1AP4A

Regulatory domain of human cardiac troponin c in the calcium-saturated state, nmr, 40 structures
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
89
structure length
89
Chain Sequence
b'MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARDIAC N-TROPONIN C
publication title Calcium-induced structural transition in the regulatory domain of human cardiac troponin C.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Calcium-binding
total genus 19
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 1997-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1ap4A00
1OZSA 2LP2A 1KK7Z 2KI4B 3O78A 1QATA 2WCEA 1MUXA 4MRYA 4GGFC 1F54A 1JWDA 1XFVO 1K9UA 1SR6B 2JTTA 3AAKA 1CLMA 1YX8A 3WHUB 1BR1B 3BUXB 3DVEA 3WNXB 1B8CA 1DF0B 4U8DA 3D0YA 2L2EA 1K93D 1YVHA 1GQMA 1CDMA 2L98A 1ZMZA 1LXFC 1S26D 3VRNA 4ORCB 1EG3A 4PE1A 1B7TY 1SL8A 1HQVA 1DJWA 4HREE 2HPSA 1CNPA 4I5KA 4GAOA 1IJ5A 1WDCC 1XO5A 1AHRA 1F8HA 1W7JB 1MQ1A 2EC6B 2E6WA 4AQJA 1A75B 1ZOTB 1UHJA 1D1OA 3KEVA 2ZNDA 4WQ3A 3CGAA 1CFPA 1YR5A 3TDUA 1K96A 1OMDA 1LINA 1KFUL 3BOWA 1U5IB 1UUSA 1BT6A 1TIZA 2MBXA 5G08A 4PHKA 2BE6A 4DUQA 1KQMC 2MRDA 1BF5A 2L4IA 2LP3A 1YX7A 1IKUA 2AMIA 1A2XA 1BMOA 1XFWO 1DT7B 4DS7A 2KBIA 1PULA 2OS8C 1IWQA 2KAXA 2K8MB 4QJ3B 2JXCA 2LAPA 2PVBA 1SYMA 1YVLA 1UHHA 3HX4A 2FCEA 5GQQC 2K2FA 4OR9B 2G9BA 1A4PA 1V1FA 1KWOB 3PM8A 2MA2A 1R2UA 1M46A 1FBVA 2JRFA 1FI5A 2KI6C 1XFYO 2GGZA 2LVKA 4YRUA 3IQOA 1FF1A 1WY9A 2LVJA 5ER4X 1DJZA 1C7WA 1PK0D 1XFUO 2PRUA 1Y6WA 1JF2A 1LA3A 1UWOA 3BQ3A 3M0WA 3FS7A 3MSEB 1NSHA 1KSOA 4XJKA 2BBNA 1QX7A 1QLKA 1XK4C 1SL9A 1QV0A 1J7RA 2KFGA 1S1EA 4R1EA 2ZNEA 1NYAA 1FI6A 4JQ0D 1UHNA 1WDCB 1NX2A 1CDPA 2ISDA 2LV7A 2WCFA 3SG4A 3SG6A 1B8LA 1SCMC 2JWWA 4MEWA 1L2OC 3QRXA 3PN7C 5DKRA 1PALA 2K7OA 3I5HC 2TN4A 1UHIA 3BUMB 1NP8A 1XA5A 4FTGA 2KAVA 2M7LA 2L4HA 3JVTC 1OMVA 2Q4UA 1SKTA 4PHJA 3VRPA 4USLA 5K89A 5I2QA 3SJSA 4YI9A 1S36A 1YTZC 2LCPA 1KQMB 1BODA 1WLZA 2JOJA 4P5OE 4YBHB 3ZWHA 1BJFA 1QASA 2KBMA 1C07A 1NUBA 1EG4A 2OPOA 3OB1B 4YGAA 2PALA 3C1VA 3FWBA 2OS8B 4MZLA 1UURA 1NPQA 3EVRA 4OVNF 4PCWA 1CTRA 1NX0A 2Y1MA 2Q91A 4AOMA 1BU3A 5CSJA 3EKHA 1CMGA 2LE9B 2I94A 2F33A 3DD4A 2Y1NA 3CTNA 4PE7A 2JC2A 2D8NA 3AKBA 1DJIA 1S5GY 4CLNA 4TNCA 5CSFA 4GGNA 1K90D 1K9PA 1BOCA 1JSAA 2COLB 1RWYA 1G4YR 2M97A 2V53A 2FJUB 2MHHA 1NX1A 2KFHA 1AVSA 3VRRA 1XVJA 3EVUA 3O4YA 4QJ4B 2M7NA 5IBWA 2JU0A 2I2RE 3CWGA 4WRIA 2ZN8A 3KF9A 2I18A 1CMFA 1AJ4A 1N2DA 1TN4A 2MLEC 1A29A 1PSRA 1BR4B 1TCOB 2JTZA 2KNEA 2KQ6A 1SCMB 3BUOB 1L2OB 3PN7B 2KFFA 3SG7A 2CBLA 3NSOA 2LHIA 3I5HB 1H4BA 2HQ8A 2QPTA 2NZ0A 4NQGA 1VRKA 4OCIA 4DCKA 1B4CA 5HLVA 1ALVA 1YUSA 4YI8A 3JVTB 2EHBA 3EK7A 5TNCA 1TTXA 3RM1A 4CPVA 5BPJA 4DRWA 1K94A 3D0YB 2PSRA 1TOPA 4AQIA 1BLQA 5D7FA 3OP0A 4YGEB 1MF8B 4C0KA 1JFKA 2H2KA 4DIRA 1KK7Y 5AANA 1QV1A 5B8IB 1YRTB 2Y4QA 1YURA 1JBAA 1DJGA 1IRJA 2KOTA 2KDHA 3BUNB 1FPWA 1OZOA 2BKIB 2G2BA 3D10A 4GBAA 1J7QA 2LUCA 2HF5A 1NIWA 1B47A 2L51A 4IL1A 4HRHA 3JTDC 2CT9A 1SK6D 2LM5A 1CM1A 1B9AA 2MLFC 1J7PA 2JNFA 1QIVA 3BOWB 2P6BB 4M2PA 2K7CA 1SY9A 5JJGA 1PRWA 1JF0A 2BL0C 2K7BA 2M1KB 3EKJA 1QS7A 1J1DA 2WORA 4CFQA 2K7DA 1OQPA 1IQ5A 1OE9B 1DGUA 5DKQA 2M3WA 2QACA 2LANA 3FIAA 4ORAB 2JPTA 4A4CA 2JT0A 2KAYA 4C0JA 1K95A 1W7IB 5HYDA 2KHNA 1CDNA 2PMYA 2JQ6A 1QVIZ 2FOTA 2F3YA 2FCDA 3AKAA 3FWCA 4F0ZB 3K21A 2HQWA 2ZN9A 4JPZB 2LUXA 3TDIA 3I5IC 2BECA 1KFXL 1SBJA 1R6PA 1YRUB 3EK8A 3GK4X 3WHTB 1RK9A 1MXEA 2MAZA 1Y0VH 2F2PA 5F6TA 5PALA 1HT9A 2KYFA 2NXQA 1GGZA 2SASA 2GGMA 3BUWB 4I5JA 4PHNA 2LLTA 2CNPA 3SG3A 4PDZA 2BBMA 1QXPA 1ZFSA 2IS9A 2O5GA 2BCAA 4GUKA 1DMOA 4XJKB 2AUCA 3DF0A 2I7AA 3O2PA 2K61A 2L0PA 1H8BA 3CS1A 2WCBA 1M63B 1WLMA 2M8UA 3OX5A 2LMVA 1MWNA 5AFPA 1QVIY 2B1UA 1AP4A 2HETA 4N5XA 2JXLA 1AUIB 1QLSA 5DKNA 1SW8A 1ZACA 3JTDB 2DOQA 3KPXA 5CPVA 3TZ1A 2L50A 2PASA 4I5NB 1LKJA 5I2LA 1TNWA 4CIDA 2BL0B 2JZIA 1KSMA 3I5GC 2WC8A 3PSRA 1IJ6A 2M29A 1IG5A 3GOFA 1NCXA 2M49B 3OHMB 4MRXA 2NCPA 4ICBA 5JOLA 1S3PA 3VRQA 3CR5X 5HKZA 1G33A 1UHKA 4L9MA 5AEQA 2BKHB 4GPLB 1AK8A 4MZKA 1F4OA 1AJ5A 3SG2A 2KGRA 1KCYA 3I5IB 4N1FA 1YUTA 2Y5IA 2K2AA 1ODBA 1F70A 1K9KA 2L5XB 1B7TZ 2JNXA 5FYXA 1NWDA 2H61A 3H4SE 4E68A 1FW4A 5ER5A 4ZCUA 4MLWA 3PATA 4MSPA 5HKYA 4YGBB 3BXKA 4OKHA 4YGCB 3TUYC 1DF0A 3WXAA 1N0YA 1RFJA 1CFDA 2BE4A 4PHMA 1Y1AA 1Y1UA 1RROA 1G8IA 3EK4A 1M45A 1KFUS 2VRGA 1C7VA 2OTGC 5J3XA 1YUUA 1ALWA 1LVCD 4ETOA 2WNDA 1A75A 2K0JA 3RLZA 3LL8B 5CSIA 2CXJA 1Y1XA 3PLFB 3NXAA 3CZTX 5KTYA 4UPGA 1ZUZA 1KK8B 1V1GA 1SMGA 2KGBC 1U5IA 3A8RA 3A4UB 3CR4X 3VROA 3DVJA 1SPYA 1MHOA 1A03A 4BY4A 3I5GB 1OOJA 2KYCA 4Q04A 4WQ2A 3SIBA 4CFRA 3LK1A 2EGDA 1M31A 4GFTA 4XYNA 3VGOA 1EL4A 2M1UA 3LK0A 1LA0A 3HCMA 3NSKA 1MXLC 1OMRA 3KO0A 1BG1A 5KSZA 4ZCVA 1QX2A 2F8PA 3IF7A 2F3ZA 1KFXS 1SRAA 1TRFA 1EJ3A 5HLOA 3TDZA 1F55A 2ZFDA 1CB1A 4GGFA 1DTLA 2NLNA 1EH2A 3PALA 4D1EA 1GGWA 4NDCA 3TUYB 2GV5A 1IGVA 3TS5C 1IQ3A 1X02A 3I5FC 1S6IA 4HRGA 2LMUA 2O60A 4QJ5B 2LLSA 1J55A 3PFVA 1JUOA 1XFZO 5AERA 3GK1A 1J1EA 3LLEA 4I5LB 1QJTA 2AAOA 3NSIA 1E8AA 1GJYA 2KI6D 1QTXA 3DVKA 1DJHA 1WRZA 2OTGB 4YGDB 2NCOA 1CFFA 4BY5A 3CLNA 2M9GA 1IH0A 1PSBA 3LCPC 1TCFA 1XYDA 2A4JA 1CLBA 4ORBB 5D69A 1TNPA 1F4QA 2KI4C 1CKKA 4A4BA 1DGVA 2H61C 2ZRSA 2ZRTA 1SR6C 1TNQA 1B1GA 1M39A 1RECA 1RTP1 1Q80A 3ICBA 2M0RA 2ZKMX 5KU1A 1J7OA 1L7ZA 3F45A 4PE0A 2BCBA 1MR8A 3DF0B 4JWQA 4OV2A 1OSAA 5I8NA 2KQYA 1SCVA 1KK8C 1NCZA 2LLUA 1S5GZ 5HKWA 2CTNA 1JFJA 2BCXA 2LHLA 1PVAA 4FQOA 2LC5A 4C0LA 2EC6C 1JC2A 2R2IA 3E3RA 1B8RA 3OB2B 4NDDA 2JT3A 3ZNIA 1DVIA 1K2HA 1UP5A 2JT8A 3OX6A 5CSNA 3IQQA 1KQVA 4PE4A 5I2OA 1QIWA 2F2OA 1SNLA 1N65A 3DVMA 1RJVA 4N1GA 1F71A 2MJWB 4MBEA 1DJYA 1WRLA 3AAJA 3KHEA 1S6CA 2LVIA 1EXRA 1SL7A 3BYAA 1CFCA 2RGIA 2JULA 2WOSA 3TS5B 5AXIA 2CCMA 1PVBA 1CM4A 3I5FB 4HSZA 1WRKA 1XK4A 4MZJA 3SIAA 2SCPA 1XFXO 4P2YB 3GK2A 2LMTA 2LNKA 4NDBA 4MVFA 1K8UA 4MN0A 1S6JA 4PALA 2KSPA 1DJXA 3O6BA 4M2QA 3SG5A 1NX3A 3CR2A 4M2OA 1TNXA 1CLLA 4GNKB 1QX5B 3EVVA 2E30A 2LVVA 1CDLA 3NSLA 1KWOC 1NCYA
chains in the Genus database with same CATH superfamily
1OZSA 2LP2A 1KK7Z 2KI4B 3O78A 1QATA 2WCEA 1MUXA 4MRYA 4GGFC 1F54A 1OW4A 1XFVO 1JWDA 1K9UA 1SR6B 2JTTA 3AAKA 1CLMA 1YX8A 3WHUB 1BR1B 3BUXB 3O4XA 3DVEA 3WNXB 5DICA 1B8CA 1DF0B 4U8DA 3D0YA 2L2EA 1K93D 1YVHA 1GQMA 3CDNA 1CDMA 2L98A 1ZMZA 1LXFC 3D78A 1S26D 3VRNA 4ORCB 1EG3A 3L4LA 4PE1A 1B7TY 1SL8A 1HQVA 1DJWA 4HREE 2HPSA 5EL2A 1CNPA 4I5KA 4GAOA 1IJ5A 1WDCC 1XO5A 1AHRA 1F8HA 1W7JB 1MQ1A 2EC6B 2E6WA 4AQJA 1A75B 1ZOTB 1UHJA 1D1OA 3DXLA 3CABA 2ZNDA 3KEVA 3CGAA 4WQ3A 2JPOA 1C3YA 1CFPA 1YR5A 3TDUA 1K96A 1OMDA 3D75A 1LINA 2QEBA 1KFUL 3BOWA 1U5IB 1UUSA 1BT6A 1TIZA 2MBXA 5G08A 4PHKA 2BE6A 4DUQA 1KQMC 2MRDA 1BF5A 2L4IA 2LP3A 1YX7A 1IKUA 2AMIA 1A2XA 1BMOA 1XFWO 1DT7B 4DS7A 2KBIA 1PULA 1SSEB 2OS8C 1IWQA 2KAXA 2K8MB 4QJ3B 2JXCA 2LAPA 2PVBA 1SYMA 1YVLA 1UHHA 3HX4A 2FCEA 3UNWA 5GQQC 2K2FA 4OR9B 2G9BA 1A4PA 1V1FA 1KWOB 3PM8A 2MA2A 1R2UA 1M46A 1FBVA 2JRFA 1FI5A 2KI6C 1XFYO 2GGZA 2LVKA 4YRUA 3IQOA 1FF1A 1WY9A 2LVJA 5ER4X 1DJZA 3D76A 1C7WA 1PK0D 1XFUO 2PRUA 1Y6WA 1JF2A 1LA3A 1UWOA 3BQ3A 2P70A 1QWVA 3FS7A 3M0WA 1NSHA 1KSOA 3MSEB 4XJKA 3D73A 2BBNA 1QX7A 1QLKA 1XK4C 1SL9A 2WC6A 1QV0A 1J7RA 2KFGA 1S1EA 4R1EA 2ZNEA 1NYAA 3Q8IA 1FI6A 4JQ0D 1UHNA 1WDCB 1NX2A 1CDPA 2ISDA 2LV7A 2WCFA 3SG4A 3SG6A 1B8LA 1SCMC 2JWWA 4MEWA 1L2OC 3QRXA 2P71A 3PN7C 5DKRA 1PALA 2K7OA 3I5HC 2TN4A 1UHIA 3BUMB 1NP8A 1XA5A 4FTGA 2KAVA 2M7LA 4OZDA 2L4HA 3JVTC 5D3OA 1OMVA 2Q4UA 3BFAA 1SKTA 4PHJA 3VRPA 4USLA 5K89A 5I2QA 3SJSA 4YI9A 1S36A 1YTZC 2LCPA 1KQMB 1BODA 1WLZA 2JOJA 4P5OE 4YBHB 3BFBA 3ZWHA 1BJFA 1QASA 2KBMA 3RZSA 1C07A 1NUBA 1EG4A 2OPOA 3OB1B 4YGAA 2GTEA 2PALA 3C1VA 3FWBA 3DZTA 2OS8B 3V2LA 1T14A 4MZLA 3B7AA 1UURA 1NPQA 3EVRA 4OVNF 4PCWA 1CTRA 1NX0A 2Y1MA 1DEKA 2Q91A 4AOMA 1BU3A 5CSJA 3EKHA 3EG5B 1CMGA 2LE9B 2I94A 2F33A 1ORGA 3DD4A 2Y1NA 3S0FA 3CTNA 4PE7A 2JC2A 2D8NA 3AKBA 1DJIA 1S5GY 1XFRA 3SS4A 4F7FA 4CLNA 4TNCA 5CSFA 4GGNA 1K90D 1K9PA 1BOCA 1JSAA 2COLB 4IJ7A 1RWYA 1G4YR 1OOHA 2M97A 2FJUB 2MHHA 2V53A 1NX1A 5I94A 2KFHA 3CZ0A 1AVSA 3VRRA 1XVJA 3EVUA 3O4YA 4QJ4B 3PM2A 1Z4HA 2M7NA 2WCKA 5IBWA 2JU0A 3IVTA 2I2RE 3CWGA 4WRIA 2ZN8A 3KF9A 2I18A 1CMFA 3VB1A 1AJ4A 1N2DA 2KLDA 1TN4A 2MLEC 2H8VA 1A29A 1PSRA 1BR4B 1TCOB 2JTZA 2KNEA 2KQ6A 1SCMB 3BUOB 1L2OB 3PN7B 2KFFA 3SG7A 2CBLA 3NSOA 2LHIA 3I5HB 1H4BA 2HQ8A 2QPTA 2NZ0A 4NQGA 1VRKA 4OCIA 4DCKA 1B4CA 5HLVA 1ALVA 1YUSA 4YI8A 3JVTB 2QEOA 2EHBA 3EK7A 5TNCA 3R1OA 1TTXA 3RM1A 2PQLA 4CPVA 5BPJA 4DRWA 1K94A 1P28A 3D0YB 2PSRA 1TOPA 3S0DA 4AQIA 1BLQA 5D7FA 3OP0A 4YGEB 1MF8B 4C0KA 1JFKA 2H2KA 4DIRA 1KK7Y 5AANA 1QV1A 5B8IB 1YRTB 2Y4QA 1C3ZA 3B6XA 1YURA 1JBAA 3N7HA 1DJGA 1IRJA 2BNXA 2KDHA 2KOTA 3BUNB 5FI6A 1FPWA 1OZOA 2BKIB 2G2BA 3D10A 4GBAA 1J7QA 2LUCA 2HF5A 1NIWA 1B47A 2L51A 3R1VA 4HRHA 4IL1A 3JTDC 3UO9A 1OOGA 2CT9A 3B88A 1SK6D 2LM5A 1CM1A 1B9AA 2MLFC 1J7PA 2JNFA 3QMEA 4JD9A 1QIVA 3BOWB 2P6BB 4M2PA 2K7CA 1SY9A 5JJGA 1PRWA 1JF0A 3B86A 2BL0C 2K7BA 2M1KB 3EKJA 1QS7A 1J1DA 2WORA 4CFQA 2K7DA 1OQPA 2KLEA 1IQ5A 1OE9B 5HL1A 3FE8A 1DGUA 5DKQA 2M3WA 2QACA 2LANA 3FIAA 4ORAB 2JPTA 4A4CA 2JT0A 2KAYA 4C0JA 1K95A 1W9ZA 1W7IB 5HYDA 1IIOA 2KHNA 1CDNA 2PMYA 2JQ6A 1QVIZ 2FOTA 2F3YA 2FCDA 3AKAA 3B87A 3FWCA 4F0ZB 3K21A 2HQWA 2ZN9A 4JPZB 2LUXA 3TDIA 3I5IC 1KFXL 1SBJA 1YRUB 1R6PA 2BECA 3EK8A 3GK4X 3WHTB 1LS8A 1RK9A 1MXEA 2MAZA 1Y0VH 2F2PA 5F6TA 5FI2A 5PALA 2L2CA 3OGNA 1HT9A 2KYFA 2NXQA 1GGZA 2SASA 2GGMA 3BUWB 4I5JA 4PHNA 2LLTA 2CNPA 3SG3A 4PDZA 2BBMA 1QXPA 1ZFSA 2IS9A 2O5GA 1DQEA 2BCAA 4FQTA 4GUKA 1DMOA 4XJKB 2AUCA 3DYEA 3DF0A 2I7AA 3O2PA 2K61A 2L0PA 2PYQA 1TUJA 1H8BA 3CS1A 2WCBA 1M63B 1WLMA 2M8UA 3OX5A 2LMVA 1MWNA 5AFPA 1QVIY 2B1UA 1AP4A 2HETA 4N5XA 4KYNA 2JXLA 1AUIB 1QLSA 5DKNA 1SW8A 3K1EA 1OOFA 1ZACA 2YGUA 2DOQA 3JTDB 3KPXA 5CPVA 3TZ1A 2L50A 2PASA 4I5NB 1LKJA 1DELA 5I2LA 1TNWA 4CIDA 3D74A 2BL0B 2JZIA 2FJYA 1KSMA 3I5GC 2WC8A 3PSRA 1IJ6A 2M29A 1IG5A 3GOFA 1NCXA 2M49B 3OHMB 3R1PA 5FI7A 4MRXA 2NCPA 4ICBA 3CZ1A 5JOLA 1S3PA 3VRQA 3CR5X 5HKZA 3BJHA 1G33A 1UHKA 4L9MA 5AEQA 4JKTA 2BKHB 4GPLB 1AK8A 4MZKA 1F4OA 1AJ5A 3SG2A 2WCHA 2KGRA 1KCYA 3I5IB 4N1FA 1YUTA 2Y5IA 3SS3A 2K2AA 1ODBA 1F70A 1K9KA 2L5XB 1B7TZ 3CYZA 2JNXA 5FYXA 1NWDA 2H61A 3H4SE 4E68A 1FW4A 2ERBA 3CZ2A 2QEHA 5ER5A 4ZCUA 4MLWA 3PATA 4MSPA 5HKYA 4YGBB 3BXKA 4OKHA 4YGCB 2WCLA 3TUYC 1DF0A 1TUZA 3WXAA 1N0YA 1RFJA 3BFHA 1CFDA 2BE4A 1DC1A 4PHMA 1Y1AA 1Y1UA 1RROA 4INWA 1G8IA 3EK4A 3L47A 1M45A 1KFUS 2VRGA 1C7VA 2OTGC 5J3XA 1YUUA 1ALWA 1LVCD 4ETOA 2WNDA 1A75A 2K0JA 3RLZA 3LL8B 5CSIA 2WC5A 2CXJA 1Y1XA 3PLFB 3NXAA 3CZTX 5KTYA 4UPGA 1ZUZA 3NHIA 1KK8B 1V1GA 1SMGA 2KGBC 1U5IA 3A8RA 3A4UB 2K60A 3CR4X 3VROA 3DVJA 1GM0A 1SPYA 1MHOA 1A03A 4BY4A 3I5GB 1OOJA 2KYCA 4Q04A 4WQ2A 3SIBA 4CFRA 3LK1A 2EGDA 2KPHA 1M31A 4GFTA 4XYNA 3VGOA 1EL4A 2M1UA 3LK0A 1LA0A 3HCMA 3NSKA 1MXLC 1OMRA 3KO0A 2BAPA 1BG1A 5KSZA 4ZCVA 1QX2A 2F8PA 3IF7A 2F3ZA 1KFXS 2WCMA 3PJIA 1SRAA 1TRFA 1EJ3A 5HLOA 3TDZA 1F55A 2ZFDA 1CB1A 4GGFA 1DTLA 2NLNA 1EH2A 3PALA 4D1EA 1GGWA 4NDCA 3TUYB 2GV5A 3OBVA 1IGVA 3S0GA 3TS5C 1IQ3A 1X02A 3I5FC 1S6IA 4HRGA 2LMUA 2O60A 4QJ5B 2LLSA 1J55A 4INXA 3PFVA 1JUOA 1XFZO 5AERA 3GK1A 1J1EA 3LLEA 4I5LB 1QJTA 2AAOA 3NSIA 1E8AA 1GJYA 2KI6D 1QTXA 3DVKA 1DJHA 1WRZA 3NHTA 2OTGB 4YGDB 2NCOA 1CFFA 1Z2CB 4BY5A 3CLNA 2M9GA 1IH0A 1PSBA 3LCPC 1TCFA 1XYDA 2A4JA 1CLBA 4ORBB 5D69A 1TNPA 1F4QA 2KI4C 1CKKA 4A4BA 1DGVA 2H61C 2ZRSA 2ZRTA 1SR6C 1TNQA 1B1GA 1M39A 1RECA 1RTP1 1Q80A 3ICBA 2M0RA 2ZKMX 5KU1A 1J7OA 3NGVA 1L7ZA 1TWOA 3F45A 4PE0A 2BCBA 1MR8A 3DF0B 4JWQA 4OV2A 1OSAA 4PT1A 3FE9A 5I8NA 2KQYA 1SCVA 1KK8C 1NCZA 2LLUA 1S5GZ 5HKWA 2CTNA 2QDIA 1JFJA 2BCXA 2LHLA 2L5YA 3L4AA 1PVAA 4FQOA 2LC5A 4C0LA 2EC6C 3SS5A 1JC2A 2R2IA 3E3RA 1B8RA 3OB2B 4NDDA 2JT3A 2WCJA 3ZNIA 1DVIA 1K2HA 1UP5A 2JT8A 3OX6A 5CSNA 3S0EA 3IQQA 1KQVA 4PE4A 5I2OA 1QIWA 2F2OA 1SNLA 1N65A 3DVMA 1RJVA 4N1GA 1F71A 2MJWB 4MBEA 1DJYA 1WRLA 3AAJA 3KHEA 1S6CA 2LVIA 1EXRA 1SL7A 3BYAA 3FE6A 3R72A 1CFCA 2RGIA 2JULA 3D77A 2WOSA 3TS5B 3DY9A 5AXIA 2CCMA 1PVBA 1CM4A 3I5FB 4HSZA 1WRKA 1XK4A 4MZJA 3SIAA 1OOIX 2SCPA 1XFXO 4P2YB 3GK2A 2LMTA 2LNKA 4NDBA 4MVFA 1K8UA 2QEVA 4MN0A 1S6JA 4PALA 2KSPA 1DJXA 3O6BA 4M2QA 3SG5A 1NX3A 3CR2A 4M2OA 3S0AA 1TNXA 1CLLA 4GNKB 1QX5B 3EVVA 2E30A 2LVVA 1CDLA 3NSLA 1KWOC 3S0BA 1NCYA
chains in the Genus database with same CATH topology
1OZSA 2LP2A 1KK7Z 2KI4B 3O78A 1QATA 2WCEA 1MUXA 4MRYA 4GGFC 1F54A 1JWDA 1XFVO 1K9UA 1SR6B 2JTTA 3AAKA 1CLMA 1YX8A 3WHUB 1BR1B 3BUXB 3DVEA 3WNXB 1B8CA 1DF0B 4U8DA 3D0YA 2L2EA 1K93D 1YVHA 1GQMA 1CDMA 2L98A 1ZMZA 1LXFC 1S26D 3VRNA 4ORCB 1EG3A 4PE1A 1B7TY 1SL8A 1HQVA 1DJWA 4HREE 2HPSA 1CNPA 4I5KA 4GAOA 1IJ5A 1WDCC 1XO5A 1AHRA 1F8HA 1W7JB 1MQ1A 2EC6B 2E6WA 4AQJA 1A75B 1ZOTB 1UHJA 1D1OA 3KEVA 2ZNDA 4WQ3A 3CGAA 1CFPA 1YR5A 3TDUA 1K96A 1OMDA 1LINA 1KFUL 3BOWA 1U5IB 1UUSA 1BT6A 1TIZA 2MBXA 5G08A 4PHKA 2BE6A 4DUQA 1KQMC 2MRDA 1BF5A 2L4IA 2LP3A 1YX7A 1IKUA 2AMIA 1A2XA 1BMOA 1XFWO 1DT7B 4DS7A 2KBIA 1PULA 2OS8C 1IWQA 2KAXA 2K8MB 4QJ3B 2JXCA 2LAPA 2PVBA 1SYMA 1YVLA 1UHHA 3HX4A 2FCEA 5GQQC 2K2FA 4OR9B 2G9BA 1A4PA 1V1FA 1KWOB 3PM8A 2MA2A 1R2UA 1M46A 1FBVA 2JRFA 1FI5A 2KI6C 1XFYO 2GGZA 2LVKA 4YRUA 3IQOA 1FF1A 1WY9A 2LVJA 5ER4X 1DJZA 1C7WA 1PK0D 1XFUO 2PRUA 1Y6WA 1JF2A 1LA3A 1UWOA 3BQ3A 3M0WA 3FS7A 3MSEB 1NSHA 1KSOA 4XJKA 2BBNA 1QX7A 1QLKA 1XK4C 1SL9A 1QV0A 1J7RA 2KFGA 1S1EA 4R1EA 2ZNEA 1NYAA 1FI6A 4JQ0D 1UHNA 1WDCB 1NX2A 1CDPA 2ISDA 2LV7A 2WCFA 3SG4A 3SG6A 1B8LA 1SCMC 2JWWA 4MEWA 1L2OC 3QRXA 3PN7C 5DKRA 1PALA 2K7OA 3I5HC 2TN4A 1UHIA 3BUMB 1NP8A 1XA5A 4FTGA 2KAVA 2M7LA 2L4HA 3JVTC 1OMVA 2Q4UA 1SKTA 4PHJA 3VRPA 4USLA 5K89A 5I2QA 3SJSA 4YI9A 1S36A 1YTZC 2LCPA 1KQMB 1BODA 1WLZA 2JOJA 4P5OE 4YBHB 3ZWHA 1BJFA 1QASA 2KBMA 1C07A 1NUBA 1EG4A 2OPOA 3OB1B 4YGAA 2PALA 3C1VA 3FWBA 2OS8B 4MZLA 1UURA 1NPQA 3EVRA 4OVNF 4PCWA 1CTRA 1NX0A 2Y1MA 2Q91A 4AOMA 1BU3A 5CSJA 3EKHA 1CMGA 2LE9B 2I94A 2F33A 3DD4A 2Y1NA 3CTNA 4PE7A 2JC2A 2D8NA 3AKBA 1DJIA 1S5GY 4CLNA 4TNCA 5CSFA 4GGNA 1K90D 1K9PA 1BOCA 1JSAA 2COLB 1RWYA 1G4YR 2M97A 2V53A 2FJUB 2MHHA 1NX1A 2KFHA 1AVSA 3VRRA 1XVJA 3EVUA 3O4YA 4QJ4B 2M7NA 5IBWA 2JU0A 2I2RE 3CWGA 4WRIA 2ZN8A 3KF9A 2I18A 1CMFA 1AJ4A 1N2DA 1TN4A 2MLEC 1A29A 1PSRA 1BR4B 1TCOB 2JTZA 2KNEA 2KQ6A 1SCMB 3BUOB 1L2OB 3PN7B 2KFFA 3SG7A 2CBLA 3NSOA 2LHIA 3I5HB 1H4BA 2HQ8A 2QPTA 2NZ0A 4NQGA 1VRKA 4OCIA 4DCKA 1B4CA 5HLVA 1ALVA 1YUSA 4YI8A 3JVTB 2EHBA 3EK7A 5TNCA 1TTXA 3RM1A 4CPVA 5BPJA 4DRWA 1K94A 3D0YB 2PSRA 1TOPA 4AQIA 1BLQA 5D7FA 3OP0A 4YGEB 1MF8B 4C0KA 1JFKA 2H2KA 4DIRA 1KK7Y 5AANA 1QV1A 5B8IB 1YRTB 2Y4QA 1YURA 1JBAA 1DJGA 1IRJA 2KOTA 2KDHA 3BUNB 1FPWA 1OZOA 2BKIB 2G2BA 3D10A 4GBAA 1J7QA 2LUCA 2HF5A 1NIWA 1B47A 2L51A 4IL1A 4HRHA 3JTDC 2CT9A 1SK6D 2LM5A 1CM1A 1B9AA 2MLFC 1J7PA 2JNFA 1QIVA 3BOWB 2P6BB 4M2PA 2K7CA 1SY9A 5JJGA 1PRWA 1JF0A 2BL0C 2K7BA 2M1KB 3EKJA 1QS7A 1J1DA 2WORA 4CFQA 2K7DA 1OQPA 1IQ5A 1OE9B 1DGUA 5DKQA 2M3WA 2QACA 2LANA 3FIAA 4ORAB 2JPTA 4A4CA 2JT0A 2KAYA 4C0JA 1K95A 1W7IB 5HYDA 2KHNA 1CDNA 2PMYA 2JQ6A 1QVIZ 2FOTA 2F3YA 2FCDA 3AKAA 3FWCA 4F0ZB 3K21A 2HQWA 2ZN9A 4JPZB 2LUXA 3TDIA 3I5IC 2BECA 1KFXL 1SBJA 1R6PA 1YRUB 3EK8A 3GK4X 3WHTB 1RK9A 1MXEA 2MAZA 1Y0VH 2F2PA 5F6TA 5PALA 1HT9A 2KYFA 2NXQA 1GGZA 2SASA 2GGMA 3BUWB 4I5JA 4PHNA 2LLTA 2CNPA 3SG3A 4PDZA 2BBMA 1QXPA 1ZFSA 2IS9A 2O5GA 2BCAA 4GUKA 1DMOA 4XJKB 2AUCA 3DF0A 2I7AA 3O2PA 2K61A 2L0PA 1H8BA 3CS1A 2WCBA 1M63B 1WLMA 2M8UA 3OX5A 2LMVA 1MWNA 5AFPA 1QVIY 2B1UA 1AP4A 2HETA 4N5XA 2JXLA 1AUIB 1QLSA 5DKNA 1SW8A 1ZACA 3JTDB 2DOQA 3KPXA 5CPVA 3TZ1A 2L50A 2PASA 4I5NB 1LKJA 5I2LA 1TNWA 4CIDA 2BL0B 2JZIA 1KSMA 3I5GC 2WC8A 3PSRA 1IJ6A 2M29A 1IG5A 3GOFA 1NCXA 2M49B 3OHMB 4MRXA 2NCPA 4ICBA 5JOLA 1S3PA 3VRQA 3CR5X 5HKZA 1G33A 1UHKA 4L9MA 5AEQA 2BKHB 4GPLB 1AK8A 4MZKA 1F4OA 1AJ5A 3SG2A 2KGRA 1KCYA 3I5IB 4N1FA 1YUTA 2Y5IA 2K2AA 1ODBA 1F70A 1K9KA 2L5XB 1B7TZ 2JNXA 5FYXA 1NWDA 2H61A 3H4SE 4E68A 1FW4A 5ER5A 4ZCUA 4MLWA 3PATA 4MSPA 5HKYA 4YGBB 3BXKA 4OKHA 4YGCB 3TUYC 1DF0A 3WXAA 1N0YA 1RFJA 1CFDA 2BE4A 4PHMA 1Y1AA 1Y1UA 1RROA 1G8IA 3EK4A 1M45A 1KFUS 2VRGA 1C7VA 2OTGC 5J3XA 1YUUA 1ALWA 1LVCD 4ETOA 2WNDA 1A75A 2K0JA 3RLZA 3LL8B 5CSIA 2CXJA 1Y1XA 3PLFB 3NXAA 3CZTX 5KTYA 4UPGA 1ZUZA 1KK8B 1V1GA 1SMGA 2KGBC 1U5IA 3A8RA 3A4UB 3CR4X 3VROA 3DVJA 1SPYA 1MHOA 1A03A 4BY4A 3I5GB 1OOJA 2KYCA 4Q04A 4WQ2A 3SIBA 4CFRA 3LK1A 2EGDA 1M31A 4GFTA 4XYNA 3VGOA 1EL4A 2M1UA 3LK0A 1LA0A 3HCMA 3NSKA 1MXLC 1OMRA 3KO0A 1BG1A 5KSZA 4ZCVA 1QX2A 2F8PA 3IF7A 2F3ZA 1KFXS 1SRAA 1TRFA 1EJ3A 5HLOA 3TDZA 1F55A 2ZFDA 1CB1A 4GGFA 1DTLA 2NLNA 1EH2A 3PALA 4D1EA 1GGWA 4NDCA 3TUYB 2GV5A 1IGVA 3TS5C 1IQ3A 1X02A 3I5FC 1S6IA 4HRGA 2LMUA 2O60A 4QJ5B 2LLSA 1J55A 3PFVA 1JUOA 1XFZO 5AERA 3GK1A 1J1EA 3LLEA 4I5LB 1QJTA 2AAOA 3NSIA 1E8AA 1GJYA 2KI6D 1QTXA 3DVKA 1DJHA 1WRZA 2OTGB 4YGDB 2NCOA 1CFFA 4BY5A 3CLNA 2M9GA 1IH0A 1PSBA 3LCPC 1TCFA 1XYDA 2A4JA 1CLBA 4ORBB 5D69A 1TNPA 1F4QA 2KI4C 1CKKA 4A4BA 1DGVA 2H61C 2ZRSA 2ZRTA 1SR6C 1TNQA 1B1GA 1M39A 1RECA 1RTP1 1Q80A 3ICBA 2M0RA 2ZKMX 5KU1A 1J7OA 1L7ZA 3F45A 4PE0A 2BCBA 1MR8A 3DF0B 4JWQA 4OV2A 1OSAA 5I8NA 2KQYA 1SCVA 1KK8C 1NCZA 2LLUA 1S5GZ 5HKWA 2CTNA 1JFJA 2BCXA 2LHLA 1PVAA 4FQOA 2LC5A 4C0LA 2EC6C 1JC2A 2R2IA 3E3RA 1B8RA 3OB2B 4NDDA 2JT3A 3ZNIA 1DVIA 1K2HA 1UP5A 2JT8A 3OX6A 5CSNA 3IQQA 1KQVA 4PE4A 5I2OA 1QIWA 2F2OA 1SNLA 1N65A 3DVMA 1RJVA 4N1GA 1F71A 2MJWB 4MBEA 1DJYA 1WRLA 3AAJA 3KHEA 1S6CA 2LVIA 1EXRA 1SL7A 3BYAA 1CFCA 2RGIA 2JULA 2WOSA 3TS5B 5AXIA 2CCMA 1PVBA 1CM4A 3I5FB 4HSZA 1WRKA 1XK4A 4MZJA 3SIAA 2SCPA 1XFXO 4P2YB 3GK2A 2LMTA 2LNKA 4NDBA 4MVFA 1K8UA 4MN0A 1S6JA 4PALA 2KSPA 1DJXA 3O6BA 4M2QA 3SG5A 1NX3A 3CR2A 4M2OA 1TNXA 1CLLA 4GNKB 1QX5B 3EVVA 2E30A 2LVVA 1CDLA 3NSLA 1KWOC 1NCYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OZS A;  2LP2 A;  1KK7 Z;  2KI4 B;  3O78 A;  1QAT A;  2WCE A;  1MUX A;  4MRY A;  4GGF C;  1F54 A;  1JWD A;  1XFV O;  1K9U A;  1SR6 B;  2JTT A;  3AAK A;  1CLM A;  1YX8 A;  3WHU B;  1BR1 B;  3BUX B;  3DVE A;  3WNX B;  1B8C A;  1DF0 B;  4U8D A;  3D0Y A;  2L2E A;  1K93 D;  1YVH A;  1GQM A;  1CDM A;  2L98 A;  1ZMZ A;  1LXF C;  1S26 D;  3VRN A;  4ORC B;  1EG3 A;  4PE1 A;  1B7T Y;  1SL8 A;  1HQV A;  1DJW A;  4HRE E;  2HPS A;  1CNP A;  4I5K A;  4GAO A;  1IJ5 A;  1WDC C;  1XO5 A;  1AHR A;  1F8H A;  1W7J B;  1MQ1 A;  2EC6 B;  2E6W A;  4AQJ A;  1A75 B;  1ZOT B;  1UHJ A;  1D1O A;  3KEV A;  2ZND A;  4WQ3 A;  3CGA A;  1CFP A;  1YR5 A;  3TDU A;  1K96 A;  1OMD A;  1LIN A;  1KFU L;  3BOW A;  1U5I B;  1UUS A;  1BT6 A;  1TIZ A;  2MBX A;  5G08 A;  4PHK A;  2BE6 A;  4DUQ A;  1KQM C;  2MRD A;  1BF5 A;  2L4I A;  2LP3 A;  1YX7 A;  1IKU A;  2AMI A;  1A2X A;  1BMO A;  1XFW O;  1DT7 B;  4DS7 A;  2KBI A;  1PUL A;  2OS8 C;  1IWQ A;  2KAX A;  2K8M B;  4QJ3 B;  2JXC A;  2LAP A;  2PVB A;  1SYM A;  1YVL A;  1UHH A;  3HX4 A;  2FCE A;  5GQQ C;  2K2F A;  4OR9 B;  2G9B A;  1A4P A;  1V1F A;  1KWO B;  3PM8 A;  2MA2 A;  1R2U A;  1M46 A;  1FBV A;  2JRF A;  1FI5 A;  2KI6 C;  1XFY O;  2GGZ A;  2LVK A;  4YRU A;  3IQO A;  1FF1 A;  1WY9 A;  2LVJ A;  5ER4 X;  1DJZ A;  1C7W A;  1PK0 D;  1XFU O;  2PRU A;  1Y6W A;  1JF2 A;  1LA3 A;  1UWO A;  3BQ3 A;  3M0W A;  3FS7 A;  3MSE B;  1NSH A;  1KSO A;  4XJK A;  2BBN A;  1QX7 A;  1QLK A;  1XK4 C;  1SL9 A;  1QV0 A;  1J7R A;  2KFG A;  1S1E A;  4R1E A;  2ZNE A;  1NYA A;  1FI6 A;  4JQ0 D;  1UHN A;  1WDC B;  1NX2 A;  1CDP A;  2ISD A;  2LV7 A;  2WCF A;  3SG4 A;  3SG6 A;  1B8L A;  1SCM C;  2JWW A;  4MEW A;  1L2O C;  3QRX A;  3PN7 C;  5DKR A;  1PAL A;  2K7O A;  3I5H C;  2TN4 A;  1UHI A;  3BUM B;  1NP8 A;  1XA5 A;  4FTG A;  2KAV A;  2M7L A;  2L4H A;  3JVT C;  1OMV A;  2Q4U A;  1SKT A;  4PHJ A;  3VRP A;  4USL A;  5K89 A;  5I2Q A;  3SJS A;  4YI9 A;  1S36 A;  1YTZ C;  2LCP A;  1KQM B;  1BOD A;  1WLZ A;  2JOJ A;  4P5O E;  4YBH B;  3ZWH A;  1BJF A;  1QAS A;  2KBM A;  1C07 A;  1NUB A;  1EG4 A;  2OPO A;  3OB1 B;  4YGA A;  2PAL A;  3C1V A;  3FWB A;  2OS8 B;  4MZL A;  1UUR A;  1NPQ A;  3EVR A;  4OVN F;  4PCW A;  1CTR A;  1NX0 A;  2Y1M A;  2Q91 A;  4AOM A;  1BU3 A;  5CSJ A;  3EKH A;  1CMG A;  2LE9 B;  2I94 A;  2F33 A;  3DD4 A;  2Y1N A;  3CTN A;  4PE7 A;  2JC2 A;  2D8N A;  3AKB A;  1DJI A;  1S5G Y;  4CLN A;  4TNC A;  5CSF A;  4GGN A;  1K90 D;  1K9P A;  1BOC A;  1JSA A;  2COL B;  1RWY A;  1G4Y R;  2M97 A;  2V53 A;  2FJU B;  2MHH A;  1NX1 A;  2KFH A;  1AVS A;  3VRR A;  1XVJ A;  3EVU A;  3O4Y A;  4QJ4 B;  2M7N A;  5IBW A;  2JU0 A;  2I2R E;  3CWG A;  4WRI A;  2ZN8 A;  3KF9 A;  2I18 A;  1CMF A;  1AJ4 A;  1N2D A;  1TN4 A;  2MLE C;  1A29 A;  1PSR A;  1BR4 B;  1TCO B;  2JTZ A;  2KNE A;  2KQ6 A;  1SCM B;  3BUO B;  1L2O B;  3PN7 B;  2KFF A;  3SG7 A;  2CBL A;  3NSO A;  2LHI A;  3I5H B;  1H4B A;  2HQ8 A;  2QPT A;  2NZ0 A;  4NQG A;  1VRK A;  4OCI A;  4DCK A;  1B4C A;  5HLV A;  1ALV A;  1YUS A;  4YI8 A;  3JVT B;  2EHB A;  3EK7 A;  5TNC A;  1TTX A;  3RM1 A;  4CPV A;  5BPJ A;  4DRW A;  1K94 A;  3D0Y B;  2PSR A;  1TOP A;  4AQI A;  1BLQ A;  5D7F A;  3OP0 A;  4YGE B;  1MF8 B;  4C0K A;  1JFK A;  2H2K A;  4DIR A;  1KK7 Y;  5AAN A;  1QV1 A;  5B8I B;  1YRT B;  2Y4Q A;  1YUR A;  1JBA A;  1DJG A;  1IRJ A;  2KOT A;  2KDH A;  3BUN B;  1FPW A;  1OZO A;  2BKI B;  2G2B A;  3D10 A;  4GBA A;  1J7Q A;  2LUC A;  2HF5 A;  1NIW A;  1B47 A;  2L51 A;  4IL1 A;  4HRH A;  3JTD C;  2CT9 A;  1SK6 D;  2LM5 A;  1CM1 A;  1B9A A;  2MLF C;  1J7P A;  2JNF A;  1QIV A;  3BOW B;  2P6B B;  4M2P A;  2K7C A;  1SY9 A;  5JJG A;  1PRW A;  1JF0 A;  2BL0 C;  2K7B A;  2M1K B;  3EKJ A;  1QS7 A;  1J1D A;  2WOR A;  4CFQ A;  2K7D A;  1OQP A;  1IQ5 A;  1OE9 B;  1DGU A;  5DKQ A;  2M3W A;  2QAC A;  2LAN A;  3FIA A;  4ORA B;  2JPT A;  4A4C A;  2JT0 A;  2KAY A;  4C0J A;  1K95 A;  1W7I B;  5HYD A;  2KHN A;  1CDN A;  2PMY A;  2JQ6 A;  1QVI Z;  2FOT A;  2F3Y A;  2FCD A;  3AKA A;  3FWC A;  4F0Z B;  3K21 A;  2HQW A;  2ZN9 A;  4JPZ B;  2LUX A;  3TDI A;  3I5I C;  2BEC A;  1KFX L;  1SBJ A;  1R6P A;  1YRU B;  3EK8 A;  3GK4 X;  3WHT B;  1RK9 A;  1MXE A;  2MAZ A;  1Y0V H;  2F2P A;  5F6T A;  5PAL A;  1HT9 A;  2KYF A;  2NXQ A;  1GGZ A;  2SAS A;  2GGM A;  3BUW B;  4I5J A;  4PHN A;  2LLT A;  2CNP A;  3SG3 A;  4PDZ A;  2BBM A;  1QXP A;  1ZFS A;  2IS9 A;  2O5G A;  2BCA A;  4GUK A;  1DMO A;  4XJK B;  2AUC A;  3DF0 A;  2I7A A;  3O2P A;  2K61 A;  2L0P A;  1H8B A;  3CS1 A;  2WCB A;  1M63 B;  1WLM A;  2M8U A;  3OX5 A;  2LMV A;  1MWN A;  5AFP A;  1QVI Y;  2B1U A;  1AP4 A;  2HET A;  4N5X A;  2JXL A;  1AUI B;  1QLS A;  5DKN A;  1SW8 A;  1ZAC A;  3JTD B;  2DOQ A;  3KPX A;  5CPV A;  3TZ1 A;  2L50 A;  2PAS A;  4I5N B;  1LKJ A;  5I2L A;  1TNW A;  4CID A;  2BL0 B;  2JZI A;  1KSM A;  3I5G C;  2WC8 A;  3PSR A;  1IJ6 A;  2M29 A;  1IG5 A;  3GOF A;  1NCX A;  2M49 B;  3OHM B;  4MRX A;  2NCP A;  4ICB A;  5JOL A;  1S3P A;  3VRQ A;  3CR5 X;  5HKZ A;  1G33 A;  1UHK A;  4L9M A;  5AEQ A;  2BKH B;  4GPL B;  1AK8 A;  4MZK A;  1F4O A;  1AJ5 A;  3SG2 A;  2KGR A;  1KCY A;  3I5I B;  4N1F A;  1YUT A;  2Y5I A;  2K2A A;  1ODB A;  1F70 A;  1K9K A;  2L5X B;  1B7T Z;  2JNX A;  5FYX A;  1NWD A;  2H61 A;  3H4S E;  4E68 A;  1FW4 A;  5ER5 A;  4ZCU A;  4MLW A;  3PAT A;  4MSP A;  5HKY A;  4YGB B;  3BXK A;  4OKH A;  4YGC B;  3TUY C;  1DF0 A;  3WXA A;  1N0Y A;  1RFJ A;  1CFD A;  2BE4 A;  4PHM A;  1Y1A A;  1Y1U A;  1RRO A;  1G8I A;  3EK4 A;  1M45 A;  1KFU S;  2VRG A;  1C7V A;  2OTG C;  5J3X A;  1YUU A;  1ALW A;  1LVC D;  4ETO A;  2WND A;  1A75 A;  2K0J A;  3RLZ A;  3LL8 B;  5CSI A;  2CXJ A;  1Y1X A;  3PLF B;  3NXA A;  3CZT X;  5KTY A;  4UPG A;  1ZUZ A;  1KK8 B;  1V1G A;  1SMG A;  2KGB C;  1U5I A;  3A8R A;  3A4U B;  3CR4 X;  3VRO A;  3DVJ A;  1SPY A;  1MHO A;  1A03 A;  4BY4 A;  3I5G B;  1OOJ A;  2KYC A;  4Q04 A;  4WQ2 A;  3SIB A;  4CFR A;  3LK1 A;  2EGD A;  1M31 A;  4GFT A;  4XYN A;  3VGO A;  1EL4 A;  2M1U A;  3LK0 A;  1LA0 A;  3HCM A;  3NSK A;  1MXL C;  1OMR A;  3KO0 A;  1BG1 A;  5KSZ A;  4ZCV A;  1QX2 A;  2F8P A;  3IF7 A;  2F3Z A;  1KFX S;  1SRA A;  1TRF A;  1EJ3 A;  5HLO A;  3TDZ A;  1F55 A;  2ZFD A;  1CB1 A;  4GGF A;  1DTL A;  2NLN A;  1EH2 A;  3PAL A;  4D1E A;  1GGW A;  4NDC A;  3TUY B;  2GV5 A;  1IGV A;  3TS5 C;  1IQ3 A;  1X02 A;  3I5F C;  1S6I A;  4HRG A;  2LMU A;  2O60 A;  4QJ5 B;  2LLS A;  1J55 A;  3PFV A;  1JUO A;  1XFZ O;  5AER A;  3GK1 A;  1J1E A;  3LLE A;  4I5L B;  1QJT A;  2AAO A;  3NSI A;  1E8A A;  1GJY A;  2KI6 D;  1QTX A;  3DVK A;  1DJH A;  1WRZ A;  2OTG B;  4YGD B;  2NCO A;  1CFF A;  4BY5 A;  3CLN A;  2M9G A;  1IH0 A;  1PSB A;  3LCP C;  1TCF A;  1XYD A;  2A4J A;  1CLB A;  4ORB B;  5D69 A;  1TNP A;  1F4Q A;  2KI4 C;  1CKK A;  4A4B A;  1DGV A;  2H61 C;  2ZRS A;  2ZRT A;  1SR6 C;  1TNQ A;  1B1G A;  1M39 A;  1REC A;  1RTP 1;  1Q80 A;  3ICB A;  2M0R A;  2ZKM X;  5KU1 A;  1J7O A;  1L7Z A;  3F45 A;  4PE0 A;  2BCB A;  1MR8 A;  3DF0 B;  4JWQ A;  4OV2 A;  1OSA A;  5I8N A;  2KQY A;  1SCV A;  1KK8 C;  1NCZ A;  2LLU A;  1S5G Z;  5HKW A;  2CTN A;  1JFJ A;  2BCX A;  2LHL A;  1PVA A;  4FQO A;  2LC5 A;  4C0L A;  2EC6 C;  1JC2 A;  2R2I A;  3E3R A;  1B8R A;  3OB2 B;  4NDD A;  2JT3 A;  3ZNI A;  1DVI A;  1K2H A;  1UP5 A;  2JT8 A;  3OX6 A;  5CSN A;  3IQQ A;  1KQV A;  4PE4 A;  5I2O A;  1QIW A;  2F2O A;  1SNL A;  1N65 A;  3DVM A;  1RJV A;  4N1G A;  1F71 A;  2MJW B;  4MBE A;  1DJY A;  1WRL A;  3AAJ A;  3KHE A;  1S6C A;  2LVI A;  1EXR A;  1SL7 A;  3BYA A;  1CFC A;  2RGI A;  2JUL A;  2WOS A;  3TS5 B;  5AXI A;  2CCM A;  1PVB A;  1CM4 A;  3I5F B;  4HSZ A;  1WRK A;  1XK4 A;  4MZJ A;  3SIA A;  2SCP A;  1XFX O;  4P2Y B;  3GK2 A;  2LMT A;  2LNK A;  4NDB A;  4MVF A;  1K8U A;  4MN0 A;  1S6J A;  4PAL A;  2KSP A;  1DJX A;  3O6B A;  4M2Q A;  3SG5 A;  1NX3 A;  3CR2 A;  4M2O A;  1TNX A;  1CLL A;  4GNK B;  1QX5 B;  3EVV A;  2E30 A;  2LVV A;  1CDL A;  3NSL A;  1KWO C;  1NCY A; 
#chains in the Genus database with same CATH topology
 1OZS A;  2LP2 A;  1KK7 Z;  2KI4 B;  3O78 A;  1QAT A;  2WCE A;  1MUX A;  4MRY A;  4GGF C;  1F54 A;  1OW4 A;  1XFV O;  1JWD A;  1K9U A;  1SR6 B;  2JTT A;  3AAK A;  1CLM A;  1YX8 A;  3WHU B;  1BR1 B;  3BUX B;  3O4X A;  3DVE A;  3WNX B;  5DIC A;  1B8C A;  1DF0 B;  4U8D A;  3D0Y A;  2L2E A;  1K93 D;  1YVH A;  1GQM A;  3CDN A;  1CDM A;  2L98 A;  1ZMZ A;  1LXF C;  3D78 A;  1S26 D;  3VRN A;  4ORC B;  1EG3 A;  3L4L A;  4PE1 A;  1B7T Y;  1SL8 A;  1HQV A;  1DJW A;  4HRE E;  2HPS A;  5EL2 A;  1CNP A;  4I5K A;  4GAO A;  1IJ5 A;  1WDC C;  1XO5 A;  1AHR A;  1F8H A;  1W7J B;  1MQ1 A;  2EC6 B;  2E6W A;  4AQJ A;  1A75 B;  1ZOT B;  1UHJ A;  1D1O A;  3DXL A;  3CAB A;  2ZND A;  3KEV A;  3CGA A;  4WQ3 A;  2JPO A;  1C3Y A;  1CFP A;  1YR5 A;  3TDU A;  1K96 A;  1OMD A;  3D75 A;  1LIN A;  2QEB A;  1KFU L;  3BOW A;  1U5I B;  1UUS A;  1BT6 A;  1TIZ A;  2MBX A;  5G08 A;  4PHK A;  2BE6 A;  4DUQ A;  1KQM C;  2MRD A;  1BF5 A;  2L4I A;  2LP3 A;  1YX7 A;  1IKU A;  2AMI A;  1A2X A;  1BMO A;  1XFW O;  1DT7 B;  4DS7 A;  2KBI A;  1PUL A;  1SSE B;  2OS8 C;  1IWQ A;  2KAX A;  2K8M B;  4QJ3 B;  2JXC A;  2LAP A;  2PVB A;  1SYM A;  1YVL A;  1UHH A;  3HX4 A;  2FCE A;  3UNW A;  5GQQ C;  2K2F A;  4OR9 B;  2G9B A;  1A4P A;  1V1F A;  1KWO B;  3PM8 A;  2MA2 A;  1R2U A;  1M46 A;  1FBV A;  2JRF A;  1FI5 A;  2KI6 C;  1XFY O;  2GGZ A;  2LVK A;  4YRU A;  3IQO A;  1FF1 A;  1WY9 A;  2LVJ A;  5ER4 X;  1DJZ A;  3D76 A;  1C7W A;  1PK0 D;  1XFU O;  2PRU A;  1Y6W A;  1JF2 A;  1LA3 A;  1UWO A;  3BQ3 A;  2P70 A;  1QWV A;  3FS7 A;  3M0W A;  1NSH A;  1KSO A;  3MSE B;  4XJK A;  3D73 A;  2BBN A;  1QX7 A;  1QLK A;  1XK4 C;  1SL9 A;  2WC6 A;  1QV0 A;  1J7R A;  2KFG A;  1S1E A;  4R1E A;  2ZNE A;  1NYA A;  3Q8I A;  1FI6 A;  4JQ0 D;  1UHN A;  1WDC B;  1NX2 A;  1CDP A;  2ISD A;  2LV7 A;  2WCF A;  3SG4 A;  3SG6 A;  1B8L A;  1SCM C;  2JWW A;  4MEW A;  1L2O C;  3QRX A;  2P71 A;  3PN7 C;  5DKR A;  1PAL A;  2K7O A;  3I5H C;  2TN4 A;  1UHI A;  3BUM B;  1NP8 A;  1XA5 A;  4FTG A;  2KAV A;  2M7L A;  4OZD A;  2L4H A;  3JVT C;  5D3O A;  1OMV A;  2Q4U A;  3BFA A;  1SKT A;  4PHJ A;  3VRP A;  4USL A;  5K89 A;  5I2Q A;  3SJS A;  4YI9 A;  1S36 A;  1YTZ C;  2LCP A;  1KQM B;  1BOD A;  1WLZ A;  2JOJ A;  4P5O E;  4YBH B;  3BFB A;  3ZWH A;  1BJF A;  1QAS A;  2KBM A;  3RZS A;  1C07 A;  1NUB A;  1EG4 A;  2OPO A;  3OB1 B;  4YGA A;  2GTE A;  2PAL A;  3C1V A;  3FWB A;  3DZT A;  2OS8 B;  3V2L A;  1T14 A;  4MZL A;  3B7A A;  1UUR A;  1NPQ A;  3EVR A;  4OVN F;  4PCW A;  1CTR A;  1NX0 A;  2Y1M A;  1DEK A;  2Q91 A;  4AOM A;  1BU3 A;  5CSJ A;  3EKH A;  3EG5 B;  1CMG A;  2LE9 B;  2I94 A;  2F33 A;  1ORG A;  3DD4 A;  2Y1N A;  3S0F A;  3CTN A;  4PE7 A;  2JC2 A;  2D8N A;  3AKB A;  1DJI A;  1S5G Y;  1XFR A;  3SS4 A;  4F7F A;  4CLN A;  4TNC A;  5CSF A;  4GGN A;  1K90 D;  1K9P A;  1BOC A;  1JSA A;  2COL B;  4IJ7 A;  1RWY A;  1G4Y R;  1OOH A;  2M97 A;  2FJU B;  2MHH A;  2V53 A;  1NX1 A;  5I94 A;  2KFH A;  3CZ0 A;  1AVS A;  3VRR A;  1XVJ A;  3EVU A;  3O4Y A;  4QJ4 B;  3PM2 A;  1Z4H A;  2M7N A;  2WCK A;  5IBW A;  2JU0 A;  3IVT A;  2I2R E;  3CWG A;  4WRI A;  2ZN8 A;  3KF9 A;  2I18 A;  1CMF A;  3VB1 A;  1AJ4 A;  1N2D A;  2KLD A;  1TN4 A;  2MLE C;  2H8V A;  1A29 A;  1PSR A;  1BR4 B;  1TCO B;  2JTZ A;  2KNE A;  2KQ6 A;  1SCM B;  3BUO B;  1L2O B;  3PN7 B;  2KFF A;  3SG7 A;  2CBL A;  3NSO A;  2LHI A;  3I5H B;  1H4B A;  2HQ8 A;  2QPT A;  2NZ0 A;  4NQG A;  1VRK A;  4OCI A;  4DCK A;  1B4C A;  5HLV A;  1ALV A;  1YUS A;  4YI8 A;  3JVT B;  2QEO A;  2EHB A;  3EK7 A;  5TNC A;  3R1O A;  1TTX A;  3RM1 A;  2PQL A;  4CPV A;  5BPJ A;  4DRW A;  1K94 A;  1P28 A;  3D0Y B;  2PSR A;  1TOP A;  3S0D A;  4AQI A;  1BLQ A;  5D7F A;  3OP0 A;  4YGE B;  1MF8 B;  4C0K A;  1JFK A;  2H2K A;  4DIR A;  1KK7 Y;  5AAN A;  1QV1 A;  5B8I B;  1YRT B;  2Y4Q A;  1C3Z A;  3B6X A;  1YUR A;  1JBA A;  3N7H A;  1DJG A;  1IRJ A;  2BNX A;  2KDH A;  2KOT A;  3BUN B;  5FI6 A;  1FPW A;  1OZO A;  2BKI B;  2G2B A;  3D10 A;  4GBA A;  1J7Q A;  2LUC A;  2HF5 A;  1NIW A;  1B47 A;  2L51 A;  3R1V A;  4HRH A;  4IL1 A;  3JTD C;  3UO9 A;  1OOG A;  2CT9 A;  3B88 A;  1SK6 D;  2LM5 A;  1CM1 A;  1B9A A;  2MLF C;  1J7P A;  2JNF A;  3QME A;  4JD9 A;  1QIV A;  3BOW B;  2P6B B;  4M2P A;  2K7C A;  1SY9 A;  5JJG A;  1PRW A;  1JF0 A;  3B86 A;  2BL0 C;  2K7B A;  2M1K B;  3EKJ A;  1QS7 A;  1J1D A;  2WOR A;  4CFQ A;  2K7D A;  1OQP A;  2KLE A;  1IQ5 A;  1OE9 B;  5HL1 A;  3FE8 A;  1DGU A;  5DKQ A;  2M3W A;  2QAC A;  2LAN A;  3FIA A;  4ORA B;  2JPT A;  4A4C A;  2JT0 A;  2KAY A;  4C0J A;  1K95 A;  1W9Z A;  1W7I B;  5HYD A;  1IIO A;  2KHN A;  1CDN A;  2PMY A;  2JQ6 A;  1QVI Z;  2FOT A;  2F3Y A;  2FCD A;  3AKA A;  3B87 A;  3FWC A;  4F0Z B;  3K21 A;  2HQW A;  2ZN9 A;  4JPZ B;  2LUX A;  3TDI A;  3I5I C;  1KFX L;  1SBJ A;  1YRU B;  1R6P A;  2BEC A;  3EK8 A;  3GK4 X;  3WHT B;  1LS8 A;  1RK9 A;  1MXE A;  2MAZ A;  1Y0V H;  2F2P A;  5F6T A;  5FI2 A;  5PAL A;  2L2C A;  3OGN A;  1HT9 A;  2KYF A;  2NXQ A;  1GGZ A;  2SAS A;  2GGM A;  3BUW B;  4I5J A;  4PHN A;  2LLT A;  2CNP A;  3SG3 A;  4PDZ A;  2BBM A;  1QXP A;  1ZFS A;  2IS9 A;  2O5G A;  1DQE A;  2BCA A;  4FQT A;  4GUK A;  1DMO A;  4XJK B;  2AUC A;  3DYE A;  3DF0 A;  2I7A A;  3O2P A;  2K61 A;  2L0P A;  2PYQ A;  1TUJ A;  1H8B A;  3CS1 A;  2WCB A;  1M63 B;  1WLM A;  2M8U A;  3OX5 A;  2LMV A;  1MWN A;  5AFP A;  1QVI Y;  2B1U A;  1AP4 A;  2HET A;  4N5X A;  4KYN A;  2JXL A;  1AUI B;  1QLS A;  5DKN A;  1SW8 A;  3K1E A;  1OOF A;  1ZAC A;  2YGU A;  2DOQ A;  3JTD B;  3KPX A;  5CPV A;  3TZ1 A;  2L50 A;  2PAS A;  4I5N B;  1LKJ A;  1DEL A;  5I2L A;  1TNW A;  4CID A;  3D74 A;  2BL0 B;  2JZI A;  2FJY A;  1KSM A;  3I5G C;  2WC8 A;  3PSR A;  1IJ6 A;  2M29 A;  1IG5 A;  3GOF A;  1NCX A;  2M49 B;  3OHM B;  3R1P A;  5FI7 A;  4MRX A;  2NCP A;  4ICB A;  3CZ1 A;  5JOL A;  1S3P A;  3VRQ A;  3CR5 X;  5HKZ A;  3BJH A;  1G33 A;  1UHK A;  4L9M A;  5AEQ A;  4JKT A;  2BKH B;  4GPL B;  1AK8 A;  4MZK A;  1F4O A;  1AJ5 A;  3SG2 A;  2WCH A;  2KGR A;  1KCY A;  3I5I B;  4N1F A;  1YUT A;  2Y5I A;  3SS3 A;  2K2A A;  1ODB A;  1F70 A;  1K9K A;  2L5X B;  1B7T Z;  3CYZ A;  2JNX A;  5FYX A;  1NWD A;  2H61 A;  3H4S E;  4E68 A;  1FW4 A;  2ERB A;  3CZ2 A;  2QEH A;  5ER5 A;  4ZCU A;  4MLW A;  3PAT A;  4MSP A;  5HKY A;  4YGB B;  3BXK A;  4OKH A;  4YGC B;  2WCL A;  3TUY C;  1DF0 A;  1TUZ A;  3WXA A;  1N0Y A;  1RFJ A;  3BFH A;  1CFD A;  2BE4 A;  1DC1 A;  4PHM A;  1Y1A A;  1Y1U A;  1RRO A;  4INW A;  1G8I A;  3EK4 A;  3L47 A;  1M45 A;  1KFU S;  2VRG A;  1C7V A;  2OTG C;  5J3X A;  1YUU A;  1ALW A;  1LVC D;  4ETO A;  2WND A;  1A75 A;  2K0J A;  3RLZ A;  3LL8 B;  5CSI A;  2WC5 A;  2CXJ A;  1Y1X A;  3PLF B;  3NXA A;  3CZT X;  5KTY A;  4UPG A;  1ZUZ A;  3NHI A;  1KK8 B;  1V1G A;  1SMG A;  2KGB C;  1U5I A;  3A8R A;  3A4U B;  2K60 A;  3CR4 X;  3VRO A;  3DVJ A;  1GM0 A;  1SPY A;  1MHO A;  1A03 A;  4BY4 A;  3I5G B;  1OOJ A;  2KYC A;  4Q04 A;  4WQ2 A;  3SIB A;  4CFR A;  3LK1 A;  2EGD A;  2KPH A;  1M31 A;  4GFT A;  4XYN A;  3VGO A;  1EL4 A;  2M1U A;  3LK0 A;  1LA0 A;  3HCM A;  3NSK A;  1MXL C;  1OMR A;  3KO0 A;  2BAP A;  1BG1 A;  5KSZ A;  4ZCV A;  1QX2 A;  2F8P A;  3IF7 A;  2F3Z A;  1KFX S;  2WCM A;  3PJI A;  1SRA A;  1TRF A;  1EJ3 A;  5HLO A;  3TDZ A;  1F55 A;  2ZFD A;  1CB1 A;  4GGF A;  1DTL A;  2NLN A;  1EH2 A;  3PAL A;  4D1E A;  1GGW A;  4NDC A;  3TUY B;  2GV5 A;  3OBV A;  1IGV A;  3S0G A;  3TS5 C;  1IQ3 A;  1X02 A;  3I5F C;  1S6I A;  4HRG A;  2LMU A;  2O60 A;  4QJ5 B;  2LLS A;  1J55 A;  4INX A;  3PFV A;  1JUO A;  1XFZ O;  5AER A;  3GK1 A;  1J1E A;  3LLE A;  4I5L B;  1QJT A;  2AAO A;  3NSI A;  1E8A A;  1GJY A;  2KI6 D;  1QTX A;  3DVK A;  1DJH A;  1WRZ A;  3NHT A;  2OTG B;  4YGD B;  2NCO A;  1CFF A;  1Z2C B;  4BY5 A;  3CLN A;  2M9G A;  1IH0 A;  1PSB A;  3LCP C;  1TCF A;  1XYD A;  2A4J A;  1CLB A;  4ORB B;  5D69 A;  1TNP A;  1F4Q A;  2KI4 C;  1CKK A;  4A4B A;  1DGV A;  2H61 C;  2ZRS A;  2ZRT A;  1SR6 C;  1TNQ A;  1B1G A;  1M39 A;  1REC A;  1RTP 1;  1Q80 A;  3ICB A;  2M0R A;  2ZKM X;  5KU1 A;  1J7O A;  3NGV A;  1L7Z A;  1TWO A;  3F45 A;  4PE0 A;  2BCB A;  1MR8 A;  3DF0 B;  4JWQ A;  4OV2 A;  1OSA A;  4PT1 A;  3FE9 A;  5I8N A;  2KQY A;  1SCV A;  1KK8 C;  1NCZ A;  2LLU A;  1S5G Z;  5HKW A;  2CTN A;  2QDI A;  1JFJ A;  2BCX A;  2LHL A;  2L5Y A;  3L4A A;  1PVA A;  4FQO A;  2LC5 A;  4C0L A;  2EC6 C;  3SS5 A;  1JC2 A;  2R2I A;  3E3R A;  1B8R A;  3OB2 B;  4NDD A;  2JT3 A;  2WCJ A;  3ZNI A;  1DVI A;  1K2H A;  1UP5 A;  2JT8 A;  3OX6 A;  5CSN A;  3S0E A;  3IQQ A;  1KQV A;  4PE4 A;  5I2O A;  1QIW A;  2F2O A;  1SNL A;  1N65 A;  3DVM A;  1RJV A;  4N1G A;  1F71 A;  2MJW B;  4MBE A;  1DJY A;  1WRL A;  3AAJ A;  3KHE A;  1S6C A;  2LVI A;  1EXR A;  1SL7 A;  3BYA A;  3FE6 A;  3R72 A;  1CFC A;  2RGI A;  2JUL A;  3D77 A;  2WOS A;  3TS5 B;  3DY9 A;  5AXI A;  2CCM A;  1PVB A;  1CM4 A;  3I5F B;  4HSZ A;  1WRK A;  1XK4 A;  4MZJ A;  3SIA A;  1OOI X;  2SCP A;  1XFX O;  4P2Y B;  3GK2 A;  2LMT A;  2LNK A;  4NDB A;  4MVF A;  1K8U A;  2QEV A;  4MN0 A;  1S6J A;  4PAL A;  2KSP A;  1DJX A;  3O6B A;  4M2Q A;  3SG5 A;  1NX3 A;  3CR2 A;  4M2O A;  3S0A A;  1TNX A;  1CLL A;  4GNK B;  1QX5 B;  3EVV A;  2E30 A;  2LVV A;  1CDL A;  3NSL A;  1KWO C;  3S0B A;  1NCY A; 
#chains in the Genus database with same CATH homology
 1OZS A;  2LP2 A;  1KK7 Z;  2KI4 B;  3O78 A;  1QAT A;  2WCE A;  1MUX A;  4MRY A;  4GGF C;  1F54 A;  1JWD A;  1XFV O;  1K9U A;  1SR6 B;  2JTT A;  3AAK A;  1CLM A;  1YX8 A;  3WHU B;  1BR1 B;  3BUX B;  3DVE A;  3WNX B;  1B8C A;  1DF0 B;  4U8D A;  3D0Y A;  2L2E A;  1K93 D;  1YVH A;  1GQM A;  1CDM A;  2L98 A;  1ZMZ A;  1LXF C;  1S26 D;  3VRN A;  4ORC B;  1EG3 A;  4PE1 A;  1B7T Y;  1SL8 A;  1HQV A;  1DJW A;  4HRE E;  2HPS A;  1CNP A;  4I5K A;  4GAO A;  1IJ5 A;  1WDC C;  1XO5 A;  1AHR A;  1F8H A;  1W7J B;  1MQ1 A;  2EC6 B;  2E6W A;  4AQJ A;  1A75 B;  1ZOT B;  1UHJ A;  1D1O A;  3KEV A;  2ZND A;  4WQ3 A;  3CGA A;  1CFP A;  1YR5 A;  3TDU A;  1K96 A;  1OMD A;  1LIN A;  1KFU L;  3BOW A;  1U5I B;  1UUS A;  1BT6 A;  1TIZ A;  2MBX A;  5G08 A;  4PHK A;  2BE6 A;  4DUQ A;  1KQM C;  2MRD A;  1BF5 A;  2L4I A;  2LP3 A;  1YX7 A;  1IKU A;  2AMI A;  1A2X A;  1BMO A;  1XFW O;  1DT7 B;  4DS7 A;  2KBI A;  1PUL A;  2OS8 C;  1IWQ A;  2KAX A;  2K8M B;  4QJ3 B;  2JXC A;  2LAP A;  2PVB A;  1SYM A;  1YVL A;  1UHH A;  3HX4 A;  2FCE A;  5GQQ C;  2K2F A;  4OR9 B;  2G9B A;  1A4P A;  1V1F A;  1KWO B;  3PM8 A;  2MA2 A;  1R2U A;  1M46 A;  1FBV A;  2JRF A;  1FI5 A;  2KI6 C;  1XFY O;  2GGZ A;  2LVK A;  4YRU A;  3IQO A;  1FF1 A;  1WY9 A;  2LVJ A;  5ER4 X;  1DJZ A;  1C7W A;  1PK0 D;  1XFU O;  2PRU A;  1Y6W A;  1JF2 A;  1LA3 A;  1UWO A;  3BQ3 A;  3M0W A;  3FS7 A;  3MSE B;  1NSH A;  1KSO A;  4XJK A;  2BBN A;  1QX7 A;  1QLK A;  1XK4 C;  1SL9 A;  1QV0 A;  1J7R A;  2KFG A;  1S1E A;  4R1E A;  2ZNE A;  1NYA A;  1FI6 A;  4JQ0 D;  1UHN A;  1WDC B;  1NX2 A;  1CDP A;  2ISD A;  2LV7 A;  2WCF A;  3SG4 A;  3SG6 A;  1B8L A;  1SCM C;  2JWW A;  4MEW A;  1L2O C;  3QRX A;  3PN7 C;  5DKR A;  1PAL A;  2K7O A;  3I5H C;  2TN4 A;  1UHI A;  3BUM B;  1NP8 A;  1XA5 A;  4FTG A;  2KAV A;  2M7L A;  2L4H A;  3JVT C;  1OMV A;  2Q4U A;  1SKT A;  4PHJ A;  3VRP A;  4USL A;  5K89 A;  5I2Q A;  3SJS A;  4YI9 A;  1S36 A;  1YTZ C;  2LCP A;  1KQM B;  1BOD A;  1WLZ A;  2JOJ A;  4P5O E;  4YBH B;  3ZWH A;  1BJF A;  1QAS A;  2KBM A;  1C07 A;  1NUB A;  1EG4 A;  2OPO A;  3OB1 B;  4YGA A;  2PAL A;  3C1V A;  3FWB A;  2OS8 B;  4MZL A;  1UUR A;  1NPQ A;  3EVR A;  4OVN F;  4PCW A;  1CTR A;  1NX0 A;  2Y1M A;  2Q91 A;  4AOM A;  1BU3 A;  5CSJ A;  3EKH A;  1CMG A;  2LE9 B;  2I94 A;  2F33 A;  3DD4 A;  2Y1N A;  3CTN A;  4PE7 A;  2JC2 A;  2D8N A;  3AKB A;  1DJI A;  1S5G Y;  4CLN A;  4TNC A;  5CSF A;  4GGN A;  1K90 D;  1K9P A;  1BOC A;  1JSA A;  2COL B;  1RWY A;  1G4Y R;  2M97 A;  2V53 A;  2FJU B;  2MHH A;  1NX1 A;  2KFH A;  1AVS A;  3VRR A;  1XVJ A;  3EVU A;  3O4Y A;  4QJ4 B;  2M7N A;  5IBW A;  2JU0 A;  2I2R E;  3CWG A;  4WRI A;  2ZN8 A;  3KF9 A;  2I18 A;  1CMF A;  1AJ4 A;  1N2D A;  1TN4 A;  2MLE C;  1A29 A;  1PSR A;  1BR4 B;  1TCO B;  2JTZ A;  2KNE A;  2KQ6 A;  1SCM B;  3BUO B;  1L2O B;  3PN7 B;  2KFF A;  3SG7 A;  2CBL A;  3NSO A;  2LHI A;  3I5H B;  1H4B A;  2HQ8 A;  2QPT A;  2NZ0 A;  4NQG A;  1VRK A;  4OCI A;  4DCK A;  1B4C A;  5HLV A;  1ALV A;  1YUS A;  4YI8 A;  3JVT B;  2EHB A;  3EK7 A;  5TNC A;  1TTX A;  3RM1 A;  4CPV A;  5BPJ A;  4DRW A;  1K94 A;  3D0Y B;  2PSR A;  1TOP A;  4AQI A;  1BLQ A;  5D7F A;  3OP0 A;  4YGE B;  1MF8 B;  4C0K A;  1JFK A;  2H2K A;  4DIR A;  1KK7 Y;  5AAN A;  1QV1 A;  5B8I B;  1YRT B;  2Y4Q A;  1YUR A;  1JBA A;  1DJG A;  1IRJ A;  2KOT A;  2KDH A;  3BUN B;  1FPW A;  1OZO A;  2BKI B;  2G2B A;  3D10 A;  4GBA A;  1J7Q A;  2LUC A;  2HF5 A;  1NIW A;  1B47 A;  2L51 A;  4IL1 A;  4HRH A;  3JTD C;  2CT9 A;  1SK6 D;  2LM5 A;  1CM1 A;  1B9A A;  2MLF C;  1J7P A;  2JNF A;  1QIV A;  3BOW B;  2P6B B;  4M2P A;  2K7C A;  1SY9 A;  5JJG A;  1PRW A;  1JF0 A;  2BL0 C;  2K7B A;  2M1K B;  3EKJ A;  1QS7 A;  1J1D A;  2WOR A;  4CFQ A;  2K7D A;  1OQP A;  1IQ5 A;  1OE9 B;  1DGU A;  5DKQ A;  2M3W A;  2QAC A;  2LAN A;  3FIA A;  4ORA B;  2JPT A;  4A4C A;  2JT0 A;  2KAY A;  4C0J A;  1K95 A;  1W7I B;  5HYD A;  2KHN A;  1CDN A;  2PMY A;  2JQ6 A;  1QVI Z;  2FOT A;  2F3Y A;  2FCD A;  3AKA A;  3FWC A;  4F0Z B;  3K21 A;  2HQW A;  2ZN9 A;  4JPZ B;  2LUX A;  3TDI A;  3I5I C;  2BEC A;  1KFX L;  1SBJ A;  1R6P A;  1YRU B;  3EK8 A;  3GK4 X;  3WHT B;  1RK9 A;  1MXE A;  2MAZ A;  1Y0V H;  2F2P A;  5F6T A;  5PAL A;  1HT9 A;  2KYF A;  2NXQ A;  1GGZ A;  2SAS A;  2GGM A;  3BUW B;  4I5J A;  4PHN A;  2LLT A;  2CNP A;  3SG3 A;  4PDZ A;  2BBM A;  1QXP A;  1ZFS A;  2IS9 A;  2O5G A;  2BCA A;  4GUK A;  1DMO A;  4XJK B;  2AUC A;  3DF0 A;  2I7A A;  3O2P A;  2K61 A;  2L0P A;  1H8B A;  3CS1 A;  2WCB A;  1M63 B;  1WLM A;  2M8U A;  3OX5 A;  2LMV A;  1MWN A;  5AFP A;  1QVI Y;  2B1U A;  1AP4 A;  2HET A;  4N5X A;  2JXL A;  1AUI B;  1QLS A;  5DKN A;  1SW8 A;  1ZAC A;  3JTD B;  2DOQ A;  3KPX A;  5CPV A;  3TZ1 A;  2L50 A;  2PAS A;  4I5N B;  1LKJ A;  5I2L A;  1TNW A;  4CID A;  2BL0 B;  2JZI A;  1KSM A;  3I5G C;  2WC8 A;  3PSR A;  1IJ6 A;  2M29 A;  1IG5 A;  3GOF A;  1NCX A;  2M49 B;  3OHM B;  4MRX A;  2NCP A;  4ICB A;  5JOL A;  1S3P A;  3VRQ A;  3CR5 X;  5HKZ A;  1G33 A;  1UHK A;  4L9M A;  5AEQ A;  2BKH B;  4GPL B;  1AK8 A;  4MZK A;  1F4O A;  1AJ5 A;  3SG2 A;  2KGR A;  1KCY A;  3I5I B;  4N1F A;  1YUT A;  2Y5I A;  2K2A A;  1ODB A;  1F70 A;  1K9K A;  2L5X B;  1B7T Z;  2JNX A;  5FYX A;  1NWD A;  2H61 A;  3H4S E;  4E68 A;  1FW4 A;  5ER5 A;  4ZCU A;  4MLW A;  3PAT A;  4MSP A;  5HKY A;  4YGB B;  3BXK A;  4OKH A;  4YGC B;  3TUY C;  1DF0 A;  3WXA A;  1N0Y A;  1RFJ A;  1CFD A;  2BE4 A;  4PHM A;  1Y1A A;  1Y1U A;  1RRO A;  1G8I A;  3EK4 A;  1M45 A;  1KFU S;  2VRG A;  1C7V A;  2OTG C;  5J3X A;  1YUU A;  1ALW A;  1LVC D;  4ETO A;  2WND A;  1A75 A;  2K0J A;  3RLZ A;  3LL8 B;  5CSI A;  2CXJ A;  1Y1X A;  3PLF B;  3NXA A;  3CZT X;  5KTY A;  4UPG A;  1ZUZ A;  1KK8 B;  1V1G A;  1SMG A;  2KGB C;  1U5I A;  3A8R A;  3A4U B;  3CR4 X;  3VRO A;  3DVJ A;  1SPY A;  1MHO A;  1A03 A;  4BY4 A;  3I5G B;  1OOJ A;  2KYC A;  4Q04 A;  4WQ2 A;  3SIB A;  4CFR A;  3LK1 A;  2EGD A;  1M31 A;  4GFT A;  4XYN A;  3VGO A;  1EL4 A;  2M1U A;  3LK0 A;  1LA0 A;  3HCM A;  3NSK A;  1MXL C;  1OMR A;  3KO0 A;  1BG1 A;  5KSZ A;  4ZCV A;  1QX2 A;  2F8P A;  3IF7 A;  2F3Z A;  1KFX S;  1SRA A;  1TRF A;  1EJ3 A;  5HLO A;  3TDZ A;  1F55 A;  2ZFD A;  1CB1 A;  4GGF A;  1DTL A;  2NLN A;  1EH2 A;  3PAL A;  4D1E A;  1GGW A;  4NDC A;  3TUY B;  2GV5 A;  1IGV A;  3TS5 C;  1IQ3 A;  1X02 A;  3I5F C;  1S6I A;  4HRG A;  2LMU A;  2O60 A;  4QJ5 B;  2LLS A;  1J55 A;  3PFV A;  1JUO A;  1XFZ O;  5AER A;  3GK1 A;  1J1E A;  3LLE A;  4I5L B;  1QJT A;  2AAO A;  3NSI A;  1E8A A;  1GJY A;  2KI6 D;  1QTX A;  3DVK A;  1DJH A;  1WRZ A;  2OTG B;  4YGD B;  2NCO A;  1CFF A;  4BY5 A;  3CLN A;  2M9G A;  1IH0 A;  1PSB A;  3LCP C;  1TCF A;  1XYD A;  2A4J A;  1CLB A;  4ORB B;  5D69 A;  1TNP A;  1F4Q A;  2KI4 C;  1CKK A;  4A4B A;  1DGV A;  2H61 C;  2ZRS A;  2ZRT A;  1SR6 C;  1TNQ A;  1B1G A;  1M39 A;  1REC A;  1RTP 1;  1Q80 A;  3ICB A;  2M0R A;  2ZKM X;  5KU1 A;  1J7O A;  1L7Z A;  3F45 A;  4PE0 A;  2BCB A;  1MR8 A;  3DF0 B;  4JWQ A;  4OV2 A;  1OSA A;  5I8N A;  2KQY A;  1SCV A;  1KK8 C;  1NCZ A;  2LLU A;  1S5G Z;  5HKW A;  2CTN A;  1JFJ A;  2BCX A;  2LHL A;  1PVA A;  4FQO A;  2LC5 A;  4C0L A;  2EC6 C;  1JC2 A;  2R2I A;  3E3R A;  1B8R A;  3OB2 B;  4NDD A;  2JT3 A;  3ZNI A;  1DVI A;  1K2H A;  1UP5 A;  2JT8 A;  3OX6 A;  5CSN A;  3IQQ A;  1KQV A;  4PE4 A;  5I2O A;  1QIW A;  2F2O A;  1SNL A;  1N65 A;  3DVM A;  1RJV A;  4N1G A;  1F71 A;  2MJW B;  4MBE A;  1DJY A;  1WRL A;  3AAJ A;  3KHE A;  1S6C A;  2LVI A;  1EXR A;  1SL7 A;  3BYA A;  1CFC A;  2RGI A;  2JUL A;  2WOS A;  3TS5 B;  5AXI A;  2CCM A;  1PVB A;  1CM4 A;  3I5F B;  4HSZ A;  1WRK A;  1XK4 A;  4MZJ A;  3SIA A;  2SCP A;  1XFX O;  4P2Y B;  3GK2 A;  2LMT A;  2LNK A;  4NDB A;  4MVF A;  1K8U A;  4MN0 A;  1S6J A;  4PAL A;  2KSP A;  1DJX A;  3O6B A;  4M2Q A;  3SG5 A;  1NX3 A;  3CR2 A;  4M2O A;  1TNX A;  1CLL A;  4GNK B;  1QX5 B;  3EVV A;  2E30 A;  2LVV A;  1CDL A;  3NSL A;  1KWO C;  1NCY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...