1AP4A

Regulatory domain of human cardiac troponin c in the calcium-saturated state, nmr, 40 structures
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
89
structure length
89
Chain Sequence
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARDIAC N-TROPONIN C
publication title Calcium-induced structural transition in the regulatory domain of human cardiac troponin C.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Calcium-binding
total genus 19
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 1997-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1ap4A00
3O78A 2LMTA 1J55A 4GUKA 1X02A 1HQVA 1PSBA 3D0YA 4DUQA 5CSIA 2KFGA 2L0PA 3JVTB 1ALWA 5D7FA 2CTNA 2BKIB 3I5IB 1TTXA 1MXLC 4AOMA 2JRFA 2L50A 2JNXA 1S5GY 2Y5IA 4NDCA 2MJWB 1SCMB 3IQQA 3JTDC 1G4YR 1NSHA 2HPSA 1TNPA 2LVIA 2M8UA 1TIZA 4CFQA 1SKTA 1A29A 2GGMA 4I5JA 4PE7A 1PALA 1V1FA 3PN7B 2LLTA 2LHLA 3DF0A 1CFDA 2I7AA 4OKHA 1F55A 2KBIA 3OB1B 5D69A 5GQQC 2KOTA 4FQOA 3WHTB 1PRWA 3TS5B 1G8IA 2F3YA 2F8PA 1KK7Z 2M97A 4YGCB 3DVJA 3A4UB 1AJ4A 1SR6B 2MLFC 4QJ5B 3H4SE 5DKRA 1CMGA 2F2PA 1FPWA 2ZKMX 1NPQA 2M1KB 2KAVA 3O2PA 4NQGA 1QLSA 1PULA 1NIWA 1ALVA 2I18A 4P5OE 3VROA 3IF7A 1TRFA 2WCFA 2WCEA 1DJHA 1CKKA 4M2OA 1C07A 3FS7A 3KF9A 2VRGA 4C0JA 2Y4QA 4OVNF 2JZIA 2MAZA 1N65A 2JWWA 1OMDA 3EVRA 4JPZB 4ETOA 2Q4UA 1YRUB 2BL0C 3EKHA 4PDZA 4N1FA 3CR4X 1SMGA 1LA0A 3TZ1A 1MR8A 3FIAA 1J7OA 3BOWA 1KFUL 2KFHA 2EC6B 1JBAA 3ICBA 5BPJA 1QX2A 2EGDA 3SG2A 2MRDA 4A4BA 4MN0A 2E30A 1PSRA 5G08A 2KI6C 1F4OA 3JVTC 3I5IC 2D8NA 1S6CA 2LVJA 2K7CA 1BF5A 1S26D 1RTP1 1IJ5A 1QXPA 2AMIA 2DOQA 2O5GA 2SASA 3NSKA 1DT7B 1J7RA 1RWYA 1L7ZA 5AERA 4D1EA 1DMOA 1Y0VH 2LUXA 3D0YB 3SG7A 2GV5A 1V1GA 1F4QA 3DD4A 3PN7C 3VRRA 1BOCA 1J1DA 4PE4A 3PM8A 3SG6A 1CNPA 4E68A 1OMRA 1NWDA 2HETA 2M7NA 2LNKA 1Y1AA 5I2OA 1K90D 2ZRSA 5HLOA 3TS5C 3WXAA 2WCBA 5CPVA 1UHJA 1AUIB 4DS7A 2K0JA 3ZNIA 2JULA 1SR6C 1CLBA 3I5FB 2KQYA 2IS9A 1YUUA 2WNDA 3DF0B 1JSAA 1JF0A 1CDLA 1WLZA 2HQ8A 1MXEA 4NDDA 1WRLA 4JQ0D 1TOPA 2K8MB 1YUTA 1IGVA 4YBHB 1IKUA 1ODBA 2JOJA 3OB2B 1UHHA 4JWQA 4YI9A 2KGBC 2OPOA 1NX2A 2F3ZA 2CCMA 4GGNA 2LM5A 4PHNA 5KSZA 1UHIA 4ICBA 3CS1A 1SK6D 1YVLA 2EC6C 4HREE 2L2EA 1G33A 4GFTA 1C7WA 2LUCA 3TDZA 1YRTB 3BQ3A 4YGEB 1GJYA 1MF8B 2KYCA 1JC2A 1AHRA 2F33A 3DVEA 1B8LA 2ZRTA 3DVKA 1DJWA 2G9BA 1NYAA 3DVMA 2ZNEA 1S6JA 1YUSA 2M7LA 1IQ5A 1QS7A 1XK4A 1CTRA 1NCXA 2V53A 2QPTA 3BOWB 3RLZA 1TCOB 1DGVA 2ZNDA 3ZWHA 1CDPA 3PALA 1FI6A 3RM1A 2ISDA 3HCMA 3CGAA 4ORAB 2LLSA 4USLA 3SJSA 2BCAA 1BT6A 1OOJA 1B8CA 4M2QA 2JT8A 1RFJA 3LL8B 2AAOA 2LMVA 4CIDA 4GGFA 1QTXA 3K21A 1XFZO 2PRUA 2JT3A 1UWOA 1WRKA 1MUXA 1S3PA 1EJ3A 1HT9A 2JTZA 4WQ2A 5HKZA 4I5KA 2A4JA 2I94A 3I5FC 4BY4A 2L5XB 2L98A 2KHNA 3E3RA 5ER4X 1ZMZA 1YX7A 4OR9B 4PHKA 1UHKA 2L51A 3EVVA 4WRIA 1IJ6A 2O60A 2COLB 1K93D 3I5HB 3CTNA 1BLQA 3VGOA 2LANA 2SCPA 1FW4A 1NX3A 1DJXA 1YR5A 1S36A 4GGFC 1Y1UA 1F54A 3OHMB 4PCWA 1TNQA 1SL7A 3PLFB 1DJGA 1K94A 2LVVA 2Y1NA 4NDBA 4P2YB 1MHOA 5I2LA 1CB1A 2KFFA 3LK1A 2K2AA 4IL1A 4ORCB 2JU0A 3GK1A 3NXAA 5HKWA 3GK2A 5HLVA 3KPXA 1XFYO 3FWCA 2KSPA 1AK8A 3KEVA 3TUYB 2BBMA 1M45A 1SBJA 5KTYA 1K2HA 1Q80A 5F6TA 1OZOA 1LKJA 1ZACA 1NX1A 1RJVA 2K7OA 2KAYA 2ZN9A 4OV2A 1BG1A 5JJGA 1H4BA 1KCYA 1EH2A 2PVBA 1QVIY 3PATA 4C0KA 1LVCD 4UPGA 1FF1A 3NSIA 2FCEA 3AAKA 3KO0A 1JWDA 3CR2A 1KWOB 4MZJA 1W7IB 2PSRA 2HQWA 4ZCUA 4PALA 1KSMA 1CDMA 1WDCB 1XFVO 1CDNA 4MEWA 3EK8A 3GK4X 2M0RA 1CFCA 1RECA 2KAXA 3MSEB 2LP2A 1F70A 1ZOTB 1NX0A 3BYAA 1JFJA 1M31A 1MQ1A 1UP5A 3EKJA 4GAOA 1QX5B 3SG4A 4ZCVA 3BXKA 2KDHA 2G2BA 3LCPC 1YTZC 1TCFA 5K89A 3SIBA 4OCIA 1OSAA 4QJ3B 2JXLA 5PALA 1NUBA 2JQ6A 5TNCA 2M1UA 3SG5A 2KYFA 2LHIA 1GQMA 1L2OB 3PFVA 4HRHA 1NP8A 4PHJA 4F0ZB 3VRPA 1A75B 1J1EA 3LLEA 1U5IA 2OTGB 5HKYA 4YGBB 4Q04A 1E8AA 5DKQA 1UURA 2Q91A 2F2OA 4GBAA 1H8BA 2KQ6A 5IBWA 1VRKA 5CSJA 2TN4A 3I5HC 2M29A 4BY5A 3IQOA 1KK8B 1IQ3A 4YGAA 4CFRA 2CBLA 1K8UA 1LXFC 4TNCA 2JTTA 2K7BA 1WRZA 2PALA 3CWGA 2KBMA 1TNWA 1DTLA 5AFPA 4N5XA 2KI4B 1K9PA 2NCPA 1KK7Y 2CT9A 3FWBA 2NXQA 1J7PA 3LK0A 1F71A 1SL8A 1MWNA 3CR5X 1FBVA 1QATA 1RK9A 2MLEC 3TUYC 3O6BA 1J7QA 4AQIA 1NCZA 2CNPA 2P6BB 2PMYA 3AKBA 4MLWA 1K9UA 2ZFDA 4ORBB 3WHUB 1CFFA 3EK4A 4MSPA 4AQJA 5J3XA 5KU1A 1B7TZ 1DF0A 2CXJA 4YI8A 1GGZA 4HRGA 2PASA 4DCKA 1A2XA 2JC2A 2LV7A 1KWOC 2WORA 3VRQA 1R2UA 1A75A 1WLMA 4U8DA 3EVUA 1TNXA 2HF5A 4PHMA 1KQMB 1DGUA 1DJYA 1WDCC 2LAPA 3A8RA 3M0WA 3PSRA 4WQ3A 3F45A 4M2PA 1BMOA 2BE4A 1KFXS 1N2DA 1PVBA 4I5LB 4L9MA 1CM4A 1GGWA 2MHHA 1XFXO 1R6PA 1UUSA 3D10A 1W7JB 1QJTA 3I5GB 1CMFA 1YURA 1KFXL 1TN4A 1AVSA 1SRAA 2R2IA 3OX5A 2K7DA 1JUOA 1XK4C 1A4PA 1DJZA 2JNFA 4PE0A 5FYXA 3KHEA 1QIWA 1SY9A 1K9KA 3BUXB 2B1UA 4YRUA 2NLNA 1L2OC 1SNLA 1QIVA 1JF2A 1EG3A 1NCYA 2I2RE 4DIRA 2KNEA 1S5GZ 2OTGC 1EL4A 2FJUB 1SL9A 4DRWA 1Y1XA 1XFUO 2LC5A 1YX8A 1QX7A 5CSFA 1D1OA 3NSLA 1LINA 2BECA 3WNXB 2FCDA 5ER5A 1KK8C 4XJKB 3TDIA 1XVJA 1M46A 1BJFA 2OS8B 1K95A 1SCVA 3BUOB 1F8HA 1BODA 2JPTA 5AEQA 1AJ5A 3VRNA 1PK0D 4HSZA 1EXRA 2KI4C 3SIAA 1U5IB 1KSOA 1XFWO 2LE9B 2BBNA 1OE9B 1KFUS 2LP3A 2MA2A 3AAJA 1KQVA 1EG4A 1CFPA 1ZFSA 2M49B 2M3WA 2WOSA 1CLLA 2H2KA 4PE1A 4CLNA 1LA3A 4I5NB 2AUCA 1QV0A 5CSNA 1B9AA 3BUMB 4N1GA 2BE6A 1Y6WA 3CLNA 2ZN8A 2K2FA 2KGRA 5B8IB 4QJ4B 2FOTA 3JTDB 1S1EA 2JT0A 3TDUA 1BR1B 1OMVA 4CPVA 1IH0A 2NZ0A 3AKAA 4A4CA 2H61A 2EHBA 1S6IA 1KQMC 4YGDB 1K96A 1YVHA 5I8NA 4MBEA 1SCMC 2NCOA 1B47A 2LMUA 1RROA 2M9GA 2LLUA 4XYNA 3I5GC 1DF0B 2MBXA 3C1VA 1M63B 2Y1MA 4XJKA 1DJIA 3CZTX 4FTGA 3HX4A 4GNKB 2GGZA 4GPLB 1PVAA 1IWQA 2LVKA 3QRXA 5DKNA 1WY9A 3OP0A 2JXCA 2BCBA 4R1EA 1ZUZA 1XYDA 3O4YA 1B1GA 1BU3A 1JFKA 4MRYA 5JOLA 1FI5A 4MVFA 1SW8A 5AXIA 3BUWB 1IRJA 1OZSA 2E6WA 2L4HA 1M39A 3OX6A 1AP4A 1QV1A 1B4CA 1SPYA 2H61C 1B7TY 5I2QA 1QVIZ 1SYMA 2KI6D 1OQPA 1CM1A 2BKHB 4MZLA 2QACA 1XA5A 1BR4B 1DVIA 3GOFA 5HYDA 1CLMA 3NSOA 2BL0B 1N0YA 4MZKA 1A03A 2WC8A 3SG3A 2OS8C 3BUNB 4MRXA 2K61A 5AANA 3EK7A 1XO5A 1QLKA 1C7VA 1B8RA 1UHNA 2RGIA 2LCPA 4C0LA 1IG5A 2BCXA 1QASA 2L4IA
chains in the Genus database with same CATH superfamily
3O78A 2LMTA 1J55A 4GUKA 1X02A 1HQVA 3EG5B 1PSBA 3D0YA 4DUQA 2JPOA 5CSIA 3S0DA 2H8VA 2KFGA 2L0PA 1ALWA 2P71A 3JVTB 5D7FA 2CTNA 2BKIB 3I5IB 1TTXA 3L4AA 1MXLC 3IVTA 4AOMA 3B87A 2JRFA 2L50A 3S0FA 1ORGA 2JNXA 1S5GY 2Y5IA 4NDCA 3DXLA 2MJWB 1SCMB 3IQQA 3JTDC 4OZDA 1G4YR 1NSHA 2HPSA 1TNPA 2LVIA 2M8UA 1TIZA 4CFQA 1SKTA 1A29A 2GGMA 4I5JA 4PE7A 1TWOA 1PALA 1V1FA 3PN7B 3UNWA 2LLTA 2LHLA 3DF0A 1CFDA 2I7AA 4OKHA 1F55A 2KBIA 3L47A 3OB1B 5D69A 3CZ0A 2KOTA 4FQOA 5GQQC 3WHTB 1PRWA 3TS5B 1G8IA 2F3YA 2F8PA 1KK7Z 2M97A 4YGCB 3DVJA 3A4UB 1AJ4A 1SR6B 2MLFC 4QJ5B 3H4SE 5DKRA 3R72A 1CMGA 2F2PA 1FPWA 2ZKMX 1NPQA 3SS3A 2M1KB 2KAVA 3O2PA 4NQGA 1QLSA 2QEVA 1PULA 1NIWA 1ALVA 2I18A 4P5OE 3VROA 3IF7A 2K60A 1TRFA 2WCFA 2WCEA 1DJHA 1CKKA 4M2OA 1C07A 3FS7A 3KF9A 2VRGA 3NGVA 4C0JA 2Y4QA 4OVNF 2JZIA 2MAZA 3S0BA 1N65A 2JWWA 1OMDA 2BAPA 3DYEA 2KPHA 3EVRA 4JPZB 4ETOA 2Q4UA 1YRUB 2BL0C 4FQTA 3EKHA 4PDZA 4N1FA 3CR4X 1SMGA 1LA0A 3TZ1A 1MR8A 3FIAA 1J7OA 3BOWA 1KFUL 2KFHA 2EC6B 1JBAA 3ICBA 5BPJA 1QX2A 2EGDA 3SG2A 2MRDA 3B6XA 4A4BA 4MN0A 2E30A 1PSRA 5G08A 2KI6C 1F4OA 3JVTC 3K1EA 3I5IC 1DEKA 2D8NA 1S6CA 2LVJA 2K7CA 1BF5A 1S26D 1RTP1 1IJ5A 1LS8A 1QXPA 2AMIA 2DOQA 2O5GA 2SASA 3NSKA 1Z4HA 1J7RA 1DT7B 1RWYA 1L7ZA 5AERA 4D1EA 1DMOA 3V2LA 1XFRA 1Y0VH 2LUXA 3D0YB 4JD9A 2GV5A 3SG7A 1V1GA 1C3YA 1F4QA 3DD4A 3CZ2A 3PN7C 3VRRA 1BOCA 1J1DA 4PE4A 3PM8A 3SG6A 1CNPA 4E68A 1OMRA 1NWDA 2HETA 2M7NA 2LNKA 1Y1AA 5I2OA 2WC6A 1K90D 2ZRSA 5HLOA 3TS5C 3WXAA 2WCBA 5CPVA 1UHJA 1AUIB 4DS7A 2K0JA 3ZNIA 2JULA 1SR6C 1CLBA 3I5FB 2KQYA 2IS9A 1YUUA 2WNDA 3DF0B 1JSAA 1JF0A 1OOGA 1CDLA 3CYZA 1WLZA 2HQ8A 1MXEA 4NDDA 1WRLA 4INWA 4JQ0D 1TOPA 3NHIA 2K8MB 3D78A 1YUTA 2WCJA 3WHUB 1IGVA 2QEHA 4YBHB 2L2CA 1IKUA 1ODBA 2JOJA 1DQEA 3OB2B 1UHHA 4JWQA 4YI9A 2KGBC 2OPOA 1NX2A 2F3ZA 1DELA 2WCKA 2CCMA 4GGNA 2LM5A 4PHNA 5KSZA 1UHIA 4ICBA 3CS1A 3D74A 1SK6D 1YVLA 2EC6C 4HREE 2L2EA 3S0AA 1G33A 4GFTA 1C7WA 2LUCA 3TDZA 1YRTB 2BNXA 3BQ3A 4YGEB 1GJYA 1MF8B 2KYCA 3N7HA 1JC2A 1AHRA 2F33A 3DVEA 1B8LA 1DC1A 2ZRTA 3DVKA 1DJWA 2G9BA 1NYAA 3DVMA 2ZNEA 1S6JA 1YUSA 1TUJA 2M7LA 1IQ5A 1QS7A 1XK4A 1CTRA 1NCXA 2V53A 2QPTA 3BOWB 3RLZA 1TCOB 5FI6A 1DGVA 2ZNDA 3ZWHA 1CDPA 3PALA 3VB1A 1FI6A 3RM1A 2ISDA 3HCMA 3CGAA 4ORAB 2LLSA 4USLA 3SJSA 2BCAA 1BT6A 1OOJA 2KLDA 1B8CA 1T14A 4M2QA 4PT1A 3BFBA 2JT8A 3O4XA 1RFJA 3LL8B 2AAOA 2LMVA 4CIDA 3R1PA 4GGFA 4KYNA 1QTXA 3K21A 1XFZO 2PRUA 2JT3A 1UWOA 1WRKA 1MUXA 1S3PA 1EJ3A 1HT9A 2JTZA 4WQ2A 5HKZA 4I5KA 2A4JA 2I94A 3I5FC 4BY4A 2L5XB 2L98A 5I94A 2KHNA 3E3RA 5ER4X 1ZMZA 1YX7A 3NHTA 4OR9B 4PHKA 1UHKA 3R1VA 2L51A 3EVVA 4WRIA 1IJ6A 2O60A 4F7FA 1GM0A 1K93D 2COLB 3I5HB 3CTNA 1QWVA 1BLQA 3VGOA 2LANA 1OW4A 2SCPA 1FW4A 1NX3A 1YR5A 1DJXA 1S36A 4GGFC 1Y1UA 1F54A 3OHMB 4PCWA 1TNQA 1SL7A 3PLFB 1DJGA 1K94A 2LVVA 2Y1NA 4NDBA 4P2YB 1MHOA 5I2LA 1CB1A 2KFFA 3LK1A 2K2AA 4IL1A 4ORCB 2JU0A 3GK1A 3NXAA 5HKWA 3GK2A 3B88A 5HLVA 3KPXA 1XFYO 3FWCA 2KSPA 1AK8A 3B86A 3Q8IA 3KEVA 3TUYB 2BBMA 1M45A 1SBJA 3R1OA 5KTYA 1K2HA 1Q80A 5F6TA 4JKTA 2PQLA 1OZOA 1LKJA 1ZACA 1NX1A 1RJVA 2K7OA 2KAYA 2ZN9A 4OV2A 1BG1A 5JJGA 1H4BA 1KCYA 1EH2A 2PVBA 1QVIY 3PATA 1Z2CB 4C0KA 1LVCD 4UPGA 3DY9A 1FF1A 3NSIA 2FCEA 3AAKA 3KO0A 1TUZA 1JWDA 3CR2A 1KWOB 4MZJA 1W7IB 2PSRA 2HQWA 4ZCUA 4PALA 1KSMA 2PYQA 1CDMA 1WDCB 1XFVO 2QEOA 1CDNA 4MEWA 3EK8A 3GK4X 2M0RA 1CFCA 1RECA 2KAXA 3MSEB 2LP2A 3PM2A 1F70A 1ZOTB 1NX0A 3BYAA 1JFJA 1M31A 1MQ1A 1UP5A 3EKJA 4GAOA 1QX5B 3SG4A 3D75A 4ZCVA 3BXKA 2KDHA 2G2BA 3LCPC 1YTZC 1TCFA 5K89A 3SIBA 4OCIA 1OSAA 4QJ3B 2JXLA 5PALA 1NUBA 2JQ6A 5TNCA 2M1UA 3SG5A 2KYFA 2LHIA 1GQMA 3S0EA 1L2OB 3PFVA 4HRHA 3SS5A 1NP8A 4PHJA 4F0ZB 3VRPA 1A75B 1J1EA 3LLEA 1U5IA 2OTGB 5HKYA 4YGBB 4Q04A 1E8AA 5DKQA 1UURA 2Q91A 2F2OA 4GBAA 1H8BA 1OOHA 1OOFA 2KQ6A 5IBWA 1VRKA 5CSJA 3SS4A 1P28A 2TN4A 3I5HC 2M29A 4BY5A 3IQOA 1KK8B 1IQ3A 4YGAA 4CFRA 2CBLA 1K8UA 1LXFC 4TNCA 2JTTA 2K7BA 1WRZA 2FJYA 2PALA 2KBMA 1TNWA 1DTLA 3CWGA 4N5XA 5FI7A 5AFPA 2KI4B 1K9PA 2NCPA 1KK7Y 2CT9A 3FWBA 2NXQA 1J7PA 3LK0A 1F71A 3BJHA 2L5YA 3CABA 3FE8A 1SL8A 1MWNA 3CR5X 1FBVA 3FE9A 5D3OA 1QATA 1RK9A 2MLEC 5FI2A 3TUYC 3O6BA 1J7QA 4AQIA 2GTEA 1NCZA 2CNPA 2P6BB 1W9ZA 2PMYA 3AKBA 1K9UA 2ZFDA 4MLWA 4ORBB 1CFFA 3EK4A 4MSPA 5EL2A 5J3XA 4AQJA 5KU1A 2WCMA 1B7TZ 1DF0A 5DICA 2CXJA 4YI8A 1GGZA 4HRGA 2PASA 4DCKA 1A2XA 2JC2A 2LV7A 1KWOC 2P70A 2WORA 1R2UA 1A75A 3VRQA 1WLMA 4U8DA 3EVUA 1TNXA 2HF5A 4PHMA 1KQMB 1DGUA 1DJYA 1WDCC 2LAPA 3A8RA 3M0WA 3PSRA 4WQ3A 3F45A 4M2PA 1BMOA 2BE4A 1KFXS 3PJIA 3S0GA 3CDNA 1OOIX 2WCHA 1N2DA 1PVBA 4I5LB 4L9MA 1CM4A 1GGWA 2MHHA 1XFXO 1R6PA 1UUSA 3D10A 1W7JB 1QJTA 3I5GB 1CMFA 1YURA 1KFXL 1TN4A 1AVSA 1SRAA 2R2IA 3B7AA 3D73A 2K7DA 3OX5A 1JUOA 1XK4C 1A4PA 1DJZA 2JNFA 3BFHA 4PE0A 5FYXA 3KHEA 1QIWA 1SY9A 1K9KA 3BUXB 4IJ7A 2B1UA 4YRUA 2NLNA 1L2OC 1SNLA 1QIVA 1JF2A 1EG3A 1NCYA 2I2RE 4DIRA 3RZSA 2QEBA 3D77A 2KNEA 1S5GZ 2OTGC 1C3ZA 1EL4A 2FJUB 1SL9A 4DRWA 1Y1XA 1XFUO 2LC5A 1YX8A 1QX7A 5CSFA 1D1OA 3NSLA 3D76A 4INXA 1LINA 2BECA 3WNXB 2FCDA 2WC5A 5ER5A 1KK8C 4XJKB 3TDIA 1XVJA 1M46A 1BJFA 2OS8B 1K95A 1SCVA 3BUOB 1F8HA 1BODA 2JPTA 5AEQA 1AJ5A 3VRNA 1PK0D 4HSZA 1EXRA 2KI4C 3SIAA 1U5IB 3DZTA 1KSOA 1XFWO 2LE9B 2BBNA 1OE9B 1KFUS 2WCLA 2LP3A 2MA2A 3AAJA 1KQVA 1EG4A 1CFPA 1ZFSA 2M49B 2M3WA 2WOSA 1CLLA 2H2KA 4PE1A 4CLNA 1LA3A 1IIOA 4I5NB 2AUCA 1QV0A 5CSNA 1B9AA 3BUMB 4N1GA 2BE6A 1Y6WA 3CLNA 3QMEA 2ZN8A 2K2FA 2KGRA 5B8IB 4QJ4B 2FOTA 3JTDB 1S1EA 2JT0A 3TDUA 1BR1B 1OMVA 4CPVA 1IH0A 2NZ0A 3AKAA 4A4CA 2H61A 2EHBA 1S6IA 1KQMC 4YGDB 5HL1A 1K96A 1YVHA 5I8NA 4MBEA 1SCMC 2NCOA 3UO9A 1B47A 2LMUA 1RROA 2ERBA 2M9GA 2LLUA 4XYNA 3I5GC 1DF0B 2MBXA 3C1VA 1M63B 2Y1MA 4XJKA 1DJIA 3CZTX 4FTGA 3HX4A 3CZ1A 3BFAA 4GNKB 2GGZA 4GPLB 1PVAA 1IWQA 2LVKA 3QRXA 5DKNA 1WY9A 3OBVA 2JXCA 2BCBA 3OP0A 4R1EA 1ZUZA 1XYDA 3O4YA 1B1GA 1BU3A 1JFKA 2KLEA 2YGUA 4MRYA 5JOLA 1FI5A 4MVFA 1SW8A 5AXIA 3BUWB 1IRJA 1OZSA 2E6WA 2L4HA 1M39A 3L4LA 3OX6A 1QV1A 1AP4A 1B4CA 1SPYA 2H61C 1B7TY 5I2QA 1QVIZ 1SYMA 2KI6D 1OQPA 1CM1A 2BKHB 4MZLA 2QDIA 2QACA 1XA5A 1BR4B 1DVIA 3GOFA 5HYDA 1CLMA 3NSOA 1SSEB 2BL0B 1N0YA 4MZKA 1A03A 2WC8A 3SG3A 2OS8C 3BUNB 4MRXA 2K61A 5AANA 3EK7A 3FE6A 1XO5A 1QLKA 3OGNA 1C7VA 1B8RA 1UHNA 2RGIA 2LCPA 4C0LA 1IG5A 2BCXA 1QASA 2L4IA
chains in the Genus database with same CATH topology
3O78A 2LMTA 1J55A 4GUKA 1X02A 1HQVA 1PSBA 3D0YA 4DUQA 5CSIA 2KFGA 2L0PA 3JVTB 1ALWA 5D7FA 2CTNA 2BKIB 3I5IB 1TTXA 1MXLC 4AOMA 2JRFA 2L50A 2JNXA 1S5GY 2Y5IA 4NDCA 2MJWB 1SCMB 3IQQA 3JTDC 1G4YR 1NSHA 2HPSA 1TNPA 2LVIA 2M8UA 1TIZA 4CFQA 1SKTA 1A29A 2GGMA 4I5JA 4PE7A 1PALA 1V1FA 3PN7B 2LLTA 2LHLA 3DF0A 1CFDA 2I7AA 4OKHA 1F55A 2KBIA 3OB1B 5D69A 5GQQC 2KOTA 4FQOA 3WHTB 1PRWA 3TS5B 1G8IA 2F3YA 2F8PA 1KK7Z 2M97A 4YGCB 3DVJA 3A4UB 1AJ4A 1SR6B 2MLFC 4QJ5B 3H4SE 5DKRA 1CMGA 2F2PA 1FPWA 2ZKMX 1NPQA 2M1KB 2KAVA 3O2PA 4NQGA 1QLSA 1PULA 1NIWA 1ALVA 2I18A 4P5OE 3VROA 3IF7A 1TRFA 2WCFA 2WCEA 1DJHA 1CKKA 4M2OA 1C07A 3FS7A 3KF9A 2VRGA 4C0JA 2Y4QA 4OVNF 2JZIA 2MAZA 1N65A 2JWWA 1OMDA 3EVRA 4JPZB 4ETOA 2Q4UA 1YRUB 2BL0C 3EKHA 4PDZA 4N1FA 3CR4X 1SMGA 1LA0A 3TZ1A 1MR8A 3FIAA 1J7OA 3BOWA 1KFUL 2KFHA 2EC6B 1JBAA 3ICBA 5BPJA 1QX2A 2EGDA 3SG2A 2MRDA 4A4BA 4MN0A 2E30A 1PSRA 5G08A 2KI6C 1F4OA 3JVTC 3I5IC 2D8NA 1S6CA 2LVJA 2K7CA 1BF5A 1S26D 1RTP1 1IJ5A 1QXPA 2AMIA 2DOQA 2O5GA 2SASA 3NSKA 1DT7B 1J7RA 1RWYA 1L7ZA 5AERA 4D1EA 1DMOA 1Y0VH 2LUXA 3D0YB 3SG7A 2GV5A 1V1GA 1F4QA 3DD4A 3PN7C 3VRRA 1BOCA 1J1DA 4PE4A 3PM8A 3SG6A 1CNPA 4E68A 1OMRA 1NWDA 2HETA 2M7NA 2LNKA 1Y1AA 5I2OA 1K90D 2ZRSA 5HLOA 3TS5C 3WXAA 2WCBA 5CPVA 1UHJA 1AUIB 4DS7A 2K0JA 3ZNIA 2JULA 1SR6C 1CLBA 3I5FB 2KQYA 2IS9A 1YUUA 2WNDA 3DF0B 1JSAA 1JF0A 1CDLA 1WLZA 2HQ8A 1MXEA 4NDDA 1WRLA 4JQ0D 1TOPA 2K8MB 1YUTA 1IGVA 4YBHB 1IKUA 1ODBA 2JOJA 3OB2B 1UHHA 4JWQA 4YI9A 2KGBC 2OPOA 1NX2A 2F3ZA 2CCMA 4GGNA 2LM5A 4PHNA 5KSZA 1UHIA 4ICBA 3CS1A 1SK6D 1YVLA 2EC6C 4HREE 2L2EA 1G33A 4GFTA 1C7WA 2LUCA 3TDZA 1YRTB 3BQ3A 4YGEB 1GJYA 1MF8B 2KYCA 1JC2A 1AHRA 2F33A 3DVEA 1B8LA 2ZRTA 3DVKA 1DJWA 2G9BA 1NYAA 3DVMA 2ZNEA 1S6JA 1YUSA 2M7LA 1IQ5A 1QS7A 1XK4A 1CTRA 1NCXA 2V53A 2QPTA 3BOWB 3RLZA 1TCOB 1DGVA 2ZNDA 3ZWHA 1CDPA 3PALA 1FI6A 3RM1A 2ISDA 3HCMA 3CGAA 4ORAB 2LLSA 4USLA 3SJSA 2BCAA 1BT6A 1OOJA 1B8CA 4M2QA 2JT8A 1RFJA 3LL8B 2AAOA 2LMVA 4CIDA 4GGFA 1QTXA 3K21A 1XFZO 2PRUA 2JT3A 1UWOA 1WRKA 1MUXA 1S3PA 1EJ3A 1HT9A 2JTZA 4WQ2A 5HKZA 4I5KA 2A4JA 2I94A 3I5FC 4BY4A 2L5XB 2L98A 2KHNA 3E3RA 5ER4X 1ZMZA 1YX7A 4OR9B 4PHKA 1UHKA 2L51A 3EVVA 4WRIA 1IJ6A 2O60A 2COLB 1K93D 3I5HB 3CTNA 1BLQA 3VGOA 2LANA 2SCPA 1FW4A 1NX3A 1DJXA 1YR5A 1S36A 4GGFC 1Y1UA 1F54A 3OHMB 4PCWA 1TNQA 1SL7A 3PLFB 1DJGA 1K94A 2LVVA 2Y1NA 4NDBA 4P2YB 1MHOA 5I2LA 1CB1A 2KFFA 3LK1A 2K2AA 4IL1A 4ORCB 2JU0A 3GK1A 3NXAA 5HKWA 3GK2A 5HLVA 3KPXA 1XFYO 3FWCA 2KSPA 1AK8A 3KEVA 3TUYB 2BBMA 1M45A 1SBJA 5KTYA 1K2HA 1Q80A 5F6TA 1OZOA 1LKJA 1ZACA 1NX1A 1RJVA 2K7OA 2KAYA 2ZN9A 4OV2A 1BG1A 5JJGA 1H4BA 1KCYA 1EH2A 2PVBA 1QVIY 3PATA 4C0KA 1LVCD 4UPGA 1FF1A 3NSIA 2FCEA 3AAKA 3KO0A 1JWDA 3CR2A 1KWOB 4MZJA 1W7IB 2PSRA 2HQWA 4ZCUA 4PALA 1KSMA 1CDMA 1WDCB 1XFVO 1CDNA 4MEWA 3EK8A 3GK4X 2M0RA 1CFCA 1RECA 2KAXA 3MSEB 2LP2A 1F70A 1ZOTB 1NX0A 3BYAA 1JFJA 1M31A 1MQ1A 1UP5A 3EKJA 4GAOA 1QX5B 3SG4A 4ZCVA 3BXKA 2KDHA 2G2BA 3LCPC 1YTZC 1TCFA 5K89A 3SIBA 4OCIA 1OSAA 4QJ3B 2JXLA 5PALA 1NUBA 2JQ6A 5TNCA 2M1UA 3SG5A 2KYFA 2LHIA 1GQMA 1L2OB 3PFVA 4HRHA 1NP8A 4PHJA 4F0ZB 3VRPA 1A75B 1J1EA 3LLEA 1U5IA 2OTGB 5HKYA 4YGBB 4Q04A 1E8AA 5DKQA 1UURA 2Q91A 2F2OA 4GBAA 1H8BA 2KQ6A 5IBWA 1VRKA 5CSJA 2TN4A 3I5HC 2M29A 4BY5A 3IQOA 1KK8B 1IQ3A 4YGAA 4CFRA 2CBLA 1K8UA 1LXFC 4TNCA 2JTTA 2K7BA 1WRZA 2PALA 3CWGA 2KBMA 1TNWA 1DTLA 5AFPA 4N5XA 2KI4B 1K9PA 2NCPA 1KK7Y 2CT9A 3FWBA 2NXQA 1J7PA 3LK0A 1F71A 1SL8A 1MWNA 3CR5X 1FBVA 1QATA 1RK9A 2MLEC 3TUYC 3O6BA 1J7QA 4AQIA 1NCZA 2CNPA 2P6BB 2PMYA 3AKBA 4MLWA 1K9UA 2ZFDA 4ORBB 3WHUB 1CFFA 3EK4A 4MSPA 4AQJA 5J3XA 5KU1A 1B7TZ 1DF0A 2CXJA 4YI8A 1GGZA 4HRGA 2PASA 4DCKA 1A2XA 2JC2A 2LV7A 1KWOC 2WORA 3VRQA 1R2UA 1A75A 1WLMA 4U8DA 3EVUA 1TNXA 2HF5A 4PHMA 1KQMB 1DGUA 1DJYA 1WDCC 2LAPA 3A8RA 3M0WA 3PSRA 4WQ3A 3F45A 4M2PA 1BMOA 2BE4A 1KFXS 1N2DA 1PVBA 4I5LB 4L9MA 1CM4A 1GGWA 2MHHA 1XFXO 1R6PA 1UUSA 3D10A 1W7JB 1QJTA 3I5GB 1CMFA 1YURA 1KFXL 1TN4A 1AVSA 1SRAA 2R2IA 3OX5A 2K7DA 1JUOA 1XK4C 1A4PA 1DJZA 2JNFA 4PE0A 5FYXA 3KHEA 1QIWA 1SY9A 1K9KA 3BUXB 2B1UA 4YRUA 2NLNA 1L2OC 1SNLA 1QIVA 1JF2A 1EG3A 1NCYA 2I2RE 4DIRA 2KNEA 1S5GZ 2OTGC 1EL4A 2FJUB 1SL9A 4DRWA 1Y1XA 1XFUO 2LC5A 1YX8A 1QX7A 5CSFA 1D1OA 3NSLA 1LINA 2BECA 3WNXB 2FCDA 5ER5A 1KK8C 4XJKB 3TDIA 1XVJA 1M46A 1BJFA 2OS8B 1K95A 1SCVA 3BUOB 1F8HA 1BODA 2JPTA 5AEQA 1AJ5A 3VRNA 1PK0D 4HSZA 1EXRA 2KI4C 3SIAA 1U5IB 1KSOA 1XFWO 2LE9B 2BBNA 1OE9B 1KFUS 2LP3A 2MA2A 3AAJA 1KQVA 1EG4A 1CFPA 1ZFSA 2M49B 2M3WA 2WOSA 1CLLA 2H2KA 4PE1A 4CLNA 1LA3A 4I5NB 2AUCA 1QV0A 5CSNA 1B9AA 3BUMB 4N1GA 2BE6A 1Y6WA 3CLNA 2ZN8A 2K2FA 2KGRA 5B8IB 4QJ4B 2FOTA 3JTDB 1S1EA 2JT0A 3TDUA 1BR1B 1OMVA 4CPVA 1IH0A 2NZ0A 3AKAA 4A4CA 2H61A 2EHBA 1S6IA 1KQMC 4YGDB 1K96A 1YVHA 5I8NA 4MBEA 1SCMC 2NCOA 1B47A 2LMUA 1RROA 2M9GA 2LLUA 4XYNA 3I5GC 1DF0B 2MBXA 3C1VA 1M63B 2Y1MA 4XJKA 1DJIA 3CZTX 4FTGA 3HX4A 4GNKB 2GGZA 4GPLB 1PVAA 1IWQA 2LVKA 3QRXA 5DKNA 1WY9A 3OP0A 2JXCA 2BCBA 4R1EA 1ZUZA 1XYDA 3O4YA 1B1GA 1BU3A 1JFKA 4MRYA 5JOLA 1FI5A 4MVFA 1SW8A 5AXIA 3BUWB 1IRJA 1OZSA 2E6WA 2L4HA 1M39A 3OX6A 1AP4A 1QV1A 1B4CA 1SPYA 2H61C 1B7TY 5I2QA 1QVIZ 1SYMA 2KI6D 1OQPA 1CM1A 2BKHB 4MZLA 2QACA 1XA5A 1BR4B 1DVIA 3GOFA 5HYDA 1CLMA 3NSOA 2BL0B 1N0YA 4MZKA 1A03A 2WC8A 3SG3A 2OS8C 3BUNB 4MRXA 2K61A 5AANA 3EK7A 1XO5A 1QLKA 1C7VA 1B8RA 1UHNA 2RGIA 2LCPA 4C0LA 1IG5A 2BCXA 1QASA 2L4IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O78 A;  2LMT A;  1J55 A;  4GUK A;  1X02 A;  1HQV A;  1PSB A;  3D0Y A;  4DUQ A;  5CSI A;  2KFG A;  2L0P A;  3JVT B;  1ALW A;  5D7F A;  2CTN A;  2BKI B;  3I5I B;  1TTX A;  1MXL C;  4AOM A;  2JRF A;  2L50 A;  2JNX A;  1S5G Y;  2Y5I A;  4NDC A;  2MJW B;  1SCM B;  3IQQ A;  3JTD C;  1G4Y R;  1NSH A;  2HPS A;  1TNP A;  2LVI A;  2M8U A;  1TIZ A;  4CFQ A;  1SKT A;  1A29 A;  2GGM A;  4I5J A;  4PE7 A;  1PAL A;  1V1F A;  3PN7 B;  2LLT A;  2LHL A;  3DF0 A;  1CFD A;  2I7A A;  4OKH A;  1F55 A;  2KBI A;  3OB1 B;  5D69 A;  5GQQ C;  2KOT A;  4FQO A;  3WHT B;  1PRW A;  3TS5 B;  1G8I A;  2F3Y A;  2F8P A;  1KK7 Z;  2M97 A;  4YGC B;  3DVJ A;  3A4U B;  1AJ4 A;  1SR6 B;  2MLF C;  4QJ5 B;  3H4S E;  5DKR A;  1CMG A;  2F2P A;  1FPW A;  2ZKM X;  1NPQ A;  2M1K B;  2KAV A;  3O2P A;  4NQG A;  1QLS A;  1PUL A;  1NIW A;  1ALV A;  2I18 A;  4P5O E;  3VRO A;  3IF7 A;  1TRF A;  2WCF A;  2WCE A;  1DJH A;  1CKK A;  4M2O A;  1C07 A;  3FS7 A;  3KF9 A;  2VRG A;  4C0J A;  2Y4Q A;  4OVN F;  2JZI A;  2MAZ A;  1N65 A;  2JWW A;  1OMD A;  3EVR A;  4JPZ B;  4ETO A;  2Q4U A;  1YRU B;  2BL0 C;  3EKH A;  4PDZ A;  4N1F A;  3CR4 X;  1SMG A;  1LA0 A;  3TZ1 A;  1MR8 A;  3FIA A;  1J7O A;  3BOW A;  1KFU L;  2KFH A;  2EC6 B;  1JBA A;  3ICB A;  5BPJ A;  1QX2 A;  2EGD A;  3SG2 A;  2MRD A;  4A4B A;  4MN0 A;  2E30 A;  1PSR A;  5G08 A;  2KI6 C;  1F4O A;  3JVT C;  3I5I C;  2D8N A;  1S6C A;  2LVJ A;  2K7C A;  1BF5 A;  1S26 D;  1RTP 1;  1IJ5 A;  1QXP A;  2AMI A;  2DOQ A;  2O5G A;  2SAS A;  3NSK A;  1DT7 B;  1J7R A;  1RWY A;  1L7Z A;  5AER A;  4D1E A;  1DMO A;  1Y0V H;  2LUX A;  3D0Y B;  3SG7 A;  2GV5 A;  1V1G A;  1F4Q A;  3DD4 A;  3PN7 C;  3VRR A;  1BOC A;  1J1D A;  4PE4 A;  3PM8 A;  3SG6 A;  1CNP A;  4E68 A;  1OMR A;  1NWD A;  2HET A;  2M7N A;  2LNK A;  1Y1A A;  5I2O A;  1K90 D;  2ZRS A;  5HLO A;  3TS5 C;  3WXA A;  2WCB A;  5CPV A;  1UHJ A;  1AUI B;  4DS7 A;  2K0J A;  3ZNI A;  2JUL A;  1SR6 C;  1CLB A;  3I5F B;  2KQY A;  2IS9 A;  1YUU A;  2WND A;  3DF0 B;  1JSA A;  1JF0 A;  1CDL A;  1WLZ A;  2HQ8 A;  1MXE A;  4NDD A;  1WRL A;  4JQ0 D;  1TOP A;  2K8M B;  1YUT A;  1IGV A;  4YBH B;  1IKU A;  1ODB A;  2JOJ A;  3OB2 B;  1UHH A;  4JWQ A;  4YI9 A;  2KGB C;  2OPO A;  1NX2 A;  2F3Z A;  2CCM A;  4GGN A;  2LM5 A;  4PHN A;  5KSZ A;  1UHI A;  4ICB A;  3CS1 A;  1SK6 D;  1YVL A;  2EC6 C;  4HRE E;  2L2E A;  1G33 A;  4GFT A;  1C7W A;  2LUC A;  3TDZ A;  1YRT B;  3BQ3 A;  4YGE B;  1GJY A;  1MF8 B;  2KYC A;  1JC2 A;  1AHR A;  2F33 A;  3DVE A;  1B8L A;  2ZRT A;  3DVK A;  1DJW A;  2G9B A;  1NYA A;  3DVM A;  2ZNE A;  1S6J A;  1YUS A;  2M7L A;  1IQ5 A;  1QS7 A;  1XK4 A;  1CTR A;  1NCX A;  2V53 A;  2QPT A;  3BOW B;  3RLZ A;  1TCO B;  1DGV A;  2ZND A;  3ZWH A;  1CDP A;  3PAL A;  1FI6 A;  3RM1 A;  2ISD A;  3HCM A;  3CGA A;  4ORA B;  2LLS A;  4USL A;  3SJS A;  2BCA A;  1BT6 A;  1OOJ A;  1B8C A;  4M2Q A;  2JT8 A;  1RFJ A;  3LL8 B;  2AAO A;  2LMV A;  4CID A;  4GGF A;  1QTX A;  3K21 A;  1XFZ O;  2PRU A;  2JT3 A;  1UWO A;  1WRK A;  1MUX A;  1S3P A;  1EJ3 A;  1HT9 A;  2JTZ A;  4WQ2 A;  5HKZ A;  4I5K A;  2A4J A;  2I94 A;  3I5F C;  4BY4 A;  2L5X B;  2L98 A;  2KHN A;  3E3R A;  5ER4 X;  1ZMZ A;  1YX7 A;  4OR9 B;  4PHK A;  1UHK A;  2L51 A;  3EVV A;  4WRI A;  1IJ6 A;  2O60 A;  2COL B;  1K93 D;  3I5H B;  3CTN A;  1BLQ A;  3VGO A;  2LAN A;  2SCP A;  1FW4 A;  1NX3 A;  1DJX A;  1YR5 A;  1S36 A;  4GGF C;  1Y1U A;  1F54 A;  3OHM B;  4PCW A;  1TNQ A;  1SL7 A;  3PLF B;  1DJG A;  1K94 A;  2LVV A;  2Y1N A;  4NDB A;  4P2Y B;  1MHO A;  5I2L A;  1CB1 A;  2KFF A;  3LK1 A;  2K2A A;  4IL1 A;  4ORC B;  2JU0 A;  3GK1 A;  3NXA A;  5HKW A;  3GK2 A;  5HLV A;  3KPX A;  1XFY O;  3FWC A;  2KSP A;  1AK8 A;  3KEV A;  3TUY B;  2BBM A;  1M45 A;  1SBJ A;  5KTY A;  1K2H A;  1Q80 A;  5F6T A;  1OZO A;  1LKJ A;  1ZAC A;  1NX1 A;  1RJV A;  2K7O A;  2KAY A;  2ZN9 A;  4OV2 A;  1BG1 A;  5JJG A;  1H4B A;  1KCY A;  1EH2 A;  2PVB A;  1QVI Y;  3PAT A;  4C0K A;  1LVC D;  4UPG A;  1FF1 A;  3NSI A;  2FCE A;  3AAK A;  3KO0 A;  1JWD A;  3CR2 A;  1KWO B;  4MZJ A;  1W7I B;  2PSR A;  2HQW A;  4ZCU A;  4PAL A;  1KSM A;  1CDM A;  1WDC B;  1XFV O;  1CDN A;  4MEW A;  3EK8 A;  3GK4 X;  2M0R A;  1CFC A;  1REC A;  2KAX A;  3MSE B;  2LP2 A;  1F70 A;  1ZOT B;  1NX0 A;  3BYA A;  1JFJ A;  1M31 A;  1MQ1 A;  1UP5 A;  3EKJ A;  4GAO A;  1QX5 B;  3SG4 A;  4ZCV A;  3BXK A;  2KDH A;  2G2B A;  3LCP C;  1YTZ C;  1TCF A;  5K89 A;  3SIB A;  4OCI A;  1OSA A;  4QJ3 B;  2JXL A;  5PAL A;  1NUB A;  2JQ6 A;  5TNC A;  2M1U A;  3SG5 A;  2KYF A;  2LHI A;  1GQM A;  1L2O B;  3PFV A;  4HRH A;  1NP8 A;  4PHJ A;  4F0Z B;  3VRP A;  1A75 B;  1J1E A;  3LLE A;  1U5I A;  2OTG B;  5HKY A;  4YGB B;  4Q04 A;  1E8A A;  5DKQ A;  1UUR A;  2Q91 A;  2F2O A;  4GBA A;  1H8B A;  2KQ6 A;  5IBW A;  1VRK A;  5CSJ A;  2TN4 A;  3I5H C;  2M29 A;  4BY5 A;  3IQO A;  1KK8 B;  1IQ3 A;  4YGA A;  4CFR A;  2CBL A;  1K8U A;  1LXF C;  4TNC A;  2JTT A;  2K7B A;  1WRZ A;  2PAL A;  3CWG A;  2KBM A;  1TNW A;  1DTL A;  5AFP A;  4N5X A;  2KI4 B;  1K9P A;  2NCP A;  1KK7 Y;  2CT9 A;  3FWB A;  2NXQ A;  1J7P A;  3LK0 A;  1F71 A;  1SL8 A;  1MWN A;  3CR5 X;  1FBV A;  1QAT A;  1RK9 A;  2MLE C;  3TUY C;  3O6B A;  1J7Q A;  4AQI A;  1NCZ A;  2CNP A;  2P6B B;  2PMY A;  3AKB A;  4MLW A;  1K9U A;  2ZFD A;  4ORB B;  3WHU B;  1CFF A;  3EK4 A;  4MSP A;  4AQJ A;  5J3X A;  5KU1 A;  1B7T Z;  1DF0 A;  2CXJ A;  4YI8 A;  1GGZ A;  4HRG A;  2PAS A;  4DCK A;  1A2X A;  2JC2 A;  2LV7 A;  1KWO C;  2WOR A;  3VRQ A;  1R2U A;  1A75 A;  1WLM A;  4U8D A;  3EVU A;  1TNX A;  2HF5 A;  4PHM A;  1KQM B;  1DGU A;  1DJY A;  1WDC C;  2LAP A;  3A8R A;  3M0W A;  3PSR A;  4WQ3 A;  3F45 A;  4M2P A;  1BMO A;  2BE4 A;  1KFX S;  1N2D A;  1PVB A;  4I5L B;  4L9M A;  1CM4 A;  1GGW A;  2MHH A;  1XFX O;  1R6P A;  1UUS A;  3D10 A;  1W7J B;  1QJT A;  3I5G B;  1CMF A;  1YUR A;  1KFX L;  1TN4 A;  1AVS A;  1SRA A;  2R2I A;  3OX5 A;  2K7D A;  1JUO A;  1XK4 C;  1A4P A;  1DJZ A;  2JNF A;  4PE0 A;  5FYX A;  3KHE A;  1QIW A;  1SY9 A;  1K9K A;  3BUX B;  2B1U A;  4YRU A;  2NLN A;  1L2O C;  1SNL A;  1QIV A;  1JF2 A;  1EG3 A;  1NCY A;  2I2R E;  4DIR A;  2KNE A;  1S5G Z;  2OTG C;  1EL4 A;  2FJU B;  1SL9 A;  4DRW A;  1Y1X A;  1XFU O;  2LC5 A;  1YX8 A;  1QX7 A;  5CSF A;  1D1O A;  3NSL A;  1LIN A;  2BEC A;  3WNX B;  2FCD A;  5ER5 A;  1KK8 C;  4XJK B;  3TDI A;  1XVJ A;  1M46 A;  1BJF A;  2OS8 B;  1K95 A;  1SCV A;  3BUO B;  1F8H A;  1BOD A;  2JPT A;  5AEQ A;  1AJ5 A;  3VRN A;  1PK0 D;  4HSZ A;  1EXR A;  2KI4 C;  3SIA A;  1U5I B;  1KSO A;  1XFW O;  2LE9 B;  2BBN A;  1OE9 B;  1KFU S;  2LP3 A;  2MA2 A;  3AAJ A;  1KQV A;  1EG4 A;  1CFP A;  1ZFS A;  2M49 B;  2M3W A;  2WOS A;  1CLL A;  2H2K A;  4PE1 A;  4CLN A;  1LA3 A;  4I5N B;  2AUC A;  1QV0 A;  5CSN A;  1B9A A;  3BUM B;  4N1G A;  2BE6 A;  1Y6W A;  3CLN A;  2ZN8 A;  2K2F A;  2KGR A;  5B8I B;  4QJ4 B;  2FOT A;  3JTD B;  1S1E A;  2JT0 A;  3TDU A;  1BR1 B;  1OMV A;  4CPV A;  1IH0 A;  2NZ0 A;  3AKA A;  4A4C A;  2H61 A;  2EHB A;  1S6I A;  1KQM C;  4YGD B;  1K96 A;  1YVH A;  5I8N A;  4MBE A;  1SCM C;  2NCO A;  1B47 A;  2LMU A;  1RRO A;  2M9G A;  2LLU A;  4XYN A;  3I5G C;  1DF0 B;  2MBX A;  3C1V A;  1M63 B;  2Y1M A;  4XJK A;  1DJI A;  3CZT X;  4FTG A;  3HX4 A;  4GNK B;  2GGZ A;  4GPL B;  1PVA A;  1IWQ A;  2LVK A;  3QRX A;  5DKN A;  1WY9 A;  3OP0 A;  2JXC A;  2BCB A;  4R1E A;  1ZUZ A;  1XYD A;  3O4Y A;  1B1G A;  1BU3 A;  1JFK A;  4MRY A;  5JOL A;  1FI5 A;  4MVF A;  1SW8 A;  5AXI A;  3BUW B;  1IRJ A;  1OZS A;  2E6W A;  2L4H A;  1M39 A;  3OX6 A;  1AP4 A;  1QV1 A;  1B4C A;  1SPY A;  2H61 C;  1B7T Y;  5I2Q A;  1QVI Z;  1SYM A;  2KI6 D;  1OQP A;  1CM1 A;  2BKH B;  4MZL A;  2QAC A;  1XA5 A;  1BR4 B;  1DVI A;  3GOF A;  5HYD A;  1CLM A;  3NSO A;  2BL0 B;  1N0Y A;  4MZK A;  1A03 A;  2WC8 A;  3SG3 A;  2OS8 C;  3BUN B;  4MRX A;  2K61 A;  5AAN A;  3EK7 A;  1XO5 A;  1QLK A;  1C7V A;  1B8R A;  1UHN A;  2RGI A;  2LCP A;  4C0L A;  1IG5 A;  2BCX A;  1QAS A;  2L4I A; 
#chains in the Genus database with same CATH topology
 3O78 A;  2LMT A;  1J55 A;  4GUK A;  1X02 A;  1HQV A;  3EG5 B;  1PSB A;  3D0Y A;  4DUQ A;  2JPO A;  5CSI A;  3S0D A;  2H8V A;  2KFG A;  2L0P A;  1ALW A;  2P71 A;  3JVT B;  5D7F A;  2CTN A;  2BKI B;  3I5I B;  1TTX A;  3L4A A;  1MXL C;  3IVT A;  4AOM A;  3B87 A;  2JRF A;  2L50 A;  3S0F A;  1ORG A;  2JNX A;  1S5G Y;  2Y5I A;  4NDC A;  3DXL A;  2MJW B;  1SCM B;  3IQQ A;  3JTD C;  4OZD A;  1G4Y R;  1NSH A;  2HPS A;  1TNP A;  2LVI A;  2M8U A;  1TIZ A;  4CFQ A;  1SKT A;  1A29 A;  2GGM A;  4I5J A;  4PE7 A;  1TWO A;  1PAL A;  1V1F A;  3PN7 B;  3UNW A;  2LLT A;  2LHL A;  3DF0 A;  1CFD A;  2I7A A;  4OKH A;  1F55 A;  2KBI A;  3L47 A;  3OB1 B;  5D69 A;  3CZ0 A;  2KOT A;  4FQO A;  5GQQ C;  3WHT B;  1PRW A;  3TS5 B;  1G8I A;  2F3Y A;  2F8P A;  1KK7 Z;  2M97 A;  4YGC B;  3DVJ A;  3A4U B;  1AJ4 A;  1SR6 B;  2MLF C;  4QJ5 B;  3H4S E;  5DKR A;  3R72 A;  1CMG A;  2F2P A;  1FPW A;  2ZKM X;  1NPQ A;  3SS3 A;  2M1K B;  2KAV A;  3O2P A;  4NQG A;  1QLS A;  2QEV A;  1PUL A;  1NIW A;  1ALV A;  2I18 A;  4P5O E;  3VRO A;  3IF7 A;  2K60 A;  1TRF A;  2WCF A;  2WCE A;  1DJH A;  1CKK A;  4M2O A;  1C07 A;  3FS7 A;  3KF9 A;  2VRG A;  3NGV A;  4C0J A;  2Y4Q A;  4OVN F;  2JZI A;  2MAZ A;  3S0B A;  1N65 A;  2JWW A;  1OMD A;  2BAP A;  3DYE A;  2KPH A;  3EVR A;  4JPZ B;  4ETO A;  2Q4U A;  1YRU B;  2BL0 C;  4FQT A;  3EKH A;  4PDZ A;  4N1F A;  3CR4 X;  1SMG A;  1LA0 A;  3TZ1 A;  1MR8 A;  3FIA A;  1J7O A;  3BOW A;  1KFU L;  2KFH A;  2EC6 B;  1JBA A;  3ICB A;  5BPJ A;  1QX2 A;  2EGD A;  3SG2 A;  2MRD A;  3B6X A;  4A4B A;  4MN0 A;  2E30 A;  1PSR A;  5G08 A;  2KI6 C;  1F4O A;  3JVT C;  3K1E A;  3I5I C;  1DEK A;  2D8N A;  1S6C A;  2LVJ A;  2K7C A;  1BF5 A;  1S26 D;  1RTP 1;  1IJ5 A;  1LS8 A;  1QXP A;  2AMI A;  2DOQ A;  2O5G A;  2SAS A;  3NSK A;  1Z4H A;  1J7R A;  1DT7 B;  1RWY A;  1L7Z A;  5AER A;  4D1E A;  1DMO A;  3V2L A;  1XFR A;  1Y0V H;  2LUX A;  3D0Y B;  4JD9 A;  2GV5 A;  3SG7 A;  1V1G A;  1C3Y A;  1F4Q A;  3DD4 A;  3CZ2 A;  3PN7 C;  3VRR A;  1BOC A;  1J1D A;  4PE4 A;  3PM8 A;  3SG6 A;  1CNP A;  4E68 A;  1OMR A;  1NWD A;  2HET A;  2M7N A;  2LNK A;  1Y1A A;  5I2O A;  2WC6 A;  1K90 D;  2ZRS A;  5HLO A;  3TS5 C;  3WXA A;  2WCB A;  5CPV A;  1UHJ A;  1AUI B;  4DS7 A;  2K0J A;  3ZNI A;  2JUL A;  1SR6 C;  1CLB A;  3I5F B;  2KQY A;  2IS9 A;  1YUU A;  2WND A;  3DF0 B;  1JSA A;  1JF0 A;  1OOG A;  1CDL A;  3CYZ A;  1WLZ A;  2HQ8 A;  1MXE A;  4NDD A;  1WRL A;  4INW A;  4JQ0 D;  1TOP A;  3NHI A;  2K8M B;  3D78 A;  1YUT A;  2WCJ A;  3WHU B;  1IGV A;  2QEH A;  4YBH B;  2L2C A;  1IKU A;  1ODB A;  2JOJ A;  1DQE A;  3OB2 B;  1UHH A;  4JWQ A;  4YI9 A;  2KGB C;  2OPO A;  1NX2 A;  2F3Z A;  1DEL A;  2WCK A;  2CCM A;  4GGN A;  2LM5 A;  4PHN A;  5KSZ A;  1UHI A;  4ICB A;  3CS1 A;  3D74 A;  1SK6 D;  1YVL A;  2EC6 C;  4HRE E;  2L2E A;  3S0A A;  1G33 A;  4GFT A;  1C7W A;  2LUC A;  3TDZ A;  1YRT B;  2BNX A;  3BQ3 A;  4YGE B;  1GJY A;  1MF8 B;  2KYC A;  3N7H A;  1JC2 A;  1AHR A;  2F33 A;  3DVE A;  1B8L A;  1DC1 A;  2ZRT A;  3DVK A;  1DJW A;  2G9B A;  1NYA A;  3DVM A;  2ZNE A;  1S6J A;  1YUS A;  1TUJ A;  2M7L A;  1IQ5 A;  1QS7 A;  1XK4 A;  1CTR A;  1NCX A;  2V53 A;  2QPT A;  3BOW B;  3RLZ A;  1TCO B;  5FI6 A;  1DGV A;  2ZND A;  3ZWH A;  1CDP A;  3PAL A;  3VB1 A;  1FI6 A;  3RM1 A;  2ISD A;  3HCM A;  3CGA A;  4ORA B;  2LLS A;  4USL A;  3SJS A;  2BCA A;  1BT6 A;  1OOJ A;  2KLD A;  1B8C A;  1T14 A;  4M2Q A;  4PT1 A;  3BFB A;  2JT8 A;  3O4X A;  1RFJ A;  3LL8 B;  2AAO A;  2LMV A;  4CID A;  3R1P A;  4GGF A;  4KYN A;  1QTX A;  3K21 A;  1XFZ O;  2PRU A;  2JT3 A;  1UWO A;  1WRK A;  1MUX A;  1S3P A;  1EJ3 A;  1HT9 A;  2JTZ A;  4WQ2 A;  5HKZ A;  4I5K A;  2A4J A;  2I94 A;  3I5F C;  4BY4 A;  2L5X B;  2L98 A;  5I94 A;  2KHN A;  3E3R A;  5ER4 X;  1ZMZ A;  1YX7 A;  3NHT A;  4OR9 B;  4PHK A;  1UHK A;  3R1V A;  2L51 A;  3EVV A;  4WRI A;  1IJ6 A;  2O60 A;  4F7F A;  1GM0 A;  1K93 D;  2COL B;  3I5H B;  3CTN A;  1QWV A;  1BLQ A;  3VGO A;  2LAN A;  1OW4 A;  2SCP A;  1FW4 A;  1NX3 A;  1YR5 A;  1DJX A;  1S36 A;  4GGF C;  1Y1U A;  1F54 A;  3OHM B;  4PCW A;  1TNQ A;  1SL7 A;  3PLF B;  1DJG A;  1K94 A;  2LVV A;  2Y1N A;  4NDB A;  4P2Y B;  1MHO A;  5I2L A;  1CB1 A;  2KFF A;  3LK1 A;  2K2A A;  4IL1 A;  4ORC B;  2JU0 A;  3GK1 A;  3NXA A;  5HKW A;  3GK2 A;  3B88 A;  5HLV A;  3KPX A;  1XFY O;  3FWC A;  2KSP A;  1AK8 A;  3B86 A;  3Q8I A;  3KEV A;  3TUY B;  2BBM A;  1M45 A;  1SBJ A;  3R1O A;  5KTY A;  1K2H A;  1Q80 A;  5F6T A;  4JKT A;  2PQL A;  1OZO A;  1LKJ A;  1ZAC A;  1NX1 A;  1RJV A;  2K7O A;  2KAY A;  2ZN9 A;  4OV2 A;  1BG1 A;  5JJG A;  1H4B A;  1KCY A;  1EH2 A;  2PVB A;  1QVI Y;  3PAT A;  1Z2C B;  4C0K A;  1LVC D;  4UPG A;  3DY9 A;  1FF1 A;  3NSI A;  2FCE A;  3AAK A;  3KO0 A;  1TUZ A;  1JWD A;  3CR2 A;  1KWO B;  4MZJ A;  1W7I B;  2PSR A;  2HQW A;  4ZCU A;  4PAL A;  1KSM A;  2PYQ A;  1CDM A;  1WDC B;  1XFV O;  2QEO A;  1CDN A;  4MEW A;  3EK8 A;  3GK4 X;  2M0R A;  1CFC A;  1REC A;  2KAX A;  3MSE B;  2LP2 A;  3PM2 A;  1F70 A;  1ZOT B;  1NX0 A;  3BYA A;  1JFJ A;  1M31 A;  1MQ1 A;  1UP5 A;  3EKJ A;  4GAO A;  1QX5 B;  3SG4 A;  3D75 A;  4ZCV A;  3BXK A;  2KDH A;  2G2B A;  3LCP C;  1YTZ C;  1TCF A;  5K89 A;  3SIB A;  4OCI A;  1OSA A;  4QJ3 B;  2JXL A;  5PAL A;  1NUB A;  2JQ6 A;  5TNC A;  2M1U A;  3SG5 A;  2KYF A;  2LHI A;  1GQM A;  3S0E A;  1L2O B;  3PFV A;  4HRH A;  3SS5 A;  1NP8 A;  4PHJ A;  4F0Z B;  3VRP A;  1A75 B;  1J1E A;  3LLE A;  1U5I A;  2OTG B;  5HKY A;  4YGB B;  4Q04 A;  1E8A A;  5DKQ A;  1UUR A;  2Q91 A;  2F2O A;  4GBA A;  1H8B A;  1OOH A;  1OOF A;  2KQ6 A;  5IBW A;  1VRK A;  5CSJ A;  3SS4 A;  1P28 A;  2TN4 A;  3I5H C;  2M29 A;  4BY5 A;  3IQO A;  1KK8 B;  1IQ3 A;  4YGA A;  4CFR A;  2CBL A;  1K8U A;  1LXF C;  4TNC A;  2JTT A;  2K7B A;  1WRZ A;  2FJY A;  2PAL A;  2KBM A;  1TNW A;  1DTL A;  3CWG A;  4N5X A;  5FI7 A;  5AFP A;  2KI4 B;  1K9P A;  2NCP A;  1KK7 Y;  2CT9 A;  3FWB A;  2NXQ A;  1J7P A;  3LK0 A;  1F71 A;  3BJH A;  2L5Y A;  3CAB A;  3FE8 A;  1SL8 A;  1MWN A;  3CR5 X;  1FBV A;  3FE9 A;  5D3O A;  1QAT A;  1RK9 A;  2MLE C;  5FI2 A;  3TUY C;  3O6B A;  1J7Q A;  4AQI A;  2GTE A;  1NCZ A;  2CNP A;  2P6B B;  1W9Z A;  2PMY A;  3AKB A;  1K9U A;  2ZFD A;  4MLW A;  4ORB B;  1CFF A;  3EK4 A;  4MSP A;  5EL2 A;  5J3X A;  4AQJ A;  5KU1 A;  2WCM A;  1B7T Z;  1DF0 A;  5DIC A;  2CXJ A;  4YI8 A;  1GGZ A;  4HRG A;  2PAS A;  4DCK A;  1A2X A;  2JC2 A;  2LV7 A;  1KWO C;  2P70 A;  2WOR A;  1R2U A;  1A75 A;  3VRQ A;  1WLM A;  4U8D A;  3EVU A;  1TNX A;  2HF5 A;  4PHM A;  1KQM B;  1DGU A;  1DJY A;  1WDC C;  2LAP A;  3A8R A;  3M0W A;  3PSR A;  4WQ3 A;  3F45 A;  4M2P A;  1BMO A;  2BE4 A;  1KFX S;  3PJI A;  3S0G A;  3CDN A;  1OOI X;  2WCH A;  1N2D A;  1PVB A;  4I5L B;  4L9M A;  1CM4 A;  1GGW A;  2MHH A;  1XFX O;  1R6P A;  1UUS A;  3D10 A;  1W7J B;  1QJT A;  3I5G B;  1CMF A;  1YUR A;  1KFX L;  1TN4 A;  1AVS A;  1SRA A;  2R2I A;  3B7A A;  3D73 A;  2K7D A;  3OX5 A;  1JUO A;  1XK4 C;  1A4P A;  1DJZ A;  2JNF A;  3BFH A;  4PE0 A;  5FYX A;  3KHE A;  1QIW A;  1SY9 A;  1K9K A;  3BUX B;  4IJ7 A;  2B1U A;  4YRU A;  2NLN A;  1L2O C;  1SNL A;  1QIV A;  1JF2 A;  1EG3 A;  1NCY A;  2I2R E;  4DIR A;  3RZS A;  2QEB A;  3D77 A;  2KNE A;  1S5G Z;  2OTG C;  1C3Z A;  1EL4 A;  2FJU B;  1SL9 A;  4DRW A;  1Y1X A;  1XFU O;  2LC5 A;  1YX8 A;  1QX7 A;  5CSF A;  1D1O A;  3NSL A;  3D76 A;  4INX A;  1LIN A;  2BEC A;  3WNX B;  2FCD A;  2WC5 A;  5ER5 A;  1KK8 C;  4XJK B;  3TDI A;  1XVJ A;  1M46 A;  1BJF A;  2OS8 B;  1K95 A;  1SCV A;  3BUO B;  1F8H A;  1BOD A;  2JPT A;  5AEQ A;  1AJ5 A;  3VRN A;  1PK0 D;  4HSZ A;  1EXR A;  2KI4 C;  3SIA A;  1U5I B;  3DZT A;  1KSO A;  1XFW O;  2LE9 B;  2BBN A;  1OE9 B;  1KFU S;  2WCL A;  2LP3 A;  2MA2 A;  3AAJ A;  1KQV A;  1EG4 A;  1CFP A;  1ZFS A;  2M49 B;  2M3W A;  2WOS A;  1CLL A;  2H2K A;  4PE1 A;  4CLN A;  1LA3 A;  1IIO A;  4I5N B;  2AUC A;  1QV0 A;  5CSN A;  1B9A A;  3BUM B;  4N1G A;  2BE6 A;  1Y6W A;  3CLN A;  3QME A;  2ZN8 A;  2K2F A;  2KGR A;  5B8I B;  4QJ4 B;  2FOT A;  3JTD B;  1S1E A;  2JT0 A;  3TDU A;  1BR1 B;  1OMV A;  4CPV A;  1IH0 A;  2NZ0 A;  3AKA A;  4A4C A;  2H61 A;  2EHB A;  1S6I A;  1KQM C;  4YGD B;  5HL1 A;  1K96 A;  1YVH A;  5I8N A;  4MBE A;  1SCM C;  2NCO A;  3UO9 A;  1B47 A;  2LMU A;  1RRO A;  2ERB A;  2M9G A;  2LLU A;  4XYN A;  3I5G C;  1DF0 B;  2MBX A;  3C1V A;  1M63 B;  2Y1M A;  4XJK A;  1DJI A;  3CZT X;  4FTG A;  3HX4 A;  3CZ1 A;  3BFA A;  4GNK B;  2GGZ A;  4GPL B;  1PVA A;  1IWQ A;  2LVK A;  3QRX A;  5DKN A;  1WY9 A;  3OBV A;  2JXC A;  2BCB A;  3OP0 A;  4R1E A;  1ZUZ A;  1XYD A;  3O4Y A;  1B1G A;  1BU3 A;  1JFK A;  2KLE A;  2YGU A;  4MRY A;  5JOL A;  1FI5 A;  4MVF A;  1SW8 A;  5AXI A;  3BUW B;  1IRJ A;  1OZS A;  2E6W A;  2L4H A;  1M39 A;  3L4L A;  3OX6 A;  1QV1 A;  1AP4 A;  1B4C A;  1SPY A;  2H61 C;  1B7T Y;  5I2Q A;  1QVI Z;  1SYM A;  2KI6 D;  1OQP A;  1CM1 A;  2BKH B;  4MZL A;  2QDI A;  2QAC A;  1XA5 A;  1BR4 B;  1DVI A;  3GOF A;  5HYD A;  1CLM A;  3NSO A;  1SSE B;  2BL0 B;  1N0Y A;  4MZK A;  1A03 A;  2WC8 A;  3SG3 A;  2OS8 C;  3BUN B;  4MRX A;  2K61 A;  5AAN A;  3EK7 A;  3FE6 A;  1XO5 A;  1QLK A;  3OGN A;  1C7V A;  1B8R A;  1UHN A;  2RGI A;  2LCP A;  4C0L A;  1IG5 A;  2BCX A;  1QAS A;  2L4I A; 
#chains in the Genus database with same CATH homology
 3O78 A;  2LMT A;  1J55 A;  4GUK A;  1X02 A;  1HQV A;  1PSB A;  3D0Y A;  4DUQ A;  5CSI A;  2KFG A;  2L0P A;  3JVT B;  1ALW A;  5D7F A;  2CTN A;  2BKI B;  3I5I B;  1TTX A;  1MXL C;  4AOM A;  2JRF A;  2L50 A;  2JNX A;  1S5G Y;  2Y5I A;  4NDC A;  2MJW B;  1SCM B;  3IQQ A;  3JTD C;  1G4Y R;  1NSH A;  2HPS A;  1TNP A;  2LVI A;  2M8U A;  1TIZ A;  4CFQ A;  1SKT A;  1A29 A;  2GGM A;  4I5J A;  4PE7 A;  1PAL A;  1V1F A;  3PN7 B;  2LLT A;  2LHL A;  3DF0 A;  1CFD A;  2I7A A;  4OKH A;  1F55 A;  2KBI A;  3OB1 B;  5D69 A;  5GQQ C;  2KOT A;  4FQO A;  3WHT B;  1PRW A;  3TS5 B;  1G8I A;  2F3Y A;  2F8P A;  1KK7 Z;  2M97 A;  4YGC B;  3DVJ A;  3A4U B;  1AJ4 A;  1SR6 B;  2MLF C;  4QJ5 B;  3H4S E;  5DKR A;  1CMG A;  2F2P A;  1FPW A;  2ZKM X;  1NPQ A;  2M1K B;  2KAV A;  3O2P A;  4NQG A;  1QLS A;  1PUL A;  1NIW A;  1ALV A;  2I18 A;  4P5O E;  3VRO A;  3IF7 A;  1TRF A;  2WCF A;  2WCE A;  1DJH A;  1CKK A;  4M2O A;  1C07 A;  3FS7 A;  3KF9 A;  2VRG A;  4C0J A;  2Y4Q A;  4OVN F;  2JZI A;  2MAZ A;  1N65 A;  2JWW A;  1OMD A;  3EVR A;  4JPZ B;  4ETO A;  2Q4U A;  1YRU B;  2BL0 C;  3EKH A;  4PDZ A;  4N1F A;  3CR4 X;  1SMG A;  1LA0 A;  3TZ1 A;  1MR8 A;  3FIA A;  1J7O A;  3BOW A;  1KFU L;  2KFH A;  2EC6 B;  1JBA A;  3ICB A;  5BPJ A;  1QX2 A;  2EGD A;  3SG2 A;  2MRD A;  4A4B A;  4MN0 A;  2E30 A;  1PSR A;  5G08 A;  2KI6 C;  1F4O A;  3JVT C;  3I5I C;  2D8N A;  1S6C A;  2LVJ A;  2K7C A;  1BF5 A;  1S26 D;  1RTP 1;  1IJ5 A;  1QXP A;  2AMI A;  2DOQ A;  2O5G A;  2SAS A;  3NSK A;  1DT7 B;  1J7R A;  1RWY A;  1L7Z A;  5AER A;  4D1E A;  1DMO A;  1Y0V H;  2LUX A;  3D0Y B;  3SG7 A;  2GV5 A;  1V1G A;  1F4Q A;  3DD4 A;  3PN7 C;  3VRR A;  1BOC A;  1J1D A;  4PE4 A;  3PM8 A;  3SG6 A;  1CNP A;  4E68 A;  1OMR A;  1NWD A;  2HET A;  2M7N A;  2LNK A;  1Y1A A;  5I2O A;  1K90 D;  2ZRS A;  5HLO A;  3TS5 C;  3WXA A;  2WCB A;  5CPV A;  1UHJ A;  1AUI B;  4DS7 A;  2K0J A;  3ZNI A;  2JUL A;  1SR6 C;  1CLB A;  3I5F B;  2KQY A;  2IS9 A;  1YUU A;  2WND A;  3DF0 B;  1JSA A;  1JF0 A;  1CDL A;  1WLZ A;  2HQ8 A;  1MXE A;  4NDD A;  1WRL A;  4JQ0 D;  1TOP A;  2K8M B;  1YUT A;  1IGV A;  4YBH B;  1IKU A;  1ODB A;  2JOJ A;  3OB2 B;  1UHH A;  4JWQ A;  4YI9 A;  2KGB C;  2OPO A;  1NX2 A;  2F3Z A;  2CCM A;  4GGN A;  2LM5 A;  4PHN A;  5KSZ A;  1UHI A;  4ICB A;  3CS1 A;  1SK6 D;  1YVL A;  2EC6 C;  4HRE E;  2L2E A;  1G33 A;  4GFT A;  1C7W A;  2LUC A;  3TDZ A;  1YRT B;  3BQ3 A;  4YGE B;  1GJY A;  1MF8 B;  2KYC A;  1JC2 A;  1AHR A;  2F33 A;  3DVE A;  1B8L A;  2ZRT A;  3DVK A;  1DJW A;  2G9B A;  1NYA A;  3DVM A;  2ZNE A;  1S6J A;  1YUS A;  2M7L A;  1IQ5 A;  1QS7 A;  1XK4 A;  1CTR A;  1NCX A;  2V53 A;  2QPT A;  3BOW B;  3RLZ A;  1TCO B;  1DGV A;  2ZND A;  3ZWH A;  1CDP A;  3PAL A;  1FI6 A;  3RM1 A;  2ISD A;  3HCM A;  3CGA A;  4ORA B;  2LLS A;  4USL A;  3SJS A;  2BCA A;  1BT6 A;  1OOJ A;  1B8C A;  4M2Q A;  2JT8 A;  1RFJ A;  3LL8 B;  2AAO A;  2LMV A;  4CID A;  4GGF A;  1QTX A;  3K21 A;  1XFZ O;  2PRU A;  2JT3 A;  1UWO A;  1WRK A;  1MUX A;  1S3P A;  1EJ3 A;  1HT9 A;  2JTZ A;  4WQ2 A;  5HKZ A;  4I5K A;  2A4J A;  2I94 A;  3I5F C;  4BY4 A;  2L5X B;  2L98 A;  2KHN A;  3E3R A;  5ER4 X;  1ZMZ A;  1YX7 A;  4OR9 B;  4PHK A;  1UHK A;  2L51 A;  3EVV A;  4WRI A;  1IJ6 A;  2O60 A;  2COL B;  1K93 D;  3I5H B;  3CTN A;  1BLQ A;  3VGO A;  2LAN A;  2SCP A;  1FW4 A;  1NX3 A;  1DJX A;  1YR5 A;  1S36 A;  4GGF C;  1Y1U A;  1F54 A;  3OHM B;  4PCW A;  1TNQ A;  1SL7 A;  3PLF B;  1DJG A;  1K94 A;  2LVV A;  2Y1N A;  4NDB A;  4P2Y B;  1MHO A;  5I2L A;  1CB1 A;  2KFF A;  3LK1 A;  2K2A A;  4IL1 A;  4ORC B;  2JU0 A;  3GK1 A;  3NXA A;  5HKW A;  3GK2 A;  5HLV A;  3KPX A;  1XFY O;  3FWC A;  2KSP A;  1AK8 A;  3KEV A;  3TUY B;  2BBM A;  1M45 A;  1SBJ A;  5KTY A;  1K2H A;  1Q80 A;  5F6T A;  1OZO A;  1LKJ A;  1ZAC A;  1NX1 A;  1RJV A;  2K7O A;  2KAY A;  2ZN9 A;  4OV2 A;  1BG1 A;  5JJG A;  1H4B A;  1KCY A;  1EH2 A;  2PVB A;  1QVI Y;  3PAT A;  4C0K A;  1LVC D;  4UPG A;  1FF1 A;  3NSI A;  2FCE A;  3AAK A;  3KO0 A;  1JWD A;  3CR2 A;  1KWO B;  4MZJ A;  1W7I B;  2PSR A;  2HQW A;  4ZCU A;  4PAL A;  1KSM A;  1CDM A;  1WDC B;  1XFV O;  1CDN A;  4MEW A;  3EK8 A;  3GK4 X;  2M0R A;  1CFC A;  1REC A;  2KAX A;  3MSE B;  2LP2 A;  1F70 A;  1ZOT B;  1NX0 A;  3BYA A;  1JFJ A;  1M31 A;  1MQ1 A;  1UP5 A;  3EKJ A;  4GAO A;  1QX5 B;  3SG4 A;  4ZCV A;  3BXK A;  2KDH A;  2G2B A;  3LCP C;  1YTZ C;  1TCF A;  5K89 A;  3SIB A;  4OCI A;  1OSA A;  4QJ3 B;  2JXL A;  5PAL A;  1NUB A;  2JQ6 A;  5TNC A;  2M1U A;  3SG5 A;  2KYF A;  2LHI A;  1GQM A;  1L2O B;  3PFV A;  4HRH A;  1NP8 A;  4PHJ A;  4F0Z B;  3VRP A;  1A75 B;  1J1E A;  3LLE A;  1U5I A;  2OTG B;  5HKY A;  4YGB B;  4Q04 A;  1E8A A;  5DKQ A;  1UUR A;  2Q91 A;  2F2O A;  4GBA A;  1H8B A;  2KQ6 A;  5IBW A;  1VRK A;  5CSJ A;  2TN4 A;  3I5H C;  2M29 A;  4BY5 A;  3IQO A;  1KK8 B;  1IQ3 A;  4YGA A;  4CFR A;  2CBL A;  1K8U A;  1LXF C;  4TNC A;  2JTT A;  2K7B A;  1WRZ A;  2PAL A;  3CWG A;  2KBM A;  1TNW A;  1DTL A;  5AFP A;  4N5X A;  2KI4 B;  1K9P A;  2NCP A;  1KK7 Y;  2CT9 A;  3FWB A;  2NXQ A;  1J7P A;  3LK0 A;  1F71 A;  1SL8 A;  1MWN A;  3CR5 X;  1FBV A;  1QAT A;  1RK9 A;  2MLE C;  3TUY C;  3O6B A;  1J7Q A;  4AQI A;  1NCZ A;  2CNP A;  2P6B B;  2PMY A;  3AKB A;  4MLW A;  1K9U A;  2ZFD A;  4ORB B;  3WHU B;  1CFF A;  3EK4 A;  4MSP A;  4AQJ A;  5J3X A;  5KU1 A;  1B7T Z;  1DF0 A;  2CXJ A;  4YI8 A;  1GGZ A;  4HRG A;  2PAS A;  4DCK A;  1A2X A;  2JC2 A;  2LV7 A;  1KWO C;  2WOR A;  3VRQ A;  1R2U A;  1A75 A;  1WLM A;  4U8D A;  3EVU A;  1TNX A;  2HF5 A;  4PHM A;  1KQM B;  1DGU A;  1DJY A;  1WDC C;  2LAP A;  3A8R A;  3M0W A;  3PSR A;  4WQ3 A;  3F45 A;  4M2P A;  1BMO A;  2BE4 A;  1KFX S;  1N2D A;  1PVB A;  4I5L B;  4L9M A;  1CM4 A;  1GGW A;  2MHH A;  1XFX O;  1R6P A;  1UUS A;  3D10 A;  1W7J B;  1QJT A;  3I5G B;  1CMF A;  1YUR A;  1KFX L;  1TN4 A;  1AVS A;  1SRA A;  2R2I A;  3OX5 A;  2K7D A;  1JUO A;  1XK4 C;  1A4P A;  1DJZ A;  2JNF A;  4PE0 A;  5FYX A;  3KHE A;  1QIW A;  1SY9 A;  1K9K A;  3BUX B;  2B1U A;  4YRU A;  2NLN A;  1L2O C;  1SNL A;  1QIV A;  1JF2 A;  1EG3 A;  1NCY A;  2I2R E;  4DIR A;  2KNE A;  1S5G Z;  2OTG C;  1EL4 A;  2FJU B;  1SL9 A;  4DRW A;  1Y1X A;  1XFU O;  2LC5 A;  1YX8 A;  1QX7 A;  5CSF A;  1D1O A;  3NSL A;  1LIN A;  2BEC A;  3WNX B;  2FCD A;  5ER5 A;  1KK8 C;  4XJK B;  3TDI A;  1XVJ A;  1M46 A;  1BJF A;  2OS8 B;  1K95 A;  1SCV A;  3BUO B;  1F8H A;  1BOD A;  2JPT A;  5AEQ A;  1AJ5 A;  3VRN A;  1PK0 D;  4HSZ A;  1EXR A;  2KI4 C;  3SIA A;  1U5I B;  1KSO A;  1XFW O;  2LE9 B;  2BBN A;  1OE9 B;  1KFU S;  2LP3 A;  2MA2 A;  3AAJ A;  1KQV A;  1EG4 A;  1CFP A;  1ZFS A;  2M49 B;  2M3W A;  2WOS A;  1CLL A;  2H2K A;  4PE1 A;  4CLN A;  1LA3 A;  4I5N B;  2AUC A;  1QV0 A;  5CSN A;  1B9A A;  3BUM B;  4N1G A;  2BE6 A;  1Y6W A;  3CLN A;  2ZN8 A;  2K2F A;  2KGR A;  5B8I B;  4QJ4 B;  2FOT A;  3JTD B;  1S1E A;  2JT0 A;  3TDU A;  1BR1 B;  1OMV A;  4CPV A;  1IH0 A;  2NZ0 A;  3AKA A;  4A4C A;  2H61 A;  2EHB A;  1S6I A;  1KQM C;  4YGD B;  1K96 A;  1YVH A;  5I8N A;  4MBE A;  1SCM C;  2NCO A;  1B47 A;  2LMU A;  1RRO A;  2M9G A;  2LLU A;  4XYN A;  3I5G C;  1DF0 B;  2MBX A;  3C1V A;  1M63 B;  2Y1M A;  4XJK A;  1DJI A;  3CZT X;  4FTG A;  3HX4 A;  4GNK B;  2GGZ A;  4GPL B;  1PVA A;  1IWQ A;  2LVK A;  3QRX A;  5DKN A;  1WY9 A;  3OP0 A;  2JXC A;  2BCB A;  4R1E A;  1ZUZ A;  1XYD A;  3O4Y A;  1B1G A;  1BU3 A;  1JFK A;  4MRY A;  5JOL A;  1FI5 A;  4MVF A;  1SW8 A;  5AXI A;  3BUW B;  1IRJ A;  1OZS A;  2E6W A;  2L4H A;  1M39 A;  3OX6 A;  1AP4 A;  1QV1 A;  1B4C A;  1SPY A;  2H61 C;  1B7T Y;  5I2Q A;  1QVI Z;  1SYM A;  2KI6 D;  1OQP A;  1CM1 A;  2BKH B;  4MZL A;  2QAC A;  1XA5 A;  1BR4 B;  1DVI A;  3GOF A;  5HYD A;  1CLM A;  3NSO A;  2BL0 B;  1N0Y A;  4MZK A;  1A03 A;  2WC8 A;  3SG3 A;  2OS8 C;  3BUN B;  4MRX A;  2K61 A;  5AAN A;  3EK7 A;  1XO5 A;  1QLK A;  1C7V A;  1B8R A;  1UHN A;  2RGI A;  2LCP A;  4C0L A;  1IG5 A;  2BCX A;  1QAS A;  2L4I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...