1AP4A

Regulatory domain of human cardiac troponin c in the calcium-saturated state, nmr, 40 structures
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
89
structure length
89
Chain Sequence
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARDIAC N-TROPONIN C
publication title Calcium-induced structural transition in the regulatory domain of human cardiac troponin C.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Calcium-binding
total genus 19
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 1997-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1ap4A00
3CLNA 5FYXA 5GQQC 4FTGA 1BU3A 2WORA 4WRIA 1N65A 2KGRA 3TDIA 1BR1B 2OTGC 1OMRA 2I7AA 5KTYA 1B4CA 2CXJA 3AAJA 2BE6A 1HQVA 5JOLA 1S5GY 1BF5A 1KFUS 4DRWA 2HETA 2Y5IA 5HKYA 1B7TY 2JTZA 2MA2A 2LV7A 2F33A 1OOJA 3IQOA 5HKZA 1CDPA 1U5IA 2MHHA 4NQGA 4ORBB 3JVTB 2JT3A 3BYAA 1TNQA 2L4HA 4BY5A 1MXLC 2KOTA 2NCOA 1V1GA 1YUSA 3TZ1A 4MSPA 2F2PA 2Q91A 1PSRA 1XFXO 3SG2A 3VRQA 2ZFDA 1BG1A 1WDCB 1CLMA 1CFCA 2L98A 4USLA 1M45A 3VRNA 1MQ1A 1KK8C 1S6IA 4N1FA 3VROA 4HRGA 2M1KB 4MEWA 3I5HC 2K7CA 4MRXA 5D7FA 3DVMA 3SG7A 2VRGA 1BLQA 3SG4A 5AEQA 1NIWA 1XVJA 5IBWA 1YRUB 1W7IB 1YUUA 2MRDA 2AAOA 3CR4X 1DF0A 2QPTA 1IGVA 3KHEA 1R2UA 1OZSA 1QLKA 1QX5B 1S26D 1B9AA 1CTRA 1KQMB 2NXQA 2ZRSA 2MJWB 1TTXA 5KU1A 1QIVA 1L2OB 2ISDA 4NDCA 2TN4A 2LM5A 1WDCC 3DF0A 5AANA 1G33A 1PALA 1QJTA 2PSRA 4IL1A 5K89A 5AERA 3LK1A 3CS1A 2M0RA 2KYCA 1IJ5A 1TRFA 2PASA 3CWGA 4PALA 4YI9A 3VGOA 2FCDA 3RLZA 1WRLA 1A75B 1RTP1 2MLEC 1J1DA 1ZFSA 2KAYA 1M46A 1QLSA 4M2OA 1F70A 1BMOA 1XFWO 2LP3A 1A29A 3JTDC 2LUXA 2WOSA 1NPQA 2JPTA 3BUXB 1UUSA 1J7OA 4JQ0D 2LLTA 3D0YB 1NCZA 1KQMC 2I94A 2JU0A 2V53A 1CKKA 1IH0A 4PE0A 1JF2A 1ZUZA 3OB1B 2WCFA 1LXFC 1L2OC 1GGWA 1CB1A 3ZNIA 3SJSA 4MZJA 2I2RE 3QRXA 2O60A 2KI4B 4I5JA 4P5OE 1WLMA 1WY9A 2OPOA 1A4PA 1QVIY 1IQ5A 3OX5A 1IRJA 3D10A 1PVAA 4FQOA 3GK2A 3CR2A 2FJUB 2L2EA 4CLNA 3NSLA 2OS8B 3EVRA 4CIDA 1JWDA 2L50A 4YGEB 2KHNA 2H2KA 1EH2A 2BKHB 4ETOA 4UPGA 1GJYA 1N0YA 2OTGB 1YX8A 2F8PA 1B1GA 4JPZB 2NLNA 4C0KA 2K61A 1OMDA 1EJ3A 1LA3A 1XYDA 1YTZC 3NXAA 4C0LA 1MXEA 1AK8A 3A8RA 2KI4C 1R6PA 5F6TA 3CR5X 1Q80A 3SIAA 1JC2A 1H8BA 1XFUO 4HSZA 4MVFA 2WCBA 2EGDA 3ZWHA 1NUBA 2LUCA 3O6BA 3AAKA 2KYFA 1K96A 1XO5A 2WC8A 3O78A 1RECA 2OS8C 5G08A 4N5XA 1WRKA 3OX6A 3EVVA 2L51A 3BOWA 1XK4A 1OE9B 2ZN9A 4OVNF 1OZOA 1DJGA 1CDLA 1C07A 3AKBA 4MN0A 4MZKA 1KQVA 2BL0B 1KK8B 3I5HB 4OR9B 1CNPA 1CM4A 1RFJA 5BPJA 1D1OA 3PM8A 3MSEB 1IJ6A 1OQPA 1RK9A 4GUKA 1UHHA 4HRHA 3KO0A 1F8HA 1KCYA 4NDDA 1MF8B 2F3YA 1F55A 1QXPA 2LAPA 1XFZO 1Y1XA 3NSIA 4L9MA 4XJKA 2IS9A 2M7NA 3I5IC 2E6WA 1S1EA 2LVIA 2A4JA 1IQ3A 4PHMA 1U5IB 2HQ8A 2PALA 2JWWA 3E3RA 2LMTA 3LCPC 1IKUA 3TDUA 1UP5A 3KEVA 1RWYA 3DVEA 1Y6WA 2BL0C 2KQYA 1AHRA 1SYMA 1NX0A 1LA0A 2LNKA 1CLLA 3SIBA 1PRWA 2KFHA 2Y1MA 1FW4A 1JFKA 2JQ6A 2MAZA 4JWQA 1FBVA 5KSZA 4MBEA 3VRPA 4YBHB 4DIRA 1PSBA 1J7QA 3EK4A 2G9BA 3IF7A 1KK7Z 3JTDB 4I5LB 4M2PA 4ORCB 2SCPA 2JXCA 2KAVA 1K9UA 5DKNA 4PCWA 1S5GZ 1NCXA 3SG6A 3EKJA 1B7TZ 2LCPA 3WHTB 1DF0B 1YX7A 2SASA 1BJFA 1OMVA 1L7ZA 2FOTA 4P2YB 1EG3A 1S6CA 4GGFA 2JTTA 4GGNA 1TN4A 2D8NA 4AQIA 3WXAA 1XFYO 1FPWA 1KWOB 4ICBA 1J1EA 3DF0B 1CMFA 1SCVA 2R2IA 3ICBA 1NSHA 2Y4QA 3A4UB 2LVJA 3PLFB 1YVHA 4OV2A 1SRAA 2ZN8A 1QV0A 1ZACA 1QV1A 4YGDB 2LE9B 3F45A 3HX4A 4U8DA 4GFTA 1UURA 5HLVA 1F4QA 2BBNA 2M1UA 2L0PA 1TNPA 1ZOTB 3OHMB 4GPLB 2CT9A 1YUTA 2LMUA 4A4CA 1LVCD 2M49B 1Y1AA 1M63B 2PRUA 3WHUB 4DCKA 1DJHA 1KWOC 2LLUA 1QIWA 4GGFC 1J7PA 2BBMA 2LHIA 1C7WA 2JT8A 4YGCB 1B47A 1X02A 1E8AA 1YURA 1CFDA 5I2QA 3DVKA 1UHKA 4PE7A 4MLWA 2BCXA 5CSFA 2LP2A 1SBJA 3GK1A 1RROA 1ODBA 2EC6B 1JF0A 5CSJA 2L5XB 4A4BA 4DS7A 1DJWA 5ER4X 4GBAA 1A03A 3FWBA 4OCIA 1LINA 1XA5A 2M9GA 4F0ZB 4C0JA 2Y1NA 4NDBA 4ZCUA 3PSRA 1A2XA 1SW8A 2AMIA 2KBMA 1B8RA 4ZCVA 2K7BA 2MLFC 3EK8A 1JUOA 2FCEA 2JZIA 2KQ6A 3I5IB 2G2BA 5DKRA 3EK7A 2M8UA 1MR8A 1DJZA 1QVIZ 4E68A 4XYNA 5I8NA 1JBAA 3I5GB 3CTNA 1IWQA 1DJIA 1DT7B 4I5KA 3CGAA 4WQ3A 5CSNA 1DGUA 2EC6C 2KGBC 3KPXA 4GNKB 1CDMA 3DD4A 1B8CA 1KFXS 2CNPA 2KSPA 3FS7A 3BOWB 1AP4A 1HT9A 5TNCA 2M7LA 1B8LA 1ALVA 3K21A 1SL9A 2M29A 3BUNB 2BCBA 1S6JA 1CDNA 2HF5A 1TNWA 5J3XA 1M39A 2K0JA 2JT0A 3IQQA 1MUXA 5HLOA 2F3ZA 4MZLA 4BY4A 1KFXL 3LLEA 1Y0VH 1K9KA 3BUWB 1TCOB 1NX1A 2K2FA 1SK6D 1S3PA 2Q4UA 2LC5A 1G4YR 2ZNEA 5JJGA 4YGBB 1K93D 4QJ5B 3I5GC 2BCAA 1K8UA 1KK7Y 2K7DA 2F2OA 4XJKB 4PE1A 3HCMA 1DJXA 3I5FB 2JXLA 4R1EA 1IG5A 1XK4C 2LVVA 1OSAA 1DVIA 5CSIA 1KSMA 1J7RA 2HQWA 2KAXA 4WQ2A 1CMGA 1FI6A 2LLSA 1TCFA 3PN7C 3TS5B 2ZKMX 2H61A 3BQ3A 1C7VA 1N2DA 1YRTB 1CFPA 1EXRA 1KFUL 2B1UA 1ALWA 3EKHA 2JULA 2NCPA 2JOJA 2JRFA 2KI6D 1K2HA 1DJYA 1QX2A 3RM1A 3CZTX 3EVUA 4AOMA 3TDZA 1CM1A 1K95A 1G8IA 5B8IB 1PK0D 3PALA 1RJVA 4Q04A 2EHBA 2KFFA 1QATA 3I5FC 2RGIA 2ZRTA 1SPYA 3M0WA 1CFFA 3OP0A 4MRYA 1FI5A 1J55A 1F71A 3O2PA 4D1EA 3AKAA 3VRRA 3JVTC 3TS5C 4PHNA 1UHIA 1PULA 3LK0A 1SL7A 2WNDA 1SMGA 3GK4X 3SG5A 4QJ3B 1MWNA 3BXKA 4ORAB 2LANA 1TIZA 5HKWA 1A75A 2CBLA 2P6BB 2H61C 2PMYA 1AJ4A 3TUYB 5D69A 1SKTA 2LVKA 4CFRA 1DMOA 2HPSA 4GAOA 1XFVO 4YI8A 5PALA 1NP8A 1NWDA 3D0YA 1K90D 1YR5A 2DOQA 1EL4A 1SR6B 2BE4A 3KF9A 4M2QA 1WRZA 4QJ4B 2O5GA 2L4IA 1Y1UA 3BUMB 1NX3A 1M31A 4YRUA 2K7OA 4DUQA 3C1VA 1F4OA 3WNXB 4CPVA 1TNXA 1AJ5A 2BECA 1CLBA 2NZ0A 1JSAA 1UHNA 1QX7A 5ER5A 2AUCA 5DKQA 1VRKA 2MBXA 1AUIB 1BR4B 5CPVA 5AXIA 1V1FA 2GGZA 2KFGA 1K94A 1BODA 1AVSA 1UHJA 3TUYC 1JFJA 3SG3A 1SCMB 3FWCA 1K9PA 4N1GA 1PVBA 1MHOA 2QACA 2BKIB 2K2AA 1DTLA 1WLZA 1SR6C 1KSOA 1NCYA 3H4SE 1QTXA 2KI6C 4TNCA 1SL8A 4PHKA 1DGVA 1QASA 4YGAA 2M3WA 1W7JB 2COLB 1NYAA 4CFQA 2CTNA 2LMVA 1NX2A 2M97A 3LL8B 2JC2A 2E30A 1SY9A 2I18A 3FIAA 2GV5A 2KBIA 1YVLA 3OB2B 4AQJA 2PVBA 4OKHA 5HYDA 1LKJA 2JNXA 1QS7A 1S36A 1FF1A 3BUOB 1GQMA 3PFVA 2CCMA 2KDHA 3GOFA 3NSKA 4I5NB 1ZMZA 4PE4A 2ZNDA 1TOPA 1SCMC 4HREE 1UWOA 3PN7B 4PHJA 3DVJA 1GGZA 2LHLA 3O4YA 2JNFA 3NSOA 1BT6A 1BOCA 1F54A 2K8MB 1EG4A 5I2LA 1H4BA 1SNLA 2WCEA 2GGMA 2KNEA 5AFPA 4PDZA 5I2OA 3PATA
chains in the Genus database with same CATH superfamily
3CLNA 5FYXA 5GQQC 2L5YA 4FTGA 1BU3A 2WORA 4WRIA 1N65A 2KGRA 3SS5A 1BR1B 3TDIA 2OTGC 1OMRA 2I7AA 5KTYA 1B4CA 3R1PA 2CXJA 3L4LA 5FI6A 3AAJA 2BE6A 4OZDA 1HQVA 5JOLA 1S5GY 1BF5A 3B86A 1KFUS 4DRWA 2HETA 1W9ZA 2Y5IA 5HKYA 1B7TY 2JTZA 2MA2A 2LV7A 2F33A 1OOJA 2WCMA 3IQOA 5HKZA 1CDPA 2K60A 1U5IA 2MHHA 2P71A 4NQGA 4ORBB 3JVTB 2JT3A 3BYAA 1TNQA 2L4HA 2GTEA 1MXLC 3S0BA 2KOTA 4BY5A 3NGVA 2NCOA 1V1GA 1YUSA 3TZ1A 4MSPA 2F2PA 2Q91A 1PSRA 1XFXO 3SG2A 3VRQA 2ZFDA 1BG1A 1WDCB 1CLMA 3CZ2A 1CFCA 2L98A 4USLA 1M45A 5D3OA 3S0DA 3VRNA 1MQ1A 1KK8C 1S6IA 4N1FA 3SS4A 4HRGA 2M1KB 3VROA 4MEWA 3I5HC 2K7CA 4MRXA 5D7FA 3DVMA 3BJHA 2VRGA 3FE8A 3NHIA 3SG4A 3D73A 3SG7A 1BLQA 5AEQA 1NIWA 1XVJA 5IBWA 1YRUB 1W7IB 1YUUA 2MRDA 2AAOA 3CR4X 1DF0A 1T14A 2QPTA 3V2LA 1IGVA 3KHEA 1R2UA 3O4XA 1OZSA 1QLKA 1QX5B 1S26D 1B9AA 1CTRA 1KQMB 2NXQA 2ZRSA 2MJWB 1TTXA 5KU1A 1QIVA 1L2OB 2ISDA 4NDCA 2TN4A 2LM5A 1WDCC 3DF0A 5AANA 1G33A 1PALA 1QJTA 2PSRA 4IL1A 5K89A 5AERA 3LK1A 3CS1A 2M0RA 2KYCA 1IJ5A 1TRFA 2PASA 3CWGA 4PALA 4YI9A 3VGOA 2FCDA 3RLZA 1WRLA 1A75B 1QWVA 1RTP1 1J1DA 2MLEC 1ZFSA 3PJIA 2KAYA 5EL2A 1M46A 1QLSA 3D77A 4INXA 1BMOA 1XFWO 3R1OA 4M2OA 2LP3A 1F70A 1A29A 3JTDC 2LUXA 2WOSA 1NPQA 1OOIX 2JPTA 1UUSA 3BUXB 4JQ0D 1J7OA 2LLTA 1ORGA 3D0YB 1NCZA 1KQMC 2I94A 2JU0A 2V53A 1CKKA 1IH0A 4PE0A 1JF2A 1ZUZA 3OB1B 2WCFA 1LXFC 1L2OC 1OOHA 1CB1A 1GGWA 3ZNIA 3SJSA 4MZJA 2I2RE 3QRXA 2O60A 2KI4B 4FQTA 4I5JA 1WLMA 1WY9A 4P5OE 2OPOA 1A4PA 1QVIY 1IIOA 1IQ5A 3OX5A 1IRJA 3D10A 3UNWA 1PVAA 4FQOA 3GK2A 3CR2A 2FJUB 2L2EA 4CLNA 3NSLA 2OS8B 3EVRA 4CIDA 3D78A 3S0FA 1JWDA 2L50A 4YGEB 2KHNA 2H2KA 1EH2A 2BKHB 4PT1A 4ETOA 4UPGA 1GJYA 3S0EA 1C3YA 3L47A 1N0YA 2OTGB 1YX8A 2F8PA 1B1GA 4JPZB 2NLNA 4IJ7A 4C0KA 2K61A 1OMDA 1EJ3A 1LA3A 1XYDA 1YTZC 3NXAA 3R72A 4C0LA 1MXEA 1AK8A 3A8RA 2KI4C 1R6PA 5F6TA 3CR5X 1Q80A 2PYQA 3FE6A 3SIAA 1JC2A 1H8BA 1XFUO 1XFRA 4HSZA 4MVFA 2WCBA 2EGDA 3ZWHA 1NUBA 2LUCA 3O6BA 3AAKA 2P70A 2KYFA 1K96A 1XO5A 2WC8A 3O78A 1RECA 2OS8C 5G08A 4N5XA 1WRKA 3OX6A 3EVVA 2L51A 3BOWA 1XK4A 1OE9B 2ZN9A 4OVNF 1OZOA 1DJGA 1CDLA 3R1VA 1C07A 3AKBA 4MN0A 4MZKA 3DZTA 1KQVA 2BL0B 1KK8B 1DQEA 3I5HB 3EG5B 4OR9B 1CNPA 1CM4A 1RFJA 5BPJA 1D1OA 3PM8A 3MSEB 3UO9A 1IJ6A 1OQPA 1RK9A 4GUKA 1UHHA 4HRHA 3KO0A 1F8HA 1KCYA 4NDDA 1MF8B 2F3YA 1F55A 1QXPA 2LAPA 1XFZO 1Y1XA 3NSIA 4L9MA 4XJKA 2IS9A 2M7NA 3I5IC 2E6WA 1S1EA 2LVIA 2A4JA 1IQ3A 4PHMA 1U5IB 2HQ8A 2PALA 2JWWA 3E3RA 2LMTA 3LCPC 1IKUA 2QEBA 5I94A 3TDUA 1UP5A 3KEVA 1RWYA 3DVEA 1Y6WA 2BL0C 2KQYA 1AHRA 1SYMA 1NX0A 1LA0A 2LNKA 1CLLA 3SIBA 1PRWA 2KFHA 2Y1MA 5DICA 1FW4A 1JFKA 2JQ6A 2MAZA 4JWQA 1FBVA 5KSZA 4MBEA 3VRPA 4YBHB 4DIRA 1PSBA 1J7QA 3EK4A 2G9BA 3IF7A 1KK7Z 3JTDB 4I5LB 4M2PA 4ORCB 2SCPA 2JXCA 2KAVA 1K9UA 5DKNA 4PCWA 1S5GZ 1NCXA 3SG6A 3EKJA 1B7TZ 2LCPA 3WHTB 1DF0B 1YX7A 1TUZA 1BJFA 1OMVA 1L7ZA 2FOTA 2SASA 1EG3A 1S6CA 4GGFA 4P2YB 2JTTA 4GGNA 1DC1A 1TN4A 2WCHA 2D8NA 4AQIA 3WXAA 1XFYO 1FPWA 1KWOB 2QEOA 1J1EA 3DF0B 4ICBA 1SCVA 2R2IA 1CMFA 3ICBA 1NSHA 2BNXA 2QEHA 2LVJA 2Y4QA 3A4UB 1P28A 3DXLA 3PLFB 1YVHA 3PM2A 4OV2A 1SRAA 2ZN8A 4F7FA 1QV0A 1ZACA 1QV1A 4YGDB 2PQLA 2LE9B 3F45A 3HX4A 2WC6A 4U8DA 4GFTA 1UURA 4INWA 5HLVA 3B6XA 1F4QA 1TWOA 2BAPA 2BBNA 2M1UA 2L0PA 1TNPA 1ZOTB 3OHMB 4GPLB 2CT9A 1YUTA 2LMUA 4A4CA 1LVCD 2M49B 1Y1AA 1M63B 2ERBA 2PRUA 3WHUB 3RZSA 4DCKA 1DJHA 1KWOC 2LLUA 1QIWA 4GGFC 1J7PA 2BBMA 2LHIA 3B7AA 3BFBA 1C7WA 2JT8A 4YGCB 1B47A 1X02A 1E8AA 1YURA 1CFDA 5I2QA 3DVKA 1UHKA 4PE7A 4MLWA 2BCXA 5CSFA 2LP2A 1SBJA 1TUJA 1RROA 3GK1A 1ODBA 2EC6B 1JF0A 5CSJA 2L5XB 4A4BA 3SS3A 1DJWA 5ER4X 4DS7A 4GBAA 1A03A 3FWBA 4OCIA 1LINA 1XA5A 2M9GA 4F0ZB 4C0JA 2Y1NA 4NDBA 4ZCUA 1SSEB 3PSRA 1LS8A 1A2XA 1SW8A 2AMIA 2KBMA 2WCKA 1B8RA 4ZCVA 2K7BA 2MLFC 3EK8A 1JUOA 2FCEA 2WC5A 2JZIA 2WCLA 2KQ6A 3I5IB 2G2BA 5DKRA 3EK7A 2M8UA 1MR8A 1DJZA 1QVIZ 4E68A 4XYNA 5I8NA 5FI7A 1JBAA 2YGUA 3I5GB 3CTNA 3NHTA 5HL1A 1IWQA 5FI2A 1DJIA 1DT7B 4I5KA 3CGAA 4WQ3A 5CSNA 1DGUA 2EC6C 2KGBC 2KPHA 3KPXA 4GNKB 1CDMA 3DD4A 1B8CA 1KFXS 2CNPA 2KSPA 3FS7A 3BOWB 1AP4A 1HT9A 5TNCA 2M7LA 1B8LA 4JD9A 1ALVA 3K21A 1SL9A 2M29A 2L2CA 3BUNB 2BCBA 1S6JA 1CDNA 2HF5A 1TNWA 5J3XA 1M39A 2K0JA 2JT0A 3L4AA 3IQQA 3OGNA 3S0GA 1MUXA 5HLOA 2F3ZA 3N7HA 4MZLA 4BY4A 1KFXL 3LLEA 2FJYA 1Y0VH 1K9KA 3BUWB 1TCOB 1NX1A 2K2FA 1SK6D 1S3PA 2Q4UA 2LC5A 1G4YR 2ZNEA 5JJGA 4YGBB 1K93D 4QJ5B 3I5GC 2BCAA 3S0AA 1K8UA 1KK7Y 2K7DA 2F2OA 4XJKB 4PE1A 3HCMA 2KLDA 1DJXA 3I5FB 2JXLA 4R1EA 1Z2CB 1IG5A 1XK4C 2LVVA 1OSAA 1DVIA 5CSIA 1KSMA 3D75A 1J7RA 2HQWA 2KAXA 4WQ2A 1CMGA 1FI6A 2LLSA 1TCFA 3PN7C 4KYNA 3TS5B 2ZKMX 2H61A 3BQ3A 1C7VA 1N2DA 1YRTB 1CFPA 1EXRA 1KFUL 2B1UA 1ALWA 3EKHA 2JULA 2NCPA 2JOJA 2JRFA 2KI6D 1K2HA 1DJYA 1QX2A 3RM1A 3CZTX 3EVUA 4AOMA 3TDZA 1CM1A 1K95A 1G8IA 5B8IB 2WCJA 3DYEA 1PK0D 3CZ0A 1RJVA 3PALA 4Q04A 2EHBA 2KFFA 3B88A 1QATA 3I5FC 2RGIA 2ZRTA 1SPYA 3CDNA 3M0WA 3OP0A 1CFFA 4MRYA 1FI5A 1J55A 3BFAA 1F71A 3CYZA 3O2PA 2KLEA 4D1EA 3AKAA 3VRRA 3JVTC 3TS5C 1OOGA 1UHIA 1PULA 4PHNA 3LK0A 1SL7A 2WNDA 3B87A 1SMGA 3GK4X 3SG5A 4QJ3B 1MWNA 3BXKA 4ORAB 2LANA 1TIZA 5HKWA 1A75A 2CBLA 2P6BB 2H61C 2PMYA 1AJ4A 3TUYB 5D69A 1SKTA 2LVKA 4CFRA 1DMOA 2HPSA 4GAOA 1XFVO 4YI8A 5PALA 1NP8A 1NWDA 3D0YA 1K90D 1YR5A 2DOQA 1EL4A 1SR6B 2BE4A 3K1EA 3KF9A 4M2QA 1WRZA 4QJ4B 2O5GA 2L4IA 1Y1UA 3BUMB 1OW4A 1NX3A 1M31A 4YRUA 2K7OA 4DUQA 3C1VA 1F4OA 3WNXB 4CPVA 1TNXA 1AJ5A 2BECA 1OOFA 1CLBA 2NZ0A 1GM0A 1JSAA 1UHNA 1QX7A 4JKTA 5ER5A 2H8VA 3VB1A 2AUCA 5DKQA 1VRKA 2MBXA 1C3ZA 1Z4HA 1AUIB 1BR4B 5CPVA 5AXIA 1V1FA 2GGZA 2KFGA 3D76A 1K94A 1BODA 1AVSA 1UHJA 3TUYC 1JFJA 3SG3A 1SCMB 3FWCA 1K9PA 3OBVA 4N1GA 1PVBA 1MHOA 2QACA 3Q8IA 2BKIB 2K2AA 1DTLA 1WLZA 1SR6C 1KSOA 1NCYA 3H4SE 1QTXA 2KI6C 4TNCA 1SL8A 4PHKA 1DGVA 1QASA 4YGAA 2M3WA 1W7JB 2COLB 1NYAA 4CFQA 2CTNA 2LMVA 1NX2A 2M97A 3LL8B 2JC2A 2E30A 1SY9A 2I18A 3FIAA 3CABA 2GV5A 2KBIA 1YVLA 1DELA 3OB2B 4AQJA 2PVBA 4OKHA 5HYDA 1LKJA 2JNXA 1QS7A 1S36A 1DEKA 1FF1A 3BUOB 1GQMA 3PFVA 2CCMA 2KDHA 3GOFA 3IVTA 3NSKA 4I5NB 1ZMZA 3CZ1A 4PE4A 2ZNDA 1TOPA 1SCMC 2QEVA 2JPOA 4HREE 3QMEA 1UWOA 3PN7B 4PHJA 3DVJA 1GGZA 2LHLA 2QDIA 2JNFA 3NSOA 3O4YA 1BT6A 1BOCA 3FE9A 3DY9A 2K8MB 1F54A 1EG4A 5I2LA 1H4BA 1SNLA 2WCEA 2GGMA 2KNEA 3BFHA 3D74A 4PDZA 5AFPA 5I2OA 3PATA
chains in the Genus database with same CATH topology
3CLNA 5FYXA 5GQQC 4FTGA 1BU3A 2WORA 4WRIA 1N65A 2KGRA 3TDIA 1BR1B 2OTGC 1OMRA 2I7AA 5KTYA 1B4CA 2CXJA 3AAJA 2BE6A 1HQVA 5JOLA 1S5GY 1BF5A 1KFUS 4DRWA 2HETA 2Y5IA 5HKYA 1B7TY 2JTZA 2MA2A 2LV7A 2F33A 1OOJA 3IQOA 5HKZA 1CDPA 1U5IA 2MHHA 4NQGA 4ORBB 3JVTB 2JT3A 3BYAA 1TNQA 2L4HA 4BY5A 1MXLC 2KOTA 2NCOA 1V1GA 1YUSA 3TZ1A 4MSPA 2F2PA 2Q91A 1PSRA 1XFXO 3SG2A 3VRQA 2ZFDA 1BG1A 1WDCB 1CLMA 1CFCA 2L98A 4USLA 1M45A 3VRNA 1MQ1A 1KK8C 1S6IA 4N1FA 3VROA 4HRGA 2M1KB 4MEWA 3I5HC 2K7CA 4MRXA 5D7FA 3DVMA 3SG7A 2VRGA 1BLQA 3SG4A 5AEQA 1NIWA 1XVJA 5IBWA 1YRUB 1W7IB 1YUUA 2MRDA 2AAOA 3CR4X 1DF0A 2QPTA 1IGVA 3KHEA 1R2UA 1OZSA 1QLKA 1QX5B 1S26D 1B9AA 1CTRA 1KQMB 2NXQA 2ZRSA 2MJWB 1TTXA 5KU1A 1QIVA 1L2OB 2ISDA 4NDCA 2TN4A 2LM5A 1WDCC 3DF0A 5AANA 1G33A 1PALA 1QJTA 2PSRA 4IL1A 5K89A 5AERA 3LK1A 3CS1A 2M0RA 2KYCA 1IJ5A 1TRFA 2PASA 3CWGA 4PALA 4YI9A 3VGOA 2FCDA 3RLZA 1WRLA 1A75B 1RTP1 2MLEC 1J1DA 1ZFSA 2KAYA 1M46A 1QLSA 4M2OA 1F70A 1BMOA 1XFWO 2LP3A 1A29A 3JTDC 2LUXA 2WOSA 1NPQA 2JPTA 3BUXB 1UUSA 1J7OA 4JQ0D 2LLTA 3D0YB 1NCZA 1KQMC 2I94A 2JU0A 2V53A 1CKKA 1IH0A 4PE0A 1JF2A 1ZUZA 3OB1B 2WCFA 1LXFC 1L2OC 1GGWA 1CB1A 3ZNIA 3SJSA 4MZJA 2I2RE 3QRXA 2O60A 2KI4B 4I5JA 4P5OE 1WLMA 1WY9A 2OPOA 1A4PA 1QVIY 1IQ5A 3OX5A 1IRJA 3D10A 1PVAA 4FQOA 3GK2A 3CR2A 2FJUB 2L2EA 4CLNA 3NSLA 2OS8B 3EVRA 4CIDA 1JWDA 2L50A 4YGEB 2KHNA 2H2KA 1EH2A 2BKHB 4ETOA 4UPGA 1GJYA 1N0YA 2OTGB 1YX8A 2F8PA 1B1GA 4JPZB 2NLNA 4C0KA 2K61A 1OMDA 1EJ3A 1LA3A 1XYDA 1YTZC 3NXAA 4C0LA 1MXEA 1AK8A 3A8RA 2KI4C 1R6PA 5F6TA 3CR5X 1Q80A 3SIAA 1JC2A 1H8BA 1XFUO 4HSZA 4MVFA 2WCBA 2EGDA 3ZWHA 1NUBA 2LUCA 3O6BA 3AAKA 2KYFA 1K96A 1XO5A 2WC8A 3O78A 1RECA 2OS8C 5G08A 4N5XA 1WRKA 3OX6A 3EVVA 2L51A 3BOWA 1XK4A 1OE9B 2ZN9A 4OVNF 1OZOA 1DJGA 1CDLA 1C07A 3AKBA 4MN0A 4MZKA 1KQVA 2BL0B 1KK8B 3I5HB 4OR9B 1CNPA 1CM4A 1RFJA 5BPJA 1D1OA 3PM8A 3MSEB 1IJ6A 1OQPA 1RK9A 4GUKA 1UHHA 4HRHA 3KO0A 1F8HA 1KCYA 4NDDA 1MF8B 2F3YA 1F55A 1QXPA 2LAPA 1XFZO 1Y1XA 3NSIA 4L9MA 4XJKA 2IS9A 2M7NA 3I5IC 2E6WA 1S1EA 2LVIA 2A4JA 1IQ3A 4PHMA 1U5IB 2HQ8A 2PALA 2JWWA 3E3RA 2LMTA 3LCPC 1IKUA 3TDUA 1UP5A 3KEVA 1RWYA 3DVEA 1Y6WA 2BL0C 2KQYA 1AHRA 1SYMA 1NX0A 1LA0A 2LNKA 1CLLA 3SIBA 1PRWA 2KFHA 2Y1MA 1FW4A 1JFKA 2JQ6A 2MAZA 4JWQA 1FBVA 5KSZA 4MBEA 3VRPA 4YBHB 4DIRA 1PSBA 1J7QA 3EK4A 2G9BA 3IF7A 1KK7Z 3JTDB 4I5LB 4M2PA 4ORCB 2SCPA 2JXCA 2KAVA 1K9UA 5DKNA 4PCWA 1S5GZ 1NCXA 3SG6A 3EKJA 1B7TZ 2LCPA 3WHTB 1DF0B 1YX7A 2SASA 1BJFA 1OMVA 1L7ZA 2FOTA 4P2YB 1EG3A 1S6CA 4GGFA 2JTTA 4GGNA 1TN4A 2D8NA 4AQIA 3WXAA 1XFYO 1FPWA 1KWOB 4ICBA 1J1EA 3DF0B 1CMFA 1SCVA 2R2IA 3ICBA 1NSHA 2Y4QA 3A4UB 2LVJA 3PLFB 1YVHA 4OV2A 1SRAA 2ZN8A 1QV0A 1ZACA 1QV1A 4YGDB 2LE9B 3F45A 3HX4A 4U8DA 4GFTA 1UURA 5HLVA 1F4QA 2BBNA 2M1UA 2L0PA 1TNPA 1ZOTB 3OHMB 4GPLB 2CT9A 1YUTA 2LMUA 4A4CA 1LVCD 2M49B 1Y1AA 1M63B 2PRUA 3WHUB 4DCKA 1DJHA 1KWOC 2LLUA 1QIWA 4GGFC 1J7PA 2BBMA 2LHIA 1C7WA 2JT8A 4YGCB 1B47A 1X02A 1E8AA 1YURA 1CFDA 5I2QA 3DVKA 1UHKA 4PE7A 4MLWA 2BCXA 5CSFA 2LP2A 1SBJA 3GK1A 1RROA 1ODBA 2EC6B 1JF0A 5CSJA 2L5XB 4A4BA 4DS7A 1DJWA 5ER4X 4GBAA 1A03A 3FWBA 4OCIA 1LINA 1XA5A 2M9GA 4F0ZB 4C0JA 2Y1NA 4NDBA 4ZCUA 3PSRA 1A2XA 1SW8A 2AMIA 2KBMA 1B8RA 4ZCVA 2K7BA 2MLFC 3EK8A 1JUOA 2FCEA 2JZIA 2KQ6A 3I5IB 2G2BA 5DKRA 3EK7A 2M8UA 1MR8A 1DJZA 1QVIZ 4E68A 4XYNA 5I8NA 1JBAA 3I5GB 3CTNA 1IWQA 1DJIA 1DT7B 4I5KA 3CGAA 4WQ3A 5CSNA 1DGUA 2EC6C 2KGBC 3KPXA 4GNKB 1CDMA 3DD4A 1B8CA 1KFXS 2CNPA 2KSPA 3FS7A 3BOWB 1AP4A 1HT9A 5TNCA 2M7LA 1B8LA 1ALVA 3K21A 1SL9A 2M29A 3BUNB 2BCBA 1S6JA 1CDNA 2HF5A 1TNWA 5J3XA 1M39A 2K0JA 2JT0A 3IQQA 1MUXA 5HLOA 2F3ZA 4MZLA 4BY4A 1KFXL 3LLEA 1Y0VH 1K9KA 3BUWB 1TCOB 1NX1A 2K2FA 1SK6D 1S3PA 2Q4UA 2LC5A 1G4YR 2ZNEA 5JJGA 4YGBB 1K93D 4QJ5B 3I5GC 2BCAA 1K8UA 1KK7Y 2K7DA 2F2OA 4XJKB 4PE1A 3HCMA 1DJXA 3I5FB 2JXLA 4R1EA 1IG5A 1XK4C 2LVVA 1OSAA 1DVIA 5CSIA 1KSMA 1J7RA 2HQWA 2KAXA 4WQ2A 1CMGA 1FI6A 2LLSA 1TCFA 3PN7C 3TS5B 2ZKMX 2H61A 3BQ3A 1C7VA 1N2DA 1YRTB 1CFPA 1EXRA 1KFUL 2B1UA 1ALWA 3EKHA 2JULA 2NCPA 2JOJA 2JRFA 2KI6D 1K2HA 1DJYA 1QX2A 3RM1A 3CZTX 3EVUA 4AOMA 3TDZA 1CM1A 1K95A 1G8IA 5B8IB 1PK0D 3PALA 1RJVA 4Q04A 2EHBA 2KFFA 1QATA 3I5FC 2RGIA 2ZRTA 1SPYA 3M0WA 1CFFA 3OP0A 4MRYA 1FI5A 1J55A 1F71A 3O2PA 4D1EA 3AKAA 3VRRA 3JVTC 3TS5C 4PHNA 1UHIA 1PULA 3LK0A 1SL7A 2WNDA 1SMGA 3GK4X 3SG5A 4QJ3B 1MWNA 3BXKA 4ORAB 2LANA 1TIZA 5HKWA 1A75A 2CBLA 2P6BB 2H61C 2PMYA 1AJ4A 3TUYB 5D69A 1SKTA 2LVKA 4CFRA 1DMOA 2HPSA 4GAOA 1XFVO 4YI8A 5PALA 1NP8A 1NWDA 3D0YA 1K90D 1YR5A 2DOQA 1EL4A 1SR6B 2BE4A 3KF9A 4M2QA 1WRZA 4QJ4B 2O5GA 2L4IA 1Y1UA 3BUMB 1NX3A 1M31A 4YRUA 2K7OA 4DUQA 3C1VA 1F4OA 3WNXB 4CPVA 1TNXA 1AJ5A 2BECA 1CLBA 2NZ0A 1JSAA 1UHNA 1QX7A 5ER5A 2AUCA 5DKQA 1VRKA 2MBXA 1AUIB 1BR4B 5CPVA 5AXIA 1V1FA 2GGZA 2KFGA 1K94A 1BODA 1AVSA 1UHJA 3TUYC 1JFJA 3SG3A 1SCMB 3FWCA 1K9PA 4N1GA 1PVBA 1MHOA 2QACA 2BKIB 2K2AA 1DTLA 1WLZA 1SR6C 1KSOA 1NCYA 3H4SE 1QTXA 2KI6C 4TNCA 1SL8A 4PHKA 1DGVA 1QASA 4YGAA 2M3WA 1W7JB 2COLB 1NYAA 4CFQA 2CTNA 2LMVA 1NX2A 2M97A 3LL8B 2JC2A 2E30A 1SY9A 2I18A 3FIAA 2GV5A 2KBIA 1YVLA 3OB2B 4AQJA 2PVBA 4OKHA 5HYDA 1LKJA 2JNXA 1QS7A 1S36A 1FF1A 3BUOB 1GQMA 3PFVA 2CCMA 2KDHA 3GOFA 3NSKA 4I5NB 1ZMZA 4PE4A 2ZNDA 1TOPA 1SCMC 4HREE 1UWOA 3PN7B 4PHJA 3DVJA 1GGZA 2LHLA 3O4YA 2JNFA 3NSOA 1BT6A 1BOCA 1F54A 2K8MB 1EG4A 5I2LA 1H4BA 1SNLA 2WCEA 2GGMA 2KNEA 5AFPA 4PDZA 5I2OA 3PATA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CLN A;  5FYX A;  5GQQ C;  4FTG A;  1BU3 A;  2WOR A;  4WRI A;  1N65 A;  2KGR A;  3TDI A;  1BR1 B;  2OTG C;  1OMR A;  2I7A A;  5KTY A;  1B4C A;  2CXJ A;  3AAJ A;  2BE6 A;  1HQV A;  5JOL A;  1S5G Y;  1BF5 A;  1KFU S;  4DRW A;  2HET A;  2Y5I A;  5HKY A;  1B7T Y;  2JTZ A;  2MA2 A;  2LV7 A;  2F33 A;  1OOJ A;  3IQO A;  5HKZ A;  1CDP A;  1U5I A;  2MHH A;  4NQG A;  4ORB B;  3JVT B;  2JT3 A;  3BYA A;  1TNQ A;  2L4H A;  4BY5 A;  1MXL C;  2KOT A;  2NCO A;  1V1G A;  1YUS A;  3TZ1 A;  4MSP A;  2F2P A;  2Q91 A;  1PSR A;  1XFX O;  3SG2 A;  3VRQ A;  2ZFD A;  1BG1 A;  1WDC B;  1CLM A;  1CFC A;  2L98 A;  4USL A;  1M45 A;  3VRN A;  1MQ1 A;  1KK8 C;  1S6I A;  4N1F A;  3VRO A;  4HRG A;  2M1K B;  4MEW A;  3I5H C;  2K7C A;  4MRX A;  5D7F A;  3DVM A;  3SG7 A;  2VRG A;  1BLQ A;  3SG4 A;  5AEQ A;  1NIW A;  1XVJ A;  5IBW A;  1YRU B;  1W7I B;  1YUU A;  2MRD A;  2AAO A;  3CR4 X;  1DF0 A;  2QPT A;  1IGV A;  3KHE A;  1R2U A;  1OZS A;  1QLK A;  1QX5 B;  1S26 D;  1B9A A;  1CTR A;  1KQM B;  2NXQ A;  2ZRS A;  2MJW B;  1TTX A;  5KU1 A;  1QIV A;  1L2O B;  2ISD A;  4NDC A;  2TN4 A;  2LM5 A;  1WDC C;  3DF0 A;  5AAN A;  1G33 A;  1PAL A;  1QJT A;  2PSR A;  4IL1 A;  5K89 A;  5AER A;  3LK1 A;  3CS1 A;  2M0R A;  2KYC A;  1IJ5 A;  1TRF A;  2PAS A;  3CWG A;  4PAL A;  4YI9 A;  3VGO A;  2FCD A;  3RLZ A;  1WRL A;  1A75 B;  1RTP 1;  2MLE C;  1J1D A;  1ZFS A;  2KAY A;  1M46 A;  1QLS A;  4M2O A;  1F70 A;  1BMO A;  1XFW O;  2LP3 A;  1A29 A;  3JTD C;  2LUX A;  2WOS A;  1NPQ A;  2JPT A;  3BUX B;  1UUS A;  1J7O A;  4JQ0 D;  2LLT A;  3D0Y B;  1NCZ A;  1KQM C;  2I94 A;  2JU0 A;  2V53 A;  1CKK A;  1IH0 A;  4PE0 A;  1JF2 A;  1ZUZ A;  3OB1 B;  2WCF A;  1LXF C;  1L2O C;  1GGW A;  1CB1 A;  3ZNI A;  3SJS A;  4MZJ A;  2I2R E;  3QRX A;  2O60 A;  2KI4 B;  4I5J A;  4P5O E;  1WLM A;  1WY9 A;  2OPO A;  1A4P A;  1QVI Y;  1IQ5 A;  3OX5 A;  1IRJ A;  3D10 A;  1PVA A;  4FQO A;  3GK2 A;  3CR2 A;  2FJU B;  2L2E A;  4CLN A;  3NSL A;  2OS8 B;  3EVR A;  4CID A;  1JWD A;  2L50 A;  4YGE B;  2KHN A;  2H2K A;  1EH2 A;  2BKH B;  4ETO A;  4UPG A;  1GJY A;  1N0Y A;  2OTG B;  1YX8 A;  2F8P A;  1B1G A;  4JPZ B;  2NLN A;  4C0K A;  2K61 A;  1OMD A;  1EJ3 A;  1LA3 A;  1XYD A;  1YTZ C;  3NXA A;  4C0L A;  1MXE A;  1AK8 A;  3A8R A;  2KI4 C;  1R6P A;  5F6T A;  3CR5 X;  1Q80 A;  3SIA A;  1JC2 A;  1H8B A;  1XFU O;  4HSZ A;  4MVF A;  2WCB A;  2EGD A;  3ZWH A;  1NUB A;  2LUC A;  3O6B A;  3AAK A;  2KYF A;  1K96 A;  1XO5 A;  2WC8 A;  3O78 A;  1REC A;  2OS8 C;  5G08 A;  4N5X A;  1WRK A;  3OX6 A;  3EVV A;  2L51 A;  3BOW A;  1XK4 A;  1OE9 B;  2ZN9 A;  4OVN F;  1OZO A;  1DJG A;  1CDL A;  1C07 A;  3AKB A;  4MN0 A;  4MZK A;  1KQV A;  2BL0 B;  1KK8 B;  3I5H B;  4OR9 B;  1CNP A;  1CM4 A;  1RFJ A;  5BPJ A;  1D1O A;  3PM8 A;  3MSE B;  1IJ6 A;  1OQP A;  1RK9 A;  4GUK A;  1UHH A;  4HRH A;  3KO0 A;  1F8H A;  1KCY A;  4NDD A;  1MF8 B;  2F3Y A;  1F55 A;  1QXP A;  2LAP A;  1XFZ O;  1Y1X A;  3NSI A;  4L9M A;  4XJK A;  2IS9 A;  2M7N A;  3I5I C;  2E6W A;  1S1E A;  2LVI A;  2A4J A;  1IQ3 A;  4PHM A;  1U5I B;  2HQ8 A;  2PAL A;  2JWW A;  3E3R A;  2LMT A;  3LCP C;  1IKU A;  3TDU A;  1UP5 A;  3KEV A;  1RWY A;  3DVE A;  1Y6W A;  2BL0 C;  2KQY A;  1AHR A;  1SYM A;  1NX0 A;  1LA0 A;  2LNK A;  1CLL A;  3SIB A;  1PRW A;  2KFH A;  2Y1M A;  1FW4 A;  1JFK A;  2JQ6 A;  2MAZ A;  4JWQ A;  1FBV A;  5KSZ A;  4MBE A;  3VRP A;  4YBH B;  4DIR A;  1PSB A;  1J7Q A;  3EK4 A;  2G9B A;  3IF7 A;  1KK7 Z;  3JTD B;  4I5L B;  4M2P A;  4ORC B;  2SCP A;  2JXC A;  2KAV A;  1K9U A;  5DKN A;  4PCW A;  1S5G Z;  1NCX A;  3SG6 A;  3EKJ A;  1B7T Z;  2LCP A;  3WHT B;  1DF0 B;  1YX7 A;  2SAS A;  1BJF A;  1OMV A;  1L7Z A;  2FOT A;  4P2Y B;  1EG3 A;  1S6C A;  4GGF A;  2JTT A;  4GGN A;  1TN4 A;  2D8N A;  4AQI A;  3WXA A;  1XFY O;  1FPW A;  1KWO B;  4ICB A;  1J1E A;  3DF0 B;  1CMF A;  1SCV A;  2R2I A;  3ICB A;  1NSH A;  2Y4Q A;  3A4U B;  2LVJ A;  3PLF B;  1YVH A;  4OV2 A;  1SRA A;  2ZN8 A;  1QV0 A;  1ZAC A;  1QV1 A;  4YGD B;  2LE9 B;  3F45 A;  3HX4 A;  4U8D A;  4GFT A;  1UUR A;  5HLV A;  1F4Q A;  2BBN A;  2M1U A;  2L0P A;  1TNP A;  1ZOT B;  3OHM B;  4GPL B;  2CT9 A;  1YUT A;  2LMU A;  4A4C A;  1LVC D;  2M49 B;  1Y1A A;  1M63 B;  2PRU A;  3WHU B;  4DCK A;  1DJH A;  1KWO C;  2LLU A;  1QIW A;  4GGF C;  1J7P A;  2BBM A;  2LHI A;  1C7W A;  2JT8 A;  4YGC B;  1B47 A;  1X02 A;  1E8A A;  1YUR A;  1CFD A;  5I2Q A;  3DVK A;  1UHK A;  4PE7 A;  4MLW A;  2BCX A;  5CSF A;  2LP2 A;  1SBJ A;  3GK1 A;  1RRO A;  1ODB A;  2EC6 B;  1JF0 A;  5CSJ A;  2L5X B;  4A4B A;  4DS7 A;  1DJW A;  5ER4 X;  4GBA A;  1A03 A;  3FWB A;  4OCI A;  1LIN A;  1XA5 A;  2M9G A;  4F0Z B;  4C0J A;  2Y1N A;  4NDB A;  4ZCU A;  3PSR A;  1A2X A;  1SW8 A;  2AMI A;  2KBM A;  1B8R A;  4ZCV A;  2K7B A;  2MLF C;  3EK8 A;  1JUO A;  2FCE A;  2JZI A;  2KQ6 A;  3I5I B;  2G2B A;  5DKR A;  3EK7 A;  2M8U A;  1MR8 A;  1DJZ A;  1QVI Z;  4E68 A;  4XYN A;  5I8N A;  1JBA A;  3I5G B;  3CTN A;  1IWQ A;  1DJI A;  1DT7 B;  4I5K A;  3CGA A;  4WQ3 A;  5CSN A;  1DGU A;  2EC6 C;  2KGB C;  3KPX A;  4GNK B;  1CDM A;  3DD4 A;  1B8C A;  1KFX S;  2CNP A;  2KSP A;  3FS7 A;  3BOW B;  1AP4 A;  1HT9 A;  5TNC A;  2M7L A;  1B8L A;  1ALV A;  3K21 A;  1SL9 A;  2M29 A;  3BUN B;  2BCB A;  1S6J A;  1CDN A;  2HF5 A;  1TNW A;  5J3X A;  1M39 A;  2K0J A;  2JT0 A;  3IQQ A;  1MUX A;  5HLO A;  2F3Z A;  4MZL A;  4BY4 A;  1KFX L;  3LLE A;  1Y0V H;  1K9K A;  3BUW B;  1TCO B;  1NX1 A;  2K2F A;  1SK6 D;  1S3P A;  2Q4U A;  2LC5 A;  1G4Y R;  2ZNE A;  5JJG A;  4YGB B;  1K93 D;  4QJ5 B;  3I5G C;  2BCA A;  1K8U A;  1KK7 Y;  2K7D A;  2F2O A;  4XJK B;  4PE1 A;  3HCM A;  1DJX A;  3I5F B;  2JXL A;  4R1E A;  1IG5 A;  1XK4 C;  2LVV A;  1OSA A;  1DVI A;  5CSI A;  1KSM A;  1J7R A;  2HQW A;  2KAX A;  4WQ2 A;  1CMG A;  1FI6 A;  2LLS A;  1TCF A;  3PN7 C;  3TS5 B;  2ZKM X;  2H61 A;  3BQ3 A;  1C7V A;  1N2D A;  1YRT B;  1CFP A;  1EXR A;  1KFU L;  2B1U A;  1ALW A;  3EKH A;  2JUL A;  2NCP A;  2JOJ A;  2JRF A;  2KI6 D;  1K2H A;  1DJY A;  1QX2 A;  3RM1 A;  3CZT X;  3EVU A;  4AOM A;  3TDZ A;  1CM1 A;  1K95 A;  1G8I A;  5B8I B;  1PK0 D;  3PAL A;  1RJV A;  4Q04 A;  2EHB A;  2KFF A;  1QAT A;  3I5F C;  2RGI A;  2ZRT A;  1SPY A;  3M0W A;  1CFF A;  3OP0 A;  4MRY A;  1FI5 A;  1J55 A;  1F71 A;  3O2P A;  4D1E A;  3AKA A;  3VRR A;  3JVT C;  3TS5 C;  4PHN A;  1UHI A;  1PUL A;  3LK0 A;  1SL7 A;  2WND A;  1SMG A;  3GK4 X;  3SG5 A;  4QJ3 B;  1MWN A;  3BXK A;  4ORA B;  2LAN A;  1TIZ A;  5HKW A;  1A75 A;  2CBL A;  2P6B B;  2H61 C;  2PMY A;  1AJ4 A;  3TUY B;  5D69 A;  1SKT A;  2LVK A;  4CFR A;  1DMO A;  2HPS A;  4GAO A;  1XFV O;  4YI8 A;  5PAL A;  1NP8 A;  1NWD A;  3D0Y A;  1K90 D;  1YR5 A;  2DOQ A;  1EL4 A;  1SR6 B;  2BE4 A;  3KF9 A;  4M2Q A;  1WRZ A;  4QJ4 B;  2O5G A;  2L4I A;  1Y1U A;  3BUM B;  1NX3 A;  1M31 A;  4YRU A;  2K7O A;  4DUQ A;  3C1V A;  1F4O A;  3WNX B;  4CPV A;  1TNX A;  1AJ5 A;  2BEC A;  1CLB A;  2NZ0 A;  1JSA A;  1UHN A;  1QX7 A;  5ER5 A;  2AUC A;  5DKQ A;  1VRK A;  2MBX A;  1AUI B;  1BR4 B;  5CPV A;  5AXI A;  1V1F A;  2GGZ A;  2KFG A;  1K94 A;  1BOD A;  1AVS A;  1UHJ A;  3TUY C;  1JFJ A;  3SG3 A;  1SCM B;  3FWC A;  1K9P A;  4N1G A;  1PVB A;  1MHO A;  2QAC A;  2BKI B;  2K2A A;  1DTL A;  1WLZ A;  1SR6 C;  1KSO A;  1NCY A;  3H4S E;  1QTX A;  2KI6 C;  4TNC A;  1SL8 A;  4PHK A;  1DGV A;  1QAS A;  4YGA A;  2M3W A;  1W7J B;  2COL B;  1NYA A;  4CFQ A;  2CTN A;  2LMV A;  1NX2 A;  2M97 A;  3LL8 B;  2JC2 A;  2E30 A;  1SY9 A;  2I18 A;  3FIA A;  2GV5 A;  2KBI A;  1YVL A;  3OB2 B;  4AQJ A;  2PVB A;  4OKH A;  5HYD A;  1LKJ A;  2JNX A;  1QS7 A;  1S36 A;  1FF1 A;  3BUO B;  1GQM A;  3PFV A;  2CCM A;  2KDH A;  3GOF A;  3NSK A;  4I5N B;  1ZMZ A;  4PE4 A;  2ZND A;  1TOP A;  1SCM C;  4HRE E;  1UWO A;  3PN7 B;  4PHJ A;  3DVJ A;  1GGZ A;  2LHL A;  3O4Y A;  2JNF A;  3NSO A;  1BT6 A;  1BOC A;  1F54 A;  2K8M B;  1EG4 A;  5I2L A;  1H4B A;  1SNL A;  2WCE A;  2GGM A;  2KNE A;  5AFP A;  4PDZ A;  5I2O A;  3PAT A; 
#chains in the Genus database with same CATH topology
 3CLN A;  5FYX A;  5GQQ C;  2L5Y A;  4FTG A;  1BU3 A;  2WOR A;  4WRI A;  1N65 A;  2KGR A;  3SS5 A;  1BR1 B;  3TDI A;  2OTG C;  1OMR A;  2I7A A;  5KTY A;  1B4C A;  3R1P A;  2CXJ A;  3L4L A;  5FI6 A;  3AAJ A;  2BE6 A;  4OZD A;  1HQV A;  5JOL A;  1S5G Y;  1BF5 A;  3B86 A;  1KFU S;  4DRW A;  2HET A;  1W9Z A;  2Y5I A;  5HKY A;  1B7T Y;  2JTZ A;  2MA2 A;  2LV7 A;  2F33 A;  1OOJ A;  2WCM A;  3IQO A;  5HKZ A;  1CDP A;  2K60 A;  1U5I A;  2MHH A;  2P71 A;  4NQG A;  4ORB B;  3JVT B;  2JT3 A;  3BYA A;  1TNQ A;  2L4H A;  2GTE A;  1MXL C;  3S0B A;  2KOT A;  4BY5 A;  3NGV A;  2NCO A;  1V1G A;  1YUS A;  3TZ1 A;  4MSP A;  2F2P A;  2Q91 A;  1PSR A;  1XFX O;  3SG2 A;  3VRQ A;  2ZFD A;  1BG1 A;  1WDC B;  1CLM A;  3CZ2 A;  1CFC A;  2L98 A;  4USL A;  1M45 A;  5D3O A;  3S0D A;  3VRN A;  1MQ1 A;  1KK8 C;  1S6I A;  4N1F A;  3SS4 A;  4HRG A;  2M1K B;  3VRO A;  4MEW A;  3I5H C;  2K7C A;  4MRX A;  5D7F A;  3DVM A;  3BJH A;  2VRG A;  3FE8 A;  3NHI A;  3SG4 A;  3D73 A;  3SG7 A;  1BLQ A;  5AEQ A;  1NIW A;  1XVJ A;  5IBW A;  1YRU B;  1W7I B;  1YUU A;  2MRD A;  2AAO A;  3CR4 X;  1DF0 A;  1T14 A;  2QPT A;  3V2L A;  1IGV A;  3KHE A;  1R2U A;  3O4X A;  1OZS A;  1QLK A;  1QX5 B;  1S26 D;  1B9A A;  1CTR A;  1KQM B;  2NXQ A;  2ZRS A;  2MJW B;  1TTX A;  5KU1 A;  1QIV A;  1L2O B;  2ISD A;  4NDC A;  2TN4 A;  2LM5 A;  1WDC C;  3DF0 A;  5AAN A;  1G33 A;  1PAL A;  1QJT A;  2PSR A;  4IL1 A;  5K89 A;  5AER A;  3LK1 A;  3CS1 A;  2M0R A;  2KYC A;  1IJ5 A;  1TRF A;  2PAS A;  3CWG A;  4PAL A;  4YI9 A;  3VGO A;  2FCD A;  3RLZ A;  1WRL A;  1A75 B;  1QWV A;  1RTP 1;  1J1D A;  2MLE C;  1ZFS A;  3PJI A;  2KAY A;  5EL2 A;  1M46 A;  1QLS A;  3D77 A;  4INX A;  1BMO A;  1XFW O;  3R1O A;  4M2O A;  2LP3 A;  1F70 A;  1A29 A;  3JTD C;  2LUX A;  2WOS A;  1NPQ A;  1OOI X;  2JPT A;  1UUS A;  3BUX B;  4JQ0 D;  1J7O A;  2LLT A;  1ORG A;  3D0Y B;  1NCZ A;  1KQM C;  2I94 A;  2JU0 A;  2V53 A;  1CKK A;  1IH0 A;  4PE0 A;  1JF2 A;  1ZUZ A;  3OB1 B;  2WCF A;  1LXF C;  1L2O C;  1OOH A;  1CB1 A;  1GGW A;  3ZNI A;  3SJS A;  4MZJ A;  2I2R E;  3QRX A;  2O60 A;  2KI4 B;  4FQT A;  4I5J A;  1WLM A;  1WY9 A;  4P5O E;  2OPO A;  1A4P A;  1QVI Y;  1IIO A;  1IQ5 A;  3OX5 A;  1IRJ A;  3D10 A;  3UNW A;  1PVA A;  4FQO A;  3GK2 A;  3CR2 A;  2FJU B;  2L2E A;  4CLN A;  3NSL A;  2OS8 B;  3EVR A;  4CID A;  3D78 A;  3S0F A;  1JWD A;  2L50 A;  4YGE B;  2KHN A;  2H2K A;  1EH2 A;  2BKH B;  4PT1 A;  4ETO A;  4UPG A;  1GJY A;  3S0E A;  1C3Y A;  3L47 A;  1N0Y A;  2OTG B;  1YX8 A;  2F8P A;  1B1G A;  4JPZ B;  2NLN A;  4IJ7 A;  4C0K A;  2K61 A;  1OMD A;  1EJ3 A;  1LA3 A;  1XYD A;  1YTZ C;  3NXA A;  3R72 A;  4C0L A;  1MXE A;  1AK8 A;  3A8R A;  2KI4 C;  1R6P A;  5F6T A;  3CR5 X;  1Q80 A;  2PYQ A;  3FE6 A;  3SIA A;  1JC2 A;  1H8B A;  1XFU O;  1XFR A;  4HSZ A;  4MVF A;  2WCB A;  2EGD A;  3ZWH A;  1NUB A;  2LUC A;  3O6B A;  3AAK A;  2P70 A;  2KYF A;  1K96 A;  1XO5 A;  2WC8 A;  3O78 A;  1REC A;  2OS8 C;  5G08 A;  4N5X A;  1WRK A;  3OX6 A;  3EVV A;  2L51 A;  3BOW A;  1XK4 A;  1OE9 B;  2ZN9 A;  4OVN F;  1OZO A;  1DJG A;  1CDL A;  3R1V A;  1C07 A;  3AKB A;  4MN0 A;  4MZK A;  3DZT A;  1KQV A;  2BL0 B;  1KK8 B;  1DQE A;  3I5H B;  3EG5 B;  4OR9 B;  1CNP A;  1CM4 A;  1RFJ A;  5BPJ A;  1D1O A;  3PM8 A;  3MSE B;  3UO9 A;  1IJ6 A;  1OQP A;  1RK9 A;  4GUK A;  1UHH A;  4HRH A;  3KO0 A;  1F8H A;  1KCY A;  4NDD A;  1MF8 B;  2F3Y A;  1F55 A;  1QXP A;  2LAP A;  1XFZ O;  1Y1X A;  3NSI A;  4L9M A;  4XJK A;  2IS9 A;  2M7N A;  3I5I C;  2E6W A;  1S1E A;  2LVI A;  2A4J A;  1IQ3 A;  4PHM A;  1U5I B;  2HQ8 A;  2PAL A;  2JWW A;  3E3R A;  2LMT A;  3LCP C;  1IKU A;  2QEB A;  5I94 A;  3TDU A;  1UP5 A;  3KEV A;  1RWY A;  3DVE A;  1Y6W A;  2BL0 C;  2KQY A;  1AHR A;  1SYM A;  1NX0 A;  1LA0 A;  2LNK A;  1CLL A;  3SIB A;  1PRW A;  2KFH A;  2Y1M A;  5DIC A;  1FW4 A;  1JFK A;  2JQ6 A;  2MAZ A;  4JWQ A;  1FBV A;  5KSZ A;  4MBE A;  3VRP A;  4YBH B;  4DIR A;  1PSB A;  1J7Q A;  3EK4 A;  2G9B A;  3IF7 A;  1KK7 Z;  3JTD B;  4I5L B;  4M2P A;  4ORC B;  2SCP A;  2JXC A;  2KAV A;  1K9U A;  5DKN A;  4PCW A;  1S5G Z;  1NCX A;  3SG6 A;  3EKJ A;  1B7T Z;  2LCP A;  3WHT B;  1DF0 B;  1YX7 A;  1TUZ A;  1BJF A;  1OMV A;  1L7Z A;  2FOT A;  2SAS A;  1EG3 A;  1S6C A;  4GGF A;  4P2Y B;  2JTT A;  4GGN A;  1DC1 A;  1TN4 A;  2WCH A;  2D8N A;  4AQI A;  3WXA A;  1XFY O;  1FPW A;  1KWO B;  2QEO A;  1J1E A;  3DF0 B;  4ICB A;  1SCV A;  2R2I A;  1CMF A;  3ICB A;  1NSH A;  2BNX A;  2QEH A;  2LVJ A;  2Y4Q A;  3A4U B;  1P28 A;  3DXL A;  3PLF B;  1YVH A;  3PM2 A;  4OV2 A;  1SRA A;  2ZN8 A;  4F7F A;  1QV0 A;  1ZAC A;  1QV1 A;  4YGD B;  2PQL A;  2LE9 B;  3F45 A;  3HX4 A;  2WC6 A;  4U8D A;  4GFT A;  1UUR A;  4INW A;  5HLV A;  3B6X A;  1F4Q A;  1TWO A;  2BAP A;  2BBN A;  2M1U A;  2L0P A;  1TNP A;  1ZOT B;  3OHM B;  4GPL B;  2CT9 A;  1YUT A;  2LMU A;  4A4C A;  1LVC D;  2M49 B;  1Y1A A;  1M63 B;  2ERB A;  2PRU A;  3WHU B;  3RZS A;  4DCK A;  1DJH A;  1KWO C;  2LLU A;  1QIW A;  4GGF C;  1J7P A;  2BBM A;  2LHI A;  3B7A A;  3BFB A;  1C7W A;  2JT8 A;  4YGC B;  1B47 A;  1X02 A;  1E8A A;  1YUR A;  1CFD A;  5I2Q A;  3DVK A;  1UHK A;  4PE7 A;  4MLW A;  2BCX A;  5CSF A;  2LP2 A;  1SBJ A;  1TUJ A;  1RRO A;  3GK1 A;  1ODB A;  2EC6 B;  1JF0 A;  5CSJ A;  2L5X B;  4A4B A;  3SS3 A;  1DJW A;  5ER4 X;  4DS7 A;  4GBA A;  1A03 A;  3FWB A;  4OCI A;  1LIN A;  1XA5 A;  2M9G A;  4F0Z B;  4C0J A;  2Y1N A;  4NDB A;  4ZCU A;  1SSE B;  3PSR A;  1LS8 A;  1A2X A;  1SW8 A;  2AMI A;  2KBM A;  2WCK A;  1B8R A;  4ZCV A;  2K7B A;  2MLF C;  3EK8 A;  1JUO A;  2FCE A;  2WC5 A;  2JZI A;  2WCL A;  2KQ6 A;  3I5I B;  2G2B A;  5DKR A;  3EK7 A;  2M8U A;  1MR8 A;  1DJZ A;  1QVI Z;  4E68 A;  4XYN A;  5I8N A;  5FI7 A;  1JBA A;  2YGU A;  3I5G B;  3CTN A;  3NHT A;  5HL1 A;  1IWQ A;  5FI2 A;  1DJI A;  1DT7 B;  4I5K A;  3CGA A;  4WQ3 A;  5CSN A;  1DGU A;  2EC6 C;  2KGB C;  2KPH A;  3KPX A;  4GNK B;  1CDM A;  3DD4 A;  1B8C A;  1KFX S;  2CNP A;  2KSP A;  3FS7 A;  3BOW B;  1AP4 A;  1HT9 A;  5TNC A;  2M7L A;  1B8L A;  4JD9 A;  1ALV A;  3K21 A;  1SL9 A;  2M29 A;  2L2C A;  3BUN B;  2BCB A;  1S6J A;  1CDN A;  2HF5 A;  1TNW A;  5J3X A;  1M39 A;  2K0J A;  2JT0 A;  3L4A A;  3IQQ A;  3OGN A;  3S0G A;  1MUX A;  5HLO A;  2F3Z A;  3N7H A;  4MZL A;  4BY4 A;  1KFX L;  3LLE A;  2FJY A;  1Y0V H;  1K9K A;  3BUW B;  1TCO B;  1NX1 A;  2K2F A;  1SK6 D;  1S3P A;  2Q4U A;  2LC5 A;  1G4Y R;  2ZNE A;  5JJG A;  4YGB B;  1K93 D;  4QJ5 B;  3I5G C;  2BCA A;  3S0A A;  1K8U A;  1KK7 Y;  2K7D A;  2F2O A;  4XJK B;  4PE1 A;  3HCM A;  2KLD A;  1DJX A;  3I5F B;  2JXL A;  4R1E A;  1Z2C B;  1IG5 A;  1XK4 C;  2LVV A;  1OSA A;  1DVI A;  5CSI A;  1KSM A;  3D75 A;  1J7R A;  2HQW A;  2KAX A;  4WQ2 A;  1CMG A;  1FI6 A;  2LLS A;  1TCF A;  3PN7 C;  4KYN A;  3TS5 B;  2ZKM X;  2H61 A;  3BQ3 A;  1C7V A;  1N2D A;  1YRT B;  1CFP A;  1EXR A;  1KFU L;  2B1U A;  1ALW A;  3EKH A;  2JUL A;  2NCP A;  2JOJ A;  2JRF A;  2KI6 D;  1K2H A;  1DJY A;  1QX2 A;  3RM1 A;  3CZT X;  3EVU A;  4AOM A;  3TDZ A;  1CM1 A;  1K95 A;  1G8I A;  5B8I B;  2WCJ A;  3DYE A;  1PK0 D;  3CZ0 A;  1RJV A;  3PAL A;  4Q04 A;  2EHB A;  2KFF A;  3B88 A;  1QAT A;  3I5F C;  2RGI A;  2ZRT A;  1SPY A;  3CDN A;  3M0W A;  3OP0 A;  1CFF A;  4MRY A;  1FI5 A;  1J55 A;  3BFA A;  1F71 A;  3CYZ A;  3O2P A;  2KLE A;  4D1E A;  3AKA A;  3VRR A;  3JVT C;  3TS5 C;  1OOG A;  1UHI A;  1PUL A;  4PHN A;  3LK0 A;  1SL7 A;  2WND A;  3B87 A;  1SMG A;  3GK4 X;  3SG5 A;  4QJ3 B;  1MWN A;  3BXK A;  4ORA B;  2LAN A;  1TIZ A;  5HKW A;  1A75 A;  2CBL A;  2P6B B;  2H61 C;  2PMY A;  1AJ4 A;  3TUY B;  5D69 A;  1SKT A;  2LVK A;  4CFR A;  1DMO A;  2HPS A;  4GAO A;  1XFV O;  4YI8 A;  5PAL A;  1NP8 A;  1NWD A;  3D0Y A;  1K90 D;  1YR5 A;  2DOQ A;  1EL4 A;  1SR6 B;  2BE4 A;  3K1E A;  3KF9 A;  4M2Q A;  1WRZ A;  4QJ4 B;  2O5G A;  2L4I A;  1Y1U A;  3BUM B;  1OW4 A;  1NX3 A;  1M31 A;  4YRU A;  2K7O A;  4DUQ A;  3C1V A;  1F4O A;  3WNX B;  4CPV A;  1TNX A;  1AJ5 A;  2BEC A;  1OOF A;  1CLB A;  2NZ0 A;  1GM0 A;  1JSA A;  1UHN A;  1QX7 A;  4JKT A;  5ER5 A;  2H8V A;  3VB1 A;  2AUC A;  5DKQ A;  1VRK A;  2MBX A;  1C3Z A;  1Z4H A;  1AUI B;  1BR4 B;  5CPV A;  5AXI A;  1V1F A;  2GGZ A;  2KFG A;  3D76 A;  1K94 A;  1BOD A;  1AVS A;  1UHJ A;  3TUY C;  1JFJ A;  3SG3 A;  1SCM B;  3FWC A;  1K9P A;  3OBV A;  4N1G A;  1PVB A;  1MHO A;  2QAC A;  3Q8I A;  2BKI B;  2K2A A;  1DTL A;  1WLZ A;  1SR6 C;  1KSO A;  1NCY A;  3H4S E;  1QTX A;  2KI6 C;  4TNC A;  1SL8 A;  4PHK A;  1DGV A;  1QAS A;  4YGA A;  2M3W A;  1W7J B;  2COL B;  1NYA A;  4CFQ A;  2CTN A;  2LMV A;  1NX2 A;  2M97 A;  3LL8 B;  2JC2 A;  2E30 A;  1SY9 A;  2I18 A;  3FIA A;  3CAB A;  2GV5 A;  2KBI A;  1YVL A;  1DEL A;  3OB2 B;  4AQJ A;  2PVB A;  4OKH A;  5HYD A;  1LKJ A;  2JNX A;  1QS7 A;  1S36 A;  1DEK A;  1FF1 A;  3BUO B;  1GQM A;  3PFV A;  2CCM A;  2KDH A;  3GOF A;  3IVT A;  3NSK A;  4I5N B;  1ZMZ A;  3CZ1 A;  4PE4 A;  2ZND A;  1TOP A;  1SCM C;  2QEV A;  2JPO A;  4HRE E;  3QME A;  1UWO A;  3PN7 B;  4PHJ A;  3DVJ A;  1GGZ A;  2LHL A;  2QDI A;  2JNF A;  3NSO A;  3O4Y A;  1BT6 A;  1BOC A;  3FE9 A;  3DY9 A;  2K8M B;  1F54 A;  1EG4 A;  5I2L A;  1H4B A;  1SNL A;  2WCE A;  2GGM A;  2KNE A;  3BFH A;  3D74 A;  4PDZ A;  5AFP A;  5I2O A;  3PAT A; 
#chains in the Genus database with same CATH homology
 3CLN A;  5FYX A;  5GQQ C;  4FTG A;  1BU3 A;  2WOR A;  4WRI A;  1N65 A;  2KGR A;  3TDI A;  1BR1 B;  2OTG C;  1OMR A;  2I7A A;  5KTY A;  1B4C A;  2CXJ A;  3AAJ A;  2BE6 A;  1HQV A;  5JOL A;  1S5G Y;  1BF5 A;  1KFU S;  4DRW A;  2HET A;  2Y5I A;  5HKY A;  1B7T Y;  2JTZ A;  2MA2 A;  2LV7 A;  2F33 A;  1OOJ A;  3IQO A;  5HKZ A;  1CDP A;  1U5I A;  2MHH A;  4NQG A;  4ORB B;  3JVT B;  2JT3 A;  3BYA A;  1TNQ A;  2L4H A;  4BY5 A;  1MXL C;  2KOT A;  2NCO A;  1V1G A;  1YUS A;  3TZ1 A;  4MSP A;  2F2P A;  2Q91 A;  1PSR A;  1XFX O;  3SG2 A;  3VRQ A;  2ZFD A;  1BG1 A;  1WDC B;  1CLM A;  1CFC A;  2L98 A;  4USL A;  1M45 A;  3VRN A;  1MQ1 A;  1KK8 C;  1S6I A;  4N1F A;  3VRO A;  4HRG A;  2M1K B;  4MEW A;  3I5H C;  2K7C A;  4MRX A;  5D7F A;  3DVM A;  3SG7 A;  2VRG A;  1BLQ A;  3SG4 A;  5AEQ A;  1NIW A;  1XVJ A;  5IBW A;  1YRU B;  1W7I B;  1YUU A;  2MRD A;  2AAO A;  3CR4 X;  1DF0 A;  2QPT A;  1IGV A;  3KHE A;  1R2U A;  1OZS A;  1QLK A;  1QX5 B;  1S26 D;  1B9A A;  1CTR A;  1KQM B;  2NXQ A;  2ZRS A;  2MJW B;  1TTX A;  5KU1 A;  1QIV A;  1L2O B;  2ISD A;  4NDC A;  2TN4 A;  2LM5 A;  1WDC C;  3DF0 A;  5AAN A;  1G33 A;  1PAL A;  1QJT A;  2PSR A;  4IL1 A;  5K89 A;  5AER A;  3LK1 A;  3CS1 A;  2M0R A;  2KYC A;  1IJ5 A;  1TRF A;  2PAS A;  3CWG A;  4PAL A;  4YI9 A;  3VGO A;  2FCD A;  3RLZ A;  1WRL A;  1A75 B;  1RTP 1;  2MLE C;  1J1D A;  1ZFS A;  2KAY A;  1M46 A;  1QLS A;  4M2O A;  1F70 A;  1BMO A;  1XFW O;  2LP3 A;  1A29 A;  3JTD C;  2LUX A;  2WOS A;  1NPQ A;  2JPT A;  3BUX B;  1UUS A;  1J7O A;  4JQ0 D;  2LLT A;  3D0Y B;  1NCZ A;  1KQM C;  2I94 A;  2JU0 A;  2V53 A;  1CKK A;  1IH0 A;  4PE0 A;  1JF2 A;  1ZUZ A;  3OB1 B;  2WCF A;  1LXF C;  1L2O C;  1GGW A;  1CB1 A;  3ZNI A;  3SJS A;  4MZJ A;  2I2R E;  3QRX A;  2O60 A;  2KI4 B;  4I5J A;  4P5O E;  1WLM A;  1WY9 A;  2OPO A;  1A4P A;  1QVI Y;  1IQ5 A;  3OX5 A;  1IRJ A;  3D10 A;  1PVA A;  4FQO A;  3GK2 A;  3CR2 A;  2FJU B;  2L2E A;  4CLN A;  3NSL A;  2OS8 B;  3EVR A;  4CID A;  1JWD A;  2L50 A;  4YGE B;  2KHN A;  2H2K A;  1EH2 A;  2BKH B;  4ETO A;  4UPG A;  1GJY A;  1N0Y A;  2OTG B;  1YX8 A;  2F8P A;  1B1G A;  4JPZ B;  2NLN A;  4C0K A;  2K61 A;  1OMD A;  1EJ3 A;  1LA3 A;  1XYD A;  1YTZ C;  3NXA A;  4C0L A;  1MXE A;  1AK8 A;  3A8R A;  2KI4 C;  1R6P A;  5F6T A;  3CR5 X;  1Q80 A;  3SIA A;  1JC2 A;  1H8B A;  1XFU O;  4HSZ A;  4MVF A;  2WCB A;  2EGD A;  3ZWH A;  1NUB A;  2LUC A;  3O6B A;  3AAK A;  2KYF A;  1K96 A;  1XO5 A;  2WC8 A;  3O78 A;  1REC A;  2OS8 C;  5G08 A;  4N5X A;  1WRK A;  3OX6 A;  3EVV A;  2L51 A;  3BOW A;  1XK4 A;  1OE9 B;  2ZN9 A;  4OVN F;  1OZO A;  1DJG A;  1CDL A;  1C07 A;  3AKB A;  4MN0 A;  4MZK A;  1KQV A;  2BL0 B;  1KK8 B;  3I5H B;  4OR9 B;  1CNP A;  1CM4 A;  1RFJ A;  5BPJ A;  1D1O A;  3PM8 A;  3MSE B;  1IJ6 A;  1OQP A;  1RK9 A;  4GUK A;  1UHH A;  4HRH A;  3KO0 A;  1F8H A;  1KCY A;  4NDD A;  1MF8 B;  2F3Y A;  1F55 A;  1QXP A;  2LAP A;  1XFZ O;  1Y1X A;  3NSI A;  4L9M A;  4XJK A;  2IS9 A;  2M7N A;  3I5I C;  2E6W A;  1S1E A;  2LVI A;  2A4J A;  1IQ3 A;  4PHM A;  1U5I B;  2HQ8 A;  2PAL A;  2JWW A;  3E3R A;  2LMT A;  3LCP C;  1IKU A;  3TDU A;  1UP5 A;  3KEV A;  1RWY A;  3DVE A;  1Y6W A;  2BL0 C;  2KQY A;  1AHR A;  1SYM A;  1NX0 A;  1LA0 A;  2LNK A;  1CLL A;  3SIB A;  1PRW A;  2KFH A;  2Y1M A;  1FW4 A;  1JFK A;  2JQ6 A;  2MAZ A;  4JWQ A;  1FBV A;  5KSZ A;  4MBE A;  3VRP A;  4YBH B;  4DIR A;  1PSB A;  1J7Q A;  3EK4 A;  2G9B A;  3IF7 A;  1KK7 Z;  3JTD B;  4I5L B;  4M2P A;  4ORC B;  2SCP A;  2JXC A;  2KAV A;  1K9U A;  5DKN A;  4PCW A;  1S5G Z;  1NCX A;  3SG6 A;  3EKJ A;  1B7T Z;  2LCP A;  3WHT B;  1DF0 B;  1YX7 A;  2SAS A;  1BJF A;  1OMV A;  1L7Z A;  2FOT A;  4P2Y B;  1EG3 A;  1S6C A;  4GGF A;  2JTT A;  4GGN A;  1TN4 A;  2D8N A;  4AQI A;  3WXA A;  1XFY O;  1FPW A;  1KWO B;  4ICB A;  1J1E A;  3DF0 B;  1CMF A;  1SCV A;  2R2I A;  3ICB A;  1NSH A;  2Y4Q A;  3A4U B;  2LVJ A;  3PLF B;  1YVH A;  4OV2 A;  1SRA A;  2ZN8 A;  1QV0 A;  1ZAC A;  1QV1 A;  4YGD B;  2LE9 B;  3F45 A;  3HX4 A;  4U8D A;  4GFT A;  1UUR A;  5HLV A;  1F4Q A;  2BBN A;  2M1U A;  2L0P A;  1TNP A;  1ZOT B;  3OHM B;  4GPL B;  2CT9 A;  1YUT A;  2LMU A;  4A4C A;  1LVC D;  2M49 B;  1Y1A A;  1M63 B;  2PRU A;  3WHU B;  4DCK A;  1DJH A;  1KWO C;  2LLU A;  1QIW A;  4GGF C;  1J7P A;  2BBM A;  2LHI A;  1C7W A;  2JT8 A;  4YGC B;  1B47 A;  1X02 A;  1E8A A;  1YUR A;  1CFD A;  5I2Q A;  3DVK A;  1UHK A;  4PE7 A;  4MLW A;  2BCX A;  5CSF A;  2LP2 A;  1SBJ A;  3GK1 A;  1RRO A;  1ODB A;  2EC6 B;  1JF0 A;  5CSJ A;  2L5X B;  4A4B A;  4DS7 A;  1DJW A;  5ER4 X;  4GBA A;  1A03 A;  3FWB A;  4OCI A;  1LIN A;  1XA5 A;  2M9G A;  4F0Z B;  4C0J A;  2Y1N A;  4NDB A;  4ZCU A;  3PSR A;  1A2X A;  1SW8 A;  2AMI A;  2KBM A;  1B8R A;  4ZCV A;  2K7B A;  2MLF C;  3EK8 A;  1JUO A;  2FCE A;  2JZI A;  2KQ6 A;  3I5I B;  2G2B A;  5DKR A;  3EK7 A;  2M8U A;  1MR8 A;  1DJZ A;  1QVI Z;  4E68 A;  4XYN A;  5I8N A;  1JBA A;  3I5G B;  3CTN A;  1IWQ A;  1DJI A;  1DT7 B;  4I5K A;  3CGA A;  4WQ3 A;  5CSN A;  1DGU A;  2EC6 C;  2KGB C;  3KPX A;  4GNK B;  1CDM A;  3DD4 A;  1B8C A;  1KFX S;  2CNP A;  2KSP A;  3FS7 A;  3BOW B;  1AP4 A;  1HT9 A;  5TNC A;  2M7L A;  1B8L A;  1ALV A;  3K21 A;  1SL9 A;  2M29 A;  3BUN B;  2BCB A;  1S6J A;  1CDN A;  2HF5 A;  1TNW A;  5J3X A;  1M39 A;  2K0J A;  2JT0 A;  3IQQ A;  1MUX A;  5HLO A;  2F3Z A;  4MZL A;  4BY4 A;  1KFX L;  3LLE A;  1Y0V H;  1K9K A;  3BUW B;  1TCO B;  1NX1 A;  2K2F A;  1SK6 D;  1S3P A;  2Q4U A;  2LC5 A;  1G4Y R;  2ZNE A;  5JJG A;  4YGB B;  1K93 D;  4QJ5 B;  3I5G C;  2BCA A;  1K8U A;  1KK7 Y;  2K7D A;  2F2O A;  4XJK B;  4PE1 A;  3HCM A;  1DJX A;  3I5F B;  2JXL A;  4R1E A;  1IG5 A;  1XK4 C;  2LVV A;  1OSA A;  1DVI A;  5CSI A;  1KSM A;  1J7R A;  2HQW A;  2KAX A;  4WQ2 A;  1CMG A;  1FI6 A;  2LLS A;  1TCF A;  3PN7 C;  3TS5 B;  2ZKM X;  2H61 A;  3BQ3 A;  1C7V A;  1N2D A;  1YRT B;  1CFP A;  1EXR A;  1KFU L;  2B1U A;  1ALW A;  3EKH A;  2JUL A;  2NCP A;  2JOJ A;  2JRF A;  2KI6 D;  1K2H A;  1DJY A;  1QX2 A;  3RM1 A;  3CZT X;  3EVU A;  4AOM A;  3TDZ A;  1CM1 A;  1K95 A;  1G8I A;  5B8I B;  1PK0 D;  3PAL A;  1RJV A;  4Q04 A;  2EHB A;  2KFF A;  1QAT A;  3I5F C;  2RGI A;  2ZRT A;  1SPY A;  3M0W A;  1CFF A;  3OP0 A;  4MRY A;  1FI5 A;  1J55 A;  1F71 A;  3O2P A;  4D1E A;  3AKA A;  3VRR A;  3JVT C;  3TS5 C;  4PHN A;  1UHI A;  1PUL A;  3LK0 A;  1SL7 A;  2WND A;  1SMG A;  3GK4 X;  3SG5 A;  4QJ3 B;  1MWN A;  3BXK A;  4ORA B;  2LAN A;  1TIZ A;  5HKW A;  1A75 A;  2CBL A;  2P6B B;  2H61 C;  2PMY A;  1AJ4 A;  3TUY B;  5D69 A;  1SKT A;  2LVK A;  4CFR A;  1DMO A;  2HPS A;  4GAO A;  1XFV O;  4YI8 A;  5PAL A;  1NP8 A;  1NWD A;  3D0Y A;  1K90 D;  1YR5 A;  2DOQ A;  1EL4 A;  1SR6 B;  2BE4 A;  3KF9 A;  4M2Q A;  1WRZ A;  4QJ4 B;  2O5G A;  2L4I A;  1Y1U A;  3BUM B;  1NX3 A;  1M31 A;  4YRU A;  2K7O A;  4DUQ A;  3C1V A;  1F4O A;  3WNX B;  4CPV A;  1TNX A;  1AJ5 A;  2BEC A;  1CLB A;  2NZ0 A;  1JSA A;  1UHN A;  1QX7 A;  5ER5 A;  2AUC A;  5DKQ A;  1VRK A;  2MBX A;  1AUI B;  1BR4 B;  5CPV A;  5AXI A;  1V1F A;  2GGZ A;  2KFG A;  1K94 A;  1BOD A;  1AVS A;  1UHJ A;  3TUY C;  1JFJ A;  3SG3 A;  1SCM B;  3FWC A;  1K9P A;  4N1G A;  1PVB A;  1MHO A;  2QAC A;  2BKI B;  2K2A A;  1DTL A;  1WLZ A;  1SR6 C;  1KSO A;  1NCY A;  3H4S E;  1QTX A;  2KI6 C;  4TNC A;  1SL8 A;  4PHK A;  1DGV A;  1QAS A;  4YGA A;  2M3W A;  1W7J B;  2COL B;  1NYA A;  4CFQ A;  2CTN A;  2LMV A;  1NX2 A;  2M97 A;  3LL8 B;  2JC2 A;  2E30 A;  1SY9 A;  2I18 A;  3FIA A;  2GV5 A;  2KBI A;  1YVL A;  3OB2 B;  4AQJ A;  2PVB A;  4OKH A;  5HYD A;  1LKJ A;  2JNX A;  1QS7 A;  1S36 A;  1FF1 A;  3BUO B;  1GQM A;  3PFV A;  2CCM A;  2KDH A;  3GOF A;  3NSK A;  4I5N B;  1ZMZ A;  4PE4 A;  2ZND A;  1TOP A;  1SCM C;  4HRE E;  1UWO A;  3PN7 B;  4PHJ A;  3DVJ A;  1GGZ A;  2LHL A;  3O4Y A;  2JNF A;  3NSO A;  1BT6 A;  1BOC A;  1F54 A;  2K8M B;  1EG4 A;  5I2L A;  1H4B A;  1SNL A;  2WCE A;  2GGM A;  2KNE A;  5AFP A;  4PDZ A;  5I2O A;  3PAT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...