1AP4A

Regulatory domain of human cardiac troponin c in the calcium-saturated state, nmr, 40 structures
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
89
structure length
89
Chain Sequence
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Calcium-binding
molecule keywords CARDIAC N-TROPONIN C
publication title Calcium-induced structural transition in the regulatory domain of human cardiac troponin C.
pubmed doi rcsb
source organism Homo sapiens
total genus 19
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 1997-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1ap4A00
1KSOA 1MHOA 1UHKA 2HQWA 4YGDB 1TNXA 5I2LA 1UHHA 1SMGA 4CIDA 1IJ5A 2F2PA 3NSKA 1EXRA 1JFKA 1NCYA 1OMDA 1XFUO 1XK4C 1YUSA 4YRUA 3EK7A 1XFWO 1XYDA 2L50A 1J7PA 1FI5A 2ZRSA 2F3YA 4YI9A 2CBLA 3DD4A 2M1KB 2QACA 5AANA 1AP4A 1CDLA 4GFTA 1LINA 1QJTA 1JSAA 1OZOA 2LANA 5ER4X 3BUNB 3TS5B 1F8HA 1M63B 3A8RA 5CSFA 2BE4A 2KAVA 1QXPA 2LVKA 4CLNA 1S1EA 2B1UA 2MHHA 1KQMB 1HT9A 1YURA 5HYDA 1S3PA 2LMUA 1JUOA 1WY9A 2E6WA 3FIAA 3TDIA 1BODA 2LV7A 3JVTC 1ZOTB 1J1EA 3SIBA 4GPLB 1G4YR 2LE9B 1IWQA 2K7BA 3AKBA 2JTTA 1NPQA 1A75A 4DS7A 1AJ5A 1N65A 1NIWA 1NUBA 1SR6B 1SK6D 1A75B 1CM1A 1YR5A 2EC6B 3NSOA 1NP8A 1B7TY 1L7ZA 2MRDA 2SCPA 4USLA 3SG6A 1K90D 4U8DA 1BR4B 2JC2A 3TS5C 1DJYA 2KQYA 4OVNF 2JNFA 2M8UA 1KFXL 1RECA 2OPOA 2JRFA 1NWDA 3OX5A 2MAZA 4MEWA 2M29A 2F2OA 5B8IB 3D10A 1HQVA 2R2IA 4AOMA 2JT8A 4YGCB 1AVSA 2KHNA 4MRXA 1PRWA 1SCMC 3EK4A 3OX6A 4MZJA 1SL9A 1TNQA 4ORCB 2BKIB 4N1GA 2CCMA 2ISDA 1S6IA 4MZLA 1MR8A 2OS8B 1K93D 5ER5A 3WHTB 5DKQA 3VRRA 2JWWA 1SY9A 5I2OA 1H4BA 1S5GZ 3AAKA 3D0YA 3D0YB 3O4YA 3VROA 5AFPA 5HLVA 5BPJA 1SR6C 4QJ4B 3K21A 2V53A 1B47A 1BJFA 1D1OA 1CDMA 1M31A 2MA2A 2CXJA 3M0WA 2LP2A 2KYFA 3O6BA 3TUYB 1EH2A 2FJUB 4ORAB 1CLBA 1FF1A 1LXFC 3BUMB 5JJGA 3F45A 1QX5B 1TCFA 1J7RA 3EVRA 5IBWA 2DOQA 1RFJA 2M9GA 2FOTA 2P6BB 1FBVA 5D7FA 1DT7B 2M7NA 4A4BA 2OS8C 1QX2A 4E68A 1IQ5A 1SPYA 2JXLA 4M2QA 4MN0A 2IS9A 5DKRA 1PK0D 1OE9B 2E30A 1QLKA 1NYAA 5CSNA 1K9KA 1S6JA 3DVJA 4ORBB 2K0JA 2WCFA 4I5JA 3PLFB 1Y1UA 1DJXA 1RK9A 2AMIA 5DKNA 1WRZA 1E8AA 3H4SE 1WRKA 1KFXS 4P2YB 2L51A 1BOCA 4UPGA 3DVKA 1BR1B 2H2KA 1K94A 4CFQA 1YUTA 4PHKA 1PSBA 3LK1A 2PVBA 1KK8B 2K2FA 1IG5A 3JTDB 5J3XA 5FYXA 1CDNA 1DJGA 4HREE 2K7DA 1Y1XA 1DTLA 2K61A 4C0JA 4FQOA 3DVEA 2KAXA 4GBAA 1NX2A 2HPSA 4OV2A 2JXCA 1U5IA 2KNEA 5HKYA 1PVBA 1U5IB 1B9AA 1QIWA 2GGMA 4DCKA 4YBHB 4C0LA 3LLEA 4N5XA 3HCMA 4ZCUA 4DIRA 4BY4A 2PRUA 4PHJA 1BF5A 1K9UA 1TRFA 2JNXA 1KWOB 1ALVA 3CWGA 3A4UB 1J7OA 2LVIA 1EG3A 1XFVO 3VRQA 1DGUA 3PATA 2M3WA 4HSZA 2HQ8A 5HKWA 1EJ3A 1W7IB 1JBAA 3WXAA 1CB1A 1C7WA 3PALA 2KFHA 1B1GA 1KK7Y 4GGFC 3FS7A 2LVVA 2L0PA 1V1FA 4N1FA 1CKKA 3O2PA 1ODBA 3I5FB 2SASA 1R6PA 1KFUS 1QIVA 1AUIB 2OTGB 4XJKA 1J1DA 4C0KA 4XJKB 4AQJA 1Y6WA 3I5HB 3CLNA 2WCEA 1N0YA 2Q4UA 3CR5X 4JQ0D 1KWOC 3ZNIA 4PE1A 4AQIA 3AAJA 2F3ZA 4ZCVA 2KOTA 1S36A 1QX7A 2LMVA 2I94A 3I5IB 1G33A 2AUCA 3RLZA 1WRLA 1F70A 1GJYA 4WQ2A 1AHRA 1CLMA 2ZFDA 1Q80A 1CFFA 3CS1A 3HX4A 3TZ1A 4OKHA 3C1VA 1KQMC 1PULA 3NSIA 3IQOA 4JPZB 3QRXA 4MBEA 5CSJA 1F55A 1PVAA 1QV0A 2JOJA 5KTYA 1JF0A 3SG7A 2H61A 2G2BA 5HLOA 3SJSA 5PALA 1JF2A 3EK8A 1AK8A 4P5OE 1IJ6A 3NSLA 1CMFA 1KSMA 1MQ1A 4MZKA 2ZN9A 1PALA 2JPTA 4GGNA 2L98A 2RGIA 1UURA 2LNKA 3GK4X 2EC6C 3SG3A 3SG4A 1BU3A 2CTNA 3OHMB 1G8IA 3I5IC 1CMGA 2K8MB 1GGWA 2BBNA 5I2QA 2PSRA 4PALA 1IKUA 1QVIZ 2KBMA 2KGRA 1B4CA 4DRWA 1SRAA 1K9PA 3EKHA 2KDHA 3PN7B 1F4OA 4L9MA 4XYNA 2Y1MA 1KCYA 1CFPA 4CFRA 4WRIA 1JFJA 3BXKA 1YVHA 1L2OB 3VRNA 3OP0A 4A4CA 1DJWA 3I5GB 1CTRA 1SCVA 2L5XB 1DJIA 4M2OA 3WHUB 5F6TA 2KAYA 1XFXO 3EVUA 4OR9B 1C7VA 1J55A 1NSHA 1ALWA 2JQ6A 2KGBC 2L2EA 1UWOA 1XO5A 1YX8A 2Q91A 3TUYC 1UHIA 3EVVA 2WOSA 1CM4A 3PN7C 4GNKB 3TDZA 4WQ3A 2M97A 2COLB 1B7TZ 1WDCB 2M7LA 1YUUA 5JOLA 3CR4X 2BL0B 1LVCD 1MUXA 1A29A 1NX0A 2HF5A 1UP5A 2LM5A 2LHIA 4IL1A 3CGAA 2ZNDA 5AXIA 2KI4B 2LLTA 3PM8A 4GUKA 1SL8A 1XK4A 3BOWA 1M45A 2F8PA 4I5KA 4D1EA 1GGZA 3BOWB 4M2PA 1JC2A 2LLSA 2KI6D 2EHBA 2JT0A 1B8RA 5HKZA 3E3RA 3FWCA 1BMOA 2ZRTA 3DF0A 5I8NA 3DF0B 2WCBA 1OOJA 4FTGA 3GK1A 1GQMA 1SKTA 2BBMA 1MWNA 1SW8A 2LUXA 2FCEA 5CPVA 3SG2A 1A03A 5GQQC 2BECA 2PMYA 1W7JB 2O5GA 3AKAA 1KK8C 2BL0C 3EKJA 1S26D 2LMTA 2LHLA 3JTDC 3KO0A 4BY5A 3TDUA 1S5GY 2LAPA 1EL4A 2Y4QA 3BUOB 2GV5A 4MRYA 2KI4C 2MLEC 3CR2A 2JZIA 1XFZO 1NX3A 2NXQA 1N2DA 4PE4A 4YGBB 1SNLA 2MLFC 4NDCA 4PE0A 3SIAA 1NX1A 5K89A 1DF0A 3JVTB 2KQ6A 4I5LB 4I5NB 1DF0B 2L4IA 1QVIY 3SG5A 1TTXA 3CZTX 2ZKMX 2TN4A 2NCOA 4MLWA 1FI6A 1S6CA 4MVFA 4PHMA 3VRPA 1QLSA 2KFGA 1LA0A 1Y0VH 1IRJA 2KBIA 3KHEA 2MBXA 3MSEB 1IGVA 3OB2B 2M49B 2K2AA 1BG1A 5CSIA 2LLUA 2EGDA 2KFFA 4PHNA 1B8LA 2L4HA 2JU0A 2BCXA 1YX7A 1SCMB 2ZNEA 1CNPA 3DVMA 5AERA 1CDPA 2BCBA 2M1UA 1TIZA 1F4QA 1QTXA 1DGVA 1ZMZA 1RWYA 3I5FC 5KU1A 1YTZC 2BKHB 2MJWB 5TNCA 2PALA 1C07A 2OTGC 2JT3A 2JULA 3I5HC 1F71A 1SYMA 1TN4A 4ETOA 4CPVA 4OCIA 1QATA 1OSAA 3BQ3A 2I18A 2AAOA 1IQ3A 1TNPA 4QJ3B 2LC5A 2F33A 4PCWA 4NQGA 1PSRA 4TNCA 3GOFA 5D69A 1QS7A 1RTP1 1YVLA 1ZFSA 1F54A 1XFYO 1SBJA 1K2HA 1SL7A 3OB1B 5AEQA 3BYAA 3RM1A 1X02A 1H8BA 1EG4A 3O78A 2FCDA 1KQVA 2O60A 4HRGA 3IF7A 3LL8B 2H61C 3GK2A 1CFCA 3KEVA 2G9BA 1OMRA 3BUWB 1WLMA 1KK7Z 3BUXB 4PE7A 3VGOA 4YGEB 4HRHA 1MF8B 2WC8A 2BE6A 1V1GA 1BLQA 2KYCA 1OZSA 1ZACA 2NZ0A 1DJHA 1YRTB 4DUQA 1NCZA 5KSZA 1B8CA 1TCOB 4NDDA 4JWQA 2ZN8A 4R1EA 1LA3A 3PFVA 1LKJA 3KPXA 1OMVA 1QASA 1K95A 1OQPA 2BCAA 1JWDA 4YGAA 1YRUB 1FW4A 1DJZA 2QPTA 1K8UA 1QV1A 2K7OA 1M46A 2LCPA 3CTNA 1DVIA 2I2RE 2JTZA 1DMOA 1Y1AA 4ICBA 1MXLC 2WNDA 1J7QA 2LUCA 1L2OC 1CLLA 1NCXA 3IQQA 3LCPC 2HETA 1BT6A 2NCPA 1ZUZA 2LP3A 1UHJA 2LVJA 1AJ4A 1KFUL 3I5GC 1A2XA 4GAOA 1UHNA 2WORA 4Q04A 2Y1NA 2CT9A 2NLNA 2CNPA 1XA5A 2KSPA 2VRGA 1WLZA 4QJ5B 1TOPA 3ICBA 3FWBA 5G08A 2KI6C 2GGZA 2A4JA 3LK0A 4MSPA 3WNXB 3PSRA 3KF9A 3NXAA 1XVJA 4YI8A 1RROA 1K96A 1IH0A 1MXEA 1TNWA 2I7AA 1R2UA 1A4PA 2D8NA 2PASA 1WDCC 4PDZA 3ZWHA 1RJVA 2K7CA 4NDBA 2M0RA 1VRKA 4F0ZB 1FPWA 4GGFA 1UUSA 1M39A 1CFDA 2Y5IA
chains in the Genus database with same CATH superfamily
1KSOA 1MHOA 1UHKA 2HQWA 2KLEA 1TNXA 4YGDB 1UHHA 1SMGA 5I2LA 4CIDA 1IJ5A 1W9ZA 2F2PA 3NSKA 1EXRA 1JFKA 1NCYA 1OMDA 1XFUO 1XK4C 1YUSA 4YRUA 2L2CA 3EK7A 1XFWO 1XYDA 2L50A 3FE8A 1J7PA 1FI5A 2ZRSA 2F3YA 4YI9A 3B88A 2CBLA 3DD4A 2M1KB 2QACA 5AANA 1AP4A 1CDLA 4GFTA 1LINA 2PQLA 1QJTA 3CZ2A 1OZOA 1TUJA 2LANA 1JSAA 5ER4X 3BUNB 3TS5B 1F8HA 1M63B 2WCLA 3A8RA 5CSFA 2BE4A 2KAVA 5FI2A 3UNWA 1QXPA 2LVKA 4CLNA 1S1EA 2B1UA 2MHHA 3SS5A 1KQMB 1HT9A 1YURA 5HYDA 1S3PA 2LMUA 1XFRA 1JUOA 1WY9A 2E6WA 3FIAA 3TDIA 1BODA 2LV7A 3JVTC 1ZOTB 1J1EA 3SIBA 4GPLB 3DYEA 1G4YR 2LE9B 4JD9A 1IWQA 3L47A 2K7BA 3AKBA 5DICA 2JTTA 1NPQA 1A75A 4DS7A 1AJ5A 1N65A 1NIWA 1NUBA 1SR6B 1SK6D 1A75B 1CM1A 1YR5A 2EC6B 3NSOA 1NP8A 1B7TY 1L7ZA 2MRDA 2SCPA 4USLA 3SG6A 1K90D 4U8DA 1BR4B 2JC2A 3TS5C 1DJYA 2KQYA 4OVNF 2JNFA 2M8UA 1KFXL 1RECA 2OPOA 2JRFA 1NWDA 3OX5A 2MAZA 4MEWA 2M29A 2F2OA 5B8IB 3D10A 1HQVA 2R2IA 4AOMA 2JT8A 2P71A 1AVSA 2KHNA 4MRXA 1PRWA 4YGCB 1SCMC 3EK4A 3OX6A 4MZJA 1SL9A 1TNQA 4ORCB 2BKIB 4N1GA 2CCMA 2ISDA 1S6IA 4MZLA 1MR8A 2OS8B 1K93D 5ER5A 3WHTB 5DKQA 3VRRA 2BNXA 2JWWA 4PT1A 1SY9A 5I2OA 1H4BA 1S5GZ 3AAKA 3D0YA 3D0YB 3O4YA 3VROA 5AFPA 5HLVA 5BPJA 1SR6C 4QJ4B 3K21A 2V53A 1B47A 1BJFA 1D1OA 1CDMA 1M31A 1TUZA 2MA2A 2CXJA 3M0WA 3DZTA 2LP2A 2KYFA 3O6BA 3TUYB 1EH2A 2FJUB 4ORAB 1CLBA 1FF1A 1LXFC 3BUMB 3D76A 5JJGA 3F45A 1QX5B 1TCFA 1J7RA 1OOHA 1GM0A 3EVRA 3D74A 5IBWA 2DOQA 2WCJA 1RFJA 2M9GA 2FOTA 2P6BB 1FBVA 5D7FA 1DT7B 2M7NA 4A4BA 2OS8C 1QX2A 4E68A 1IQ5A 1SPYA 2JXLA 4M2QA 4MN0A 3FE9A 2IS9A 5DKRA 1PK0D 1OE9B 2E30A 1QLKA 3UO9A 1NYAA 5CSNA 1K9KA 5HL1A 1S6JA 3D77A 3DVJA 4ORBB 2K0JA 2WCFA 4I5JA 3PLFB 3QMEA 1Y1UA 1DJXA 1C3YA 1RK9A 3SS4A 2AMIA 5DKNA 1WRZA 1E8AA 3H4SE 1WRKA 1KFXS 1OOFA 4P2YB 2L51A 1BOCA 4UPGA 3DVKA 1BR1B 2H2KA 1K94A 4CFQA 1YUTA 2KPHA 4PHKA 1PSBA 3LK1A 4IJ7A 2WC6A 2PVBA 1KK8B 2K2FA 1IG5A 3JTDB 5J3XA 2WCHA 5FYXA 2FJYA 1CDNA 1DJGA 4HREE 2K7DA 3DXLA 1Y1XA 1DTLA 2K61A 4C0JA 4FQOA 3FE6A 3DVEA 2KAXA 4GBAA 1NX2A 2HPSA 4OV2A 2JXCA 1U5IA 2KNEA 5HKYA 3IVTA 1PVBA 1U5IB 1B9AA 1QIWA 2GGMA 4DCKA 4YBHB 4C0LA 3LLEA 4N5XA 3HCMA 4ZCUA 4DIRA 4BY4A 2PYQA 2PRUA 4PHJA 1BF5A 1K9UA 1TRFA 2JNXA 1KWOB 3OGNA 1ALVA 3CWGA 3A4UB 1J7OA 2LVIA 1EG3A 1XFVO 3VRQA 1DGUA 3PATA 2M3WA 2YGUA 4HSZA 2HQ8A 5HKWA 1EJ3A 1W7IB 1JBAA 3WXAA 1CB1A 1C7WA 3PALA 4INXA 2KFHA 1B1GA 1KK7Y 4GGFC 3FS7A 2LVVA 2L0PA 1V1FA 4N1FA 1CKKA 3O2PA 1ODBA 3I5FB 2SASA 1R6PA 1KFUS 1QIVA 4INWA 1AUIB 2OTGB 4XJKA 4FQTA 1J1DA 4PE4A 4XJKB 4AQJA 4C0KA 1Y6WA 3I5HB 3OBVA 3B87A 3B6XA 3CLNA 2WCEA 1N0YA 2Q4UA 3CR5X 3O4XA 3CDNA 1KWOC 4JQ0D 4PE1A 3ZNIA 4AQIA 3AAJA 2F3ZA 4ZCVA 2KOTA 1S36A 1QX7A 2LMVA 2I94A 3D78A 3I5IB 3PM2A 3S0AA 1G33A 2AUCA 2L5YA 3RLZA 1WRLA 1F70A 3R1OA 1GJYA 4WQ2A 1AHRA 1CLMA 2ZFDA 1Q80A 4OZDA 1CFFA 3CS1A 1ORGA 3HX4A 3TZ1A 4OKHA 3C1VA 1KQMC 1PULA 3NSIA 3IQOA 2H8VA 4JPZB 3QRXA 4MBEA 5FI7A 5CSJA 1F55A 1PVAA 1QV0A 2JOJA 5KTYA 1JF0A 3SG7A 2H61A 2G2BA 5HLOA 3SJSA 5PALA 3S0FA 3D73A 1JF2A 3EK8A 3V2LA 1AK8A 1T14A 1IJ6A 3NSLA 4P5OE 1CMFA 1KSMA 1MQ1A 4MZKA 2ZN9A 2WC5A 1PALA 2JPTA 4GGNA 2L98A 2RGIA 1UURA 2LNKA 3GK4X 2EC6C 3SG3A 3SG4A 1BU3A 2CTNA 3OHMB 1G8IA 3I5IC 1CMGA 2K8MB 2QEHA 1GGWA 2BBNA 5I2QA 2PSRA 3B86A 4PALA 1IKUA 3CABA 1QVIZ 3K1EA 2KBMA 2KGRA 3L4AA 1B4CA 4DRWA 1SRAA 1K9PA 3EKHA 2KDHA 3PN7B 1F4OA 4L9MA 4XYNA 2Y1MA 1KCYA 1CFPA 4CFRA 3NHTA 4WRIA 1JFJA 3BXKA 1YVHA 1L2OB 3VRNA 3OP0A 4A4CA 2QDIA 1DJWA 3CZ0A 3I5GB 1CTRA 1SCVA 2L5XB 1DJIA 1P28A 1IIOA 4M2OA 1OW4A 3WHUB 3Q8IA 5FI6A 3PJIA 5F6TA 2KAYA 1XFXO 3EVUA 4KYNA 4OR9B 1C7VA 1J55A 1NSHA 1ALWA 2JQ6A 2KGBC 2L2EA 1DEKA 1UWOA 3EG5B 1XO5A 1YX8A 2Q91A 3TUYC 1UHIA 2ERBA 3EVVA 2WOSA 1CM4A 3PN7C 4GNKB 3TDZA 4WQ3A 2M97A 2COLB 1B7TZ 1WDCB 2M7LA 1YUUA 5JOLA 3CR4X 2BL0B 1LVCD 1MUXA 1A29A 1NX0A 2HF5A 1UP5A 2JPOA 2LM5A 2LHIA 4IL1A 3CGAA 2ZNDA 5AXIA 2KI4B 2LLTA 3PM8A 4GUKA 1SL8A 1XK4A 2BAPA 1M45A 2F8PA 3BOWA 4I5KA 4D1EA 1GGZA 3BOWB 4M2PA 1JC2A 2LLSA 2KI6D 2EHBA 2JT0A 1B8RA 5HKZA 3E3RA 3FWCA 1OOIX 3S0DA 1BMOA 2ZRTA 3DF0A 5I8NA 3DF0B 2WCBA 1OOJA 4FTGA 3GK1A 1GQMA 1SKTA 2BBMA 3CYZA 3N7HA 1MWNA 1SW8A 2LUXA 2FCEA 5CPVA 3SG2A 1A03A 5GQQC 2BECA 2PMYA 1W7JB 2O5GA 3AKAA 1KK8C 2BL0C 1DELA 3EKJA 1S26D 2LMTA 2LHLA 3JTDC 3KO0A 4BY5A 3TDUA 1S5GY 2LAPA 1EL4A 2Y4QA 3BUOB 2GV5A 4MRYA 2KI4C 2MLEC 3CR2A 2JZIA 1XFZO 1NX3A 1Z2CB 1N2DA 2NXQA 2QEVA 3DY9A 4YGBB 1SNLA 2MLFC 4NDCA 4PE0A 3S0EA 3SIAA 1NX1A 5K89A 1DF0A 3JVTB 2KQ6A 4I5LB 4I5NB 1DF0B 3B7AA 2L4IA 3VB1A 1QVIY 3SG5A 1TTXA 3CZTX 2ZKMX 2TN4A 2NCOA 4MLWA 1FI6A 1S6CA 4MVFA 4PHMA 3VRPA 1QLSA 3S0BA 2KFGA 1LA0A 1Y0VH 1IRJA 2KBIA 3KHEA 2MBXA 3MSEB 1IGVA 3OB2B 4F7FA 2M49B 2KLDA 2K2AA 1BG1A 5CSIA 2LLUA 3BFAA 2WCMA 2K60A 2EGDA 2KFFA 4PHNA 1C3ZA 1B8LA 5EL2A 2L4HA 2JU0A 2BCXA 1YX7A 1SCMB 1QWVA 1Z4HA 2ZNEA 1CNPA 3DVMA 5AERA 1CDPA 2BCBA 2M1UA 1TIZA 1F4QA 1QTXA 1DGVA 1ZMZA 1RWYA 2GTEA 3I5FC 1DQEA 5KU1A 1YTZC 2BKHB 2MJWB 5TNCA 2PALA 1C07A 2OTGC 2JT3A 2JULA 3I5HC 1F71A 1SYMA 1TN4A 4ETOA 4CPVA 2P70A 3NGVA 4OCIA 1QATA 1OSAA 3BQ3A 2I18A 1LS8A 2AAOA 1IQ3A 1TNPA 4QJ3B 2LC5A 2F33A 3D75A 1TWOA 4PCWA 4NQGA 1PSRA 2QEBA 5D3OA 4TNCA 3GOFA 5D69A 1QS7A 1RTP1 1YVLA 1ZFSA 1F54A 1XFYO 1SBJA 1K2HA 1SL7A 3OB1B 5AEQA 3BYAA 3RM1A 1X02A 1H8BA 1EG4A 3O78A 2FCDA 1KQVA 2O60A 4HRGA 3IF7A 3LL8B 2H61C 3GK2A 1CFCA 3KEVA 2G9BA 1OMRA 3BUWB 3R1VA 1WLMA 1KK7Z 3BUXB 2QEOA 4PE7A 4YGEB 3VGOA 4HRHA 3S0GA 1MF8B 2WC8A 2BE6A 1V1GA 1BLQA 2KYCA 1OZSA 3RZSA 1ZACA 2NZ0A 1DJHA 1YRTB 4DUQA 1NCZA 5KSZA 1B8CA 1TCOB 4NDDA 3NHIA 4JWQA 2ZN8A 4R1EA 1LA3A 3PFVA 1LKJA 3KPXA 1OMVA 1SSEB 1QASA 1K95A 1OQPA 2BCAA 1JWDA 4YGAA 1YRUB 3R1PA 1FW4A 1DJZA 2QPTA 1K8UA 1QV1A 2K7OA 1M46A 2LCPA 3SS3A 4GGFA 3CTNA 1DVIA 2I2RE 2JTZA 3L4LA 1Y1AA 3BFHA 4ICBA 1MXLC 2WNDA 1J7QA 2LUCA 1DMOA 1L2OC 1CLLA 1NCXA 3IQQA 3LCPC 2HETA 1BT6A 2NCPA 1ZUZA 2LP3A 1UHJA 2LVJA 1AJ4A 1KFUL 3I5GC 1A2XA 4GAOA 1UHNA 2WORA 4Q04A 2Y1NA 2CT9A 2NLNA 1OOGA 2CNPA 1XA5A 2KSPA 2VRGA 3BFBA 1WLZA 4QJ5B 1TOPA 3ICBA 3FWBA 5G08A 2KI6C 2GGZA 2WCKA 2A4JA 3LK0A 4MSPA 3WNXB 5I94A 1DC1A 3PSRA 3KF9A 3NXAA 1XVJA 4YI8A 1RROA 3BJHA 1K96A 1IH0A 3CZ1A 1MXEA 4JKTA 1TNWA 2I7AA 1R2UA 1A4PA 2D8NA 2PASA 1WDCC 4PDZA 3ZWHA 1RJVA 2K7CA 4NDBA 2M0RA 1VRKA 4F0ZB 1FPWA 3R72A 1UUSA 1M39A 1CFDA 2Y5IA
chains in the Genus database with same CATH topology
1KSOA 1MHOA 1UHKA 2HQWA 4YGDB 1TNXA 5I2LA 1UHHA 1SMGA 4CIDA 1IJ5A 2F2PA 3NSKA 1EXRA 1JFKA 1NCYA 1OMDA 1XFUO 1XK4C 1YUSA 4YRUA 3EK7A 1XFWO 1XYDA 2L50A 1J7PA 1FI5A 2ZRSA 2F3YA 4YI9A 2CBLA 3DD4A 2M1KB 2QACA 5AANA 1AP4A 1CDLA 4GFTA 1LINA 1QJTA 1JSAA 1OZOA 2LANA 5ER4X 3BUNB 3TS5B 1F8HA 1M63B 3A8RA 5CSFA 2BE4A 2KAVA 1QXPA 2LVKA 4CLNA 1S1EA 2B1UA 2MHHA 1KQMB 1HT9A 1YURA 5HYDA 1S3PA 2LMUA 1JUOA 1WY9A 2E6WA 3FIAA 3TDIA 1BODA 2LV7A 3JVTC 1ZOTB 1J1EA 3SIBA 4GPLB 1G4YR 2LE9B 1IWQA 2K7BA 3AKBA 2JTTA 1NPQA 1A75A 4DS7A 1AJ5A 1N65A 1NIWA 1NUBA 1SR6B 1SK6D 1A75B 1CM1A 1YR5A 2EC6B 3NSOA 1NP8A 1B7TY 1L7ZA 2MRDA 2SCPA 4USLA 3SG6A 1K90D 4U8DA 1BR4B 2JC2A 3TS5C 1DJYA 2KQYA 4OVNF 2JNFA 2M8UA 1KFXL 1RECA 2OPOA 2JRFA 1NWDA 3OX5A 2MAZA 4MEWA 2M29A 2F2OA 5B8IB 3D10A 1HQVA 2R2IA 4AOMA 2JT8A 4YGCB 1AVSA 2KHNA 4MRXA 1PRWA 1SCMC 3EK4A 3OX6A 4MZJA 1SL9A 1TNQA 4ORCB 2BKIB 4N1GA 2CCMA 2ISDA 1S6IA 4MZLA 1MR8A 2OS8B 1K93D 5ER5A 3WHTB 5DKQA 3VRRA 2JWWA 1SY9A 5I2OA 1H4BA 1S5GZ 3AAKA 3D0YA 3D0YB 3O4YA 3VROA 5AFPA 5HLVA 5BPJA 1SR6C 4QJ4B 3K21A 2V53A 1B47A 1BJFA 1D1OA 1CDMA 1M31A 2MA2A 2CXJA 3M0WA 2LP2A 2KYFA 3O6BA 3TUYB 1EH2A 2FJUB 4ORAB 1CLBA 1FF1A 1LXFC 3BUMB 5JJGA 3F45A 1QX5B 1TCFA 1J7RA 3EVRA 5IBWA 2DOQA 1RFJA 2M9GA 2FOTA 2P6BB 1FBVA 5D7FA 1DT7B 2M7NA 4A4BA 2OS8C 1QX2A 4E68A 1IQ5A 1SPYA 2JXLA 4M2QA 4MN0A 2IS9A 5DKRA 1PK0D 1OE9B 2E30A 1QLKA 1NYAA 5CSNA 1K9KA 1S6JA 3DVJA 4ORBB 2K0JA 2WCFA 4I5JA 3PLFB 1Y1UA 1DJXA 1RK9A 2AMIA 5DKNA 1WRZA 1E8AA 3H4SE 1WRKA 1KFXS 4P2YB 2L51A 1BOCA 4UPGA 3DVKA 1BR1B 2H2KA 1K94A 4CFQA 1YUTA 4PHKA 1PSBA 3LK1A 2PVBA 1KK8B 2K2FA 1IG5A 3JTDB 5J3XA 5FYXA 1CDNA 1DJGA 4HREE 2K7DA 1Y1XA 1DTLA 2K61A 4C0JA 4FQOA 3DVEA 2KAXA 4GBAA 1NX2A 2HPSA 4OV2A 2JXCA 1U5IA 2KNEA 5HKYA 1PVBA 1U5IB 1B9AA 1QIWA 2GGMA 4DCKA 4YBHB 4C0LA 3LLEA 4N5XA 3HCMA 4ZCUA 4DIRA 4BY4A 2PRUA 4PHJA 1BF5A 1K9UA 1TRFA 2JNXA 1KWOB 1ALVA 3CWGA 3A4UB 1J7OA 2LVIA 1EG3A 1XFVO 3VRQA 1DGUA 3PATA 2M3WA 4HSZA 2HQ8A 5HKWA 1EJ3A 1W7IB 1JBAA 3WXAA 1CB1A 1C7WA 3PALA 2KFHA 1B1GA 1KK7Y 4GGFC 3FS7A 2LVVA 2L0PA 1V1FA 4N1FA 1CKKA 3O2PA 1ODBA 3I5FB 2SASA 1R6PA 1KFUS 1QIVA 1AUIB 2OTGB 4XJKA 1J1DA 4C0KA 4XJKB 4AQJA 1Y6WA 3I5HB 3CLNA 2WCEA 1N0YA 2Q4UA 3CR5X 4JQ0D 1KWOC 3ZNIA 4PE1A 4AQIA 3AAJA 2F3ZA 4ZCVA 2KOTA 1S36A 1QX7A 2LMVA 2I94A 3I5IB 1G33A 2AUCA 3RLZA 1WRLA 1F70A 1GJYA 4WQ2A 1AHRA 1CLMA 2ZFDA 1Q80A 1CFFA 3CS1A 3HX4A 3TZ1A 4OKHA 3C1VA 1KQMC 1PULA 3NSIA 3IQOA 4JPZB 3QRXA 4MBEA 5CSJA 1F55A 1PVAA 1QV0A 2JOJA 5KTYA 1JF0A 3SG7A 2H61A 2G2BA 5HLOA 3SJSA 5PALA 1JF2A 3EK8A 1AK8A 4P5OE 1IJ6A 3NSLA 1CMFA 1KSMA 1MQ1A 4MZKA 2ZN9A 1PALA 2JPTA 4GGNA 2L98A 2RGIA 1UURA 2LNKA 3GK4X 2EC6C 3SG3A 3SG4A 1BU3A 2CTNA 3OHMB 1G8IA 3I5IC 1CMGA 2K8MB 1GGWA 2BBNA 5I2QA 2PSRA 4PALA 1IKUA 1QVIZ 2KBMA 2KGRA 1B4CA 4DRWA 1SRAA 1K9PA 3EKHA 2KDHA 3PN7B 1F4OA 4L9MA 4XYNA 2Y1MA 1KCYA 1CFPA 4CFRA 4WRIA 1JFJA 3BXKA 1YVHA 1L2OB 3VRNA 3OP0A 4A4CA 1DJWA 3I5GB 1CTRA 1SCVA 2L5XB 1DJIA 4M2OA 3WHUB 5F6TA 2KAYA 1XFXO 3EVUA 4OR9B 1C7VA 1J55A 1NSHA 1ALWA 2JQ6A 2KGBC 2L2EA 1UWOA 1XO5A 1YX8A 2Q91A 3TUYC 1UHIA 3EVVA 2WOSA 1CM4A 3PN7C 4GNKB 3TDZA 4WQ3A 2M97A 2COLB 1B7TZ 1WDCB 2M7LA 1YUUA 5JOLA 3CR4X 2BL0B 1LVCD 1MUXA 1A29A 1NX0A 2HF5A 1UP5A 2LM5A 2LHIA 4IL1A 3CGAA 2ZNDA 5AXIA 2KI4B 2LLTA 3PM8A 4GUKA 1SL8A 1XK4A 3BOWA 1M45A 2F8PA 4I5KA 4D1EA 1GGZA 3BOWB 4M2PA 1JC2A 2LLSA 2KI6D 2EHBA 2JT0A 1B8RA 5HKZA 3E3RA 3FWCA 1BMOA 2ZRTA 3DF0A 5I8NA 3DF0B 2WCBA 1OOJA 4FTGA 3GK1A 1GQMA 1SKTA 2BBMA 1MWNA 1SW8A 2LUXA 2FCEA 5CPVA 3SG2A 1A03A 5GQQC 2BECA 2PMYA 1W7JB 2O5GA 3AKAA 1KK8C 2BL0C 3EKJA 1S26D 2LMTA 2LHLA 3JTDC 3KO0A 4BY5A 3TDUA 1S5GY 2LAPA 1EL4A 2Y4QA 3BUOB 2GV5A 4MRYA 2KI4C 2MLEC 3CR2A 2JZIA 1XFZO 1NX3A 2NXQA 1N2DA 4PE4A 4YGBB 1SNLA 2MLFC 4NDCA 4PE0A 3SIAA 1NX1A 5K89A 1DF0A 3JVTB 2KQ6A 4I5LB 4I5NB 1DF0B 2L4IA 1QVIY 3SG5A 1TTXA 3CZTX 2ZKMX 2TN4A 2NCOA 4MLWA 1FI6A 1S6CA 4MVFA 4PHMA 3VRPA 1QLSA 2KFGA 1LA0A 1Y0VH 1IRJA 2KBIA 3KHEA 2MBXA 3MSEB 1IGVA 3OB2B 2M49B 2K2AA 1BG1A 5CSIA 2LLUA 2EGDA 2KFFA 4PHNA 1B8LA 2L4HA 2JU0A 2BCXA 1YX7A 1SCMB 2ZNEA 1CNPA 3DVMA 5AERA 1CDPA 2BCBA 2M1UA 1TIZA 1F4QA 1QTXA 1DGVA 1ZMZA 1RWYA 3I5FC 5KU1A 1YTZC 2BKHB 2MJWB 5TNCA 2PALA 1C07A 2OTGC 2JT3A 2JULA 3I5HC 1F71A 1SYMA 1TN4A 4ETOA 4CPVA 4OCIA 1QATA 1OSAA 3BQ3A 2I18A 2AAOA 1IQ3A 1TNPA 4QJ3B 2LC5A 2F33A 4PCWA 4NQGA 1PSRA 4TNCA 3GOFA 5D69A 1QS7A 1RTP1 1YVLA 1ZFSA 1F54A 1XFYO 1SBJA 1K2HA 1SL7A 3OB1B 5AEQA 3BYAA 3RM1A 1X02A 1H8BA 1EG4A 3O78A 2FCDA 1KQVA 2O60A 4HRGA 3IF7A 3LL8B 2H61C 3GK2A 1CFCA 3KEVA 2G9BA 1OMRA 3BUWB 1WLMA 1KK7Z 3BUXB 4PE7A 3VGOA 4YGEB 4HRHA 1MF8B 2WC8A 2BE6A 1V1GA 1BLQA 2KYCA 1OZSA 1ZACA 2NZ0A 1DJHA 1YRTB 4DUQA 1NCZA 5KSZA 1B8CA 1TCOB 4NDDA 4JWQA 2ZN8A 4R1EA 1LA3A 3PFVA 1LKJA 3KPXA 1OMVA 1QASA 1K95A 1OQPA 2BCAA 1JWDA 4YGAA 1YRUB 1FW4A 1DJZA 2QPTA 1K8UA 1QV1A 2K7OA 1M46A 2LCPA 3CTNA 1DVIA 2I2RE 2JTZA 1DMOA 1Y1AA 4ICBA 1MXLC 2WNDA 1J7QA 2LUCA 1L2OC 1CLLA 1NCXA 3IQQA 3LCPC 2HETA 1BT6A 2NCPA 1ZUZA 2LP3A 1UHJA 2LVJA 1AJ4A 1KFUL 3I5GC 1A2XA 4GAOA 1UHNA 2WORA 4Q04A 2Y1NA 2CT9A 2NLNA 2CNPA 1XA5A 2KSPA 2VRGA 1WLZA 4QJ5B 1TOPA 3ICBA 3FWBA 5G08A 2KI6C 2GGZA 2A4JA 3LK0A 4MSPA 3WNXB 3PSRA 3KF9A 3NXAA 1XVJA 4YI8A 1RROA 1K96A 1IH0A 1MXEA 1TNWA 2I7AA 1R2UA 1A4PA 2D8NA 2PASA 1WDCC 4PDZA 3ZWHA 1RJVA 2K7CA 4NDBA 2M0RA 1VRKA 4F0ZB 1FPWA 4GGFA 1UUSA 1M39A 1CFDA 2Y5IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KSO A;  1MHO A;  1UHK A;  2HQW A;  4YGD B;  1TNX A;  5I2L A;  1UHH A;  1SMG A;  4CID A;  1IJ5 A;  2F2P A;  3NSK A;  1EXR A;  1JFK A;  1NCY A;  1OMD A;  1XFU O;  1XK4 C;  1YUS A;  4YRU A;  3EK7 A;  1XFW O;  1XYD A;  2L50 A;  1J7P A;  1FI5 A;  2ZRS A;  2F3Y A;  4YI9 A;  2CBL A;  3DD4 A;  2M1K B;  2QAC A;  5AAN A;  1AP4 A;  1CDL A;  4GFT A;  1LIN A;  1QJT A;  1JSA A;  1OZO A;  2LAN A;  5ER4 X;  3BUN B;  3TS5 B;  1F8H A;  1M63 B;  3A8R A;  5CSF A;  2BE4 A;  2KAV A;  1QXP A;  2LVK A;  4CLN A;  1S1E A;  2B1U A;  2MHH A;  1KQM B;  1HT9 A;  1YUR A;  5HYD A;  1S3P A;  2LMU A;  1JUO A;  1WY9 A;  2E6W A;  3FIA A;  3TDI A;  1BOD A;  2LV7 A;  3JVT C;  1ZOT B;  1J1E A;  3SIB A;  4GPL B;  1G4Y R;  2LE9 B;  1IWQ A;  2K7B A;  3AKB A;  2JTT A;  1NPQ A;  1A75 A;  4DS7 A;  1AJ5 A;  1N65 A;  1NIW A;  1NUB A;  1SR6 B;  1SK6 D;  1A75 B;  1CM1 A;  1YR5 A;  2EC6 B;  3NSO A;  1NP8 A;  1B7T Y;  1L7Z A;  2MRD A;  2SCP A;  4USL A;  3SG6 A;  1K90 D;  4U8D A;  1BR4 B;  2JC2 A;  3TS5 C;  1DJY A;  2KQY A;  4OVN F;  2JNF A;  2M8U A;  1KFX L;  1REC A;  2OPO A;  2JRF A;  1NWD A;  3OX5 A;  2MAZ A;  4MEW A;  2M29 A;  2F2O A;  5B8I B;  3D10 A;  1HQV A;  2R2I A;  4AOM A;  2JT8 A;  4YGC B;  1AVS A;  2KHN A;  4MRX A;  1PRW A;  1SCM C;  3EK4 A;  3OX6 A;  4MZJ A;  1SL9 A;  1TNQ A;  4ORC B;  2BKI B;  4N1G A;  2CCM A;  2ISD A;  1S6I A;  4MZL A;  1MR8 A;  2OS8 B;  1K93 D;  5ER5 A;  3WHT B;  5DKQ A;  3VRR A;  2JWW A;  1SY9 A;  5I2O A;  1H4B A;  1S5G Z;  3AAK A;  3D0Y A;  3D0Y B;  3O4Y A;  3VRO A;  5AFP A;  5HLV A;  5BPJ A;  1SR6 C;  4QJ4 B;  3K21 A;  2V53 A;  1B47 A;  1BJF A;  1D1O A;  1CDM A;  1M31 A;  2MA2 A;  2CXJ A;  3M0W A;  2LP2 A;  2KYF A;  3O6B A;  3TUY B;  1EH2 A;  2FJU B;  4ORA B;  1CLB A;  1FF1 A;  1LXF C;  3BUM B;  5JJG A;  3F45 A;  1QX5 B;  1TCF A;  1J7R A;  3EVR A;  5IBW A;  2DOQ A;  1RFJ A;  2M9G A;  2FOT A;  2P6B B;  1FBV A;  5D7F A;  1DT7 B;  2M7N A;  4A4B A;  2OS8 C;  1QX2 A;  4E68 A;  1IQ5 A;  1SPY A;  2JXL A;  4M2Q A;  4MN0 A;  2IS9 A;  5DKR A;  1PK0 D;  1OE9 B;  2E30 A;  1QLK A;  1NYA A;  5CSN A;  1K9K A;  1S6J A;  3DVJ A;  4ORB B;  2K0J A;  2WCF A;  4I5J A;  3PLF B;  1Y1U A;  1DJX A;  1RK9 A;  2AMI A;  5DKN A;  1WRZ A;  1E8A A;  3H4S E;  1WRK A;  1KFX S;  4P2Y B;  2L51 A;  1BOC A;  4UPG A;  3DVK A;  1BR1 B;  2H2K A;  1K94 A;  4CFQ A;  1YUT A;  4PHK A;  1PSB A;  3LK1 A;  2PVB A;  1KK8 B;  2K2F A;  1IG5 A;  3JTD B;  5J3X A;  5FYX A;  1CDN A;  1DJG A;  4HRE E;  2K7D A;  1Y1X A;  1DTL A;  2K61 A;  4C0J A;  4FQO A;  3DVE A;  2KAX A;  4GBA A;  1NX2 A;  2HPS A;  4OV2 A;  2JXC A;  1U5I A;  2KNE A;  5HKY A;  1PVB A;  1U5I B;  1B9A A;  1QIW A;  2GGM A;  4DCK A;  4YBH B;  4C0L A;  3LLE A;  4N5X A;  3HCM A;  4ZCU A;  4DIR A;  4BY4 A;  2PRU A;  4PHJ A;  1BF5 A;  1K9U A;  1TRF A;  2JNX A;  1KWO B;  1ALV A;  3CWG A;  3A4U B;  1J7O A;  2LVI A;  1EG3 A;  1XFV O;  3VRQ A;  1DGU A;  3PAT A;  2M3W A;  4HSZ A;  2HQ8 A;  5HKW A;  1EJ3 A;  1W7I B;  1JBA A;  3WXA A;  1CB1 A;  1C7W A;  3PAL A;  2KFH A;  1B1G A;  1KK7 Y;  4GGF C;  3FS7 A;  2LVV A;  2L0P A;  1V1F A;  4N1F A;  1CKK A;  3O2P A;  1ODB A;  3I5F B;  2SAS A;  1R6P A;  1KFU S;  1QIV A;  1AUI B;  2OTG B;  4XJK A;  1J1D A;  4C0K A;  4XJK B;  4AQJ A;  1Y6W A;  3I5H B;  3CLN A;  2WCE A;  1N0Y A;  2Q4U A;  3CR5 X;  4JQ0 D;  1KWO C;  3ZNI A;  4PE1 A;  4AQI A;  3AAJ A;  2F3Z A;  4ZCV A;  2KOT A;  1S36 A;  1QX7 A;  2LMV A;  2I94 A;  3I5I B;  1G33 A;  2AUC A;  3RLZ A;  1WRL A;  1F70 A;  1GJY A;  4WQ2 A;  1AHR A;  1CLM A;  2ZFD A;  1Q80 A;  1CFF A;  3CS1 A;  3HX4 A;  3TZ1 A;  4OKH A;  3C1V A;  1KQM C;  1PUL A;  3NSI A;  3IQO A;  4JPZ B;  3QRX A;  4MBE A;  5CSJ A;  1F55 A;  1PVA A;  1QV0 A;  2JOJ A;  5KTY A;  1JF0 A;  3SG7 A;  2H61 A;  2G2B A;  5HLO A;  3SJS A;  5PAL A;  1JF2 A;  3EK8 A;  1AK8 A;  4P5O E;  1IJ6 A;  3NSL A;  1CMF A;  1KSM A;  1MQ1 A;  4MZK A;  2ZN9 A;  1PAL A;  2JPT A;  4GGN A;  2L98 A;  2RGI A;  1UUR A;  2LNK A;  3GK4 X;  2EC6 C;  3SG3 A;  3SG4 A;  1BU3 A;  2CTN A;  3OHM B;  1G8I A;  3I5I C;  1CMG A;  2K8M B;  1GGW A;  2BBN A;  5I2Q A;  2PSR A;  4PAL A;  1IKU A;  1QVI Z;  2KBM A;  2KGR A;  1B4C A;  4DRW A;  1SRA A;  1K9P A;  3EKH A;  2KDH A;  3PN7 B;  1F4O A;  4L9M A;  4XYN A;  2Y1M A;  1KCY A;  1CFP A;  4CFR A;  4WRI A;  1JFJ A;  3BXK A;  1YVH A;  1L2O B;  3VRN A;  3OP0 A;  4A4C A;  1DJW A;  3I5G B;  1CTR A;  1SCV A;  2L5X B;  1DJI A;  4M2O A;  3WHU B;  5F6T A;  2KAY A;  1XFX O;  3EVU A;  4OR9 B;  1C7V A;  1J55 A;  1NSH A;  1ALW A;  2JQ6 A;  2KGB C;  2L2E A;  1UWO A;  1XO5 A;  1YX8 A;  2Q91 A;  3TUY C;  1UHI A;  3EVV A;  2WOS A;  1CM4 A;  3PN7 C;  4GNK B;  3TDZ A;  4WQ3 A;  2M97 A;  2COL B;  1B7T Z;  1WDC B;  2M7L A;  1YUU A;  5JOL A;  3CR4 X;  2BL0 B;  1LVC D;  1MUX A;  1A29 A;  1NX0 A;  2HF5 A;  1UP5 A;  2LM5 A;  2LHI A;  4IL1 A;  3CGA A;  2ZND A;  5AXI A;  2KI4 B;  2LLT A;  3PM8 A;  4GUK A;  1SL8 A;  1XK4 A;  3BOW A;  1M45 A;  2F8P A;  4I5K A;  4D1E A;  1GGZ A;  3BOW B;  4M2P A;  1JC2 A;  2LLS A;  2KI6 D;  2EHB A;  2JT0 A;  1B8R A;  5HKZ A;  3E3R A;  3FWC A;  1BMO A;  2ZRT A;  3DF0 A;  5I8N A;  3DF0 B;  2WCB A;  1OOJ A;  4FTG A;  3GK1 A;  1GQM A;  1SKT A;  2BBM A;  1MWN A;  1SW8 A;  2LUX A;  2FCE A;  5CPV A;  3SG2 A;  1A03 A;  5GQQ C;  2BEC A;  2PMY A;  1W7J B;  2O5G A;  3AKA A;  1KK8 C;  2BL0 C;  3EKJ A;  1S26 D;  2LMT A;  2LHL A;  3JTD C;  3KO0 A;  4BY5 A;  3TDU A;  1S5G Y;  2LAP A;  1EL4 A;  2Y4Q A;  3BUO B;  2GV5 A;  4MRY A;  2KI4 C;  2MLE C;  3CR2 A;  2JZI A;  1XFZ O;  1NX3 A;  2NXQ A;  1N2D A;  4PE4 A;  4YGB B;  1SNL A;  2MLF C;  4NDC A;  4PE0 A;  3SIA A;  1NX1 A;  5K89 A;  1DF0 A;  3JVT B;  2KQ6 A;  4I5L B;  4I5N B;  1DF0 B;  2L4I A;  1QVI Y;  3SG5 A;  1TTX A;  3CZT X;  2ZKM X;  2TN4 A;  2NCO A;  4MLW A;  1FI6 A;  1S6C A;  4MVF A;  4PHM A;  3VRP A;  1QLS A;  2KFG A;  1LA0 A;  1Y0V H;  1IRJ A;  2KBI A;  3KHE A;  2MBX A;  3MSE B;  1IGV A;  3OB2 B;  2M49 B;  2K2A A;  1BG1 A;  5CSI A;  2LLU A;  2EGD A;  2KFF A;  4PHN A;  1B8L A;  2L4H A;  2JU0 A;  2BCX A;  1YX7 A;  1SCM B;  2ZNE A;  1CNP A;  3DVM A;  5AER A;  1CDP A;  2BCB A;  2M1U A;  1TIZ A;  1F4Q A;  1QTX A;  1DGV A;  1ZMZ A;  1RWY A;  3I5F C;  5KU1 A;  1YTZ C;  2BKH B;  2MJW B;  5TNC A;  2PAL A;  1C07 A;  2OTG C;  2JT3 A;  2JUL A;  3I5H C;  1F71 A;  1SYM A;  1TN4 A;  4ETO A;  4CPV A;  4OCI A;  1QAT A;  1OSA A;  3BQ3 A;  2I18 A;  2AAO A;  1IQ3 A;  1TNP A;  4QJ3 B;  2LC5 A;  2F33 A;  4PCW A;  4NQG A;  1PSR A;  4TNC A;  3GOF A;  5D69 A;  1QS7 A;  1RTP 1;  1YVL A;  1ZFS A;  1F54 A;  1XFY O;  1SBJ A;  1K2H A;  1SL7 A;  3OB1 B;  5AEQ A;  3BYA A;  3RM1 A;  1X02 A;  1H8B A;  1EG4 A;  3O78 A;  2FCD A;  1KQV A;  2O60 A;  4HRG A;  3IF7 A;  3LL8 B;  2H61 C;  3GK2 A;  1CFC A;  3KEV A;  2G9B A;  1OMR A;  3BUW B;  1WLM A;  1KK7 Z;  3BUX B;  4PE7 A;  3VGO A;  4YGE B;  4HRH A;  1MF8 B;  2WC8 A;  2BE6 A;  1V1G A;  1BLQ A;  2KYC A;  1OZS A;  1ZAC A;  2NZ0 A;  1DJH A;  1YRT B;  4DUQ A;  1NCZ A;  5KSZ A;  1B8C A;  1TCO B;  4NDD A;  4JWQ A;  2ZN8 A;  4R1E A;  1LA3 A;  3PFV A;  1LKJ A;  3KPX A;  1OMV A;  1QAS A;  1K95 A;  1OQP A;  2BCA A;  1JWD A;  4YGA A;  1YRU B;  1FW4 A;  1DJZ A;  2QPT A;  1K8U A;  1QV1 A;  2K7O A;  1M46 A;  2LCP A;  3CTN A;  1DVI A;  2I2R E;  2JTZ A;  1DMO A;  1Y1A A;  4ICB A;  1MXL C;  2WND A;  1J7Q A;  2LUC A;  1L2O C;  1CLL A;  1NCX A;  3IQQ A;  3LCP C;  2HET A;  1BT6 A;  2NCP A;  1ZUZ A;  2LP3 A;  1UHJ A;  2LVJ A;  1AJ4 A;  1KFU L;  3I5G C;  1A2X A;  4GAO A;  1UHN A;  2WOR A;  4Q04 A;  2Y1N A;  2CT9 A;  2NLN A;  2CNP A;  1XA5 A;  2KSP A;  2VRG A;  1WLZ A;  4QJ5 B;  1TOP A;  3ICB A;  3FWB A;  5G08 A;  2KI6 C;  2GGZ A;  2A4J A;  3LK0 A;  4MSP A;  3WNX B;  3PSR A;  3KF9 A;  3NXA A;  1XVJ A;  4YI8 A;  1RRO A;  1K96 A;  1IH0 A;  1MXE A;  1TNW A;  2I7A A;  1R2U A;  1A4P A;  2D8N A;  2PAS A;  1WDC C;  4PDZ A;  3ZWH A;  1RJV A;  2K7C A;  4NDB A;  2M0R A;  1VRK A;  4F0Z B;  1FPW A;  4GGF A;  1UUS A;  1M39 A;  1CFD A;  2Y5I A; 
#chains in the Genus database with same CATH topology
 1KSO A;  1MHO A;  1UHK A;  2HQW A;  2KLE A;  1TNX A;  4YGD B;  1UHH A;  1SMG A;  5I2L A;  4CID A;  1IJ5 A;  1W9Z A;  2F2P A;  3NSK A;  1EXR A;  1JFK A;  1NCY A;  1OMD A;  1XFU O;  1XK4 C;  1YUS A;  4YRU A;  2L2C A;  3EK7 A;  1XFW O;  1XYD A;  2L50 A;  3FE8 A;  1J7P A;  1FI5 A;  2ZRS A;  2F3Y A;  4YI9 A;  3B88 A;  2CBL A;  3DD4 A;  2M1K B;  2QAC A;  5AAN A;  1AP4 A;  1CDL A;  4GFT A;  1LIN A;  2PQL A;  1QJT A;  3CZ2 A;  1OZO A;  1TUJ A;  2LAN A;  1JSA A;  5ER4 X;  3BUN B;  3TS5 B;  1F8H A;  1M63 B;  2WCL A;  3A8R A;  5CSF A;  2BE4 A;  2KAV A;  5FI2 A;  3UNW A;  1QXP A;  2LVK A;  4CLN A;  1S1E A;  2B1U A;  2MHH A;  3SS5 A;  1KQM B;  1HT9 A;  1YUR A;  5HYD A;  1S3P A;  2LMU A;  1XFR A;  1JUO A;  1WY9 A;  2E6W A;  3FIA A;  3TDI A;  1BOD A;  2LV7 A;  3JVT C;  1ZOT B;  1J1E A;  3SIB A;  4GPL B;  3DYE A;  1G4Y R;  2LE9 B;  4JD9 A;  1IWQ A;  3L47 A;  2K7B A;  3AKB A;  5DIC A;  2JTT A;  1NPQ A;  1A75 A;  4DS7 A;  1AJ5 A;  1N65 A;  1NIW A;  1NUB A;  1SR6 B;  1SK6 D;  1A75 B;  1CM1 A;  1YR5 A;  2EC6 B;  3NSO A;  1NP8 A;  1B7T Y;  1L7Z A;  2MRD A;  2SCP A;  4USL A;  3SG6 A;  1K90 D;  4U8D A;  1BR4 B;  2JC2 A;  3TS5 C;  1DJY A;  2KQY A;  4OVN F;  2JNF A;  2M8U A;  1KFX L;  1REC A;  2OPO A;  2JRF A;  1NWD A;  3OX5 A;  2MAZ A;  4MEW A;  2M29 A;  2F2O A;  5B8I B;  3D10 A;  1HQV A;  2R2I A;  4AOM A;  2JT8 A;  2P71 A;  1AVS A;  2KHN A;  4MRX A;  1PRW A;  4YGC B;  1SCM C;  3EK4 A;  3OX6 A;  4MZJ A;  1SL9 A;  1TNQ A;  4ORC B;  2BKI B;  4N1G A;  2CCM A;  2ISD A;  1S6I A;  4MZL A;  1MR8 A;  2OS8 B;  1K93 D;  5ER5 A;  3WHT B;  5DKQ A;  3VRR A;  2BNX A;  2JWW A;  4PT1 A;  1SY9 A;  5I2O A;  1H4B A;  1S5G Z;  3AAK A;  3D0Y A;  3D0Y B;  3O4Y A;  3VRO A;  5AFP A;  5HLV A;  5BPJ A;  1SR6 C;  4QJ4 B;  3K21 A;  2V53 A;  1B47 A;  1BJF A;  1D1O A;  1CDM A;  1M31 A;  1TUZ A;  2MA2 A;  2CXJ A;  3M0W A;  3DZT A;  2LP2 A;  2KYF A;  3O6B A;  3TUY B;  1EH2 A;  2FJU B;  4ORA B;  1CLB A;  1FF1 A;  1LXF C;  3BUM B;  3D76 A;  5JJG A;  3F45 A;  1QX5 B;  1TCF A;  1J7R A;  1OOH A;  1GM0 A;  3EVR A;  3D74 A;  5IBW A;  2DOQ A;  2WCJ A;  1RFJ A;  2M9G A;  2FOT A;  2P6B B;  1FBV A;  5D7F A;  1DT7 B;  2M7N A;  4A4B A;  2OS8 C;  1QX2 A;  4E68 A;  1IQ5 A;  1SPY A;  2JXL A;  4M2Q A;  4MN0 A;  3FE9 A;  2IS9 A;  5DKR A;  1PK0 D;  1OE9 B;  2E30 A;  1QLK A;  3UO9 A;  1NYA A;  5CSN A;  1K9K A;  5HL1 A;  1S6J A;  3D77 A;  3DVJ A;  4ORB B;  2K0J A;  2WCF A;  4I5J A;  3PLF B;  3QME A;  1Y1U A;  1DJX A;  1C3Y A;  1RK9 A;  3SS4 A;  2AMI A;  5DKN A;  1WRZ A;  1E8A A;  3H4S E;  1WRK A;  1KFX S;  1OOF A;  4P2Y B;  2L51 A;  1BOC A;  4UPG A;  3DVK A;  1BR1 B;  2H2K A;  1K94 A;  4CFQ A;  1YUT A;  2KPH A;  4PHK A;  1PSB A;  3LK1 A;  4IJ7 A;  2WC6 A;  2PVB A;  1KK8 B;  2K2F A;  1IG5 A;  3JTD B;  5J3X A;  2WCH A;  5FYX A;  2FJY A;  1CDN A;  1DJG A;  4HRE E;  2K7D A;  3DXL A;  1Y1X A;  1DTL A;  2K61 A;  4C0J A;  4FQO A;  3FE6 A;  3DVE A;  2KAX A;  4GBA A;  1NX2 A;  2HPS A;  4OV2 A;  2JXC A;  1U5I A;  2KNE A;  5HKY A;  3IVT A;  1PVB A;  1U5I B;  1B9A A;  1QIW A;  2GGM A;  4DCK A;  4YBH B;  4C0L A;  3LLE A;  4N5X A;  3HCM A;  4ZCU A;  4DIR A;  4BY4 A;  2PYQ A;  2PRU A;  4PHJ A;  1BF5 A;  1K9U A;  1TRF A;  2JNX A;  1KWO B;  3OGN A;  1ALV A;  3CWG A;  3A4U B;  1J7O A;  2LVI A;  1EG3 A;  1XFV O;  3VRQ A;  1DGU A;  3PAT A;  2M3W A;  2YGU A;  4HSZ A;  2HQ8 A;  5HKW A;  1EJ3 A;  1W7I B;  1JBA A;  3WXA A;  1CB1 A;  1C7W A;  3PAL A;  4INX A;  2KFH A;  1B1G A;  1KK7 Y;  4GGF C;  3FS7 A;  2LVV A;  2L0P A;  1V1F A;  4N1F A;  1CKK A;  3O2P A;  1ODB A;  3I5F B;  2SAS A;  1R6P A;  1KFU S;  1QIV A;  4INW A;  1AUI B;  2OTG B;  4XJK A;  4FQT A;  1J1D A;  4PE4 A;  4XJK B;  4AQJ A;  4C0K A;  1Y6W A;  3I5H B;  3OBV A;  3B87 A;  3B6X A;  3CLN A;  2WCE A;  1N0Y A;  2Q4U A;  3CR5 X;  3O4X A;  3CDN A;  1KWO C;  4JQ0 D;  4PE1 A;  3ZNI A;  4AQI A;  3AAJ A;  2F3Z A;  4ZCV A;  2KOT A;  1S36 A;  1QX7 A;  2LMV A;  2I94 A;  3D78 A;  3I5I B;  3PM2 A;  3S0A A;  1G33 A;  2AUC A;  2L5Y A;  3RLZ A;  1WRL A;  1F70 A;  3R1O A;  1GJY A;  4WQ2 A;  1AHR A;  1CLM A;  2ZFD A;  1Q80 A;  4OZD A;  1CFF A;  3CS1 A;  1ORG A;  3HX4 A;  3TZ1 A;  4OKH A;  3C1V A;  1KQM C;  1PUL A;  3NSI A;  3IQO A;  2H8V A;  4JPZ B;  3QRX A;  4MBE A;  5FI7 A;  5CSJ A;  1F55 A;  1PVA A;  1QV0 A;  2JOJ A;  5KTY A;  1JF0 A;  3SG7 A;  2H61 A;  2G2B A;  5HLO A;  3SJS A;  5PAL A;  3S0F A;  3D73 A;  1JF2 A;  3EK8 A;  3V2L A;  1AK8 A;  1T14 A;  1IJ6 A;  3NSL A;  4P5O E;  1CMF A;  1KSM A;  1MQ1 A;  4MZK A;  2ZN9 A;  2WC5 A;  1PAL A;  2JPT A;  4GGN A;  2L98 A;  2RGI A;  1UUR A;  2LNK A;  3GK4 X;  2EC6 C;  3SG3 A;  3SG4 A;  1BU3 A;  2CTN A;  3OHM B;  1G8I A;  3I5I C;  1CMG A;  2K8M B;  2QEH A;  1GGW A;  2BBN A;  5I2Q A;  2PSR A;  3B86 A;  4PAL A;  1IKU A;  3CAB A;  1QVI Z;  3K1E A;  2KBM A;  2KGR A;  3L4A A;  1B4C A;  4DRW A;  1SRA A;  1K9P A;  3EKH A;  2KDH A;  3PN7 B;  1F4O A;  4L9M A;  4XYN A;  2Y1M A;  1KCY A;  1CFP A;  4CFR A;  3NHT A;  4WRI A;  1JFJ A;  3BXK A;  1YVH A;  1L2O B;  3VRN A;  3OP0 A;  4A4C A;  2QDI A;  1DJW A;  3CZ0 A;  3I5G B;  1CTR A;  1SCV A;  2L5X B;  1DJI A;  1P28 A;  1IIO A;  4M2O A;  1OW4 A;  3WHU B;  3Q8I A;  5FI6 A;  3PJI A;  5F6T A;  2KAY A;  1XFX O;  3EVU A;  4KYN A;  4OR9 B;  1C7V A;  1J55 A;  1NSH A;  1ALW A;  2JQ6 A;  2KGB C;  2L2E A;  1DEK A;  1UWO A;  3EG5 B;  1XO5 A;  1YX8 A;  2Q91 A;  3TUY C;  1UHI A;  2ERB A;  3EVV A;  2WOS A;  1CM4 A;  3PN7 C;  4GNK B;  3TDZ A;  4WQ3 A;  2M97 A;  2COL B;  1B7T Z;  1WDC B;  2M7L A;  1YUU A;  5JOL A;  3CR4 X;  2BL0 B;  1LVC D;  1MUX A;  1A29 A;  1NX0 A;  2HF5 A;  1UP5 A;  2JPO A;  2LM5 A;  2LHI A;  4IL1 A;  3CGA A;  2ZND A;  5AXI A;  2KI4 B;  2LLT A;  3PM8 A;  4GUK A;  1SL8 A;  1XK4 A;  2BAP A;  1M45 A;  2F8P A;  3BOW A;  4I5K A;  4D1E A;  1GGZ A;  3BOW B;  4M2P A;  1JC2 A;  2LLS A;  2KI6 D;  2EHB A;  2JT0 A;  1B8R A;  5HKZ A;  3E3R A;  3FWC A;  1OOI X;  3S0D A;  1BMO A;  2ZRT A;  3DF0 A;  5I8N A;  3DF0 B;  2WCB A;  1OOJ A;  4FTG A;  3GK1 A;  1GQM A;  1SKT A;  2BBM A;  3CYZ A;  3N7H A;  1MWN A;  1SW8 A;  2LUX A;  2FCE A;  5CPV A;  3SG2 A;  1A03 A;  5GQQ C;  2BEC A;  2PMY A;  1W7J B;  2O5G A;  3AKA A;  1KK8 C;  2BL0 C;  1DEL A;  3EKJ A;  1S26 D;  2LMT A;  2LHL A;  3JTD C;  3KO0 A;  4BY5 A;  3TDU A;  1S5G Y;  2LAP A;  1EL4 A;  2Y4Q A;  3BUO B;  2GV5 A;  4MRY A;  2KI4 C;  2MLE C;  3CR2 A;  2JZI A;  1XFZ O;  1NX3 A;  1Z2C B;  1N2D A;  2NXQ A;  2QEV A;  3DY9 A;  4YGB B;  1SNL A;  2MLF C;  4NDC A;  4PE0 A;  3S0E A;  3SIA A;  1NX1 A;  5K89 A;  1DF0 A;  3JVT B;  2KQ6 A;  4I5L B;  4I5N B;  1DF0 B;  3B7A A;  2L4I A;  3VB1 A;  1QVI Y;  3SG5 A;  1TTX A;  3CZT X;  2ZKM X;  2TN4 A;  2NCO A;  4MLW A;  1FI6 A;  1S6C A;  4MVF A;  4PHM A;  3VRP A;  1QLS A;  3S0B A;  2KFG A;  1LA0 A;  1Y0V H;  1IRJ A;  2KBI A;  3KHE A;  2MBX A;  3MSE B;  1IGV A;  3OB2 B;  4F7F A;  2M49 B;  2KLD A;  2K2A A;  1BG1 A;  5CSI A;  2LLU A;  3BFA A;  2WCM A;  2K60 A;  2EGD A;  2KFF A;  4PHN A;  1C3Z A;  1B8L A;  5EL2 A;  2L4H A;  2JU0 A;  2BCX A;  1YX7 A;  1SCM B;  1QWV A;  1Z4H A;  2ZNE A;  1CNP A;  3DVM A;  5AER A;  1CDP A;  2BCB A;  2M1U A;  1TIZ A;  1F4Q A;  1QTX A;  1DGV A;  1ZMZ A;  1RWY A;  2GTE A;  3I5F C;  1DQE A;  5KU1 A;  1YTZ C;  2BKH B;  2MJW B;  5TNC A;  2PAL A;  1C07 A;  2OTG C;  2JT3 A;  2JUL A;  3I5H C;  1F71 A;  1SYM A;  1TN4 A;  4ETO A;  4CPV A;  2P70 A;  3NGV A;  4OCI A;  1QAT A;  1OSA A;  3BQ3 A;  2I18 A;  1LS8 A;  2AAO A;  1IQ3 A;  1TNP A;  4QJ3 B;  2LC5 A;  2F33 A;  3D75 A;  1TWO A;  4PCW A;  4NQG A;  1PSR A;  2QEB A;  5D3O A;  4TNC A;  3GOF A;  5D69 A;  1QS7 A;  1RTP 1;  1YVL A;  1ZFS A;  1F54 A;  1XFY O;  1SBJ A;  1K2H A;  1SL7 A;  3OB1 B;  5AEQ A;  3BYA A;  3RM1 A;  1X02 A;  1H8B A;  1EG4 A;  3O78 A;  2FCD A;  1KQV A;  2O60 A;  4HRG A;  3IF7 A;  3LL8 B;  2H61 C;  3GK2 A;  1CFC A;  3KEV A;  2G9B A;  1OMR A;  3BUW B;  3R1V A;  1WLM A;  1KK7 Z;  3BUX B;  2QEO A;  4PE7 A;  4YGE B;  3VGO A;  4HRH A;  3S0G A;  1MF8 B;  2WC8 A;  2BE6 A;  1V1G A;  1BLQ A;  2KYC A;  1OZS A;  3RZS A;  1ZAC A;  2NZ0 A;  1DJH A;  1YRT B;  4DUQ A;  1NCZ A;  5KSZ A;  1B8C A;  1TCO B;  4NDD A;  3NHI A;  4JWQ A;  2ZN8 A;  4R1E A;  1LA3 A;  3PFV A;  1LKJ A;  3KPX A;  1OMV A;  1SSE B;  1QAS A;  1K95 A;  1OQP A;  2BCA A;  1JWD A;  4YGA A;  1YRU B;  3R1P A;  1FW4 A;  1DJZ A;  2QPT A;  1K8U A;  1QV1 A;  2K7O A;  1M46 A;  2LCP A;  3SS3 A;  4GGF A;  3CTN A;  1DVI A;  2I2R E;  2JTZ A;  3L4L A;  1Y1A A;  3BFH A;  4ICB A;  1MXL C;  2WND A;  1J7Q A;  2LUC A;  1DMO A;  1L2O C;  1CLL A;  1NCX A;  3IQQ A;  3LCP C;  2HET A;  1BT6 A;  2NCP A;  1ZUZ A;  2LP3 A;  1UHJ A;  2LVJ A;  1AJ4 A;  1KFU L;  3I5G C;  1A2X A;  4GAO A;  1UHN A;  2WOR A;  4Q04 A;  2Y1N A;  2CT9 A;  2NLN A;  1OOG A;  2CNP A;  1XA5 A;  2KSP A;  2VRG A;  3BFB A;  1WLZ A;  4QJ5 B;  1TOP A;  3ICB A;  3FWB A;  5G08 A;  2KI6 C;  2GGZ A;  2WCK A;  2A4J A;  3LK0 A;  4MSP A;  3WNX B;  5I94 A;  1DC1 A;  3PSR A;  3KF9 A;  3NXA A;  1XVJ A;  4YI8 A;  1RRO A;  3BJH A;  1K96 A;  1IH0 A;  3CZ1 A;  1MXE A;  4JKT A;  1TNW A;  2I7A A;  1R2U A;  1A4P A;  2D8N A;  2PAS A;  1WDC C;  4PDZ A;  3ZWH A;  1RJV A;  2K7C A;  4NDB A;  2M0R A;  1VRK A;  4F0Z B;  1FPW A;  3R72 A;  1UUS A;  1M39 A;  1CFD A;  2Y5I A; 
#chains in the Genus database with same CATH homology
 1KSO A;  1MHO A;  1UHK A;  2HQW A;  4YGD B;  1TNX A;  5I2L A;  1UHH A;  1SMG A;  4CID A;  1IJ5 A;  2F2P A;  3NSK A;  1EXR A;  1JFK A;  1NCY A;  1OMD A;  1XFU O;  1XK4 C;  1YUS A;  4YRU A;  3EK7 A;  1XFW O;  1XYD A;  2L50 A;  1J7P A;  1FI5 A;  2ZRS A;  2F3Y A;  4YI9 A;  2CBL A;  3DD4 A;  2M1K B;  2QAC A;  5AAN A;  1AP4 A;  1CDL A;  4GFT A;  1LIN A;  1QJT A;  1JSA A;  1OZO A;  2LAN A;  5ER4 X;  3BUN B;  3TS5 B;  1F8H A;  1M63 B;  3A8R A;  5CSF A;  2BE4 A;  2KAV A;  1QXP A;  2LVK A;  4CLN A;  1S1E A;  2B1U A;  2MHH A;  1KQM B;  1HT9 A;  1YUR A;  5HYD A;  1S3P A;  2LMU A;  1JUO A;  1WY9 A;  2E6W A;  3FIA A;  3TDI A;  1BOD A;  2LV7 A;  3JVT C;  1ZOT B;  1J1E A;  3SIB A;  4GPL B;  1G4Y R;  2LE9 B;  1IWQ A;  2K7B A;  3AKB A;  2JTT A;  1NPQ A;  1A75 A;  4DS7 A;  1AJ5 A;  1N65 A;  1NIW A;  1NUB A;  1SR6 B;  1SK6 D;  1A75 B;  1CM1 A;  1YR5 A;  2EC6 B;  3NSO A;  1NP8 A;  1B7T Y;  1L7Z A;  2MRD A;  2SCP A;  4USL A;  3SG6 A;  1K90 D;  4U8D A;  1BR4 B;  2JC2 A;  3TS5 C;  1DJY A;  2KQY A;  4OVN F;  2JNF A;  2M8U A;  1KFX L;  1REC A;  2OPO A;  2JRF A;  1NWD A;  3OX5 A;  2MAZ A;  4MEW A;  2M29 A;  2F2O A;  5B8I B;  3D10 A;  1HQV A;  2R2I A;  4AOM A;  2JT8 A;  4YGC B;  1AVS A;  2KHN A;  4MRX A;  1PRW A;  1SCM C;  3EK4 A;  3OX6 A;  4MZJ A;  1SL9 A;  1TNQ A;  4ORC B;  2BKI B;  4N1G A;  2CCM A;  2ISD A;  1S6I A;  4MZL A;  1MR8 A;  2OS8 B;  1K93 D;  5ER5 A;  3WHT B;  5DKQ A;  3VRR A;  2JWW A;  1SY9 A;  5I2O A;  1H4B A;  1S5G Z;  3AAK A;  3D0Y A;  3D0Y B;  3O4Y A;  3VRO A;  5AFP A;  5HLV A;  5BPJ A;  1SR6 C;  4QJ4 B;  3K21 A;  2V53 A;  1B47 A;  1BJF A;  1D1O A;  1CDM A;  1M31 A;  2MA2 A;  2CXJ A;  3M0W A;  2LP2 A;  2KYF A;  3O6B A;  3TUY B;  1EH2 A;  2FJU B;  4ORA B;  1CLB A;  1FF1 A;  1LXF C;  3BUM B;  5JJG A;  3F45 A;  1QX5 B;  1TCF A;  1J7R A;  3EVR A;  5IBW A;  2DOQ A;  1RFJ A;  2M9G A;  2FOT A;  2P6B B;  1FBV A;  5D7F A;  1DT7 B;  2M7N A;  4A4B A;  2OS8 C;  1QX2 A;  4E68 A;  1IQ5 A;  1SPY A;  2JXL A;  4M2Q A;  4MN0 A;  2IS9 A;  5DKR A;  1PK0 D;  1OE9 B;  2E30 A;  1QLK A;  1NYA A;  5CSN A;  1K9K A;  1S6J A;  3DVJ A;  4ORB B;  2K0J A;  2WCF A;  4I5J A;  3PLF B;  1Y1U A;  1DJX A;  1RK9 A;  2AMI A;  5DKN A;  1WRZ A;  1E8A A;  3H4S E;  1WRK A;  1KFX S;  4P2Y B;  2L51 A;  1BOC A;  4UPG A;  3DVK A;  1BR1 B;  2H2K A;  1K94 A;  4CFQ A;  1YUT A;  4PHK A;  1PSB A;  3LK1 A;  2PVB A;  1KK8 B;  2K2F A;  1IG5 A;  3JTD B;  5J3X A;  5FYX A;  1CDN A;  1DJG A;  4HRE E;  2K7D A;  1Y1X A;  1DTL A;  2K61 A;  4C0J A;  4FQO A;  3DVE A;  2KAX A;  4GBA A;  1NX2 A;  2HPS A;  4OV2 A;  2JXC A;  1U5I A;  2KNE A;  5HKY A;  1PVB A;  1U5I B;  1B9A A;  1QIW A;  2GGM A;  4DCK A;  4YBH B;  4C0L A;  3LLE A;  4N5X A;  3HCM A;  4ZCU A;  4DIR A;  4BY4 A;  2PRU A;  4PHJ A;  1BF5 A;  1K9U A;  1TRF A;  2JNX A;  1KWO B;  1ALV A;  3CWG A;  3A4U B;  1J7O A;  2LVI A;  1EG3 A;  1XFV O;  3VRQ A;  1DGU A;  3PAT A;  2M3W A;  4HSZ A;  2HQ8 A;  5HKW A;  1EJ3 A;  1W7I B;  1JBA A;  3WXA A;  1CB1 A;  1C7W A;  3PAL A;  2KFH A;  1B1G A;  1KK7 Y;  4GGF C;  3FS7 A;  2LVV A;  2L0P A;  1V1F A;  4N1F A;  1CKK A;  3O2P A;  1ODB A;  3I5F B;  2SAS A;  1R6P A;  1KFU S;  1QIV A;  1AUI B;  2OTG B;  4XJK A;  1J1D A;  4C0K A;  4XJK B;  4AQJ A;  1Y6W A;  3I5H B;  3CLN A;  2WCE A;  1N0Y A;  2Q4U A;  3CR5 X;  4JQ0 D;  1KWO C;  3ZNI A;  4PE1 A;  4AQI A;  3AAJ A;  2F3Z A;  4ZCV A;  2KOT A;  1S36 A;  1QX7 A;  2LMV A;  2I94 A;  3I5I B;  1G33 A;  2AUC A;  3RLZ A;  1WRL A;  1F70 A;  1GJY A;  4WQ2 A;  1AHR A;  1CLM A;  2ZFD A;  1Q80 A;  1CFF A;  3CS1 A;  3HX4 A;  3TZ1 A;  4OKH A;  3C1V A;  1KQM C;  1PUL A;  3NSI A;  3IQO A;  4JPZ B;  3QRX A;  4MBE A;  5CSJ A;  1F55 A;  1PVA A;  1QV0 A;  2JOJ A;  5KTY A;  1JF0 A;  3SG7 A;  2H61 A;  2G2B A;  5HLO A;  3SJS A;  5PAL A;  1JF2 A;  3EK8 A;  1AK8 A;  4P5O E;  1IJ6 A;  3NSL A;  1CMF A;  1KSM A;  1MQ1 A;  4MZK A;  2ZN9 A;  1PAL A;  2JPT A;  4GGN A;  2L98 A;  2RGI A;  1UUR A;  2LNK A;  3GK4 X;  2EC6 C;  3SG3 A;  3SG4 A;  1BU3 A;  2CTN A;  3OHM B;  1G8I A;  3I5I C;  1CMG A;  2K8M B;  1GGW A;  2BBN A;  5I2Q A;  2PSR A;  4PAL A;  1IKU A;  1QVI Z;  2KBM A;  2KGR A;  1B4C A;  4DRW A;  1SRA A;  1K9P A;  3EKH A;  2KDH A;  3PN7 B;  1F4O A;  4L9M A;  4XYN A;  2Y1M A;  1KCY A;  1CFP A;  4CFR A;  4WRI A;  1JFJ A;  3BXK A;  1YVH A;  1L2O B;  3VRN A;  3OP0 A;  4A4C A;  1DJW A;  3I5G B;  1CTR A;  1SCV A;  2L5X B;  1DJI A;  4M2O A;  3WHU B;  5F6T A;  2KAY A;  1XFX O;  3EVU A;  4OR9 B;  1C7V A;  1J55 A;  1NSH A;  1ALW A;  2JQ6 A;  2KGB C;  2L2E A;  1UWO A;  1XO5 A;  1YX8 A;  2Q91 A;  3TUY C;  1UHI A;  3EVV A;  2WOS A;  1CM4 A;  3PN7 C;  4GNK B;  3TDZ A;  4WQ3 A;  2M97 A;  2COL B;  1B7T Z;  1WDC B;  2M7L A;  1YUU A;  5JOL A;  3CR4 X;  2BL0 B;  1LVC D;  1MUX A;  1A29 A;  1NX0 A;  2HF5 A;  1UP5 A;  2LM5 A;  2LHI A;  4IL1 A;  3CGA A;  2ZND A;  5AXI A;  2KI4 B;  2LLT A;  3PM8 A;  4GUK A;  1SL8 A;  1XK4 A;  3BOW A;  1M45 A;  2F8P A;  4I5K A;  4D1E A;  1GGZ A;  3BOW B;  4M2P A;  1JC2 A;  2LLS A;  2KI6 D;  2EHB A;  2JT0 A;  1B8R A;  5HKZ A;  3E3R A;  3FWC A;  1BMO A;  2ZRT A;  3DF0 A;  5I8N A;  3DF0 B;  2WCB A;  1OOJ A;  4FTG A;  3GK1 A;  1GQM A;  1SKT A;  2BBM A;  1MWN A;  1SW8 A;  2LUX A;  2FCE A;  5CPV A;  3SG2 A;  1A03 A;  5GQQ C;  2BEC A;  2PMY A;  1W7J B;  2O5G A;  3AKA A;  1KK8 C;  2BL0 C;  3EKJ A;  1S26 D;  2LMT A;  2LHL A;  3JTD C;  3KO0 A;  4BY5 A;  3TDU A;  1S5G Y;  2LAP A;  1EL4 A;  2Y4Q A;  3BUO B;  2GV5 A;  4MRY A;  2KI4 C;  2MLE C;  3CR2 A;  2JZI A;  1XFZ O;  1NX3 A;  2NXQ A;  1N2D A;  4PE4 A;  4YGB B;  1SNL A;  2MLF C;  4NDC A;  4PE0 A;  3SIA A;  1NX1 A;  5K89 A;  1DF0 A;  3JVT B;  2KQ6 A;  4I5L B;  4I5N B;  1DF0 B;  2L4I A;  1QVI Y;  3SG5 A;  1TTX A;  3CZT X;  2ZKM X;  2TN4 A;  2NCO A;  4MLW A;  1FI6 A;  1S6C A;  4MVF A;  4PHM A;  3VRP A;  1QLS A;  2KFG A;  1LA0 A;  1Y0V H;  1IRJ A;  2KBI A;  3KHE A;  2MBX A;  3MSE B;  1IGV A;  3OB2 B;  2M49 B;  2K2A A;  1BG1 A;  5CSI A;  2LLU A;  2EGD A;  2KFF A;  4PHN A;  1B8L A;  2L4H A;  2JU0 A;  2BCX A;  1YX7 A;  1SCM B;  2ZNE A;  1CNP A;  3DVM A;  5AER A;  1CDP A;  2BCB A;  2M1U A;  1TIZ A;  1F4Q A;  1QTX A;  1DGV A;  1ZMZ A;  1RWY A;  3I5F C;  5KU1 A;  1YTZ C;  2BKH B;  2MJW B;  5TNC A;  2PAL A;  1C07 A;  2OTG C;  2JT3 A;  2JUL A;  3I5H C;  1F71 A;  1SYM A;  1TN4 A;  4ETO A;  4CPV A;  4OCI A;  1QAT A;  1OSA A;  3BQ3 A;  2I18 A;  2AAO A;  1IQ3 A;  1TNP A;  4QJ3 B;  2LC5 A;  2F33 A;  4PCW A;  4NQG A;  1PSR A;  4TNC A;  3GOF A;  5D69 A;  1QS7 A;  1RTP 1;  1YVL A;  1ZFS A;  1F54 A;  1XFY O;  1SBJ A;  1K2H A;  1SL7 A;  3OB1 B;  5AEQ A;  3BYA A;  3RM1 A;  1X02 A;  1H8B A;  1EG4 A;  3O78 A;  2FCD A;  1KQV A;  2O60 A;  4HRG A;  3IF7 A;  3LL8 B;  2H61 C;  3GK2 A;  1CFC A;  3KEV A;  2G9B A;  1OMR A;  3BUW B;  1WLM A;  1KK7 Z;  3BUX B;  4PE7 A;  3VGO A;  4YGE B;  4HRH A;  1MF8 B;  2WC8 A;  2BE6 A;  1V1G A;  1BLQ A;  2KYC A;  1OZS A;  1ZAC A;  2NZ0 A;  1DJH A;  1YRT B;  4DUQ A;  1NCZ A;  5KSZ A;  1B8C A;  1TCO B;  4NDD A;  4JWQ A;  2ZN8 A;  4R1E A;  1LA3 A;  3PFV A;  1LKJ A;  3KPX A;  1OMV A;  1QAS A;  1K95 A;  1OQP A;  2BCA A;  1JWD A;  4YGA A;  1YRU B;  1FW4 A;  1DJZ A;  2QPT A;  1K8U A;  1QV1 A;  2K7O A;  1M46 A;  2LCP A;  3CTN A;  1DVI A;  2I2R E;  2JTZ A;  1DMO A;  1Y1A A;  4ICB A;  1MXL C;  2WND A;  1J7Q A;  2LUC A;  1L2O C;  1CLL A;  1NCX A;  3IQQ A;  3LCP C;  2HET A;  1BT6 A;  2NCP A;  1ZUZ A;  2LP3 A;  1UHJ A;  2LVJ A;  1AJ4 A;  1KFU L;  3I5G C;  1A2X A;  4GAO A;  1UHN A;  2WOR A;  4Q04 A;  2Y1N A;  2CT9 A;  2NLN A;  2CNP A;  1XA5 A;  2KSP A;  2VRG A;  1WLZ A;  4QJ5 B;  1TOP A;  3ICB A;  3FWB A;  5G08 A;  2KI6 C;  2GGZ A;  2A4J A;  3LK0 A;  4MSP A;  3WNX B;  3PSR A;  3KF9 A;  3NXA A;  1XVJ A;  4YI8 A;  1RRO A;  1K96 A;  1IH0 A;  1MXE A;  1TNW A;  2I7A A;  1R2U A;  1A4P A;  2D8N A;  2PAS A;  1WDC C;  4PDZ A;  3ZWH A;  1RJV A;  2K7C A;  4NDB A;  2M0R A;  1VRK A;  4F0Z B;  1FPW A;  4GGF A;  1UUS A;  1M39 A;  1CFD A;  2Y5I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...