1BOCA

The solution structures of mutant calbindin d9k's, as determined by nmr, show that the calcium binding site can adopt different folds
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
76
structure length
76
Chain Sequence
MKSPEELKGIFEKYADKEGDGNQLSKEELKLLLQTEFPSLLKGMSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CALBINDIN D9K
publication title The solution structures of mutant calbindin D9k's, as determined by NMR, show that the calcium-binding site can adopt different folds.
pubmed doi rcsb
source organism Bos taurus
molecule tags Calcium-binding protein
total genus 6
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 1993-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1bocA00
3TS5B 3O2PA 5I8NA 1OMVA 1OZOA 2PASA 2WOSA 3I5IC 3SG3A 1S5GY 2HF5A 4QJ5B 2CXJA 4XJKA 3TUYB 1TCOB 1L7ZA 1GJYA 2I7AA 4PE0A 1A2XA 3EVRA 4HRHA 2MHHA 1Y0VH 1QX5B 3KF9A 2M7NA 5AEQA 1MWNA 2K0JA 1SCVA 2ZN9A 1CLMA 1IJ6A 1MXLC 1QXPA 2LLSA 1BR4B 4R1EA 1NX1A 1SCMB 4GGFA 1DJXA 1NCZA 1YUUA 1B8CA 2Y5IA 4MZJA 3SG7A 5I2QA 3CLNA 1XVJA 1BMOA 1OOJA 1OSAA 4PE7A 2ZRSA 2BCBA 1K96A 4WRIA 4XJKB 1WDCB 3DVKA 1PULA 3WHTB 1YX7A 2AUCA 3I5GB 1SMGA 2NLNA 1TTXA 3VROA 1TNPA 1K9PA 3CS1A 1K8UA 4NDCA 3AAJA 2JNFA 1XFYO 1RWYA 2ISDA 1A29A 2HQ8A 4E68A 3KPXA 5D7FA 1CM4A 3EVUA 1B8RA 1KWOB 2BKHB 1EG4A 1A75B 2GGZA 1IKUA 1QJTA 1LA0A 1PK0D 1SPYA 1JF0A 1SYMA 2LP2A 2M49B 3A4UB 2LHLA 2F2OA 4QJ4B 5AERA 1TCFA 1ODBA 3I5HB 4YRUA 4MZKA 3I5FC 4NQGA 1KQVA 4OKHA 5HKYA 1S6IA 1SR6C 2L50A 2KNEA 3LK0A 3TDUA 4PHJA 2KGRA 2BKIB 1EXRA 1K90D 1S1EA 1YURA 4OCIA 4XYNA 3TS5C 2A4JA 3PSRA 1TIZA 1DJZA 3BUWB 4I5KA 5DKQA 1S36A 1DF0A 3EKJA 3OP0A 5FYXA 3TUYC 3PALA 1ALWA 1B1GA 1PSBA 5J3XA 2GV5A 1ALVA 2JNXA 4ZCVA 1M31A 4TNCA 2AAOA 1NPQA 2WORA 3CGAA 3RLZA 2BL0B 5CSNA 1AHRA 1LVCD 1GGZA 1IQ3A 2LNKA 2ZRTA 1SCMC 2KSPA 4N5XA 1XFVO 1XK4A 2WCBA 2G9BA 2JU0A 5G08A 2BE6A 1B47A 1YRUB 2JT8A 2DOQA 2L4IA 1J1DA 3DD4A 2WCEA 5I2LA 3PN7B 1OE9B 1RFJA 2LVIA 4N1GA 4MBEA 2KHNA 3D0YA 4ORAB 5DKRA 1CTRA 3QRXA 4JQ0D 1WDCC 5BPJA 1BG1A 1NUBA 3DVJA 1QV1A 1IRJA 1K95A 2CTNA 2KI6C 1JUOA 3PM8A 1F70A 1LA3A 3I5GC 2L0PA 1Y1UA 2K2AA 3EK8A 1NWDA 2LHIA 2M3WA 2PALA 4YGEB 3NSLA 2JT0A 4USLA 3WHUB 1JWDA 2LVJA 4GPLB 2NCOA 3EVVA 1PSRA 2D8NA 1MF8B 1ZUZA 5CSJA 2V53A 4I5NB 1N2DA 4IL1A 3OHMB 1KWOC 1CDNA 5B8IB 2NXQA 1SL7A 1J7RA 1CM1A 1DJYA 3EK4A 1DJWA 2GGMA 1QVIZ 2F3ZA 3I5HC 1G33A 3VRNA 3EKHA 1SR6B 1KFXL 1WRZA 2ZN8A 2CNPA 2JRFA 2LUCA 5KSZA 2P6BB 1DGVA 3M0WA 2M8UA 1NP8A 2F8PA 2O5GA 1B8LA 5D69A 3KO0A 4OVNF 2BCXA 3AKAA 4I5LB 4HRGA 2LV7A 4CFRA 5KU1A 3KHEA 4MN0A 2EHBA 3OB2B 4MLWA 1IH0A 1KK7Z 1EJ3A 1ZFSA 1RK9A 1YUSA 2RGIA 1BT6A 1QASA 2KYFA 1TNXA 1F54A 1HT9A 2KBMA 2BL0C 2JQ6A 4DS7A 1SK6D 3BYAA 1TN4A 1SNLA 4MRYA 4Q04A 3O4YA 3TDIA 1PRWA 1VRKA 4L9MA 1Y6WA 1S3PA 1QS7A 3OB1B 3K21A 1A75A 2M0RA 3PN7C 1W7IB 4NDBA 1DVIA 5AANA 4GAOA 3ICBA 2MLFC 1E8AA 1FW4A 1KSMA 2CBLA 2OTGB 5F6TA 1NX3A 1CMFA 1LKJA 1CB1A 1LXFC 2WCFA 1DMOA 1BLQA 4CPVA 1NYAA 1YVHA 5I2OA 1KK8C 1GQMA 2JTZA 1B7TY 2I18A 3GOFA 4OR9B 2LC5A 3JVTB 1J7OA 2BBNA 2JWWA 1ZMZA 2L4HA 1JFKA 3OX6A 1UHKA 3BUMB 4MSPA 1DGUA 1V1FA 1XK4C 4UPGA 1S26D 2VRGA 1EG3A 2MBXA 1CFCA 1FI6A 1NX0A 2FOTA 3SG2A 3BUOB 1JC2A 2SCPA 1X02A 2M29A 3FWCA 1FBVA 4BY5A 1B9AA 1OZSA 4M2PA 4OV2A 4QJ3B 2JC2A 2KAYA 4WQ3A 1XO5A 3VGOA 2NZ0A 1S6JA 4YI8A 2Q4UA 2I2RE 1MQ1A 4HSZA 2MAZA 2JZIA 1JSAA 2H61C 4GNKB 2KI6D 1QV0A 1KQMB 4JPZB 3DF0A 1PALA 5JOLA 1V1GA 4MZLA 3JTDB 1KFUL 1UHJA 1IWQA 1RROA 1RECA 2K7CA 1W7JB 1C7VA 4PE1A 4DCKA 1F71A 1J55A 3CWGA 3LCPC 3OX5A 2TN4A 1GGWA 1J1EA 1CNPA 4N1FA 4C0JA 1F55A 1SKTA 2K7DA 1CLBA 3NSIA 2MJWB 4F0ZB 3WXAA 1OMDA 1FF1A 2M1UA 3SG4A 3HX4A 2OPOA 2COLB 5AXIA 1BR1B 1EL4A 2EGDA 2R2IA 5TNCA 2JULA 1SL8A 3DF0B 3IF7A 3BXKA 2I94A 2KFHA 2CT9A 2OTGC 1B4CA 1OQPA 3CR2A 5HKWA 1YTZC 2ZFDA 4AQIA 1KK8B 3GK4X 3GK2A 1BODA 2K7BA 2LM5A 1U5IB 2H61A 3VRRA 4CFQA 4GUKA 2JTTA 3JVTC 1CFFA 1KSOA 2LLUA 1KFXS 2Y1MA 4PALA 1TNQA 2LMUA 2FCDA 1J7PA 1CFDA 1C07A 1UUSA 2JOJA 1QIWA 3VRQA 1CDPA 1MHOA 5KTYA 2L5XB 2CCMA 1JBAA 1SW8A 1AUIB 1UHIA 1PVAA 1RJVA 1DJIA 1WY9A 1M45A 2H2KA 2NCPA 3AKBA 2OS8C 4M2OA 1F4OA 1MXEA 5CPVA 1L2OB 2MRDA 1A03A 1WLMA 1CDLA 2ZNDA 3CTNA 1ZACA 1AK8A 1S5GZ 2KAXA 3O6BA 3SG5A 3F45A 2KBIA 2KQYA 2BCAA 3AAKA 4NDDA 2Y1NA 3VRPA 2LUXA 1KQMC 3BOWB 3MSEB 1RTP1 2EC6B 3JTDC 1Q80A 4FTGA 4PHMA 1NIWA 1S6CA 1LINA 4YGAA 1QATA 2E30A 3H4SE 5AFPA 1BU3A 1XYDA 1G8IA 4JWQA 4DUQA 4U8DA 3D10A 2PVBA 1DJGA 1IQ5A 1DJHA 3LL8B 2QACA 5CSIA 2LMTA 5HLVA 1IGVA 2AMIA 2JPTA 5DKNA 1YRTB 3CZTX 5K89A 2KDHA 3BUNB 2LLTA 2SASA 1UP5A 1N65A 1DTLA 2LCPA 2FJUB 1CLLA 3FS7A 1B7TZ 5HKZA 1M39A 2K2FA 5PALA 4PDZA 1NCXA 4CIDA 3E3RA 3NSKA 1KK7Y 3BUXB 2ZNEA 4C0KA 1BJFA 2Y4QA 3CR5X 3EK7A 1OMRA 1EH2A 1NSHA 4ICBA 4MVFA 2KOTA 3RM1A 1SBJA 1UURA 4WQ2A 2LAPA 4PE4A 3BQ3A 1QIVA 3TZ1A 3PATA 1K94A 1XA5A 1M63B 1UHNA 1Y1AA 1K9KA 1QLSA 3FIAA 2LP3A 3SJSA 1XFWO 3SG6A 2O60A 4GBAA 2E6WA 1KFUS 2OS8B 3DVEA 4PHNA 4BY4A 1L2OC 1AJ5A 1PVBA 1UWOA 3A8RA 2WNDA 1FI5A 3HCMA 4MEWA 1YUTA 3IQOA 4P5OE 2BECA 1XFXO 4YGBB 5JJGA 2LANA 1CFPA 2IS9A 1DT7B 1TOPA 1WLZA 1F8HA 1Y1XA 3DVMA 4ORCB 2EC6C 2Q91A 4PCWA 1CKKA 2HETA 1TNWA 4ETOA 1C7WA 4HREE 2L2EA 4AQJA 3PLFB 3PFVA 1KCYA 1HQVA 2KI4B 1IG5A 1U5IA 1AVSA 1MR8A 3ZWHA 2L51A 2MA2A 4D1EA 1R6PA 4PHKA 2F3YA 2KGBC 3GK1A 3I5IB 1JFJA 3SIBA 2PRUA 2BE4A 5CSFA 2HPSA 5ER4X 1J7QA 3CR4X 4A4BA 1H8BA 1BF5A 4GFTA 2JXLA 3FWBA 3TDZA 2LVKA 4C0LA 1QX7A 2K61A 1NCYA 2FCEA 2KYCA 2KFGA 1XFUO 4DRWA 2WC8A 1R2UA 2LVVA 4YGCB 3BOWA 3ZNIA 1WRLA 2M97A 2JT3A 1UHHA 2KFFA 1BOCA 2K8MB 4CLNA 3SIAA 1QLKA 2PSRA 2LE9B 3NXAA 2M9GA 1K9UA 2M7LA 1AP4A 1DF0B 2M1KB 2QPTA 3IQQA 4FQOA 2B1UA 4A4CA 1YX8A 2KQ6A 1NX2A 1YVLA 1QX2A 1F4QA 1CDMA 3LLEA 1SY9A 2G2BA 5HYDA 1WRKA 4GGNA 5GQQC 5IBWA 2L98A 1CMGA 2F33A 1AJ4A 1JF2A 1ZOTB 4GGFC 5ER5A 1G4YR 2JXCA 3NSOA 1M46A 4I5JA 2F2PA 3KEVA 4M2QA 4YBHB 1D1OA 1FPWA 1SL9A 1XFZO 1A4PA 1IJ5A 1K93D 4AOMA 3D0YB 3LK1A 2ZKMX 4P2YB 4YI9A 4YGDB 3C1VA 1N0YA 2HQWA 1QTXA 1SRAA 1YR5A 3I5FB 2KI4C 1H4BA 4DIRA 1K2HA 1TRFA 4ORBB 2BBMA 2MLEC 3O78A 4MRXA 2LMVA 2K7OA 2PMYA 4ZCUA 3WNXB 2KAVA 1QVIY 1MUXA 5HLOA
chains in the Genus database with same CATH superfamily
3TS5B 3O2PA 5I8NA 2L5YA 1OMVA 1OZOA 2PASA 2WOSA 3I5IC 3SG3A 1S5GY 2HF5A 4QJ5B 2CXJA 1OOHA 4XJKA 3TUYB 1TCOB 1L7ZA 3D76A 1GJYA 2I7AA 4PE0A 1A2XA 3EVRA 4HRHA 2MHHA 1Y0VH 1QX5B 3KF9A 2M7NA 5AEQA 1MWNA 2K0JA 1SCVA 1C3YA 2ZN9A 1CLMA 1IJ6A 1MXLC 1QXPA 2LLSA 1BR4B 4R1EA 1NX1A 1SCMB 4GGFA 1DJXA 1NCZA 1YUUA 1B8CA 2Y5IA 4MZJA 3SG7A 5I2QA 3CLNA 3D73A 5D3OA 1DELA 3R1OA 3DZTA 1XVJA 1BMOA 1OOJA 1OSAA 4PE7A 2ZRSA 2BCBA 1K96A 4WRIA 4XJKB 1WDCB 1TUZA 3DVKA 1PULA 3WHTB 1YX7A 1OOIX 2WC6A 2AUCA 3S0AA 3B6XA 4PT1A 3I5GB 3CABA 4OZDA 1SMGA 2P71A 2NLNA 1TTXA 3VROA 1TNPA 1K9PA 3BFBA 3CS1A 1K8UA 4NDCA 3AAJA 2JNFA 1XFYO 1RWYA 2ISDA 1A29A 2HQ8A 4E68A 3KPXA 5D7FA 2GTEA 1CM4A 3EVUA 1B8RA 1KWOB 2BKHB 3CZ1A 1EG4A 1W9ZA 1A75B 2GGZA 1IKUA 1QJTA 1LA0A 1PK0D 1SPYA 1JF0A 1SYMA 2LP2A 2M49B 3A4UB 2LHLA 2F2OA 4QJ4B 5AERA 1TCFA 2PQLA 3FE6A 1ODBA 3I5HB 4YRUA 4MZKA 3I5FC 4NQGA 1KQVA 4OKHA 5HKYA 1S6IA 1T14A 2KPHA 3CDNA 1SR6C 2L50A 2KNEA 3LK0A 3TDUA 4PHJA 2KGRA 2BKIB 1EXRA 1K90D 1S1EA 1YURA 4OCIA 4XYNA 3SS4A 3TS5C 2A4JA 3PSRA 1TIZA 1DJZA 3BUWB 4I5KA 5DKQA 1S36A 1DF0A 3EKJA 3OP0A 5FYXA 3TUYC 3PALA 1ALWA 1B1GA 1PSBA 5J3XA 2GV5A 1ALVA 2JNXA 4ZCVA 3S0GA 1M31A 4TNCA 3PJIA 2AAOA 1NPQA 2QEBA 2WORA 2L2CA 3CGAA 3RLZA 2BL0B 5CSNA 1AHRA 1LVCD 1GGZA 1IQ3A 2LNKA 2ZRTA 1SCMC 2KSPA 4N5XA 1XFVO 1XK4A 2WCBA 2G9BA 2JU0A 5G08A 2BE6A 1B47A 1YRUB 2JT8A 2DOQA 2L4IA 1J1DA 3DD4A 2WCEA 5I2LA 2KLDA 3PN7B 1OE9B 1RFJA 2LVIA 4N1GA 4MBEA 2KHNA 3D0YA 4ORAB 5DKRA 1CTRA 3QRXA 4JQ0D 1WDCC 5BPJA 1BG1A 1NUBA 3DVJA 1QV1A 1IRJA 1K95A 2CTNA 1XFRA 1JUOA 2KI6C 3PM8A 1F70A 1GM0A 1LA3A 3I5GC 2L0PA 1Y1UA 2K2AA 3EK8A 1NWDA 2LHIA 2M3WA 2PALA 4YGEB 3NSLA 2JT0A 4USLA 3WHUB 1JWDA 2LVJA 3VB1A 4GPLB 2NCOA 3EVVA 1PSRA 2D8NA 1MF8B 1ZUZA 5CSJA 2V53A 4I5NB 1N2DA 4IL1A 1Z2CB 3OHMB 3UNWA 2WCHA 1KWOC 1CDNA 5B8IB 2NXQA 1SL7A 1LS8A 1J7RA 1CM1A 1DJYA 3EK4A 1DJWA 5I94A 2GGMA 1ORGA 1QVIZ 2F3ZA 3I5HC 1G33A 3VRNA 2WCLA 3EKHA 1SR6B 1KFXL 1DQEA 1WRZA 2ZN8A 2CNPA 2JRFA 2LUCA 5KSZA 2P6BB 1DGVA 3M0WA 2M8UA 1NP8A 2F8PA 2O5GA 1B8LA 5D69A 3KO0A 4OVNF 2BCXA 3AKAA 4I5LB 4HRGA 2LV7A 4CFRA 5KU1A 1OOFA 3KHEA 4MN0A 2QEOA 2EHBA 3OB2B 4MLWA 1IH0A 1KK7Z 1EJ3A 1ZFSA 1RK9A 1YUSA 2RGIA 1BT6A 1QASA 2KYFA 1TNXA 1F54A 1HT9A 1TWOA 2KBMA 2BL0C 2JQ6A 3D75A 3S0BA 4DS7A 1SK6D 3BYAA 1TN4A 1SNLA 4MRYA 4Q04A 3O4YA 3TDIA 1PRWA 1VRKA 2K60A 3NHIA 4L9MA 4F7FA 1Y6WA 1S3PA 2QEHA 1QS7A 3OB1B 3K21A 1A75A 2M0RA 3PN7C 1W7IB 4NDBA 1DVIA 5AANA 4GAOA 2WCMA 3ICBA 3PM2A 2MLFC 1E8AA 1FW4A 1KSMA 1SSEB 2CBLA 2OTGB 1NX3A 3DYEA 1LKJA 5F6TA 1CMFA 1CB1A 1LXFC 2WCFA 1DMOA 1BLQA 4CPVA 1NYAA 1YVHA 5I2OA 1KK8C 1C3ZA 1GQMA 2JTZA 1B7TY 2I18A 3GOFA 4OR9B 2LC5A 3JVTB 1J7OA 2BBNA 2JWWA 1ZMZA 2L4HA 1JFKA 3OX6A 5EL2A 1OOGA 1UHKA 3BUMB 3L4LA 4MSPA 1DGUA 1V1FA 1XK4C 2BAPA 4UPGA 1S26D 3FE9A 2VRGA 1EG3A 2MBXA 1CFCA 1FI6A 1IIOA 3K1EA 1NX0A 2FOTA 3SG2A 3BUOB 1JC2A 2SCPA 1X02A 2M29A 3FWCA 1FBVA 3R1PA 4BY5A 1B9AA 1OZSA 4M2PA 4OV2A 4QJ3B 2JC2A 2KAYA 4WQ3A 1XO5A 3VGOA 2NZ0A 1S6JA 4YI8A 2Q4UA 2I2RE 1MQ1A 4HSZA 2MAZA 2JZIA 3UO9A 1JSAA 2H61C 4GNKB 3B7AA 2KI6D 1QV0A 2ERBA 1KQMB 4JPZB 3DF0A 1PALA 5JOLA 1V1GA 4MZLA 3JTDB 3BFAA 3S0EA 1KFUL 1UHJA 1IWQA 1RROA 1RECA 2K7CA 1W7JB 1C7VA 4PE1A 3BJHA 4DCKA 5FI2A 1F71A 1J55A 3CWGA 3LCPC 3OX5A 2TN4A 1GGWA 1J1EA 1CNPA 4N1FA 4C0JA 1F55A 1SKTA 2K7DA 1CLBA 3NSIA 3NHTA 2MJWB 4F0ZB 4KYNA 1OMDA 3WXAA 1FF1A 2M1UA 3SG4A 3HX4A 3IVTA 2OPOA 2COLB 5AXIA 1BR1B 1EL4A 2EGDA 2R2IA 4JKTA 5TNCA 2JULA 1SL8A 3DF0B 3N7HA 3IF7A 3BXKA 2I94A 2KFHA 2CT9A 2OTGC 1B4CA 1OQPA 1P28A 3CR2A 5HKWA 3SS5A 1YTZC 2ZFDA 4AQIA 1KK8B 3GK4X 3GK2A 1BODA 2BNXA 2K7BA 2LM5A 1U5IB 2H61A 3VRRA 4CFQA 4GUKA 3DXLA 2JTTA 3JVTC 1CFFA 1KSOA 2LLUA 1KFXS 2Y1MA 3B88A 4PALA 1TNQA 5FI7A 2LMUA 2FCDA 1J7PA 1CFDA 4IJ7A 1C07A 3SS3A 1UUSA 2JOJA 1QIWA 3VRQA 1CDPA 1MHOA 5KTYA 4FQTA 3RZSA 2L5XB 2CCMA 1JBAA 1OW4A 1SW8A 1AUIB 2JPOA 1UHIA 1PVAA 1RJVA 1DJIA 1WY9A 1M45A 2H2KA 2NCPA 3AKBA 2OS8C 4M2OA 1F4OA 1MXEA 5CPVA 3D77A 1L2OB 2MRDA 3R72A 1A03A 1WLMA 1CDLA 3QMEA 3CZ0A 2ZNDA 3CTNA 1ZACA 1AK8A 1S5GZ 2KAXA 3O6BA 5HL1A 3SG5A 3F45A 3D74A 2KBIA 2KQYA 2BCAA 3AAKA 4NDDA 2Y1NA 3VRPA 2LUXA 1KQMC 3BOWB 3MSEB 1RTP1 3CYZA 2EC6B 2QDIA 3JTDC 1Q80A 3CZ2A 4FTGA 3S0DA 2WCKA 4PHMA 1NIWA 1S6CA 1LINA 4YGAA 1QATA 2E30A 3H4SE 2WC5A 1BU3A 1XYDA 5AFPA 1G8IA 4JWQA 4DUQA 4U8DA 3D10A 2PVBA 1DJGA 1IQ5A 1DJHA 3LL8B 2QACA 5CSIA 2LMTA 5HLVA 1IGVA 2AMIA 2JPTA 5DKNA 1YRTB 3CZTX 5K89A 2KDHA 3BUNB 2LLTA 2SASA 1UP5A 1N65A 1DTLA 2LCPA 2FJUB 1CLLA 3FS7A 1B7TZ 5HKZA 1M39A 2K2FA 5PALA 1DC1A 3D78A 4PDZA 1NCXA 4CIDA 3E3RA 2FJYA 3NSKA 1KK7Y 3BUXB 2ZNEA 4C0KA 1BJFA 2Y4QA 3CR5X 3EK7A 1OMRA 1EH2A 2WCJA 1NSHA 4ICBA 4MVFA 2KOTA 3RM1A 1SBJA 1UURA 4WQ2A 2LAPA 4PE4A 3BQ3A 1QIVA 3TZ1A 3PATA 1K94A 1XA5A 1M63B 1UHNA 1Y1AA 1K9KA 1QLSA 3FIAA 2LP3A 3SJSA 1XFWO 3SG6A 2O60A 4GBAA 2E6WA 1KFUS 2OS8B 3DVEA 4PHNA 4BY4A 1L2OC 1TUJA 2P70A 1AJ5A 1PVBA 1UWOA 3A8RA 2WNDA 3S0FA 1FI5A 3HCMA 4MEWA 1YUTA 3IQOA 4P5OE 2BECA 1XFXO 4YGBB 5JJGA 2LANA 1CFPA 2IS9A 3L4AA 1DT7B 1TOPA 1WLZA 1F8HA 1Y1XA 3DVMA 4ORCB 2EC6C 3BFHA 2Q91A 3B87A 4PCWA 1CKKA 2HETA 1TNWA 4ETOA 4JD9A 1C7WA 4HREE 2L2EA 4AQJA 3PLFB 3PFVA 1KCYA 1HQVA 2KI4B 1IG5A 1U5IA 1DEKA 1AVSA 1MR8A 3ZWHA 2L51A 4INWA 2MA2A 4D1EA 1R6PA 4PHKA 2F3YA 2KGBC 2YGUA 4INXA 5DICA 3GK1A 3I5IB 1JFJA 3SIBA 3R1VA 2PRUA 2BE4A 5CSFA 2HPSA 2PYQA 5ER4X 1J7QA 3CR4X 4A4BA 1H8BA 1BF5A 4GFTA 3OBVA 2JXLA 3FWBA 3TDZA 2LVKA 3B86A 4C0LA 1QX7A 2K61A 1NCYA 2FCEA 2KYCA 1QWVA 2KFGA 1XFUO 4DRWA 2WC8A 1R2UA 2LVVA 1Z4HA 4YGCB 3BOWA 3ZNIA 1WRLA 2M97A 2JT3A 1UHHA 2KFFA 3L47A 1BOCA 2K8MB 4CLNA 3SIAA 1QLKA 2PSRA 2LE9B 3NXAA 2M9GA 1K9UA 2KLEA 3O4XA 2M7LA 1AP4A 1DF0B 2M1KB 2QPTA 3IQQA 4FQOA 2B1UA 4A4CA 2H8VA 1YX8A 2KQ6A 1NX2A 1YVLA 1QX2A 3EG5B 1F4QA 1CDMA 3LLEA 1SY9A 2G2BA 2QEVA 5HYDA 1WRKA 4GGNA 5GQQC 5IBWA 2L98A 1CMGA 2F33A 1AJ4A 1JF2A 1ZOTB 4GGFC 5ER5A 1G4YR 2JXCA 3NSOA 1M46A 4I5JA 2F2PA 3KEVA 4M2QA 4YBHB 1D1OA 1FPWA 1SL9A 3NGVA 1XFZO 1A4PA 1IJ5A 1K93D 3FE8A 4AOMA 3D0YB 3DY9A 2ZKMX 3LK1A 4P2YB 4YI9A 3C1VA 4YGDB 5FI6A 1N0YA 2HQWA 1QTXA 1SRAA 1YR5A 3I5FB 2KI4C 1H4BA 3Q8IA 3OGNA 4DIRA 3V2LA 1K2HA 1TRFA 4ORBB 2BBMA 2MLEC 3O78A 4MRXA 2LMVA 2K7OA 2PMYA 4ZCUA 3WNXB 2KAVA 1QVIY 1MUXA 5HLOA
chains in the Genus database with same CATH topology
3TS5B 3O2PA 5I8NA 1OMVA 1OZOA 2PASA 2WOSA 3I5IC 3SG3A 1S5GY 2HF5A 4QJ5B 2CXJA 4XJKA 3TUYB 1TCOB 1L7ZA 1GJYA 2I7AA 4PE0A 1A2XA 3EVRA 4HRHA 2MHHA 1Y0VH 1QX5B 3KF9A 2M7NA 5AEQA 1MWNA 2K0JA 1SCVA 2ZN9A 1CLMA 1IJ6A 1MXLC 1QXPA 2LLSA 1BR4B 4R1EA 1NX1A 1SCMB 4GGFA 1DJXA 1NCZA 1YUUA 1B8CA 2Y5IA 4MZJA 3SG7A 5I2QA 3CLNA 1XVJA 1BMOA 1OOJA 1OSAA 4PE7A 2ZRSA 2BCBA 1K96A 4WRIA 4XJKB 1WDCB 3DVKA 1PULA 3WHTB 1YX7A 2AUCA 3I5GB 1SMGA 2NLNA 1TTXA 3VROA 1TNPA 1K9PA 3CS1A 1K8UA 4NDCA 3AAJA 2JNFA 1XFYO 1RWYA 2ISDA 1A29A 2HQ8A 4E68A 3KPXA 5D7FA 1CM4A 3EVUA 1B8RA 1KWOB 2BKHB 1EG4A 1A75B 2GGZA 1IKUA 1QJTA 1LA0A 1PK0D 1SPYA 1JF0A 1SYMA 2LP2A 2M49B 3A4UB 2LHLA 2F2OA 4QJ4B 5AERA 1TCFA 1ODBA 3I5HB 4YRUA 4MZKA 3I5FC 4NQGA 1KQVA 4OKHA 5HKYA 1S6IA 1SR6C 2L50A 2KNEA 3LK0A 3TDUA 4PHJA 2KGRA 2BKIB 1EXRA 1K90D 1S1EA 1YURA 4OCIA 4XYNA 3TS5C 2A4JA 3PSRA 1TIZA 1DJZA 3BUWB 4I5KA 5DKQA 1S36A 1DF0A 3EKJA 3OP0A 5FYXA 3TUYC 3PALA 1ALWA 1B1GA 1PSBA 5J3XA 2GV5A 1ALVA 2JNXA 4ZCVA 1M31A 4TNCA 2AAOA 1NPQA 2WORA 3CGAA 3RLZA 2BL0B 5CSNA 1AHRA 1LVCD 1GGZA 1IQ3A 2LNKA 2ZRTA 1SCMC 2KSPA 4N5XA 1XFVO 1XK4A 2WCBA 2G9BA 2JU0A 5G08A 2BE6A 1B47A 1YRUB 2JT8A 2DOQA 2L4IA 1J1DA 3DD4A 2WCEA 5I2LA 3PN7B 1OE9B 1RFJA 2LVIA 4N1GA 4MBEA 2KHNA 3D0YA 4ORAB 5DKRA 1CTRA 3QRXA 4JQ0D 1WDCC 5BPJA 1BG1A 1NUBA 3DVJA 1QV1A 1IRJA 1K95A 2CTNA 2KI6C 1JUOA 3PM8A 1F70A 1LA3A 3I5GC 2L0PA 1Y1UA 2K2AA 3EK8A 1NWDA 2LHIA 2M3WA 2PALA 4YGEB 3NSLA 2JT0A 4USLA 3WHUB 1JWDA 2LVJA 4GPLB 2NCOA 3EVVA 1PSRA 2D8NA 1MF8B 1ZUZA 5CSJA 2V53A 4I5NB 1N2DA 4IL1A 3OHMB 1KWOC 1CDNA 5B8IB 2NXQA 1SL7A 1J7RA 1CM1A 1DJYA 3EK4A 1DJWA 2GGMA 1QVIZ 2F3ZA 3I5HC 1G33A 3VRNA 3EKHA 1SR6B 1KFXL 1WRZA 2ZN8A 2CNPA 2JRFA 2LUCA 5KSZA 2P6BB 1DGVA 3M0WA 2M8UA 1NP8A 2F8PA 2O5GA 1B8LA 5D69A 3KO0A 4OVNF 2BCXA 3AKAA 4I5LB 4HRGA 2LV7A 4CFRA 5KU1A 3KHEA 4MN0A 2EHBA 3OB2B 4MLWA 1IH0A 1KK7Z 1EJ3A 1ZFSA 1RK9A 1YUSA 2RGIA 1BT6A 1QASA 2KYFA 1TNXA 1F54A 1HT9A 2KBMA 2BL0C 2JQ6A 4DS7A 1SK6D 3BYAA 1TN4A 1SNLA 4MRYA 4Q04A 3O4YA 3TDIA 1PRWA 1VRKA 4L9MA 1Y6WA 1S3PA 1QS7A 3OB1B 3K21A 1A75A 2M0RA 3PN7C 1W7IB 4NDBA 1DVIA 5AANA 4GAOA 3ICBA 2MLFC 1E8AA 1FW4A 1KSMA 2CBLA 2OTGB 5F6TA 1NX3A 1CMFA 1LKJA 1CB1A 1LXFC 2WCFA 1DMOA 1BLQA 4CPVA 1NYAA 1YVHA 5I2OA 1KK8C 1GQMA 2JTZA 1B7TY 2I18A 3GOFA 4OR9B 2LC5A 3JVTB 1J7OA 2BBNA 2JWWA 1ZMZA 2L4HA 1JFKA 3OX6A 1UHKA 3BUMB 4MSPA 1DGUA 1V1FA 1XK4C 4UPGA 1S26D 2VRGA 1EG3A 2MBXA 1CFCA 1FI6A 1NX0A 2FOTA 3SG2A 3BUOB 1JC2A 2SCPA 1X02A 2M29A 3FWCA 1FBVA 4BY5A 1B9AA 1OZSA 4M2PA 4OV2A 4QJ3B 2JC2A 2KAYA 4WQ3A 1XO5A 3VGOA 2NZ0A 1S6JA 4YI8A 2Q4UA 2I2RE 1MQ1A 4HSZA 2MAZA 2JZIA 1JSAA 2H61C 4GNKB 2KI6D 1QV0A 1KQMB 4JPZB 3DF0A 1PALA 5JOLA 1V1GA 4MZLA 3JTDB 1KFUL 1UHJA 1IWQA 1RROA 1RECA 2K7CA 1W7JB 1C7VA 4PE1A 4DCKA 1F71A 1J55A 3CWGA 3LCPC 3OX5A 2TN4A 1GGWA 1J1EA 1CNPA 4N1FA 4C0JA 1F55A 1SKTA 2K7DA 1CLBA 3NSIA 2MJWB 4F0ZB 3WXAA 1OMDA 1FF1A 2M1UA 3SG4A 3HX4A 2OPOA 2COLB 5AXIA 1BR1B 1EL4A 2EGDA 2R2IA 5TNCA 2JULA 1SL8A 3DF0B 3IF7A 3BXKA 2I94A 2KFHA 2CT9A 2OTGC 1B4CA 1OQPA 3CR2A 5HKWA 1YTZC 2ZFDA 4AQIA 1KK8B 3GK4X 3GK2A 1BODA 2K7BA 2LM5A 1U5IB 2H61A 3VRRA 4CFQA 4GUKA 2JTTA 3JVTC 1CFFA 1KSOA 2LLUA 1KFXS 2Y1MA 4PALA 1TNQA 2LMUA 2FCDA 1J7PA 1CFDA 1C07A 1UUSA 2JOJA 1QIWA 3VRQA 1CDPA 1MHOA 5KTYA 2L5XB 2CCMA 1JBAA 1SW8A 1AUIB 1UHIA 1PVAA 1RJVA 1DJIA 1WY9A 1M45A 2H2KA 2NCPA 3AKBA 2OS8C 4M2OA 1F4OA 1MXEA 5CPVA 1L2OB 2MRDA 1A03A 1WLMA 1CDLA 2ZNDA 3CTNA 1ZACA 1AK8A 1S5GZ 2KAXA 3O6BA 3SG5A 3F45A 2KBIA 2KQYA 2BCAA 3AAKA 4NDDA 2Y1NA 3VRPA 2LUXA 1KQMC 3BOWB 3MSEB 1RTP1 2EC6B 3JTDC 1Q80A 4FTGA 4PHMA 1NIWA 1S6CA 1LINA 4YGAA 1QATA 2E30A 3H4SE 5AFPA 1BU3A 1XYDA 1G8IA 4JWQA 4DUQA 4U8DA 3D10A 2PVBA 1DJGA 1IQ5A 1DJHA 3LL8B 2QACA 5CSIA 2LMTA 5HLVA 1IGVA 2AMIA 2JPTA 5DKNA 1YRTB 3CZTX 5K89A 2KDHA 3BUNB 2LLTA 2SASA 1UP5A 1N65A 1DTLA 2LCPA 2FJUB 1CLLA 3FS7A 1B7TZ 5HKZA 1M39A 2K2FA 5PALA 4PDZA 1NCXA 4CIDA 3E3RA 3NSKA 1KK7Y 3BUXB 2ZNEA 4C0KA 1BJFA 2Y4QA 3CR5X 3EK7A 1OMRA 1EH2A 1NSHA 4ICBA 4MVFA 2KOTA 3RM1A 1SBJA 1UURA 4WQ2A 2LAPA 4PE4A 3BQ3A 1QIVA 3TZ1A 3PATA 1K94A 1XA5A 1M63B 1UHNA 1Y1AA 1K9KA 1QLSA 3FIAA 2LP3A 3SJSA 1XFWO 3SG6A 2O60A 4GBAA 2E6WA 1KFUS 2OS8B 3DVEA 4PHNA 4BY4A 1L2OC 1AJ5A 1PVBA 1UWOA 3A8RA 2WNDA 1FI5A 3HCMA 4MEWA 1YUTA 3IQOA 4P5OE 2BECA 1XFXO 4YGBB 5JJGA 2LANA 1CFPA 2IS9A 1DT7B 1TOPA 1WLZA 1F8HA 1Y1XA 3DVMA 4ORCB 2EC6C 2Q91A 4PCWA 1CKKA 2HETA 1TNWA 4ETOA 1C7WA 4HREE 2L2EA 4AQJA 3PLFB 3PFVA 1KCYA 1HQVA 2KI4B 1IG5A 1U5IA 1AVSA 1MR8A 3ZWHA 2L51A 2MA2A 4D1EA 1R6PA 4PHKA 2F3YA 2KGBC 3GK1A 3I5IB 1JFJA 3SIBA 2PRUA 2BE4A 5CSFA 2HPSA 5ER4X 1J7QA 3CR4X 4A4BA 1H8BA 1BF5A 4GFTA 2JXLA 3FWBA 3TDZA 2LVKA 4C0LA 1QX7A 2K61A 1NCYA 2FCEA 2KYCA 2KFGA 1XFUO 4DRWA 2WC8A 1R2UA 2LVVA 4YGCB 3BOWA 3ZNIA 1WRLA 2M97A 2JT3A 1UHHA 2KFFA 1BOCA 2K8MB 4CLNA 3SIAA 1QLKA 2PSRA 2LE9B 3NXAA 2M9GA 1K9UA 2M7LA 1AP4A 1DF0B 2M1KB 2QPTA 3IQQA 4FQOA 2B1UA 4A4CA 1YX8A 2KQ6A 1NX2A 1YVLA 1QX2A 1F4QA 1CDMA 3LLEA 1SY9A 2G2BA 5HYDA 1WRKA 4GGNA 5GQQC 5IBWA 2L98A 1CMGA 2F33A 1AJ4A 1JF2A 1ZOTB 4GGFC 5ER5A 1G4YR 2JXCA 3NSOA 1M46A 4I5JA 2F2PA 3KEVA 4M2QA 4YBHB 1D1OA 1FPWA 1SL9A 1XFZO 1A4PA 1IJ5A 1K93D 4AOMA 3D0YB 3LK1A 2ZKMX 4P2YB 4YI9A 4YGDB 3C1VA 1N0YA 2HQWA 1QTXA 1SRAA 1YR5A 3I5FB 2KI4C 1H4BA 4DIRA 1K2HA 1TRFA 4ORBB 2BBMA 2MLEC 3O78A 4MRXA 2LMVA 2K7OA 2PMYA 4ZCUA 3WNXB 2KAVA 1QVIY 1MUXA 5HLOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TS5 B;  3O2P A;  5I8N A;  1OMV A;  1OZO A;  2PAS A;  2WOS A;  3I5I C;  3SG3 A;  1S5G Y;  2HF5 A;  4QJ5 B;  2CXJ A;  4XJK A;  3TUY B;  1TCO B;  1L7Z A;  1GJY A;  2I7A A;  4PE0 A;  1A2X A;  3EVR A;  4HRH A;  2MHH A;  1Y0V H;  1QX5 B;  3KF9 A;  2M7N A;  5AEQ A;  1MWN A;  2K0J A;  1SCV A;  2ZN9 A;  1CLM A;  1IJ6 A;  1MXL C;  1QXP A;  2LLS A;  1BR4 B;  4R1E A;  1NX1 A;  1SCM B;  4GGF A;  1DJX A;  1NCZ A;  1YUU A;  1B8C A;  2Y5I A;  4MZJ A;  3SG7 A;  5I2Q A;  3CLN A;  1XVJ A;  1BMO A;  1OOJ A;  1OSA A;  4PE7 A;  2ZRS A;  2BCB A;  1K96 A;  4WRI A;  4XJK B;  1WDC B;  3DVK A;  1PUL A;  3WHT B;  1YX7 A;  2AUC A;  3I5G B;  1SMG A;  2NLN A;  1TTX A;  3VRO A;  1TNP A;  1K9P A;  3CS1 A;  1K8U A;  4NDC A;  3AAJ A;  2JNF A;  1XFY O;  1RWY A;  2ISD A;  1A29 A;  2HQ8 A;  4E68 A;  3KPX A;  5D7F A;  1CM4 A;  3EVU A;  1B8R A;  1KWO B;  2BKH B;  1EG4 A;  1A75 B;  2GGZ A;  1IKU A;  1QJT A;  1LA0 A;  1PK0 D;  1SPY A;  1JF0 A;  1SYM A;  2LP2 A;  2M49 B;  3A4U B;  2LHL A;  2F2O A;  4QJ4 B;  5AER A;  1TCF A;  1ODB A;  3I5H B;  4YRU A;  4MZK A;  3I5F C;  4NQG A;  1KQV A;  4OKH A;  5HKY A;  1S6I A;  1SR6 C;  2L50 A;  2KNE A;  3LK0 A;  3TDU A;  4PHJ A;  2KGR A;  2BKI B;  1EXR A;  1K90 D;  1S1E A;  1YUR A;  4OCI A;  4XYN A;  3TS5 C;  2A4J A;  3PSR A;  1TIZ A;  1DJZ A;  3BUW B;  4I5K A;  5DKQ A;  1S36 A;  1DF0 A;  3EKJ A;  3OP0 A;  5FYX A;  3TUY C;  3PAL A;  1ALW A;  1B1G A;  1PSB A;  5J3X A;  2GV5 A;  1ALV A;  2JNX A;  4ZCV A;  1M31 A;  4TNC A;  2AAO A;  1NPQ A;  2WOR A;  3CGA A;  3RLZ A;  2BL0 B;  5CSN A;  1AHR A;  1LVC D;  1GGZ A;  1IQ3 A;  2LNK A;  2ZRT A;  1SCM C;  2KSP A;  4N5X A;  1XFV O;  1XK4 A;  2WCB A;  2G9B A;  2JU0 A;  5G08 A;  2BE6 A;  1B47 A;  1YRU B;  2JT8 A;  2DOQ A;  2L4I A;  1J1D A;  3DD4 A;  2WCE A;  5I2L A;  3PN7 B;  1OE9 B;  1RFJ A;  2LVI A;  4N1G A;  4MBE A;  2KHN A;  3D0Y A;  4ORA B;  5DKR A;  1CTR A;  3QRX A;  4JQ0 D;  1WDC C;  5BPJ A;  1BG1 A;  1NUB A;  3DVJ A;  1QV1 A;  1IRJ A;  1K95 A;  2CTN A;  2KI6 C;  1JUO A;  3PM8 A;  1F70 A;  1LA3 A;  3I5G C;  2L0P A;  1Y1U A;  2K2A A;  3EK8 A;  1NWD A;  2LHI A;  2M3W A;  2PAL A;  4YGE B;  3NSL A;  2JT0 A;  4USL A;  3WHU B;  1JWD A;  2LVJ A;  4GPL B;  2NCO A;  3EVV A;  1PSR A;  2D8N A;  1MF8 B;  1ZUZ A;  5CSJ A;  2V53 A;  4I5N B;  1N2D A;  4IL1 A;  3OHM B;  1KWO C;  1CDN A;  5B8I B;  2NXQ A;  1SL7 A;  1J7R A;  1CM1 A;  1DJY A;  3EK4 A;  1DJW A;  2GGM A;  1QVI Z;  2F3Z A;  3I5H C;  1G33 A;  3VRN A;  3EKH A;  1SR6 B;  1KFX L;  1WRZ A;  2ZN8 A;  2CNP A;  2JRF A;  2LUC A;  5KSZ A;  2P6B B;  1DGV A;  3M0W A;  2M8U A;  1NP8 A;  2F8P A;  2O5G A;  1B8L A;  5D69 A;  3KO0 A;  4OVN F;  2BCX A;  3AKA A;  4I5L B;  4HRG A;  2LV7 A;  4CFR A;  5KU1 A;  3KHE A;  4MN0 A;  2EHB A;  3OB2 B;  4MLW A;  1IH0 A;  1KK7 Z;  1EJ3 A;  1ZFS A;  1RK9 A;  1YUS A;  2RGI A;  1BT6 A;  1QAS A;  2KYF A;  1TNX A;  1F54 A;  1HT9 A;  2KBM A;  2BL0 C;  2JQ6 A;  4DS7 A;  1SK6 D;  3BYA A;  1TN4 A;  1SNL A;  4MRY A;  4Q04 A;  3O4Y A;  3TDI A;  1PRW A;  1VRK A;  4L9M A;  1Y6W A;  1S3P A;  1QS7 A;  3OB1 B;  3K21 A;  1A75 A;  2M0R A;  3PN7 C;  1W7I B;  4NDB A;  1DVI A;  5AAN A;  4GAO A;  3ICB A;  2MLF C;  1E8A A;  1FW4 A;  1KSM A;  2CBL A;  2OTG B;  5F6T A;  1NX3 A;  1CMF A;  1LKJ A;  1CB1 A;  1LXF C;  2WCF A;  1DMO A;  1BLQ A;  4CPV A;  1NYA A;  1YVH A;  5I2O A;  1KK8 C;  1GQM A;  2JTZ A;  1B7T Y;  2I18 A;  3GOF A;  4OR9 B;  2LC5 A;  3JVT B;  1J7O A;  2BBN A;  2JWW A;  1ZMZ A;  2L4H A;  1JFK A;  3OX6 A;  1UHK A;  3BUM B;  4MSP A;  1DGU A;  1V1F A;  1XK4 C;  4UPG A;  1S26 D;  2VRG A;  1EG3 A;  2MBX A;  1CFC A;  1FI6 A;  1NX0 A;  2FOT A;  3SG2 A;  3BUO B;  1JC2 A;  2SCP A;  1X02 A;  2M29 A;  3FWC A;  1FBV A;  4BY5 A;  1B9A A;  1OZS A;  4M2P A;  4OV2 A;  4QJ3 B;  2JC2 A;  2KAY A;  4WQ3 A;  1XO5 A;  3VGO A;  2NZ0 A;  1S6J A;  4YI8 A;  2Q4U A;  2I2R E;  1MQ1 A;  4HSZ A;  2MAZ A;  2JZI A;  1JSA A;  2H61 C;  4GNK B;  2KI6 D;  1QV0 A;  1KQM B;  4JPZ B;  3DF0 A;  1PAL A;  5JOL A;  1V1G A;  4MZL A;  3JTD B;  1KFU L;  1UHJ A;  1IWQ A;  1RRO A;  1REC A;  2K7C A;  1W7J B;  1C7V A;  4PE1 A;  4DCK A;  1F71 A;  1J55 A;  3CWG A;  3LCP C;  3OX5 A;  2TN4 A;  1GGW A;  1J1E A;  1CNP A;  4N1F A;  4C0J A;  1F55 A;  1SKT A;  2K7D A;  1CLB A;  3NSI A;  2MJW B;  4F0Z B;  3WXA A;  1OMD A;  1FF1 A;  2M1U A;  3SG4 A;  3HX4 A;  2OPO A;  2COL B;  5AXI A;  1BR1 B;  1EL4 A;  2EGD A;  2R2I A;  5TNC A;  2JUL A;  1SL8 A;  3DF0 B;  3IF7 A;  3BXK A;  2I94 A;  2KFH A;  2CT9 A;  2OTG C;  1B4C A;  1OQP A;  3CR2 A;  5HKW A;  1YTZ C;  2ZFD A;  4AQI A;  1KK8 B;  3GK4 X;  3GK2 A;  1BOD A;  2K7B A;  2LM5 A;  1U5I B;  2H61 A;  3VRR A;  4CFQ A;  4GUK A;  2JTT A;  3JVT C;  1CFF A;  1KSO A;  2LLU A;  1KFX S;  2Y1M A;  4PAL A;  1TNQ A;  2LMU A;  2FCD A;  1J7P A;  1CFD A;  1C07 A;  1UUS A;  2JOJ A;  1QIW A;  3VRQ A;  1CDP A;  1MHO A;  5KTY A;  2L5X B;  2CCM A;  1JBA A;  1SW8 A;  1AUI B;  1UHI A;  1PVA A;  1RJV A;  1DJI A;  1WY9 A;  1M45 A;  2H2K A;  2NCP A;  3AKB A;  2OS8 C;  4M2O A;  1F4O A;  1MXE A;  5CPV A;  1L2O B;  2MRD A;  1A03 A;  1WLM A;  1CDL A;  2ZND A;  3CTN A;  1ZAC A;  1AK8 A;  1S5G Z;  2KAX A;  3O6B A;  3SG5 A;  3F45 A;  2KBI A;  2KQY A;  2BCA A;  3AAK A;  4NDD A;  2Y1N A;  3VRP A;  2LUX A;  1KQM C;  3BOW B;  3MSE B;  1RTP 1;  2EC6 B;  3JTD C;  1Q80 A;  4FTG A;  4PHM A;  1NIW A;  1S6C A;  1LIN A;  4YGA A;  1QAT A;  2E30 A;  3H4S E;  5AFP A;  1BU3 A;  1XYD A;  1G8I A;  4JWQ A;  4DUQ A;  4U8D A;  3D10 A;  2PVB A;  1DJG A;  1IQ5 A;  1DJH A;  3LL8 B;  2QAC A;  5CSI A;  2LMT A;  5HLV A;  1IGV A;  2AMI A;  2JPT A;  5DKN A;  1YRT B;  3CZT X;  5K89 A;  2KDH A;  3BUN B;  2LLT A;  2SAS A;  1UP5 A;  1N65 A;  1DTL A;  2LCP A;  2FJU B;  1CLL A;  3FS7 A;  1B7T Z;  5HKZ A;  1M39 A;  2K2F A;  5PAL A;  4PDZ A;  1NCX A;  4CID A;  3E3R A;  3NSK A;  1KK7 Y;  3BUX B;  2ZNE A;  4C0K A;  1BJF A;  2Y4Q A;  3CR5 X;  3EK7 A;  1OMR A;  1EH2 A;  1NSH A;  4ICB A;  4MVF A;  2KOT A;  3RM1 A;  1SBJ A;  1UUR A;  4WQ2 A;  2LAP A;  4PE4 A;  3BQ3 A;  1QIV A;  3TZ1 A;  3PAT A;  1K94 A;  1XA5 A;  1M63 B;  1UHN A;  1Y1A A;  1K9K A;  1QLS A;  3FIA A;  2LP3 A;  3SJS A;  1XFW O;  3SG6 A;  2O60 A;  4GBA A;  2E6W A;  1KFU S;  2OS8 B;  3DVE A;  4PHN A;  4BY4 A;  1L2O C;  1AJ5 A;  1PVB A;  1UWO A;  3A8R A;  2WND A;  1FI5 A;  3HCM A;  4MEW A;  1YUT A;  3IQO A;  4P5O E;  2BEC A;  1XFX O;  4YGB B;  5JJG A;  2LAN A;  1CFP A;  2IS9 A;  1DT7 B;  1TOP A;  1WLZ A;  1F8H A;  1Y1X A;  3DVM A;  4ORC B;  2EC6 C;  2Q91 A;  4PCW A;  1CKK A;  2HET A;  1TNW A;  4ETO A;  1C7W A;  4HRE E;  2L2E A;  4AQJ A;  3PLF B;  3PFV A;  1KCY A;  1HQV A;  2KI4 B;  1IG5 A;  1U5I A;  1AVS A;  1MR8 A;  3ZWH A;  2L51 A;  2MA2 A;  4D1E A;  1R6P A;  4PHK A;  2F3Y A;  2KGB C;  3GK1 A;  3I5I B;  1JFJ A;  3SIB A;  2PRU A;  2BE4 A;  5CSF A;  2HPS A;  5ER4 X;  1J7Q A;  3CR4 X;  4A4B A;  1H8B A;  1BF5 A;  4GFT A;  2JXL A;  3FWB A;  3TDZ A;  2LVK A;  4C0L A;  1QX7 A;  2K61 A;  1NCY A;  2FCE A;  2KYC A;  2KFG A;  1XFU O;  4DRW A;  2WC8 A;  1R2U A;  2LVV A;  4YGC B;  3BOW A;  3ZNI A;  1WRL A;  2M97 A;  2JT3 A;  1UHH A;  2KFF A;  1BOC A;  2K8M B;  4CLN A;  3SIA A;  1QLK A;  2PSR A;  2LE9 B;  3NXA A;  2M9G A;  1K9U A;  2M7L A;  1AP4 A;  1DF0 B;  2M1K B;  2QPT A;  3IQQ A;  4FQO A;  2B1U A;  4A4C A;  1YX8 A;  2KQ6 A;  1NX2 A;  1YVL A;  1QX2 A;  1F4Q A;  1CDM A;  3LLE A;  1SY9 A;  2G2B A;  5HYD A;  1WRK A;  4GGN A;  5GQQ C;  5IBW A;  2L98 A;  1CMG A;  2F33 A;  1AJ4 A;  1JF2 A;  1ZOT B;  4GGF C;  5ER5 A;  1G4Y R;  2JXC A;  3NSO A;  1M46 A;  4I5J A;  2F2P A;  3KEV A;  4M2Q A;  4YBH B;  1D1O A;  1FPW A;  1SL9 A;  1XFZ O;  1A4P A;  1IJ5 A;  1K93 D;  4AOM A;  3D0Y B;  3LK1 A;  2ZKM X;  4P2Y B;  4YI9 A;  4YGD B;  3C1V A;  1N0Y A;  2HQW A;  1QTX A;  1SRA A;  1YR5 A;  3I5F B;  2KI4 C;  1H4B A;  4DIR A;  1K2H A;  1TRF A;  4ORB B;  2BBM A;  2MLE C;  3O78 A;  4MRX A;  2LMV A;  2K7O A;  2PMY A;  4ZCU A;  3WNX B;  2KAV A;  1QVI Y;  1MUX A;  5HLO A; 
#chains in the Genus database with same CATH topology
 3TS5 B;  3O2P A;  5I8N A;  2L5Y A;  1OMV A;  1OZO A;  2PAS A;  2WOS A;  3I5I C;  3SG3 A;  1S5G Y;  2HF5 A;  4QJ5 B;  2CXJ A;  1OOH A;  4XJK A;  3TUY B;  1TCO B;  1L7Z A;  3D76 A;  1GJY A;  2I7A A;  4PE0 A;  1A2X A;  3EVR A;  4HRH A;  2MHH A;  1Y0V H;  1QX5 B;  3KF9 A;  2M7N A;  5AEQ A;  1MWN A;  2K0J A;  1SCV A;  1C3Y A;  2ZN9 A;  1CLM A;  1IJ6 A;  1MXL C;  1QXP A;  2LLS A;  1BR4 B;  4R1E A;  1NX1 A;  1SCM B;  4GGF A;  1DJX A;  1NCZ A;  1YUU A;  1B8C A;  2Y5I A;  4MZJ A;  3SG7 A;  5I2Q A;  3CLN A;  3D73 A;  5D3O A;  1DEL A;  3R1O A;  3DZT A;  1XVJ A;  1BMO A;  1OOJ A;  1OSA A;  4PE7 A;  2ZRS A;  2BCB A;  1K96 A;  4WRI A;  4XJK B;  1WDC B;  1TUZ A;  3DVK A;  1PUL A;  3WHT B;  1YX7 A;  1OOI X;  2WC6 A;  2AUC A;  3S0A A;  3B6X A;  4PT1 A;  3I5G B;  3CAB A;  4OZD A;  1SMG A;  2P71 A;  2NLN A;  1TTX A;  3VRO A;  1TNP A;  1K9P A;  3BFB A;  3CS1 A;  1K8U A;  4NDC A;  3AAJ A;  2JNF A;  1XFY O;  1RWY A;  2ISD A;  1A29 A;  2HQ8 A;  4E68 A;  3KPX A;  5D7F A;  2GTE A;  1CM4 A;  3EVU A;  1B8R A;  1KWO B;  2BKH B;  3CZ1 A;  1EG4 A;  1W9Z A;  1A75 B;  2GGZ A;  1IKU A;  1QJT A;  1LA0 A;  1PK0 D;  1SPY A;  1JF0 A;  1SYM A;  2LP2 A;  2M49 B;  3A4U B;  2LHL A;  2F2O A;  4QJ4 B;  5AER A;  1TCF A;  2PQL A;  3FE6 A;  1ODB A;  3I5H B;  4YRU A;  4MZK A;  3I5F C;  4NQG A;  1KQV A;  4OKH A;  5HKY A;  1S6I A;  1T14 A;  2KPH A;  3CDN A;  1SR6 C;  2L50 A;  2KNE A;  3LK0 A;  3TDU A;  4PHJ A;  2KGR A;  2BKI B;  1EXR A;  1K90 D;  1S1E A;  1YUR A;  4OCI A;  4XYN A;  3SS4 A;  3TS5 C;  2A4J A;  3PSR A;  1TIZ A;  1DJZ A;  3BUW B;  4I5K A;  5DKQ A;  1S36 A;  1DF0 A;  3EKJ A;  3OP0 A;  5FYX A;  3TUY C;  3PAL A;  1ALW A;  1B1G A;  1PSB A;  5J3X A;  2GV5 A;  1ALV A;  2JNX A;  4ZCV A;  3S0G A;  1M31 A;  4TNC A;  3PJI A;  2AAO A;  1NPQ A;  2QEB A;  2WOR A;  2L2C A;  3CGA A;  3RLZ A;  2BL0 B;  5CSN A;  1AHR A;  1LVC D;  1GGZ A;  1IQ3 A;  2LNK A;  2ZRT A;  1SCM C;  2KSP A;  4N5X A;  1XFV O;  1XK4 A;  2WCB A;  2G9B A;  2JU0 A;  5G08 A;  2BE6 A;  1B47 A;  1YRU B;  2JT8 A;  2DOQ A;  2L4I A;  1J1D A;  3DD4 A;  2WCE A;  5I2L A;  2KLD A;  3PN7 B;  1OE9 B;  1RFJ A;  2LVI A;  4N1G A;  4MBE A;  2KHN A;  3D0Y A;  4ORA B;  5DKR A;  1CTR A;  3QRX A;  4JQ0 D;  1WDC C;  5BPJ A;  1BG1 A;  1NUB A;  3DVJ A;  1QV1 A;  1IRJ A;  1K95 A;  2CTN A;  1XFR A;  1JUO A;  2KI6 C;  3PM8 A;  1F70 A;  1GM0 A;  1LA3 A;  3I5G C;  2L0P A;  1Y1U A;  2K2A A;  3EK8 A;  1NWD A;  2LHI A;  2M3W A;  2PAL A;  4YGE B;  3NSL A;  2JT0 A;  4USL A;  3WHU B;  1JWD A;  2LVJ A;  3VB1 A;  4GPL B;  2NCO A;  3EVV A;  1PSR A;  2D8N A;  1MF8 B;  1ZUZ A;  5CSJ A;  2V53 A;  4I5N B;  1N2D A;  4IL1 A;  1Z2C B;  3OHM B;  3UNW A;  2WCH A;  1KWO C;  1CDN A;  5B8I B;  2NXQ A;  1SL7 A;  1LS8 A;  1J7R A;  1CM1 A;  1DJY A;  3EK4 A;  1DJW A;  5I94 A;  2GGM A;  1ORG A;  1QVI Z;  2F3Z A;  3I5H C;  1G33 A;  3VRN A;  2WCL A;  3EKH A;  1SR6 B;  1KFX L;  1DQE A;  1WRZ A;  2ZN8 A;  2CNP A;  2JRF A;  2LUC A;  5KSZ A;  2P6B B;  1DGV A;  3M0W A;  2M8U A;  1NP8 A;  2F8P A;  2O5G A;  1B8L A;  5D69 A;  3KO0 A;  4OVN F;  2BCX A;  3AKA A;  4I5L B;  4HRG A;  2LV7 A;  4CFR A;  5KU1 A;  1OOF A;  3KHE A;  4MN0 A;  2QEO A;  2EHB A;  3OB2 B;  4MLW A;  1IH0 A;  1KK7 Z;  1EJ3 A;  1ZFS A;  1RK9 A;  1YUS A;  2RGI A;  1BT6 A;  1QAS A;  2KYF A;  1TNX A;  1F54 A;  1HT9 A;  1TWO A;  2KBM A;  2BL0 C;  2JQ6 A;  3D75 A;  3S0B A;  4DS7 A;  1SK6 D;  3BYA A;  1TN4 A;  1SNL A;  4MRY A;  4Q04 A;  3O4Y A;  3TDI A;  1PRW A;  1VRK A;  2K60 A;  3NHI A;  4L9M A;  4F7F A;  1Y6W A;  1S3P A;  2QEH A;  1QS7 A;  3OB1 B;  3K21 A;  1A75 A;  2M0R A;  3PN7 C;  1W7I B;  4NDB A;  1DVI A;  5AAN A;  4GAO A;  2WCM A;  3ICB A;  3PM2 A;  2MLF C;  1E8A A;  1FW4 A;  1KSM A;  1SSE B;  2CBL A;  2OTG B;  1NX3 A;  3DYE A;  1LKJ A;  5F6T A;  1CMF A;  1CB1 A;  1LXF C;  2WCF A;  1DMO A;  1BLQ A;  4CPV A;  1NYA A;  1YVH A;  5I2O A;  1KK8 C;  1C3Z A;  1GQM A;  2JTZ A;  1B7T Y;  2I18 A;  3GOF A;  4OR9 B;  2LC5 A;  3JVT B;  1J7O A;  2BBN A;  2JWW A;  1ZMZ A;  2L4H A;  1JFK A;  3OX6 A;  5EL2 A;  1OOG A;  1UHK A;  3BUM B;  3L4L A;  4MSP A;  1DGU A;  1V1F A;  1XK4 C;  2BAP A;  4UPG A;  1S26 D;  3FE9 A;  2VRG A;  1EG3 A;  2MBX A;  1CFC A;  1FI6 A;  1IIO A;  3K1E A;  1NX0 A;  2FOT A;  3SG2 A;  3BUO B;  1JC2 A;  2SCP A;  1X02 A;  2M29 A;  3FWC A;  1FBV A;  3R1P A;  4BY5 A;  1B9A A;  1OZS A;  4M2P A;  4OV2 A;  4QJ3 B;  2JC2 A;  2KAY A;  4WQ3 A;  1XO5 A;  3VGO A;  2NZ0 A;  1S6J A;  4YI8 A;  2Q4U A;  2I2R E;  1MQ1 A;  4HSZ A;  2MAZ A;  2JZI A;  3UO9 A;  1JSA A;  2H61 C;  4GNK B;  3B7A A;  2KI6 D;  1QV0 A;  2ERB A;  1KQM B;  4JPZ B;  3DF0 A;  1PAL A;  5JOL A;  1V1G A;  4MZL A;  3JTD B;  3BFA A;  3S0E A;  1KFU L;  1UHJ A;  1IWQ A;  1RRO A;  1REC A;  2K7C A;  1W7J B;  1C7V A;  4PE1 A;  3BJH A;  4DCK A;  5FI2 A;  1F71 A;  1J55 A;  3CWG A;  3LCP C;  3OX5 A;  2TN4 A;  1GGW A;  1J1E A;  1CNP A;  4N1F A;  4C0J A;  1F55 A;  1SKT A;  2K7D A;  1CLB A;  3NSI A;  3NHT A;  2MJW B;  4F0Z B;  4KYN A;  1OMD A;  3WXA A;  1FF1 A;  2M1U A;  3SG4 A;  3HX4 A;  3IVT A;  2OPO A;  2COL B;  5AXI A;  1BR1 B;  1EL4 A;  2EGD A;  2R2I A;  4JKT A;  5TNC A;  2JUL A;  1SL8 A;  3DF0 B;  3N7H A;  3IF7 A;  3BXK A;  2I94 A;  2KFH A;  2CT9 A;  2OTG C;  1B4C A;  1OQP A;  1P28 A;  3CR2 A;  5HKW A;  3SS5 A;  1YTZ C;  2ZFD A;  4AQI A;  1KK8 B;  3GK4 X;  3GK2 A;  1BOD A;  2BNX A;  2K7B A;  2LM5 A;  1U5I B;  2H61 A;  3VRR A;  4CFQ A;  4GUK A;  3DXL A;  2JTT A;  3JVT C;  1CFF A;  1KSO A;  2LLU A;  1KFX S;  2Y1M A;  3B88 A;  4PAL A;  1TNQ A;  5FI7 A;  2LMU A;  2FCD A;  1J7P A;  1CFD A;  4IJ7 A;  1C07 A;  3SS3 A;  1UUS A;  2JOJ A;  1QIW A;  3VRQ A;  1CDP A;  1MHO A;  5KTY A;  4FQT A;  3RZS A;  2L5X B;  2CCM A;  1JBA A;  1OW4 A;  1SW8 A;  1AUI B;  2JPO A;  1UHI A;  1PVA A;  1RJV A;  1DJI A;  1WY9 A;  1M45 A;  2H2K A;  2NCP A;  3AKB A;  2OS8 C;  4M2O A;  1F4O A;  1MXE A;  5CPV A;  3D77 A;  1L2O B;  2MRD A;  3R72 A;  1A03 A;  1WLM A;  1CDL A;  3QME A;  3CZ0 A;  2ZND A;  3CTN A;  1ZAC A;  1AK8 A;  1S5G Z;  2KAX A;  3O6B A;  5HL1 A;  3SG5 A;  3F45 A;  3D74 A;  2KBI A;  2KQY A;  2BCA A;  3AAK A;  4NDD A;  2Y1N A;  3VRP A;  2LUX A;  1KQM C;  3BOW B;  3MSE B;  1RTP 1;  3CYZ A;  2EC6 B;  2QDI A;  3JTD C;  1Q80 A;  3CZ2 A;  4FTG A;  3S0D A;  2WCK A;  4PHM A;  1NIW A;  1S6C A;  1LIN A;  4YGA A;  1QAT A;  2E30 A;  3H4S E;  2WC5 A;  1BU3 A;  1XYD A;  5AFP A;  1G8I A;  4JWQ A;  4DUQ A;  4U8D A;  3D10 A;  2PVB A;  1DJG A;  1IQ5 A;  1DJH A;  3LL8 B;  2QAC A;  5CSI A;  2LMT A;  5HLV A;  1IGV A;  2AMI A;  2JPT A;  5DKN A;  1YRT B;  3CZT X;  5K89 A;  2KDH A;  3BUN B;  2LLT A;  2SAS A;  1UP5 A;  1N65 A;  1DTL A;  2LCP A;  2FJU B;  1CLL A;  3FS7 A;  1B7T Z;  5HKZ A;  1M39 A;  2K2F A;  5PAL A;  1DC1 A;  3D78 A;  4PDZ A;  1NCX A;  4CID A;  3E3R A;  2FJY A;  3NSK A;  1KK7 Y;  3BUX B;  2ZNE A;  4C0K A;  1BJF A;  2Y4Q A;  3CR5 X;  3EK7 A;  1OMR A;  1EH2 A;  2WCJ A;  1NSH A;  4ICB A;  4MVF A;  2KOT A;  3RM1 A;  1SBJ A;  1UUR A;  4WQ2 A;  2LAP A;  4PE4 A;  3BQ3 A;  1QIV A;  3TZ1 A;  3PAT A;  1K94 A;  1XA5 A;  1M63 B;  1UHN A;  1Y1A A;  1K9K A;  1QLS A;  3FIA A;  2LP3 A;  3SJS A;  1XFW O;  3SG6 A;  2O60 A;  4GBA A;  2E6W A;  1KFU S;  2OS8 B;  3DVE A;  4PHN A;  4BY4 A;  1L2O C;  1TUJ A;  2P70 A;  1AJ5 A;  1PVB A;  1UWO A;  3A8R A;  2WND A;  3S0F A;  1FI5 A;  3HCM A;  4MEW A;  1YUT A;  3IQO A;  4P5O E;  2BEC A;  1XFX O;  4YGB B;  5JJG A;  2LAN A;  1CFP A;  2IS9 A;  3L4A A;  1DT7 B;  1TOP A;  1WLZ A;  1F8H A;  1Y1X A;  3DVM A;  4ORC B;  2EC6 C;  3BFH A;  2Q91 A;  3B87 A;  4PCW A;  1CKK A;  2HET A;  1TNW A;  4ETO A;  4JD9 A;  1C7W A;  4HRE E;  2L2E A;  4AQJ A;  3PLF B;  3PFV A;  1KCY A;  1HQV A;  2KI4 B;  1IG5 A;  1U5I A;  1DEK A;  1AVS A;  1MR8 A;  3ZWH A;  2L51 A;  4INW A;  2MA2 A;  4D1E A;  1R6P A;  4PHK A;  2F3Y A;  2KGB C;  2YGU A;  4INX A;  5DIC A;  3GK1 A;  3I5I B;  1JFJ A;  3SIB A;  3R1V A;  2PRU A;  2BE4 A;  5CSF A;  2HPS A;  2PYQ A;  5ER4 X;  1J7Q A;  3CR4 X;  4A4B A;  1H8B A;  1BF5 A;  4GFT A;  3OBV A;  2JXL A;  3FWB A;  3TDZ A;  2LVK A;  3B86 A;  4C0L A;  1QX7 A;  2K61 A;  1NCY A;  2FCE A;  2KYC A;  1QWV A;  2KFG A;  1XFU O;  4DRW A;  2WC8 A;  1R2U A;  2LVV A;  1Z4H A;  4YGC B;  3BOW A;  3ZNI A;  1WRL A;  2M97 A;  2JT3 A;  1UHH A;  2KFF A;  3L47 A;  1BOC A;  2K8M B;  4CLN A;  3SIA A;  1QLK A;  2PSR A;  2LE9 B;  3NXA A;  2M9G A;  1K9U A;  2KLE A;  3O4X A;  2M7L A;  1AP4 A;  1DF0 B;  2M1K B;  2QPT A;  3IQQ A;  4FQO A;  2B1U A;  4A4C A;  2H8V A;  1YX8 A;  2KQ6 A;  1NX2 A;  1YVL A;  1QX2 A;  3EG5 B;  1F4Q A;  1CDM A;  3LLE A;  1SY9 A;  2G2B A;  2QEV A;  5HYD A;  1WRK A;  4GGN A;  5GQQ C;  5IBW A;  2L98 A;  1CMG A;  2F33 A;  1AJ4 A;  1JF2 A;  1ZOT B;  4GGF C;  5ER5 A;  1G4Y R;  2JXC A;  3NSO A;  1M46 A;  4I5J A;  2F2P A;  3KEV A;  4M2Q A;  4YBH B;  1D1O A;  1FPW A;  1SL9 A;  3NGV A;  1XFZ O;  1A4P A;  1IJ5 A;  1K93 D;  3FE8 A;  4AOM A;  3D0Y B;  3DY9 A;  2ZKM X;  3LK1 A;  4P2Y B;  4YI9 A;  3C1V A;  4YGD B;  5FI6 A;  1N0Y A;  2HQW A;  1QTX A;  1SRA A;  1YR5 A;  3I5F B;  2KI4 C;  1H4B A;  3Q8I A;  3OGN A;  4DIR A;  3V2L A;  1K2H A;  1TRF A;  4ORB B;  2BBM A;  2MLE C;  3O78 A;  4MRX A;  2LMV A;  2K7O A;  2PMY A;  4ZCU A;  3WNX B;  2KAV A;  1QVI Y;  1MUX A;  5HLO A; 
#chains in the Genus database with same CATH homology
 3TS5 B;  3O2P A;  5I8N A;  1OMV A;  1OZO A;  2PAS A;  2WOS A;  3I5I C;  3SG3 A;  1S5G Y;  2HF5 A;  4QJ5 B;  2CXJ A;  4XJK A;  3TUY B;  1TCO B;  1L7Z A;  1GJY A;  2I7A A;  4PE0 A;  1A2X A;  3EVR A;  4HRH A;  2MHH A;  1Y0V H;  1QX5 B;  3KF9 A;  2M7N A;  5AEQ A;  1MWN A;  2K0J A;  1SCV A;  2ZN9 A;  1CLM A;  1IJ6 A;  1MXL C;  1QXP A;  2LLS A;  1BR4 B;  4R1E A;  1NX1 A;  1SCM B;  4GGF A;  1DJX A;  1NCZ A;  1YUU A;  1B8C A;  2Y5I A;  4MZJ A;  3SG7 A;  5I2Q A;  3CLN A;  1XVJ A;  1BMO A;  1OOJ A;  1OSA A;  4PE7 A;  2ZRS A;  2BCB A;  1K96 A;  4WRI A;  4XJK B;  1WDC B;  3DVK A;  1PUL A;  3WHT B;  1YX7 A;  2AUC A;  3I5G B;  1SMG A;  2NLN A;  1TTX A;  3VRO A;  1TNP A;  1K9P A;  3CS1 A;  1K8U A;  4NDC A;  3AAJ A;  2JNF A;  1XFY O;  1RWY A;  2ISD A;  1A29 A;  2HQ8 A;  4E68 A;  3KPX A;  5D7F A;  1CM4 A;  3EVU A;  1B8R A;  1KWO B;  2BKH B;  1EG4 A;  1A75 B;  2GGZ A;  1IKU A;  1QJT A;  1LA0 A;  1PK0 D;  1SPY A;  1JF0 A;  1SYM A;  2LP2 A;  2M49 B;  3A4U B;  2LHL A;  2F2O A;  4QJ4 B;  5AER A;  1TCF A;  1ODB A;  3I5H B;  4YRU A;  4MZK A;  3I5F C;  4NQG A;  1KQV A;  4OKH A;  5HKY A;  1S6I A;  1SR6 C;  2L50 A;  2KNE A;  3LK0 A;  3TDU A;  4PHJ A;  2KGR A;  2BKI B;  1EXR A;  1K90 D;  1S1E A;  1YUR A;  4OCI A;  4XYN A;  3TS5 C;  2A4J A;  3PSR A;  1TIZ A;  1DJZ A;  3BUW B;  4I5K A;  5DKQ A;  1S36 A;  1DF0 A;  3EKJ A;  3OP0 A;  5FYX A;  3TUY C;  3PAL A;  1ALW A;  1B1G A;  1PSB A;  5J3X A;  2GV5 A;  1ALV A;  2JNX A;  4ZCV A;  1M31 A;  4TNC A;  2AAO A;  1NPQ A;  2WOR A;  3CGA A;  3RLZ A;  2BL0 B;  5CSN A;  1AHR A;  1LVC D;  1GGZ A;  1IQ3 A;  2LNK A;  2ZRT A;  1SCM C;  2KSP A;  4N5X A;  1XFV O;  1XK4 A;  2WCB A;  2G9B A;  2JU0 A;  5G08 A;  2BE6 A;  1B47 A;  1YRU B;  2JT8 A;  2DOQ A;  2L4I A;  1J1D A;  3DD4 A;  2WCE A;  5I2L A;  3PN7 B;  1OE9 B;  1RFJ A;  2LVI A;  4N1G A;  4MBE A;  2KHN A;  3D0Y A;  4ORA B;  5DKR A;  1CTR A;  3QRX A;  4JQ0 D;  1WDC C;  5BPJ A;  1BG1 A;  1NUB A;  3DVJ A;  1QV1 A;  1IRJ A;  1K95 A;  2CTN A;  2KI6 C;  1JUO A;  3PM8 A;  1F70 A;  1LA3 A;  3I5G C;  2L0P A;  1Y1U A;  2K2A A;  3EK8 A;  1NWD A;  2LHI A;  2M3W A;  2PAL A;  4YGE B;  3NSL A;  2JT0 A;  4USL A;  3WHU B;  1JWD A;  2LVJ A;  4GPL B;  2NCO A;  3EVV A;  1PSR A;  2D8N A;  1MF8 B;  1ZUZ A;  5CSJ A;  2V53 A;  4I5N B;  1N2D A;  4IL1 A;  3OHM B;  1KWO C;  1CDN A;  5B8I B;  2NXQ A;  1SL7 A;  1J7R A;  1CM1 A;  1DJY A;  3EK4 A;  1DJW A;  2GGM A;  1QVI Z;  2F3Z A;  3I5H C;  1G33 A;  3VRN A;  3EKH A;  1SR6 B;  1KFX L;  1WRZ A;  2ZN8 A;  2CNP A;  2JRF A;  2LUC A;  5KSZ A;  2P6B B;  1DGV A;  3M0W A;  2M8U A;  1NP8 A;  2F8P A;  2O5G A;  1B8L A;  5D69 A;  3KO0 A;  4OVN F;  2BCX A;  3AKA A;  4I5L B;  4HRG A;  2LV7 A;  4CFR A;  5KU1 A;  3KHE A;  4MN0 A;  2EHB A;  3OB2 B;  4MLW A;  1IH0 A;  1KK7 Z;  1EJ3 A;  1ZFS A;  1RK9 A;  1YUS A;  2RGI A;  1BT6 A;  1QAS A;  2KYF A;  1TNX A;  1F54 A;  1HT9 A;  2KBM A;  2BL0 C;  2JQ6 A;  4DS7 A;  1SK6 D;  3BYA A;  1TN4 A;  1SNL A;  4MRY A;  4Q04 A;  3O4Y A;  3TDI A;  1PRW A;  1VRK A;  4L9M A;  1Y6W A;  1S3P A;  1QS7 A;  3OB1 B;  3K21 A;  1A75 A;  2M0R A;  3PN7 C;  1W7I B;  4NDB A;  1DVI A;  5AAN A;  4GAO A;  3ICB A;  2MLF C;  1E8A A;  1FW4 A;  1KSM A;  2CBL A;  2OTG B;  5F6T A;  1NX3 A;  1CMF A;  1LKJ A;  1CB1 A;  1LXF C;  2WCF A;  1DMO A;  1BLQ A;  4CPV A;  1NYA A;  1YVH A;  5I2O A;  1KK8 C;  1GQM A;  2JTZ A;  1B7T Y;  2I18 A;  3GOF A;  4OR9 B;  2LC5 A;  3JVT B;  1J7O A;  2BBN A;  2JWW A;  1ZMZ A;  2L4H A;  1JFK A;  3OX6 A;  1UHK A;  3BUM B;  4MSP A;  1DGU A;  1V1F A;  1XK4 C;  4UPG A;  1S26 D;  2VRG A;  1EG3 A;  2MBX A;  1CFC A;  1FI6 A;  1NX0 A;  2FOT A;  3SG2 A;  3BUO B;  1JC2 A;  2SCP A;  1X02 A;  2M29 A;  3FWC A;  1FBV A;  4BY5 A;  1B9A A;  1OZS A;  4M2P A;  4OV2 A;  4QJ3 B;  2JC2 A;  2KAY A;  4WQ3 A;  1XO5 A;  3VGO A;  2NZ0 A;  1S6J A;  4YI8 A;  2Q4U A;  2I2R E;  1MQ1 A;  4HSZ A;  2MAZ A;  2JZI A;  1JSA A;  2H61 C;  4GNK B;  2KI6 D;  1QV0 A;  1KQM B;  4JPZ B;  3DF0 A;  1PAL A;  5JOL A;  1V1G A;  4MZL A;  3JTD B;  1KFU L;  1UHJ A;  1IWQ A;  1RRO A;  1REC A;  2K7C A;  1W7J B;  1C7V A;  4PE1 A;  4DCK A;  1F71 A;  1J55 A;  3CWG A;  3LCP C;  3OX5 A;  2TN4 A;  1GGW A;  1J1E A;  1CNP A;  4N1F A;  4C0J A;  1F55 A;  1SKT A;  2K7D A;  1CLB A;  3NSI A;  2MJW B;  4F0Z B;  3WXA A;  1OMD A;  1FF1 A;  2M1U A;  3SG4 A;  3HX4 A;  2OPO A;  2COL B;  5AXI A;  1BR1 B;  1EL4 A;  2EGD A;  2R2I A;  5TNC A;  2JUL A;  1SL8 A;  3DF0 B;  3IF7 A;  3BXK A;  2I94 A;  2KFH A;  2CT9 A;  2OTG C;  1B4C A;  1OQP A;  3CR2 A;  5HKW A;  1YTZ C;  2ZFD A;  4AQI A;  1KK8 B;  3GK4 X;  3GK2 A;  1BOD A;  2K7B A;  2LM5 A;  1U5I B;  2H61 A;  3VRR A;  4CFQ A;  4GUK A;  2JTT A;  3JVT C;  1CFF A;  1KSO A;  2LLU A;  1KFX S;  2Y1M A;  4PAL A;  1TNQ A;  2LMU A;  2FCD A;  1J7P A;  1CFD A;  1C07 A;  1UUS A;  2JOJ A;  1QIW A;  3VRQ A;  1CDP A;  1MHO A;  5KTY A;  2L5X B;  2CCM A;  1JBA A;  1SW8 A;  1AUI B;  1UHI A;  1PVA A;  1RJV A;  1DJI A;  1WY9 A;  1M45 A;  2H2K A;  2NCP A;  3AKB A;  2OS8 C;  4M2O A;  1F4O A;  1MXE A;  5CPV A;  1L2O B;  2MRD A;  1A03 A;  1WLM A;  1CDL A;  2ZND A;  3CTN A;  1ZAC A;  1AK8 A;  1S5G Z;  2KAX A;  3O6B A;  3SG5 A;  3F45 A;  2KBI A;  2KQY A;  2BCA A;  3AAK A;  4NDD A;  2Y1N A;  3VRP A;  2LUX A;  1KQM C;  3BOW B;  3MSE B;  1RTP 1;  2EC6 B;  3JTD C;  1Q80 A;  4FTG A;  4PHM A;  1NIW A;  1S6C A;  1LIN A;  4YGA A;  1QAT A;  2E30 A;  3H4S E;  5AFP A;  1BU3 A;  1XYD A;  1G8I A;  4JWQ A;  4DUQ A;  4U8D A;  3D10 A;  2PVB A;  1DJG A;  1IQ5 A;  1DJH A;  3LL8 B;  2QAC A;  5CSI A;  2LMT A;  5HLV A;  1IGV A;  2AMI A;  2JPT A;  5DKN A;  1YRT B;  3CZT X;  5K89 A;  2KDH A;  3BUN B;  2LLT A;  2SAS A;  1UP5 A;  1N65 A;  1DTL A;  2LCP A;  2FJU B;  1CLL A;  3FS7 A;  1B7T Z;  5HKZ A;  1M39 A;  2K2F A;  5PAL A;  4PDZ A;  1NCX A;  4CID A;  3E3R A;  3NSK A;  1KK7 Y;  3BUX B;  2ZNE A;  4C0K A;  1BJF A;  2Y4Q A;  3CR5 X;  3EK7 A;  1OMR A;  1EH2 A;  1NSH A;  4ICB A;  4MVF A;  2KOT A;  3RM1 A;  1SBJ A;  1UUR A;  4WQ2 A;  2LAP A;  4PE4 A;  3BQ3 A;  1QIV A;  3TZ1 A;  3PAT A;  1K94 A;  1XA5 A;  1M63 B;  1UHN A;  1Y1A A;  1K9K A;  1QLS A;  3FIA A;  2LP3 A;  3SJS A;  1XFW O;  3SG6 A;  2O60 A;  4GBA A;  2E6W A;  1KFU S;  2OS8 B;  3DVE A;  4PHN A;  4BY4 A;  1L2O C;  1AJ5 A;  1PVB A;  1UWO A;  3A8R A;  2WND A;  1FI5 A;  3HCM A;  4MEW A;  1YUT A;  3IQO A;  4P5O E;  2BEC A;  1XFX O;  4YGB B;  5JJG A;  2LAN A;  1CFP A;  2IS9 A;  1DT7 B;  1TOP A;  1WLZ A;  1F8H A;  1Y1X A;  3DVM A;  4ORC B;  2EC6 C;  2Q91 A;  4PCW A;  1CKK A;  2HET A;  1TNW A;  4ETO A;  1C7W A;  4HRE E;  2L2E A;  4AQJ A;  3PLF B;  3PFV A;  1KCY A;  1HQV A;  2KI4 B;  1IG5 A;  1U5I A;  1AVS A;  1MR8 A;  3ZWH A;  2L51 A;  2MA2 A;  4D1E A;  1R6P A;  4PHK A;  2F3Y A;  2KGB C;  3GK1 A;  3I5I B;  1JFJ A;  3SIB A;  2PRU A;  2BE4 A;  5CSF A;  2HPS A;  5ER4 X;  1J7Q A;  3CR4 X;  4A4B A;  1H8B A;  1BF5 A;  4GFT A;  2JXL A;  3FWB A;  3TDZ A;  2LVK A;  4C0L A;  1QX7 A;  2K61 A;  1NCY A;  2FCE A;  2KYC A;  2KFG A;  1XFU O;  4DRW A;  2WC8 A;  1R2U A;  2LVV A;  4YGC B;  3BOW A;  3ZNI A;  1WRL A;  2M97 A;  2JT3 A;  1UHH A;  2KFF A;  1BOC A;  2K8M B;  4CLN A;  3SIA A;  1QLK A;  2PSR A;  2LE9 B;  3NXA A;  2M9G A;  1K9U A;  2M7L A;  1AP4 A;  1DF0 B;  2M1K B;  2QPT A;  3IQQ A;  4FQO A;  2B1U A;  4A4C A;  1YX8 A;  2KQ6 A;  1NX2 A;  1YVL A;  1QX2 A;  1F4Q A;  1CDM A;  3LLE A;  1SY9 A;  2G2B A;  5HYD A;  1WRK A;  4GGN A;  5GQQ C;  5IBW A;  2L98 A;  1CMG A;  2F33 A;  1AJ4 A;  1JF2 A;  1ZOT B;  4GGF C;  5ER5 A;  1G4Y R;  2JXC A;  3NSO A;  1M46 A;  4I5J A;  2F2P A;  3KEV A;  4M2Q A;  4YBH B;  1D1O A;  1FPW A;  1SL9 A;  1XFZ O;  1A4P A;  1IJ5 A;  1K93 D;  4AOM A;  3D0Y B;  3LK1 A;  2ZKM X;  4P2Y B;  4YI9 A;  4YGD B;  3C1V A;  1N0Y A;  2HQW A;  1QTX A;  1SRA A;  1YR5 A;  3I5F B;  2KI4 C;  1H4B A;  4DIR A;  1K2H A;  1TRF A;  4ORB B;  2BBM A;  2MLE C;  3O78 A;  4MRX A;  2LMV A;  2K7O A;  2PMY A;  4ZCU A;  3WNX B;  2KAV A;  1QVI Y;  1MUX A;  5HLO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...