  2L5Y A;  4WRI A;  2WOS A;  2Y4Q A;  3UNW A;  2BKI B;  4ETO A;  3IVT A;  1FBV A;  3EG5 B;  3S0A A;  2MLE C;  2KGR A;  3FWC A;  1XVJ A;  2KI4 C;  2BKH B;  4I5N B;  5D3O A;  5GQQ C;  1B8R A;  1OOG A;  5KTY A;  1NX2 A;  1S5G Z;  3IQO A;  2PMY A;  3KPX A;  5HKY A;  2KAV A;  2GGM A;  1J55 A;  1KFX L;  2JTT A;  2KNE A;  4JWQ A;  1C7W A;  3PLF B;  4QJ5 B;  1K9K A;  3CAB A;  3LK0 A;  3H4S E;  1S36 A;  1NX0 A;  2MLF C;  4DIR A;  1RFJ A;  2K7D A;  2O5G A;  3BFH A;  2KFH A;  3BOW A;  3D73 A;  3NHT A;  4INW A;  1QIW A;  1SYM A;  1Z2C B;  3RM1 A;  3VRP A;  4F7F A;  1EL4 A;  1JFK A;  2GV5 A;  3EKJ A;  1B8C A;  2LE9 B;  2ERB A;  2KQ6 A;  2Q4U A;  3BFA A;  4HRH A;  2Y1N A;  2QEB A;  2BE6 A;  2KBM A;  2LV7 A;  3I5H C;  2PAS A;  2KYF A;  2PAL A;  1KSM A;  3R72 A;  4MVF A;  3SJS A;  5B8I B;  2EC6 B;  1ZMZ A;  1A75 A;  1WRK A;  3I5I B;  1K90 D;  2WCF A;  4UPG A;  1LA3 A;  1BOD A;  2M29 A;  3OGN A;  1SSE B;  3DD4 A;  1U5I A;  2I94 A;  2KI4 B;  1ZUZ A;  2YGU A;  2LLT A;  3QRX A;  1AVS A;  3WNX B;  2JPT A;  2OS8 C;  1A2X A;  3FS7 A;  4YBH B;  1CFF A;  4YGD B;  1AJ4 A;  1QVI Z;  2F2O A;  1M31 A;  2CNP A;  1DJG A;  2BL0 C;  1JF2 A;  2H8V A;  3SIB A;  2E30 A;  4DS7 A;  1PSR A;  3SS3 A;  3D78 A;  5IBW A;  5I94 A;  1B7T Y;  1AHR A;  3DVK A;  3PAT A;  3C1V A;  4PE0 A;  4A4B A;  1KQM C;  1C07 A;  2FCE A;  2JUL A;  3GK2 A;  3PN7 C;  2WCE A;  3SG6 A;  3LLE A;  1XO5 A;  2WC6 A;  1S26 D;  1S6I A;  1JC2 A;  2LMU A;  1QIV A;  2K7O A;  3UO9 A;  4PDZ A;  4NDB A;  3ZNI A;  2K7C A;  2F33 A;  4GGF A;  3RLZ A;  3KO0 A;  1ORG A;  2LAN A;  1S5G Y;  3I5H B;  5TNC A;  3TDZ A;  2AMI A;  3BUO B;  4JKT A;  1A03 A;  3VGO A;  2BBM A;  1KWO C;  4I5L B;  1UUR A;  1GGW A;  4OKH A;  1TRF A;  1B9A A;  1IJ5 A;  2LLU A;  2PQL A;  4PCW A;  2GTE A;  1WY9 A;  2JU0 A;  4M2Q A;  4KYN A;  4OV2 A;  3B88 A;  3I5G B;  1CDP A;  1JBA A;  3RZS A;  3B7A A;  1TTX A;  1G33 A;  2NXQ A;  2WCJ A;  1JUO A;  4HRG A;  3SG7 A;  1SL7 A;  1CMF A;  1QLS A;  1K9U A;  2M97 A;  1H4B A;  4GAO A;  3EK7 A;  5CSJ A;  3DVM A;  2KYC A;  1QXP A;  2M7N A;  4PHM A;  1KQM B;  1UHI A;  1QLK A;  3L4L A;  3BUW B;  1C3Z A;  2HF5 A;  1Y1U A;  1UUS A;  1CDN A;  2LM5 A;  1V1G A;  1GGZ A;  1NCZ A;  1AUI B;  1F8H A;  1SMG A;  1S3P A;  2LLS A;  3D74 A;  1F4Q A;  1TCO B;  4YGA A;  1QVI Y;  3EVU A;  2ISD A;  4IJ7 A;  1K96 A;  3BUX B;  2I7A A;  1K9P A;  1YVL A;  1KWO B;  3WHT B;  4OVN F;  3CLN A;  1DEL A;  4GNK B;  2JRF A;  1PVB A;  2ZN8 A;  1JSA A;  1YUS A;  2F3Z A;  3VRQ A;  3IF7 A;  2ZND A;  2WCL A;  1YX8 A;  1EJ3 A;  1WDC C;  3EK4 A;  2CCM A;  1DTL A;  4C0J A;  5HL1 A;  2F8P A;  2L50 A;  1TUJ A;  2CT9 A;  4NDC A;  3SIA A;  1BT6 A;  1ODB A;  1TWO A;  3PAL A;  1OQP A;  1DC1 A;  1J7O A;  1GQM A;  5DKR A;  1BLQ A;  4PE7 A;  3D76 A;  4N1G A;  1ZFS A;  1Z4H A;  2K0J A;  3GOF A;  1QX5 B;  5CSF A;  1JFJ A;  1QAS A;  3CYZ A;  1BF5 A;  2JXL A;  5DIC A;  3D75 A;  2EHB A;  3D0Y B;  4R1E A;  1B1G A;  2FOT A;  1CMG A;  2MAZ A;  4M2P A;  4D1E A;  1AK8 A;  5PAL A;  1R6P A;  2KI6 C;  2LNK A;  5HLO A;  3K21 A;  1ZOT B;  1V1F A;  1CFP A;  4GFT A;  3CR2 A;  1YTZ C;  4PE4 A;  4ORB B;  1TOP A;  1KCY A;  3B87 A;  1DT7 B;  1TNQ A;  2WCH A;  3DF0 B;  1K2H A;  4XJK B;  1YUU A;  3SS5 A;  2KSP A;  1K95 A;  1CKK A;  1CNP A;  1IRJ A;  1CM1 A;  1G4Y R;  3DYE A;  3I5F C;  3QME A;  3JTD C;  1KFU L;  1UHN A;  4QJ3 B;  1WDC B;  5CSN A;  2O60 A;  1UHH A;  1NWD A;  3TUY B;  2JT0 A;  1OOJ A;  3GK1 A;  1CLM A;  1TCF A;  1EH2 A;  2R2I A;  1K94 A;  1RK9 A;  3NXA A;  3NSK A;  2CTN A;  1IH0 A;  2OTG B;  1BJF A;  2FJY A;  4ORC B;  5F6T A;  4FTG A;  1UWO A;  1XK4 C;  2AAO A;  1DJZ A;  3N7H A;  3TDU A;  1DGV A;  1TNW A;  1CFD A;  3ICB A;  3O6B A;  5FI6 A;  5DKN A;  1LKJ A;  1OSA A;  2K7B A;  3CZ1 A;  3IQQ A;  2LP2 A;  4IL1 A;  4YGC B;  1CFC A;  3AAJ A;  5EL2 A;  2KQY A;  3B6X A;  2ZNE A;  2CXJ A;  4YGE B;  1BG1 A;  3PSR A;  3S0D A;  3AKA A;  1IJ6 A;  1NIW A;  2JWW A;  2D8N A;  2L98 A;  3MSE B;  4JQ0 D;  1XFX O;  3NSL A;  1DEK A;  1SL9 A;  2MBX A;  2JT8 A;  1G8I A;  4JPZ B;  2WCM A;  4P5O E;  1J7Q A;  2L5X B;  1FI6 A;  1PAL A;  1Y0V H;  3I5F B;  1PSB A;  3PFV A;  3S0E A;  4N5X A;  2AUC A;  3DZT A;  3CZ2 A;  1SRA A;  1OMV A;  1NCX A;  3SG5 A;  5K89 A;  1PRW A;  4I5J A;  3TS5 C;  3ZWH A;  3FE6 A;  4AQJ A;  2B1U A;  1EG4 A;  2WND A;  3NGV A;  1KSO A;  1WRZ A;  1KQV A;  3DY9 A;  1B4C A;  3HCM A;  4USL A;  2FJU B;  3KF9 A;  4OZD A;  5D69 A;  4M2O A;  1GM0 A;  3CR4 X;  2KLE A;  4MEW A;  1C7V A;  2LVJ A;  5HYD A;  2JNX A;  3HX4 A;  1H8B A;  2WCB A;  2LAP A;  1OW4 A;  2KFF A;  2PRU A;  2KFG A;  3V2L A;  1XFY O;  2HQW A;  2KI6 D;  1BR1 B;  1NX3 A;  1PVA A;  1MUX A;  1AJ5 A;  4MZL A;  1T14 A;  3CZT X;  4TNC A;  2KOT A;  1OOH A;  2NCO A;  1IQ5 A;  2OS8 B;  1QV1 A;  4F0Z B;  4YI9 A;  1MXL C;  2DOQ A;  1NYA A;  1BU3 A;  2BCB A;  1E8A A;  2KAY A;  2L2E A;  2MA2 A;  2BL0 B;  1BMO A;  1LXF C;  2LVV A;  1ALW A;  3NSI A;  4PT1 A;  1J7R A;  1KK8 C;  1OZS A;  2H61 C;  2K61 A;  2WC5 A;  3EK8 A;  1WLZ A;  3OBV A;  1SCM C;  3EKH A;  3PM2 A;  3D77 A;  3BQ3 A;  5CSI A;  3TDI A;  3WXA A;  1CTR A;  2BCX A;  3PN7 B;  1TIZ A;  1OOI X;  3BUM B;  3CGA A;  4MSP A;  2JC2 A;  3AAK A;  1SNL A;  1XFZ O;  4OCI A;  2LCP A;  1DJW A;  1LIN A;  3NHI A;  1TN4 A;  5J3X A;  1C3Y A;  2BEC A;  5AEQ A;  5AXI A;  1J1D A;  4GBA A;  3LL8 B;  3VB1 A;  1IIO A;  2QAC A;  3A8R A;  5FI7 A;  5G08 A;  1YR5 A;  1A29 A;  2OPO A;  5KU1 A;  4CFQ A;  3S0G A;  1W7I B;  2ZRS A;  3EVR A;  2K60 A;  1CLB A;  2JPO A;  1Q80 A;  4BY5 A;  2A4J A;  2KLD A;  2L0P A;  1DQE A;  3BYA A;  3SS4 A;  1PUL A;  1K93 D;  4C0L A;  4DCK A;  2L4H A;  3O4Y A;  1TNX A;  1YUR A;  1XFW O;  1XFV O;  4BY4 A;  2QDI A;  1REC A;  1W9Z A;  1F70 A;  1XA5 A;  1TUZ A;  2VRG A;  4JD9 A;  1KK8 B;  1GJY A;  1SBJ A;  1SCM B;  3D10 A;  5AAN A;  2L2C A;  4MRX A;  3BFB A;  1JWD A;  1OZO A;  3FWB A;  2MJW B;  1Y1X A;  4NDD A;  1MQ1 A;  2MHH A;  4MRY A;  1CDL A;  1SY9 A;  3E3R A;  2SAS A;  3D0Y A;  1DF0 B;  1OOF A;  2Y1M A;  1YRT B;  2JT3 A;  1SPY A;  2COL B;  1XFU O;  2LUX A;  2ZN9 A;  1L2O C;  4GGN A;  1IKU A;  1DJI A;  2LMT A;  3OB1 B;  4YRU A;  1NCY A;  1KK7 Z;  3R1V A;  4GPL B;  5AFP A;  3DXL A;  2KHN A;  3DVJ A;  2WCK A;  4MLW A;  3VRO A;  4C0K A;  1MR8 A;  3VRR A;  3CDN A;  5JOL A;  3DF0 A;  3LK1 A;  3PJI A;  4FQT A;  4XJK A;  2P70 A;  1YX7 A;  2EC6 C;  3CWG A;  3I5I C;  2BAP A;  4N1F A;  1MHO A;  1XFR A;  2G2B A;  2RGI A;  3VRN A;  3O78 A;  1NSH A;  1OMR A;  2JOJ A;  3FIA A;  5CPV A;  2ZFD A;  3L47 A;  4AOM A;  3JVT C;  1IG5 A;  3PM8 A;  4E68 A;  1DVI A;  1RJV A;  2NZ0 A;  2WC8 A;  3OP0 A; 
#chains in the Genus database with same CATH homology
 2BCA A;  5ER5 A;  2L51 A;  3BOW B;  2M49 B;  5I8N A;  5D7F A;  3NSO A;  4YI8 A;  1OE9 B;  3KHE A;  3TZ1 A;  1EG3 A;  4PAL A;  2Q91 A;  3BXK A;  3OX5 A;  2LVI A;  2JXC A;  1F4O A;  1L2O B;  2KGB C;  4GGF C;  4U8D A;  5KSZ A;  1RTP 1;  1MXE A;  2K2F A;  2LP3 A;  5FYX A;  2NLN A;  2LC5 A;  1MF8 B;  5ER4 X;  2P6B B;  4MZK A;  1PK0 D;  1X02 A;  1A75 B;  1DGU A;  2LVK A;  2PSR A;  1N2D A;  4ZCU A;  2K2A A;  1FF1 A;  4HSZ A;  2M8U A;  1IWQ A;  3JTD B;  4CLN A;  5I2O A;  2FCD A;  3OB2 B;  1NX1 A;  1YUT A;  1DMO A;  1TNP A;  1M39 A;  1Y6W A;  1ALV A;  1NPQ A;  1S1E A;  1U5I B;  4CFR A;  2M3W A;  2QPT A;  2HPS A;  2F2P A;  4MN0 A;  1VRK A;  3AKB A;  3SG3 A;  4PHJ A;  3I5G C;  4PE1 A;  3JVT B;  4L9M A;  4HRE E;  2Y5I A;  2M7L A;  1NP8 A;  2LMV A;  1KK7 Y;  5HKW A;  1M46 A;  3LCP C;  1BR4 B;  4I5K A;  2K8M B;  1HQV A;  2M9G A;  3BUN B;  1EXR A;  1MWN A;  1QTX A;  2JTZ A;  3CR5 X;  1L7Z A;  1XK4 A;  2MRD A;  5HLV A;  2M1K B;  2KBI A;  2ZRT A;  2NCP A;  4AQI A;  3CTN A;  5JJG A;  2JZI A;  4FQO A;  4CPV A;  1M45 A;  2ZKM X;  1S6J A;  1A4P A;  1CLL A;  3O2P A;  1CDM A;  1N65 A;  1F54 A;  2GGZ A;  2KDH A;  3OHM B;  1S6C A;  1M63 B;  2CBL A;  3CS1 A;  1JF0 A;  2E6W A;  1ZAC A;  2JNF A;  2TN4 A;  1Y1A A;  1D1O A;  3M0W A;  2HET A;  1SR6 C;  1AP4 A;  1LVC D;  3GK4 X;  1CB1 A;  1SL8 A;  1SW8 A;  1DJX A;  3TS5 B;  1DJH A;  2BE4 A;  1F55 A;  2LHL A;  1LA0 A;  2I18 A;  1IQ3 A;  1SKT A;  1HT9 A;  3A4U B;  3EVV A;  1J7P A;  1QS7 A;  1YRU B;  1UHJ A;  1QAT A;  5AER A;  5I2L A;  2LUC A;  2M0R A;  4A4C A;  4NQG A;  4ICB A;  1QJT A;  5HKZ A;  1FPW A;  1J1E A;  3DVE A;  1CM4 A;  1YVH A;  2HQ8 A;  2F3Y A;  4OR9 B;  4ZCV A;  1RRO A;  1BOC A;  1QX7 A;  1F71 A;  1SCV A;  4QJ4 B;  4DRW A;  4P2Y B;  1UP5 A;  2M1U A;  4GUK A;  1OMD A;  1SK6 D;  5I2Q A;  2LHI A;  1FI5 A;  2WOR A;  3OX6 A;  1DJY A;  2PVB A;  3KEV A;  4MZJ A;  3SG4 A;  2JQ6 A;  4WQ2 A;  2KAX A;  4DUQ A;  1R2U A;  1SR6 B;  2H61 A;  1NUB A;  1WRL A;  2EGD A;  2IS9 A;  1RWY A;  2L4I A;  4PHK A;  5DKQ A;  4Q04 A;  2I2R E;  1FW4 A;  1WLM A;  1KFX S;  3TUY C;  2SCP A;  1IGV A;  4ORA B;  4YGB B;  2BBN A;  1B47 A;  1N0Y A;  2G9B A;  1DF0 A;  1KFU S;  1W7J B;  1UHK A;  1QX2 A;  2H2K A;  2OTG C;  4WQ3 A;  1B8L A;  4MBE A;  4XYN A;  1QV0 A;  3F45 A;  1B7T Z;  1K8U A;  3SG2 A;  4PHN A;  5BPJ A;  3WHU B;  2V53 A;  4CID A;  1XYD A;  4WRI A;  2WOS A;  2Y4Q A;  4ETO A;  2BKI B;  1FBV A;  2MLE C;  2KGR A;  3FWC A;  1XVJ A;  2KI4 C;  2BKH B;  4I5N B;  5GQQ C;  1B8R A;  5KTY A;  1NX2 A;  1S5G Z;  3IQO A;  2PMY A;  3KPX A;  5HKY A;  2KAV A;  2GGM A;  1J55 A;  1KFX L;  2JTT A;  2KNE A;  4JWQ A;  1C7W A;  3PLF B;  4QJ5 B;  1K9K A;  3LK0 A;  3H4S E;  1S36 A;  1NX0 A;  2MLF C;  4DIR A;  1RFJ A;  2K7D A;  2O5G A;  3BOW A;  2KFH A;  3RM1 A;  1QIW A;  1SYM A;  3VRP A;  1EL4 A;  1JFK A;  2GV5 A;  3EKJ A;  1B8C A;  2LE9 B;  2KQ6 A;  2Q4U A;  4HRH A;  2Y1N A;  2BE6 A;  2KBM A;  2LV7 A;  3I5H C;  2PAS A;  2KYF A;  2PAL A;  1KSM A;  3SJS A;  4MVF A;  5B8I B;  2EC6 B;  1ZMZ A;  1A75 A;  1WRK A;  3I5I B;  1K90 D;  2WCF A;  4UPG A;  1LA3 A;  1BOD A;  2M29 A;  3DD4 A;  1U5I A;  2I94 A;  2KI4 B;  1ZUZ A;  2LLT A;  3QRX A;  1AVS A;  3WNX B;  2JPT A;  2OS8 C;  1A2X A;  3FS7 A;  4YBH B;  1CFF A;  4YGD B;  1AJ4 A;  1QVI Z;  2F2O A;  1M31 A;  2CNP A;  2BL0 C;  1DJG A;  1JF2 A;  3SIB A;  2E30 A;  4DS7 A;  1PSR A;  5IBW A;  1B7T Y;  1AHR A;  3DVK A;  3PAT A;  3C1V A;  4PE0 A;  4A4B A;  1KQM C;  1C07 A;  2FCE A;  2JUL A;  3GK2 A;  3PN7 C;  2WCE A;  3SG6 A;  3LLE A;  1XO5 A;  1S26 D;  1S6I A;  1JC2 A;  2LMU A;  1QIV A;  2K7O A;  4PDZ A;  4NDB A;  3ZNI A;  2K7C A;  2F33 A;  4GGF A;  3RLZ A;  3KO0 A;  2LAN A;  1S5G Y;  3I5H B;  5TNC A;  3TDZ A;  2AMI A;  3BUO B;  1A03 A;  3VGO A;  2BBM A;  1KWO C;  4I5L B;  1UUR A;  1GGW A;  4OKH A;  1TRF A;  1B9A A;  1IJ5 A;  2LLU A;  4PCW A;  2JU0 A;  1WY9 A;  4M2Q A;  4OV2 A;  3I5G B;  1CDP A;  1JBA A;  1TTX A;  1G33 A;  2NXQ A;  4HRG A;  1JUO A;  3SG7 A;  1SL7 A;  1CMF A;  1QLS A;  1K9U A;  2M97 A;  1H4B A;  4GAO A;  3EK7 A;  5CSJ A;  3DVM A;  2KYC A;  1QXP A;  2M7N A;  4PHM A;  1KQM B;  1UHI A;  1QLK A;  3BUW B;  2HF5 A;  1Y1U A;  1UUS A;  1CDN A;  2LM5 A;  1V1G A;  1GGZ A;  1NCZ A;  1AUI B;  1F8H A;  1SMG A;  1S3P A;  2LLS A;  1F4Q A;  1TCO B;  4YGA A;  1QVI Y;  3EVU A;  2ISD A;  1K96 A;  3BUX B;  2I7A A;  1K9P A;  1YVL A;  1KWO B;  3WHT B;  4OVN F;  3CLN A;  4GNK B;  2JRF A;  1PVB A;  2ZN8 A;  1JSA A;  1YUS A;  2F3Z A;  3VRQ A;  3IF7 A;  2ZND A;  1YX8 A;  1EJ3 A;  1WDC C;  3EK4 A;  2CCM A;  1DTL A;  4C0J A;  2F8P A;  2L50 A;  2CT9 A;  4NDC A;  3SIA A;  1BT6 A;  1ODB A;  3PAL A;  1OQP A;  1J7O A;  1GQM A;  5DKR A;  1BLQ A;  4PE7 A;  4N1G A;  1ZFS A;  3GOF A;  2K0J A;  5CSF A;  1QX5 B;  1JFJ A;  1QAS A;  1BF5 A;  2JXL A;  2EHB A;  3D0Y B;  4R1E A;  1B1G A;  2FOT A;  1CMG A;  2MAZ A;  4M2P A;  4D1E A;  1AK8 A;  5PAL A;  1R6P A;  2KI6 C;  2LNK A;  5HLO A;  3K21 A;  1ZOT B;  1V1F A;  1CFP A;  4GFT A;  3CR2 A;  1YTZ C;  4PE4 A;  4ORB B;  1TOP A;  1KCY A;  1DT7 B;  1TNQ A;  3DF0 B;  1K2H A;  4XJK B;  1YUU A;  2KSP A;  1K95 A;  1CKK A;  1CNP A;  1IRJ A;  1CM1 A;  1G4Y R;  4QJ3 B;  3I5F C;  3JTD C;  1KFU L;  1UHN A;  1WDC B;  5CSN A;  2O60 A;  1UHH A;  1NWD A;  3TUY B;  2JT0 A;  1OOJ A;  3GK1 A;  1CLM A;  1TCF A;  1EH2 A;  2R2I A;  1K94 A;  1RK9 A;  3NXA A;  3NSK A;  2CTN A;  1IH0 A;  2OTG B;  1BJF A;  4ORC B;  5F6T A;  4FTG A;  1UWO A;  1XK4 C;  2AAO A;  1DJZ A;  3TDU A;  1DGV A;  1TNW A;  1CFD A;  3ICB A;  5DKN A;  1LKJ A;  1OSA A;  2K7B A;  3IQQ A;  4IL1 A;  2LP2 A;  4YGC B;  1CFC A;  3AAJ A;  2KQY A;  4YGE B;  2ZNE A;  2CXJ A;  1BG1 A;  3PSR A;  3AKA A;  1IJ6 A;  1NIW A;  2JWW A;  2D8N A;  2L98 A;  3MSE B;  4JQ0 D;  1XFX O;  3NSL A;  1SL9 A;  2MBX A;  2JT8 A;  1G8I A;  4JPZ B;  4P5O E;  1J7Q A;  2L5X B;  1FI6 A;  1PAL A;  1Y0V H;  3I5F B;  1PSB A;  3PFV A;  4N5X A;  2AUC A;  1SRA A;  1OMV A;  1NCX A;  3SG5 A;  5K89 A;  1PRW A;  4I5J A;  3TS5 C;  3ZWH A;  4AQJ A;  2B1U A;  1EG4 A;  2WND A;  1KSO A;  1WRZ A;  1KQV A;  1B4C A;  3HCM A;  4USL A;  2FJU B;  3KF9 A;  5D69 A;  4M2O A;  3CR4 X;  1C7V A;  4MEW A;  2LVJ A;  5HYD A;  2JNX A;  3HX4 A;  1H8B A;  2WCB A;  2LAP A;  2KFF A;  2PRU A;  2KFG A;  1XFY O;  2HQW A;  2KI6 D;  1BR1 B;  1NX3 A;  1PVA A;  1MUX A;  1AJ5 A;  4MZL A;  3CZT X;  4TNC A;  2KOT A;  2NCO A;  1IQ5 A;  2OS8 B;  1QV1 A;  4F0Z B;  4YI9 A;  1MXL C;  2DOQ A;  1NYA A;  2BCB A;  1BU3 A;  1E8A A;  2KAY A;  2L2E A;  2MA2 A;  2BL0 B;  1BMO A;  1LXF C;  2LVV A;  1ALW A;  3NSI A;  1J7R A;  1KK8 C;  1OZS A;  2H61 C;  2K61 A;  3EK8 A;  1WLZ A;  1SCM C;  3EKH A;  5CSI A;  3TDI A;  3BQ3 A;  3WXA A;  1CTR A;  2BCX A;  3PN7 B;  1TIZ A;  3BUM B;  3CGA A;  4MSP A;  2JC2 A;  3AAK A;  1SNL A;  1XFZ O;  4OCI A;  2LCP A;  1DJW A;  1LIN A;  5J3X A;  1TN4 A;  2BEC A;  5AEQ A;  5AXI A;  1J1D A;  4GBA A;  3LL8 B;  2QAC A;  3A8R A;  5G08 A;  1YR5 A;  1A29 A;  2OPO A;  5KU1 A;  4CFQ A;  1W7I B;  2ZRS A;  3EVR A;  1CLB A;  1Q80 A;  4BY5 A;  2A4J A;  2L0P A;  3BYA A;  1PUL A;  1K93 D;  4C0L A;  4DCK A;  2L4H A;  3O4Y A;  1TNX A;  1YUR A;  1XFW O;  1XFV O;  4BY4 A;  1REC A;  1F70 A;  1XA5 A;  2VRG A;  1KK8 B;  1GJY A;  1SBJ A;  1SCM B;  3D10 A;  5AAN A;  4MRX A;  1JWD A;  1OZO A;  3FWB A;  2MJW B;  1Y1X A;  4NDD A;  1MQ1 A;  2MHH A;  4MRY A;  1CDL A;  1SY9 A;  3E3R A;  2SAS A;  3D0Y A;  1DF0 B;  2Y1M A;  3O6B A;  1YRT B;  2JT3 A;  1SPY A;  2COL B;  1XFU O;  2LUX A;  2ZN9 A;  1L2O C;  4GGN A;  1IKU A;  1DJI A;  2LMT A;  3OB1 B;  4YRU A;  1NCY A;  1KK7 Z;  4GPL B;  5AFP A;  2KHN A;  3DVJ A;  4MLW A;  3VRO A;  4C0K A;  1MR8 A;  3VRR A;  5JOL A;  3DF0 A;  3LK1 A;  4XJK A;  1YX7 A;  2EC6 C;  3CWG A;  3I5I C;  4N1F A;  1MHO A;  2G2B A;  2RGI A;  3VRN A;  3O78 A;  1NSH A;  1OMR A;  2JOJ A;  3FIA A;  5CPV A;  2ZFD A;  4AOM A;  3JVT C;  1IG5 A;  3PM8 A;  4E68 A;  1DVI A;  1RJV A;  2NZ0 A;  2WC8 A;  3OP0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...