1BOCA

The solution structures of mutant calbindin d9k's, as determined by nmr, show that the calcium binding site can adopt different folds
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
76
structure length
76
Chain Sequence
MKSPEELKGIFEKYADKEGDGNQLSKEELKLLLQTEFPSLLKGMSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Calcium-binding protein
molecule keywords CALBINDIN D9K
publication title The solution structures of mutant calbindin D9k's, as determined by NMR, show that the calcium-binding site can adopt different folds.
pubmed doi rcsb
source organism Bos taurus
total genus 6
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 1993-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1bocA00
1M46A 1RWYA 2WORA 2LC5A 1WRKA 2M8UA 3PSRA 4HSZA 1KK8C 1YRTB 3DD4A 1JSAA 1C07A 2WCFA 4PHKA 2JT3A 5HLOA 5HKWA 1PVAA 3LK1A 1IKUA 3LL8B 4YI8A 1U5IB 3EVUA 3D10A 3A4UB 1IG5A 1NX2A 1KWOB 1SMGA 2KBIA 2QACA 3BUXB 1PALA 4M2OA 1U5IA 3E3RA 4I5JA 3GK4X 4XYNA 4PE0A 2JTTA 1HT9A 3I5HC 1TNQA 2M1UA 1EG3A 1IWQA 5PALA 1DVIA 1J7QA 1B8LA 1BMOA 3HCMA 4WQ2A 4R1EA 1NWDA 2I7AA 5I8NA 3IQOA 5GQQC 2OS8B 4MVFA 4ZCUA 3TDIA 2HF5A 3DVMA 1CFPA 3EVRA 3OP0A 5D7FA 1K90D 1S5GZ 2H61A 5B8IB 4YGDB 3EK8A 1CM1A 4GNKB 1AJ4A 2JRFA 3WNXB 1OZSA 5D69A 2OTGC 3HX4A 1J7PA 1NCZA 1KK8B 1XFVO 1YX7A 3MSEB 2F2OA 1DJWA 1NCXA 1SRAA 1A4PA 1ALWA 2ZNDA 5KTYA 2K7CA 2AAOA 5AERA 2BKHB 1CFFA 2KFGA 1L2OC 1YUTA 2MLEC 3GK2A 1F4OA 1WLMA 1FF1A 1NSHA 2JULA 1KQVA 1SPYA 5HYDA 1MUXA 5ER5A 2LANA 1A29A 2LLTA 5FYXA 5HKYA 1GQMA 5DKNA 3I5HB 2CXJA 1TNXA 1IRJA 1Q80A 4I5NB 3A8RA 3KHEA 2MHHA 1KSOA 1WRZA 1YVHA 1F8HA 1N0YA 3CGAA 2KGBC 1K95A 1M45A 1C7VA 4UPGA 2GV5A 3PALA 1CLBA 5CPVA 2F33A 4NDCA 3LCPC 2CTNA 1GGZA 1AHRA 4NDBA 2KAXA 3NSLA 4GGNA 2FCEA 5JOLA 1R2UA 4C0LA 2D8NA 4CFQA 3NSIA 1QV1A 1BR4B 2KBMA 4YGCB 2BKIB 3CR4X 1MQ1A 4DIRA 3CLNA 2H2KA 4BY4A 2LMUA 4C0JA 1DTLA 4PDZA 4P2YB 1EG4A 3OX5A 4TNCA 2M49B 4YGBB 3VRPA 1UHIA 2JXCA 2K7BA 2M9GA 2K2FA 3PM8A 3QRXA 4CLNA 3I5IC 1UHNA 4MZJA 1IJ6A 1B7TY 1L2OB 2K8MB 4GPLB 1BU3A 1JC2A 2ZKMX 1DJGA 1K9PA 1H4BA 1YUUA 5DKQA 2MRDA 2NCOA 1Y0VH 3OX6A 2JOJA 2K7OA 2K61A 1QX2A 4D1EA 3F45A 1IGVA 2KI6D 2I2RE 2M7NA 1WY9A 4DS7A 3TZ1A 4P5OE 2LE9B 3SIAA 2KDHA 2KYCA 1DJIA 4FTGA 2BBMA 4AOMA 2KFHA 5F6TA 1TRFA 1CLLA 2LNKA 3NSOA 2LM5A 2H61C 4ETOA 2LHLA 1XYDA 2NXQA 1EL4A 1NX0A 1J7OA 3FIAA 1RJVA 2L2EA 5CSFA 2F8PA 2O60A 2ZRTA 1SYMA 2VRGA 1CFCA 1QLKA 3AKBA 2MLFC 2KQ6A 5AEQA 1K94A 2FCDA 4GBAA 4ORAB 3SG5A 2BCBA 2WCBA 1SL7A 1H8BA 1HQVA 1KK7Z 3I5IB 3BYAA 1OSAA 3IQQA 1QASA 2JU0A 4N1FA 2MJWB 4OV2A 4I5LB 4L9MA 3BUOB 4MEWA 1TCOB 3BXKA 1GJYA 2JNXA 2SCPA 3OB1B 4JPZB 2WCEA 1NX3A 2MBXA 3VRRA 1NPQA 4M2PA 1AP4A 2ZN8A 2I18A 4N5XA 1J1DA 3CTNA 1CKKA 4MSPA 3NSKA 1DJXA 4HREE 1SW8A 4MLWA 4QJ5B 3ZWHA 1K8UA 1PSBA 1KFUS 4NQGA 4PE7A 1ZFSA 1J1EA 1M39A 1LA3A 2LVKA 1XFWO 4WRIA 1IH0A 2LMVA 1TOPA 4GAOA 1ZOTB 1PVBA 1S5GY 2L50A 2NZ0A 1XFUO 1YTZC 1CB1A 1NIWA 2JXLA 5K89A 2KI4C 3O6BA 1DGVA 1NUBA 2JPTA 1WLZA 1FI6A 2MA2A 1G8IA 1R6PA 2L4HA 4PHNA 2B1UA 2EGDA 1F55A 1YX8A 1KQMC 2TN4A 1KFXL 1S6JA 1SBJA 4DCKA 1SCVA 3AKAA 3EKJA 4ICBA 2M7LA 2E6WA 3DVEA 1CMGA 3CWGA 2ZNEA 2KI6C 1CDNA 3DF0B 1RECA 1OZOA 1LINA 1UUSA 1B9AA 5AFPA 2L98A 2ZN9A 4DUQA 2KAYA 3DF0A 3EK7A 1BT6A 2GGMA 5AXIA 2R2IA 1SCMC 5G08A 1X02A 5I2QA 3JTDC 3KO0A 3BUWB 1OMRA 2EHBA 3GOFA 3WHUB 3PLFB 2KFFA 2LVJA 4M2QA 1QX5B 4ORCB 1LXFC 1CNPA 4CIDA 4GUKA 3FWCA 2BECA 1QS7A 2LCPA 1S3PA 1V1GA 4AQIA 1FI5A 2JZIA 1WRLA 2ZRSA 2JNFA 1LA0A 2M1KB 2KI4B 2M0RA 1F71A 2Q91A 1QLSA 1Y1AA 5I2OA 3PFVA 1ALVA 2KQYA 1CDLA 4QJ4B 3PATA 3TS5C 1JUOA 1KQMB 2JQ6A 1B8CA 1M63B 1NYAA 2BE4A 5J3XA 1RFJA 2LVIA 4MRXA 4GGFC 1GGWA 5HKZA 1BODA 4E68A 3VRNA 1XFZO 1FBVA 4AQJA 1PRWA 1JFJA 3WXAA 1SCMB 1MXLC 1UURA 1QATA 1ZACA 3JTDB 4YI9A 1ZUZA 1QVIY 2HQWA 2KAVA 4OR9B 4HRGA 1QIWA 1QIVA 3O2PA 2LUXA 1DF0B 2AUCA 4A4BA 3BUMB 2JT0A 1MR8A 2WOSA 1K2HA 4PHJA 3M0WA 1DF0A 5CSNA 2LLSA 1PULA 3SG3A 1B4CA 1TN4A 5BPJA 4MZLA 3FWBA 1J55A 5ER4X 1L7ZA 1JFKA 2COLB 3VROA 3EVVA 2M29A 3AAKA 1DMOA 1KSMA 4CPVA 1XK4C 3OB2B 3RLZA 1N2DA 1PSRA 2F3YA 2PASA 1DJYA 2Y4QA 1TNPA 2LP3A 1F4QA 2PVBA 3TS5B 2OPOA 3AAJA 1TTXA 1DT7B 1QJTA 1KK7Y 4YRUA 1D1OA 1CDMA 4Q04A 4MN0A 1XVJA 1Y1XA 1S6IA 2K7DA 2G9BA 3BQ3A 5JJGA 4YBHB 1S26D 1EXRA 1S36A 1SL9A 2ISDA 1YRUB 2JC2A 4GGFA 3EK4A 1CFDA 1CM4A 2JTZA 1K9UA 2BCXA 1Y1UA 2CT9A 4MZKA 4PE1A 2G2BA 3CS1A 1MHOA 1BG1A 1OMVA 2KYFA 3ZNIA 3CR2A 1UHKA 2F2PA 3JVTC 4MRYA 2CBLA 1G33A 4PCWA 2LLUA 3BUNB 2HQ8A 2L0PA 2Y1MA 4QJ3B 1FPWA 1IQ3A 1CLMA 1PK0D 1YVLA 4PALA 1KCYA 2I94A 4N1GA 3LLEA 4MBEA 1XFXO 1AVSA 4I5KA 1QX7A 1OE9B 3CZTX 1XK4A 2CNPA 4NDDA 2PRUA 1TNWA 1CDPA 2BE6A 1QXPA 4YGEB 3PN7C 2KHNA 3SIBA 5KSZA 2L4IA 2PSRA 4CFRA 1ODBA 4C0KA 1J7RA 1QTXA 4JQ0D 1IQ5A 2L51A 4A4CA 5AANA 1K93D 2BBNA 1YUSA 2SASA 3SG4A 1AUIB 2CCMA 3CR5X 1S1EA 3I5FC 3KF9A 4OVNF 2RGIA 2LAPA 1E8AA 1WDCC 1YR5A 3I5GC 3JVTB 4U8DA 2V53A 4BY5A 3TUYC 4ZCVA 4WQ3A 1V1FA 4OCIA 1DJHA 1TIZA 1LVCD 1RK9A 1JWDA 3C1VA 2E30A 4JWQA 2WNDA 2K2AA 2LMTA 3O78A 2LP2A 1NX1A 1SKTA 1SR6C 3LK0A 1S6CA 1BR1B 2JWWA 2KNEA 1DGUA 2PMYA 1FW4A 1MXEA 1SL8A 2P6BB 3K21A 2M3WA 1KFXS 3DVJA 1UHJA 1XO5A 1SNLA 3OHMB 1JBAA 3PN7B 2MAZA 2EC6C 2KGRA 1ZMZA 4IL1A 1B8RA 5CSJA 3RM1A 1OQPA 3H4SE 1M31A 1XFYO 2Q4UA 3KPXA 1BLQA 1MF8B 2LHIA 5KU1A 1RROA 3BOWB 2BL0C 2LV7A 5I2LA 2ZFDA 2FOTA 1NCYA 3BOWA 3DVKA 1AJ5A 1B1GA 2OTGB 5IBWA 1UWOA 2WC8A 3I5FB 3SJSA 2L5XB 1WDCB 3I5GB 2O5GA 2Y1NA 3TUYB 1NP8A 1YURA 1B7TZ 1JF2A 2F3ZA 2KSPA 1SK6D 1F70A 4PE4A 1EH2A 3D0YB 1SY9A 1XA5A 1A2XA 1TCFA 4DRWA 1K96A 1UHHA 4PHMA 1QV0A 4FQOA 3D0YA 1JF0A 1CMFA 3TDUA 1N65A 2GGZA 4YGAA 4F0ZB 1BF5A 1IJ5A 1UP5A 2A4JA 1KWOC 3ICBA 2LVVA 3EKHA 4HRHA 3GK1A 1A03A 1CTRA 2FJUB 1SR6B 2NCPA 1B47A 2PALA 3O4YA 3SG2A 4OKHA 1DJZA 2HETA 1OMDA 3TDZA 2BCAA 1LKJA 2QPTA 1QVIZ 4GFTA 1RTP1 1VRKA 4ORBB 3WHTB 2DOQA 2EC6B 2HPSA 5DKRA 2Y5IA 2M97A 3SG6A 1Y6WA 3IF7A 2IS9A 2K0JA 3KEVA 2JT8A 2NLNA 3VGOA 1W7JB 2OS8C 4XJKB 1BJFA 2KOTA 2BL0B 1F54A 1A75B 3FS7A 3SG7A 1BOCA 1K9KA 1W7IB 4XJKA 3VRQA 1OOJA 2AMIA 1KFUL 1C7WA 1A75A 1EJ3A 1MWNA 5CSIA 5TNCA 3NXAA 4USLA 5HLVA 1G4YR 1AK8A 2LUCA
chains in the Genus database with same CATH superfamily
1M46A 1RWYA 2WORA 2LC5A 3BFBA 1WRKA 2M8UA 3PSRA 4HSZA 1KK8C 3CYZA 1YRTB 2KLDA 3DD4A 1JSAA 1C07A 2WCFA 4PHKA 1T14A 3EG5B 3L4LA 2JT3A 5HLOA 5HKWA 1PVAA 3LK1A 1IKUA 3LL8B 4YI8A 1U5IB 3EVUA 3D10A 3A4UB 1IG5A 1NX2A 1KWOB 1SMGA 2KBIA 2QACA 3BUXB 4IJ7A 1PALA 4M2OA 1U5IA 3E3RA 3DYEA 4I5JA 3RZSA 2JPOA 3GK4X 4XYNA 4PE0A 2JTTA 1HT9A 3I5HC 1TNQA 2M1UA 1EG3A 1IWQA 5PALA 1DVIA 4PT1A 1J7QA 1B8LA 4INXA 1BMOA 3HCMA 4WQ2A 4R1EA 1NWDA 2I7AA 5I8NA 3IQOA 1C3ZA 2OS8B 4MVFA 5GQQC 1QWVA 3CZ1A 4ZCUA 3TDIA 2HF5A 3DVMA 1CFPA 3EVRA 3OP0A 5D7FA 1K90D 1S5GZ 2H61A 3CDNA 5B8IB 4YGDB 3EK8A 1CM1A 4GNKB 1AJ4A 2JRFA 3WNXB 1OZSA 5D69A 1OOIX 2OTGC 3HX4A 1J7PA 1NCZA 1KK8B 1XFVO 1YX7A 3MSEB 2F2OA 1DJWA 1NCXA 1SRAA 1A4PA 1ALWA 2ZNDA 5KTYA 2K7CA 2AAOA 5AERA 2BKHB 4JKTA 5FI2A 2H8VA 2KFGA 1CFFA 1L2OC 1YUTA 2MLEC 3GK2A 1F4OA 2BNXA 3UNWA 1WLMA 1FF1A 4INWA 1NSHA 2JULA 1KQVA 1SPYA 5HYDA 1MUXA 1DEKA 5ER5A 2LANA 1A29A 2LLTA 5FYXA 5HKYA 1GQMA 5DKNA 3I5HB 1LS8A 1TNXA 2CXJA 1IRJA 1TUJA 1Q80A 4I5NB 3CZ0A 3A8RA 3KHEA 2MHHA 1KSOA 1WRZA 1YVHA 1F8HA 1N0YA 2YGUA 2KGBC 3CGAA 2QDIA 1K95A 1M45A 1C7VA 4UPGA 2GV5A 3PALA 1CLBA 2P71A 5CPVA 2F33A 4NDCA 3LCPC 2CTNA 1GGZA 1AHRA 4NDBA 3B86A 2KAXA 3NSLA 1OOGA 4GGNA 2FCEA 5JOLA 1R2UA 3B87A 4C0LA 2D8NA 4CFQA 3NSIA 1QV1A 3D74A 1BR4B 2KBMA 4YGCB 2BKIB 3CR4X 1MQ1A 4DIRA 3CLNA 2H2KA 4BY4A 2LMUA 4C0JA 1DTLA 2GTEA 4P2YB 1EG4A 3OX5A 4PDZA 4TNCA 2M49B 4YGBB 3VRPA 1UHIA 2JXCA 2K7BA 2M9GA 2K2FA 3PM8A 3QRXA 4CLNA 3I5IC 1UHNA 4MZJA 1IJ6A 1B7TY 1L2OB 2K8MB 3O4XA 4GPLB 2PYQA 1BU3A 1JC2A 3CABA 2ZKMX 1DJGA 1K9PA 1H4BA 1YUUA 5DKQA 2MRDA 2NCOA 1Y0VH 3OX6A 2JOJA 3SS3A 2K7OA 2K61A 1QX2A 4D1EA 3F45A 1IGVA 2KI6D 3BFHA 2I2RE 2M7NA 1WY9A 4DS7A 3OGNA 4P5OE 2LE9B 3TZ1A 3SIAA 3SS5A 2KDHA 3BJHA 2KYCA 1DJIA 4FTGA 2BBMA 4AOMA 2KFHA 5F6TA 1TRFA 1CLLA 2LNKA 3NSOA 2LM5A 2H61C 5FI7A 1IIOA 3BFAA 4ETOA 2LHLA 1XYDA 2NXQA 1EL4A 1NX0A 1J7OA 3FIAA 1RJVA 1SSEB 2L2EA 2F8PA 2O60A 2ZRTA 1SYMA 2VRGA 5CSFA 1DC1A 1QLKA 3AKBA 2BAPA 2MLFC 2KQ6A 5AEQA 1K94A 2FCDA 4GBAA 4ORAB 3SG5A 3IVTA 2KPHA 2BCBA 2WCBA 1SL7A 1H8BA 1HQVA 1KK7Z 3I5IB 3BYAA 1OSAA 3IQQA 1QASA 2JU0A 4N1FA 2MJWB 4OV2A 4I5LB 4L9MA 3S0AA 3BUOB 2L2CA 4MEWA 1TCOB 1TUZA 3BXKA 1GJYA 2JNXA 2SCPA 3OB1B 3D77A 4JPZB 2WCEA 1NX3A 2MBXA 3VRRA 1NPQA 2L5YA 2P70A 4M2PA 1AP4A 2ZN8A 2I18A 4N5XA 1J1DA 3CTNA 1CKKA 4MSPA 3NSKA 1DJXA 4HREE 1SW8A 4MLWA 4QJ5B 3ZWHA 1K8UA 1PSBA 1KFUS 4NQGA 4PE7A 3S0EA 1ZFSA 3N7HA 1DELA 1J1EA 1M39A 1LA3A 1TWOA 2LVKA 1XFWO 4WRIA 1IH0A 2LMVA 1TOPA 4GAOA 1OOFA 1ZOTB 1PVBA 1S5GY 2L50A 2NZ0A 1XFUO 2PQLA 1YTZC 1CB1A 1NIWA 2JXLA 5K89A 2KI4C 3O6BA 1DGVA 1NUBA 2JPTA 1WLZA 4OZDA 3Q8IA 1FI6A 2MA2A 1CFCA 1DQEA 1G8IA 1R6PA 2L4HA 2B1UA 2EGDA 2WCKA 1YX8A 4PHNA 1KQMC 1F55A 2TN4A 1KFXL 1S6JA 1SBJA 3S0DA 4DCKA 1SCVA 3AKAA 3EKJA 4ICBA 2M7LA 2E6WA 3DVEA 1CMGA 3CWGA 2ZNEA 2KI6C 1CDNA 5FI6A 3DF0B 1RECA 1OZOA 1LINA 1UUSA 1B9AA 3FE9A 2L98A 4FQTA 5AFPA 2ZN9A 4DUQA 2KAYA 2WC6A 3DF0A 3EK7A 1BT6A 2GGMA 3S0FA 5AXIA 5D3OA 2R2IA 1SCMC 5G08A 1X02A 2WCHA 5I2QA 3JTDC 3L47A 3KO0A 3BUWB 1C3YA 1OMRA 2EHBA 3GOFA 3WHUB 3PLFB 2KFFA 2LVJA 4M2QA 1QX5B 4ORCB 1LXFC 1CNPA 1ORGA 4CIDA 4GUKA 3FWCA 2BECA 1GM0A 1QS7A 2LCPA 1S3PA 1V1GA 4AQIA 1FI5A 2JZIA 1WRLA 2ZRSA 2JNFA 1LA0A 2M1KB 2KI4B 2M0RA 3D76A 1F71A 5DICA 3DXLA 2Q91A 2K60A 1QLSA 1Y1AA 5I2OA 3PFVA 1ALVA 2KQYA 1CDLA 1W9ZA 3PATA 3TS5C 4QJ4B 1JUOA 1KQMB 1P28A 2JQ6A 3B6XA 1OOHA 1B8CA 1M63B 1NYAA 2BE4A 3SS4A 5J3XA 5I94A 1RFJA 2LVIA 4MRXA 4GGFC 1GGWA 5HKZA 3NHTA 1BODA 3PM2A 4E68A 3VRNA 1XFZO 1FBVA 2QEOA 4AQJA 1PRWA 1JFJA 3WXAA 1SCMB 3R1OA 1MXLC 1UURA 1QATA 1ZACA 3JTDB 4YI9A 1ZUZA 1QVIY 2HQWA 2KAVA 4OR9B 4HRGA 1QIWA 1QIVA 3O2PA 2LUXA 1DF0B 2AUCA 4A4BA 3BUMB 2JT0A 1MR8A 2WOSA 1K2HA 4PHJA 3M0WA 1DF0A 5CSNA 2LLSA 1PULA 3SG3A 1B4CA 1TN4A 5BPJA 4MZLA 3FWBA 1J55A 5ER4X 1L7ZA 1JFKA 2COLB 3QMEA 3EVVA 3R1PA 3VROA 2M29A 3AAKA 1DMOA 1KSMA 4CPVA 1XK4C 3OB2B 3R1VA 3RLZA 1N2DA 1PSRA 2F3YA 2PASA 1DJYA 2Y4QA 1TNPA 2LP3A 1F4QA 2PVBA 3TS5B 2OPOA 3AAJA 1TTXA 1DT7B 1QJTA 1KK7Y 4YRUA 1D1OA 1CDMA 4Q04A 3B88A 1XVJA 1Y1XA 1S6IA 2K7DA 4MN0A 2G9BA 3BQ3A 2WCJA 5JJGA 4YBHB 1S26D 1EXRA 1S36A 1SL9A 2ISDA 1YRUB 2JC2A 2QEVA 3FE6A 3EK4A 4GGFA 2WCLA 3FE8A 1CFDA 1CM4A 2JTZA 1K9UA 2BCXA 2WC5A 1Y1UA 2CT9A 4MZKA 3S0BA 4PE1A 2G2BA 3CS1A 1MHOA 1BG1A 1OMVA 2KYFA 3ZNIA 3CR2A 3D78A 1UHKA 2F2PA 3JVTC 4MRYA 2CBLA 1G33A 4PCWA 2QEHA 2LLUA 3VB1A 3BUNB 2HQ8A 2L0PA 2Y1MA 4QJ3B 1FPWA 1IQ3A 1CLMA 1PK0D 1YVLA 4PALA 1KCYA 2I94A 1Z2CB 4N1GA 3LLEA 4MBEA 1XFXO 1AVSA 4I5KA 1QX7A 1OE9B 3CZTX 1XK4A 2CNPA 4NDDA 2PRUA 1TNWA 1CDPA 2BE6A 1QXPA 4YGEB 3PN7C 2KHNA 3SIBA 5KSZA 3DZTA 2L4IA 2PSRA 4CFRA 1ODBA 3D73A 3DY9A 5HL1A 4C0KA 1J7RA 1QTXA 4JQ0D 1IQ5A 2L51A 4A4CA 4JD9A 5AANA 3D75A 1K93D 2BBNA 3NHIA 1YUSA 2SASA 3B7AA 3SG4A 1AUIB 2CCMA 3CR5X 1S1EA 3I5FC 3KF9A 2KLEA 4OVNF 2RGIA 2LAPA 1E8AA 1WDCC 1YR5A 3I5GC 3JVTB 4U8DA 2V53A 4BY5A 3TUYC 4ZCVA 4WQ3A 1V1FA 4OCIA 1DJHA 1TIZA 2WCMA 1LVCD 1RK9A 1JWDA 3C1VA 2E30A 3K1EA 4JWQA 2WNDA 2K2AA 2LMTA 3O78A 2LP2A 1NX1A 1SKTA 1SR6C 3LK0A 1S6CA 1BR1B 2JWWA 2KNEA 1DGUA 2PMYA 3V2LA 1FW4A 1MXEA 1SL8A 2P6BB 3K21A 2M3WA 1KFXS 3DVJA 1UHJA 1XO5A 1SNLA 2FJYA 3OHMB 1JBAA 3PN7B 2MAZA 2EC6C 3NGVA 2KGRA 1ZMZA 4IL1A 5EL2A 1B8RA 5CSJA 1Z4HA 3RM1A 1OQPA 3H4SE 1M31A 1XFYO 2Q4UA 3KPXA 1BLQA 1MF8B 1OW4A 2LHIA 5KU1A 1RROA 3BOWB 2BL0C 2LV7A 5I2LA 2ZFDA 2FOTA 1NCYA 3BOWA 3DVKA 1AJ5A 1B1GA 2OTGB 5IBWA 1UWOA 2WC8A 3I5FB 3SJSA 2L5XB 1WDCB 3I5GB 2O5GA 2Y1NA 3TUYB 3UO9A 1NP8A 1YURA 1B7TZ 1JF2A 2F3ZA 2KSPA 1SK6D 1F70A 3CZ2A 4PE4A 1EH2A 3D0YB 1SY9A 1XA5A 3S0GA 1A2XA 1TCFA 4DRWA 1K96A 1UHHA 4PHMA 1QV0A 4FQOA 3D0YA 1JF0A 2ERBA 3OBVA 1CMFA 3TDUA 1N65A 2GGZA 4YGAA 4F0ZB 1BF5A 1IJ5A 1UP5A 2A4JA 1KWOC 3ICBA 2LVVA 3EKHA 4HRHA 3GK1A 1A03A 1CTRA 2FJUB 1SR6B 2NCPA 3R72A 1B47A 2PALA 3O4YA 3SG2A 4OKHA 1DJZA 2HETA 1OMDA 3TDZA 2BCAA 1LKJA 2QEBA 2QPTA 1QVIZ 4GFTA 4KYNA 1RTP1 1VRKA 4ORBB 3WHTB 2DOQA 2EC6B 2HPSA 5DKRA 2Y5IA 2M97A 3SG6A 1Y6WA 3IF7A 2IS9A 2K0JA 3KEVA 2JT8A 3PJIA 2NLNA 3VGOA 4F7FA 1XFRA 1W7JB 2OS8C 4XJKB 3L4AA 1BJFA 2KOTA 2BL0B 1F54A 1A75B 3FS7A 3SG7A 1BOCA 1K9KA 1W7IB 4XJKA 3VRQA 1OOJA 2AMIA 1KFUL 1C7WA 1A75A 1EJ3A 1MWNA 5CSIA 5TNCA 3NXAA 4USLA 5HLVA 1G4YR 1AK8A 2LUCA
chains in the Genus database with same CATH topology
1M46A 1RWYA 2WORA 2LC5A 1WRKA 2M8UA 3PSRA 4HSZA 1KK8C 1YRTB 3DD4A 1JSAA 1C07A 2WCFA 4PHKA 2JT3A 5HLOA 5HKWA 1PVAA 3LK1A 1IKUA 3LL8B 4YI8A 1U5IB 3EVUA 3D10A 3A4UB 1IG5A 1NX2A 1KWOB 1SMGA 2KBIA 2QACA 3BUXB 1PALA 4M2OA 1U5IA 3E3RA 4I5JA 3GK4X 4XYNA 4PE0A 2JTTA 1HT9A 3I5HC 1TNQA 2M1UA 1EG3A 1IWQA 5PALA 1DVIA 1J7QA 1B8LA 1BMOA 3HCMA 4WQ2A 4R1EA 1NWDA 2I7AA 5I8NA 3IQOA 5GQQC 2OS8B 4MVFA 4ZCUA 3TDIA 2HF5A 3DVMA 1CFPA 3EVRA 3OP0A 5D7FA 1K90D 1S5GZ 2H61A 5B8IB 4YGDB 3EK8A 1CM1A 4GNKB 1AJ4A 2JRFA 3WNXB 1OZSA 5D69A 2OTGC 3HX4A 1J7PA 1NCZA 1KK8B 1XFVO 1YX7A 3MSEB 2F2OA 1DJWA 1NCXA 1SRAA 1A4PA 1ALWA 2ZNDA 5KTYA 2K7CA 2AAOA 5AERA 2BKHB 1CFFA 2KFGA 1L2OC 1YUTA 2MLEC 3GK2A 1F4OA 1WLMA 1FF1A 1NSHA 2JULA 1KQVA 1SPYA 5HYDA 1MUXA 5ER5A 2LANA 1A29A 2LLTA 5FYXA 5HKYA 1GQMA 5DKNA 3I5HB 2CXJA 1TNXA 1IRJA 1Q80A 4I5NB 3A8RA 3KHEA 2MHHA 1KSOA 1WRZA 1YVHA 1F8HA 1N0YA 3CGAA 2KGBC 1K95A 1M45A 1C7VA 4UPGA 2GV5A 3PALA 1CLBA 5CPVA 2F33A 4NDCA 3LCPC 2CTNA 1GGZA 1AHRA 4NDBA 2KAXA 3NSLA 4GGNA 2FCEA 5JOLA 1R2UA 4C0LA 2D8NA 4CFQA 3NSIA 1QV1A 1BR4B 2KBMA 4YGCB 2BKIB 3CR4X 1MQ1A 4DIRA 3CLNA 2H2KA 4BY4A 2LMUA 4C0JA 1DTLA 4PDZA 4P2YB 1EG4A 3OX5A 4TNCA 2M49B 4YGBB 3VRPA 1UHIA 2JXCA 2K7BA 2M9GA 2K2FA 3PM8A 3QRXA 4CLNA 3I5IC 1UHNA 4MZJA 1IJ6A 1B7TY 1L2OB 2K8MB 4GPLB 1BU3A 1JC2A 2ZKMX 1DJGA 1K9PA 1H4BA 1YUUA 5DKQA 2MRDA 2NCOA 1Y0VH 3OX6A 2JOJA 2K7OA 2K61A 1QX2A 4D1EA 3F45A 1IGVA 2KI6D 2I2RE 2M7NA 1WY9A 4DS7A 3TZ1A 4P5OE 2LE9B 3SIAA 2KDHA 2KYCA 1DJIA 4FTGA 2BBMA 4AOMA 2KFHA 5F6TA 1TRFA 1CLLA 2LNKA 3NSOA 2LM5A 2H61C 4ETOA 2LHLA 1XYDA 2NXQA 1EL4A 1NX0A 1J7OA 3FIAA 1RJVA 2L2EA 5CSFA 2F8PA 2O60A 2ZRTA 1SYMA 2VRGA 1CFCA 1QLKA 3AKBA 2MLFC 2KQ6A 5AEQA 1K94A 2FCDA 4GBAA 4ORAB 3SG5A 2BCBA 2WCBA 1SL7A 1H8BA 1HQVA 1KK7Z 3I5IB 3BYAA 1OSAA 3IQQA 1QASA 2JU0A 4N1FA 2MJWB 4OV2A 4I5LB 4L9MA 3BUOB 4MEWA 1TCOB 3BXKA 1GJYA 2JNXA 2SCPA 3OB1B 4JPZB 2WCEA 1NX3A 2MBXA 3VRRA 1NPQA 4M2PA 1AP4A 2ZN8A 2I18A 4N5XA 1J1DA 3CTNA 1CKKA 4MSPA 3NSKA 1DJXA 4HREE 1SW8A 4MLWA 4QJ5B 3ZWHA 1K8UA 1PSBA 1KFUS 4NQGA 4PE7A 1ZFSA 1J1EA 1M39A 1LA3A 2LVKA 1XFWO 4WRIA 1IH0A 2LMVA 1TOPA 4GAOA 1ZOTB 1PVBA 1S5GY 2L50A 2NZ0A 1XFUO 1YTZC 1CB1A 1NIWA 2JXLA 5K89A 2KI4C 3O6BA 1DGVA 1NUBA 2JPTA 1WLZA 1FI6A 2MA2A 1G8IA 1R6PA 2L4HA 4PHNA 2B1UA 2EGDA 1F55A 1YX8A 1KQMC 2TN4A 1KFXL 1S6JA 1SBJA 4DCKA 1SCVA 3AKAA 3EKJA 4ICBA 2M7LA 2E6WA 3DVEA 1CMGA 3CWGA 2ZNEA 2KI6C 1CDNA 3DF0B 1RECA 1OZOA 1LINA 1UUSA 1B9AA 5AFPA 2L98A 2ZN9A 4DUQA 2KAYA 3DF0A 3EK7A 1BT6A 2GGMA 5AXIA 2R2IA 1SCMC 5G08A 1X02A 5I2QA 3JTDC 3KO0A 3BUWB 1OMRA 2EHBA 3GOFA 3WHUB 3PLFB 2KFFA 2LVJA 4M2QA 1QX5B 4ORCB 1LXFC 1CNPA 4CIDA 4GUKA 3FWCA 2BECA 1QS7A 2LCPA 1S3PA 1V1GA 4AQIA 1FI5A 2JZIA 1WRLA 2ZRSA 2JNFA 1LA0A 2M1KB 2KI4B 2M0RA 1F71A 2Q91A 1QLSA 1Y1AA 5I2OA 3PFVA 1ALVA 2KQYA 1CDLA 4QJ4B 3PATA 3TS5C 1JUOA 1KQMB 2JQ6A 1B8CA 1M63B 1NYAA 2BE4A 5J3XA 1RFJA 2LVIA 4MRXA 4GGFC 1GGWA 5HKZA 1BODA 4E68A 3VRNA 1XFZO 1FBVA 4AQJA 1PRWA 1JFJA 3WXAA 1SCMB 1MXLC 1UURA 1QATA 1ZACA 3JTDB 4YI9A 1ZUZA 1QVIY 2HQWA 2KAVA 4OR9B 4HRGA 1QIWA 1QIVA 3O2PA 2LUXA 1DF0B 2AUCA 4A4BA 3BUMB 2JT0A 1MR8A 2WOSA 1K2HA 4PHJA 3M0WA 1DF0A 5CSNA 2LLSA 1PULA 3SG3A 1B4CA 1TN4A 5BPJA 4MZLA 3FWBA 1J55A 5ER4X 1L7ZA 1JFKA 2COLB 3VROA 3EVVA 2M29A 3AAKA 1DMOA 1KSMA 4CPVA 1XK4C 3OB2B 3RLZA 1N2DA 1PSRA 2F3YA 2PASA 1DJYA 2Y4QA 1TNPA 2LP3A 1F4QA 2PVBA 3TS5B 2OPOA 3AAJA 1TTXA 1DT7B 1QJTA 1KK7Y 4YRUA 1D1OA 1CDMA 4Q04A 4MN0A 1XVJA 1Y1XA 1S6IA 2K7DA 2G9BA 3BQ3A 5JJGA 4YBHB 1S26D 1EXRA 1S36A 1SL9A 2ISDA 1YRUB 2JC2A 4GGFA 3EK4A 1CFDA 1CM4A 2JTZA 1K9UA 2BCXA 1Y1UA 2CT9A 4MZKA 4PE1A 2G2BA 3CS1A 1MHOA 1BG1A 1OMVA 2KYFA 3ZNIA 3CR2A 1UHKA 2F2PA 3JVTC 4MRYA 2CBLA 1G33A 4PCWA 2LLUA 3BUNB 2HQ8A 2L0PA 2Y1MA 4QJ3B 1FPWA 1IQ3A 1CLMA 1PK0D 1YVLA 4PALA 1KCYA 2I94A 4N1GA 3LLEA 4MBEA 1XFXO 1AVSA 4I5KA 1QX7A 1OE9B 3CZTX 1XK4A 2CNPA 4NDDA 2PRUA 1TNWA 1CDPA 2BE6A 1QXPA 4YGEB 3PN7C 2KHNA 3SIBA 5KSZA 2L4IA 2PSRA 4CFRA 1ODBA 4C0KA 1J7RA 1QTXA 4JQ0D 1IQ5A 2L51A 4A4CA 5AANA 1K93D 2BBNA 1YUSA 2SASA 3SG4A 1AUIB 2CCMA 3CR5X 1S1EA 3I5FC 3KF9A 4OVNF 2RGIA 2LAPA 1E8AA 1WDCC 1YR5A 3I5GC 3JVTB 4U8DA 2V53A 4BY5A 3TUYC 4ZCVA 4WQ3A 1V1FA 4OCIA 1DJHA 1TIZA 1LVCD 1RK9A 1JWDA 3C1VA 2E30A 4JWQA 2WNDA 2K2AA 2LMTA 3O78A 2LP2A 1NX1A 1SKTA 1SR6C 3LK0A 1S6CA 1BR1B 2JWWA 2KNEA 1DGUA 2PMYA 1FW4A 1MXEA 1SL8A 2P6BB 3K21A 2M3WA 1KFXS 3DVJA 1UHJA 1XO5A 1SNLA 3OHMB 1JBAA 3PN7B 2MAZA 2EC6C 2KGRA 1ZMZA 4IL1A 1B8RA 5CSJA 3RM1A 1OQPA 3H4SE 1M31A 1XFYO 2Q4UA 3KPXA 1BLQA 1MF8B 2LHIA 5KU1A 1RROA 3BOWB 2BL0C 2LV7A 5I2LA 2ZFDA 2FOTA 1NCYA 3BOWA 3DVKA 1AJ5A 1B1GA 2OTGB 5IBWA 1UWOA 2WC8A 3I5FB 3SJSA 2L5XB 1WDCB 3I5GB 2O5GA 2Y1NA 3TUYB 1NP8A 1YURA 1B7TZ 1JF2A 2F3ZA 2KSPA 1SK6D 1F70A 4PE4A 1EH2A 3D0YB 1SY9A 1XA5A 1A2XA 1TCFA 4DRWA 1K96A 1UHHA 4PHMA 1QV0A 4FQOA 3D0YA 1JF0A 1CMFA 3TDUA 1N65A 2GGZA 4YGAA 4F0ZB 1BF5A 1IJ5A 1UP5A 2A4JA 1KWOC 3ICBA 2LVVA 3EKHA 4HRHA 3GK1A 1A03A 1CTRA 2FJUB 1SR6B 2NCPA 1B47A 2PALA 3O4YA 3SG2A 4OKHA 1DJZA 2HETA 1OMDA 3TDZA 2BCAA 1LKJA 2QPTA 1QVIZ 4GFTA 1RTP1 1VRKA 4ORBB 3WHTB 2DOQA 2EC6B 2HPSA 5DKRA 2Y5IA 2M97A 3SG6A 1Y6WA 3IF7A 2IS9A 2K0JA 3KEVA 2JT8A 2NLNA 3VGOA 1W7JB 2OS8C 4XJKB 1BJFA 2KOTA 2BL0B 1F54A 1A75B 3FS7A 3SG7A 1BOCA 1K9KA 1W7IB 4XJKA 3VRQA 1OOJA 2AMIA 1KFUL 1C7WA 1A75A 1EJ3A 1MWNA 5CSIA 5TNCA 3NXAA 4USLA 5HLVA 1G4YR 1AK8A 2LUCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M46 A;  1RWY A;  2WOR A;  2LC5 A;  1WRK A;  2M8U A;  3PSR A;  4HSZ A;  1KK8 C;  1YRT B;  3DD4 A;  1JSA A;  1C07 A;  2WCF A;  4PHK A;  2JT3 A;  5HLO A;  5HKW A;  1PVA A;  3LK1 A;  1IKU A;  3LL8 B;  4YI8 A;  1U5I B;  3EVU A;  3D10 A;  3A4U B;  1IG5 A;  1NX2 A;  1KWO B;  1SMG A;  2KBI A;  2QAC A;  3BUX B;  1PAL A;  4M2O A;  1U5I A;  3E3R A;  4I5J A;  3GK4 X;  4XYN A;  4PE0 A;  2JTT A;  1HT9 A;  3I5H C;  1TNQ A;  2M1U A;  1EG3 A;  1IWQ A;  5PAL A;  1DVI A;  1J7Q A;  1B8L A;  1BMO A;  3HCM A;  4WQ2 A;  4R1E A;  1NWD A;  2I7A A;  5I8N A;  3IQO A;  5GQQ C;  2OS8 B;  4MVF A;  4ZCU A;  3TDI A;  2HF5 A;  3DVM A;  1CFP A;  3EVR A;  3OP0 A;  5D7F A;  1K90 D;  1S5G Z;  2H61 A;  5B8I B;  4YGD B;  3EK8 A;  1CM1 A;  4GNK B;  1AJ4 A;  2JRF A;  3WNX B;  1OZS A;  5D69 A;  2OTG C;  3HX4 A;  1J7P A;  1NCZ A;  1KK8 B;  1XFV O;  1YX7 A;  3MSE B;  2F2O A;  1DJW A;  1NCX A;  1SRA A;  1A4P A;  1ALW A;  2ZND A;  5KTY A;  2K7C A;  2AAO A;  5AER A;  2BKH B;  1CFF A;  2KFG A;  1L2O C;  1YUT A;  2MLE C;  3GK2 A;  1F4O A;  1WLM A;  1FF1 A;  1NSH A;  2JUL A;  1KQV A;  1SPY A;  5HYD A;  1MUX A;  5ER5 A;  2LAN A;  1A29 A;  2LLT A;  5FYX A;  5HKY A;  1GQM A;  5DKN A;  3I5H B;  2CXJ A;  1TNX A;  1IRJ A;  1Q80 A;  4I5N B;  3A8R A;  3KHE A;  2MHH A;  1KSO A;  1WRZ A;  1YVH A;  1F8H A;  1N0Y A;  3CGA A;  2KGB C;  1K95 A;  1M45 A;  1C7V A;  4UPG A;  2GV5 A;  3PAL A;  1CLB A;  5CPV A;  2F33 A;  4NDC A;  3LCP C;  2CTN A;  1GGZ A;  1AHR A;  4NDB A;  2KAX A;  3NSL A;  4GGN A;  2FCE A;  5JOL A;  1R2U A;  4C0L A;  2D8N A;  4CFQ A;  3NSI A;  1QV1 A;  1BR4 B;  2KBM A;  4YGC B;  2BKI B;  3CR4 X;  1MQ1 A;  4DIR A;  3CLN A;  2H2K A;  4BY4 A;  2LMU A;  4C0J A;  1DTL A;  4PDZ A;  4P2Y B;  1EG4 A;  3OX5 A;  4TNC A;  2M49 B;  4YGB B;  3VRP A;  1UHI A;  2JXC A;  2K7B A;  2M9G A;  2K2F A;  3PM8 A;  3QRX A;  4CLN A;  3I5I C;  1UHN A;  4MZJ A;  1IJ6 A;  1B7T Y;  1L2O B;  2K8M B;  4GPL B;  1BU3 A;  1JC2 A;  2ZKM X;  1DJG A;  1K9P A;  1H4B A;  1YUU A;  5DKQ A;  2MRD A;  2NCO A;  1Y0V H;  3OX6 A;  2JOJ A;  2K7O A;  2K61 A;  1QX2 A;  4D1E A;  3F45 A;  1IGV A;  2KI6 D;  2I2R E;  2M7N A;  1WY9 A;  4DS7 A;  3TZ1 A;  4P5O E;  2LE9 B;  3SIA A;  2KDH A;  2KYC A;  1DJI A;  4FTG A;  2BBM A;  4AOM A;  2KFH A;  5F6T A;  1TRF A;  1CLL A;  2LNK A;  3NSO A;  2LM5 A;  2H61 C;  4ETO A;  2LHL A;  1XYD A;  2NXQ A;  1EL4 A;  1NX0 A;  1J7O A;  3FIA A;  1RJV A;  2L2E A;  5CSF A;  2F8P A;  2O60 A;  2ZRT A;  1SYM A;  2VRG A;  1CFC A;  1QLK A;  3AKB A;  2MLF C;  2KQ6 A;  5AEQ A;  1K94 A;  2FCD A;  4GBA A;  4ORA B;  3SG5 A;  2BCB A;  2WCB A;  1SL7 A;  1H8B A;  1HQV A;  1KK7 Z;  3I5I B;  3BYA A;  1OSA A;  3IQQ A;  1QAS A;  2JU0 A;  4N1F A;  2MJW B;  4OV2 A;  4I5L B;  4L9M A;  3BUO B;  4MEW A;  1TCO B;  3BXK A;  1GJY A;  2JNX A;  2SCP A;  3OB1 B;  4JPZ B;  2WCE A;  1NX3 A;  2MBX A;  3VRR A;  1NPQ A;  4M2P A;  1AP4 A;  2ZN8 A;  2I18 A;  4N5X A;  1J1D A;  3CTN A;  1CKK A;  4MSP A;  3NSK A;  1DJX A;  4HRE E;  1SW8 A;  4MLW A;  4QJ5 B;  3ZWH A;  1K8U A;  1PSB A;  1KFU S;  4NQG A;  4PE7 A;  1ZFS A;  1J1E A;  1M39 A;  1LA3 A;  2LVK A;  1XFW O;  4WRI A;  1IH0 A;  2LMV A;  1TOP A;  4GAO A;  1ZOT B;  1PVB A;  1S5G Y;  2L50 A;  2NZ0 A;  1XFU O;  1YTZ C;  1CB1 A;  1NIW A;  2JXL A;  5K89 A;  2KI4 C;  3O6B A;  1DGV A;  1NUB A;  2JPT A;  1WLZ A;  1FI6 A;  2MA2 A;  1G8I A;  1R6P A;  2L4H A;  4PHN A;  2B1U A;  2EGD A;  1F55 A;  1YX8 A;  1KQM C;  2TN4 A;  1KFX L;  1S6J A;  1SBJ A;  4DCK A;  1SCV A;  3AKA A;  3EKJ A;  4ICB A;  2M7L A;  2E6W A;  3DVE A;  1CMG A;  3CWG A;  2ZNE A;  2KI6 C;  1CDN A;  3DF0 B;  1REC A;  1OZO A;  1LIN A;  1UUS A;  1B9A A;  5AFP A;  2L98 A;  2ZN9 A;  4DUQ A;  2KAY A;  3DF0 A;  3EK7 A;  1BT6 A;  2GGM A;  5AXI A;  2R2I A;  1SCM C;  5G08 A;  1X02 A;  5I2Q A;  3JTD C;  3KO0 A;  3BUW B;  1OMR A;  2EHB A;  3GOF A;  3WHU B;  3PLF B;  2KFF A;  2LVJ A;  4M2Q A;  1QX5 B;  4ORC B;  1LXF C;  1CNP A;  4CID A;  4GUK A;  3FWC A;  2BEC A;  1QS7 A;  2LCP A;  1S3P A;  1V1G A;  4AQI A;  1FI5 A;  2JZI A;  1WRL A;  2ZRS A;  2JNF A;  1LA0 A;  2M1K B;  2KI4 B;  2M0R A;  1F71 A;  2Q91 A;  1QLS A;  1Y1A A;  5I2O A;  3PFV A;  1ALV A;  2KQY A;  1CDL A;  4QJ4 B;  3PAT A;  3TS5 C;  1JUO A;  1KQM B;  2JQ6 A;  1B8C A;  1M63 B;  1NYA A;  2BE4 A;  5J3X A;  1RFJ A;  2LVI A;  4MRX A;  4GGF C;  1GGW A;  5HKZ A;  1BOD A;  4E68 A;  3VRN A;  1XFZ O;  1FBV A;  4AQJ A;  1PRW A;  1JFJ A;  3WXA A;  1SCM B;  1MXL C;  1UUR A;  1QAT A;  1ZAC A;  3JTD B;  4YI9 A;  1ZUZ A;  1QVI Y;  2HQW A;  2KAV A;  4OR9 B;  4HRG A;  1QIW A;  1QIV A;  3O2P A;  2LUX A;  1DF0 B;  2AUC A;  4A4B A;  3BUM B;  2JT0 A;  1MR8 A;  2WOS A;  1K2H A;  4PHJ A;  3M0W A;  1DF0 A;  5CSN A;  2LLS A;  1PUL A;  3SG3 A;  1B4C A;  1TN4 A;  5BPJ A;  4MZL A;  3FWB A;  1J55 A;  5ER4 X;  1L7Z A;  1JFK A;  2COL B;  3VRO A;  3EVV A;  2M29 A;  3AAK A;  1DMO A;  1KSM A;  4CPV A;  1XK4 C;  3OB2 B;  3RLZ A;  1N2D A;  1PSR A;  2F3Y A;  2PAS A;  1DJY A;  2Y4Q A;  1TNP A;  2LP3 A;  1F4Q A;  2PVB A;  3TS5 B;  2OPO A;  3AAJ A;  1TTX A;  1DT7 B;  1QJT A;  1KK7 Y;  4YRU A;  1D1O A;  1CDM A;  4Q04 A;  4MN0 A;  1XVJ A;  1Y1X A;  1S6I A;  2K7D A;  2G9B A;  3BQ3 A;  5JJG A;  4YBH B;  1S26 D;  1EXR A;  1S36 A;  1SL9 A;  2ISD A;  1YRU B;  2JC2 A;  4GGF A;  3EK4 A;  1CFD A;  1CM4 A;  2JTZ A;  1K9U A;  2BCX A;  1Y1U A;  2CT9 A;  4MZK A;  4PE1 A;  2G2B A;  3CS1 A;  1MHO A;  1BG1 A;  1OMV A;  2KYF A;  3ZNI A;  3CR2 A;  1UHK A;  2F2P A;  3JVT C;  4MRY A;  2CBL A;  1G33 A;  4PCW A;  2LLU A;  3BUN B;  2HQ8 A;  2L0P A;  2Y1M A;  4QJ3 B;  1FPW A;  1IQ3 A;  1CLM A;  1PK0 D;  1YVL A;  4PAL A;  1KCY A;  2I94 A;  4N1G A;  3LLE A;  4MBE A;  1XFX O;  1AVS A;  4I5K A;  1QX7 A;  1OE9 B;  3CZT X;  1XK4 A;  2CNP A;  4NDD A;  2PRU A;  1TNW A;  1CDP A;  2BE6 A;  1QXP A;  4YGE B;  3PN7 C;  2KHN A;  3SIB A;  5KSZ A;  2L4I A;  2PSR A;  4CFR A;  1ODB A;  4C0K A;  1J7R A;  1QTX A;  4JQ0 D;  1IQ5 A;  2L51 A;  4A4C A;  5AAN A;  1K93 D;  2BBN A;  1YUS A;  2SAS A;  3SG4 A;  1AUI B;  2CCM A;  3CR5 X;  1S1E A;  3I5F C;  3KF9 A;  4OVN F;  2RGI A;  2LAP A;  1E8A A;  1WDC C;  1YR5 A;  3I5G C;  3JVT B;  4U8D A;  2V53 A;  4BY5 A;  3TUY C;  4ZCV A;  4WQ3 A;  1V1F A;  4OCI A;  1DJH A;  1TIZ A;  1LVC D;  1RK9 A;  1JWD A;  3C1V A;  2E30 A;  4JWQ A;  2WND A;  2K2A A;  2LMT A;  3O78 A;  2LP2 A;  1NX1 A;  1SKT A;  1SR6 C;  3LK0 A;  1S6C A;  1BR1 B;  2JWW A;  2KNE A;  1DGU A;  2PMY A;  1FW4 A;  1MXE A;  1SL8 A;  2P6B B;  3K21 A;  2M3W A;  1KFX S;  3DVJ A;  1UHJ A;  1XO5 A;  1SNL A;  3OHM B;  1JBA A;  3PN7 B;  2MAZ A;  2EC6 C;  2KGR A;  1ZMZ A;  4IL1 A;  1B8R A;  5CSJ A;  3RM1 A;  1OQP A;  3H4S E;  1M31 A;  1XFY O;  2Q4U A;  3KPX A;  1BLQ A;  1MF8 B;  2LHI A;  5KU1 A;  1RRO A;  3BOW B;  2BL0 C;  2LV7 A;  5I2L A;  2ZFD A;  2FOT A;  1NCY A;  3BOW A;  3DVK A;  1AJ5 A;  1B1G A;  2OTG B;  5IBW A;  1UWO A;  2WC8 A;  3I5F B;  3SJS A;  2L5X B;  1WDC B;  3I5G B;  2O5G A;  2Y1N A;  3TUY B;  1NP8 A;  1YUR A;  1B7T Z;  1JF2 A;  2F3Z A;  2KSP A;  1SK6 D;  1F70 A;  4PE4 A;  1EH2 A;  3D0Y B;  1SY9 A;  1XA5 A;  1A2X A;  1TCF A;  4DRW A;  1K96 A;  1UHH A;  4PHM A;  1QV0 A;  4FQO A;  3D0Y A;  1JF0 A;  1CMF A;  3TDU A;  1N65 A;  2GGZ A;  4YGA A;  4F0Z B;  1BF5 A;  1IJ5 A;  1UP5 A;  2A4J A;  1KWO C;  3ICB A;  2LVV A;  3EKH A;  4HRH A;  3GK1 A;  1A03 A;  1CTR A;  2FJU B;  1SR6 B;  2NCP A;  1B47 A;  2PAL A;  3O4Y A;  3SG2 A;  4OKH A;  1DJZ A;  2HET A;  1OMD A;  3TDZ A;  2BCA A;  1LKJ A;  2QPT A;  1QVI Z;  4GFT A;  1RTP 1;  1VRK A;  4ORB B;  3WHT B;  2DOQ A;  2EC6 B;  2HPS A;  5DKR A;  2Y5I A;  2M97 A;  3SG6 A;  1Y6W A;  3IF7 A;  2IS9 A;  2K0J A;  3KEV A;  2JT8 A;  2NLN A;  3VGO A;  1W7J B;  2OS8 C;  4XJK B;  1BJF A;  2KOT A;  2BL0 B;  1F54 A;  1A75 B;  3FS7 A;  3SG7 A;  1BOC A;  1K9K A;  1W7I B;  4XJK A;  3VRQ A;  1OOJ A;  2AMI A;  1KFU L;  1C7W A;  1A75 A;  1EJ3 A;  1MWN A;  5CSI A;  5TNC A;  3NXA A;  4USL A;  5HLV A;  1G4Y R;  1AK8 A;  2LUC A; 
#chains in the Genus database with same CATH topology
 1M46 A;  1RWY A;  2WOR A;  2LC5 A;  3BFB A;  1WRK A;  2M8U A;  3PSR A;  4HSZ A;  1KK8 C;  3CYZ A;  1YRT B;  2KLD A;  3DD4 A;  1JSA A;  1C07 A;  2WCF A;  4PHK A;  1T14 A;  3EG5 B;  3L4L A;  2JT3 A;  5HLO A;  5HKW A;  1PVA A;  3LK1 A;  1IKU A;  3LL8 B;  4YI8 A;  1U5I B;  3EVU A;  3D10 A;  3A4U B;  1IG5 A;  1NX2 A;  1KWO B;  1SMG A;  2KBI A;  2QAC A;  3BUX B;  4IJ7 A;  1PAL A;  4M2O A;  1U5I A;  3E3R A;  3DYE A;  4I5J A;  3RZS A;  2JPO A;  3GK4 X;  4XYN A;  4PE0 A;  2JTT A;  1HT9 A;  3I5H C;  1TNQ A;  2M1U A;  1EG3 A;  1IWQ A;  5PAL A;  1DVI A;  4PT1 A;  1J7Q A;  1B8L A;  4INX A;  1BMO A;  3HCM A;  4WQ2 A;  4R1E A;  1NWD A;  2I7A A;  5I8N A;  3IQO A;  1C3Z A;  2OS8 B;  4MVF A;  5GQQ C;  1QWV A;  3CZ1 A;  4ZCU A;  3TDI A;  2HF5 A;  3DVM A;  1CFP A;  3EVR A;  3OP0 A;  5D7F A;  1K90 D;  1S5G Z;  2H61 A;  3CDN A;  5B8I B;  4YGD B;  3EK8 A;  1CM1 A;  4GNK B;  1AJ4 A;  2JRF A;  3WNX B;  1OZS A;  5D69 A;  1OOI X;  2OTG C;  3HX4 A;  1J7P A;  1NCZ A;  1KK8 B;  1XFV O;  1YX7 A;  3MSE B;  2F2O A;  1DJW A;  1NCX A;  1SRA A;  1A4P A;  1ALW A;  2ZND A;  5KTY A;  2K7C A;  2AAO A;  5AER A;  2BKH B;  4JKT A;  5FI2 A;  2H8V A;  2KFG A;  1CFF A;  1L2O C;  1YUT A;  2MLE C;  3GK2 A;  1F4O A;  2BNX A;  3UNW A;  1WLM A;  1FF1 A;  4INW A;  1NSH A;  2JUL A;  1KQV A;  1SPY A;  5HYD A;  1MUX A;  1DEK A;  5ER5 A;  2LAN A;  1A29 A;  2LLT A;  5FYX A;  5HKY A;  1GQM A;  5DKN A;  3I5H B;  1LS8 A;  1TNX A;  2CXJ A;  1IRJ A;  1TUJ A;  1Q80 A;  4I5N B;  3CZ0 A;  3A8R A;  3KHE A;  2MHH A;  1KSO A;  1WRZ A;  1YVH A;  1F8H A;  1N0Y A;  2YGU A;  2KGB C;  3CGA A;  2QDI A;  1K95 A;  1M45 A;  1C7V A;  4UPG A;  2GV5 A;  3PAL A;  1CLB A;  2P71 A;  5CPV A;  2F33 A;  4NDC A;  3LCP C;  2CTN A;  1GGZ A;  1AHR A;  4NDB A;  3B86 A;  2KAX A;  3NSL A;  1OOG A;  4GGN A;  2FCE A;  5JOL A;  1R2U A;  3B87 A;  4C0L A;  2D8N A;  4CFQ A;  3NSI A;  1QV1 A;  3D74 A;  1BR4 B;  2KBM A;  4YGC B;  2BKI B;  3CR4 X;  1MQ1 A;  4DIR A;  3CLN A;  2H2K A;  4BY4 A;  2LMU A;  4C0J A;  1DTL A;  2GTE A;  4P2Y B;  1EG4 A;  3OX5 A;  4PDZ A;  4TNC A;  2M49 B;  4YGB B;  3VRP A;  1UHI A;  2JXC A;  2K7B A;  2M9G A;  2K2F A;  3PM8 A;  3QRX A;  4CLN A;  3I5I C;  1UHN A;  4MZJ A;  1IJ6 A;  1B7T Y;  1L2O B;  2K8M B;  3O4X A;  4GPL B;  2PYQ A;  1BU3 A;  1JC2 A;  3CAB A;  2ZKM X;  1DJG A;  1K9P A;  1H4B A;  1YUU A;  5DKQ A;  2MRD A;  2NCO A;  1Y0V H;  3OX6 A;  2JOJ A;  3SS3 A;  2K7O A;  2K61 A;  1QX2 A;  4D1E A;  3F45 A;  1IGV A;  2KI6 D;  3BFH A;  2I2R E;  2M7N A;  1WY9 A;  4DS7 A;  3OGN A;  4P5O E;  2LE9 B;  3TZ1 A;  3SIA A;  3SS5 A;  2KDH A;  3BJH A;  2KYC A;  1DJI A;  4FTG A;  2BBM A;  4AOM A;  2KFH A;  5F6T A;  1TRF A;  1CLL A;  2LNK A;  3NSO A;  2LM5 A;  2H61 C;  5FI7 A;  1IIO A;  3BFA A;  4ETO A;  2LHL A;  1XYD A;  2NXQ A;  1EL4 A;  1NX0 A;  1J7O A;  3FIA A;  1RJV A;  1SSE B;  2L2E A;  2F8P A;  2O60 A;  2ZRT A;  1SYM A;  2VRG A;  5CSF A;  1DC1 A;  1QLK A;  3AKB A;  2BAP A;  2MLF C;  2KQ6 A;  5AEQ A;  1K94 A;  2FCD A;  4GBA A;  4ORA B;  3SG5 A;  3IVT A;  2KPH A;  2BCB A;  2WCB A;  1SL7 A;  1H8B A;  1HQV A;  1KK7 Z;  3I5I B;  3BYA A;  1OSA A;  3IQQ A;  1QAS A;  2JU0 A;  4N1F A;  2MJW B;  4OV2 A;  4I5L B;  4L9M A;  3S0A A;  3BUO B;  2L2C A;  4MEW A;  1TCO B;  1TUZ A;  3BXK A;  1GJY A;  2JNX A;  2SCP A;  3OB1 B;  3D77 A;  4JPZ B;  2WCE A;  1NX3 A;  2MBX A;  3VRR A;  1NPQ A;  2L5Y A;  2P70 A;  4M2P A;  1AP4 A;  2ZN8 A;  2I18 A;  4N5X A;  1J1D A;  3CTN A;  1CKK A;  4MSP A;  3NSK A;  1DJX A;  4HRE E;  1SW8 A;  4MLW A;  4QJ5 B;  3ZWH A;  1K8U A;  1PSB A;  1KFU S;  4NQG A;  4PE7 A;  3S0E A;  1ZFS A;  3N7H A;  1DEL A;  1J1E A;  1M39 A;  1LA3 A;  1TWO A;  2LVK A;  1XFW O;  4WRI A;  1IH0 A;  2LMV A;  1TOP A;  4GAO A;  1OOF A;  1ZOT B;  1PVB A;  1S5G Y;  2L50 A;  2NZ0 A;  1XFU O;  2PQL A;  1YTZ C;  1CB1 A;  1NIW A;  2JXL A;  5K89 A;  2KI4 C;  3O6B A;  1DGV A;  1NUB A;  2JPT A;  1WLZ A;  4OZD A;  3Q8I A;  1FI6 A;  2MA2 A;  1CFC A;  1DQE A;  1G8I A;  1R6P A;  2L4H A;  2B1U A;  2EGD A;  2WCK A;  1YX8 A;  4PHN A;  1KQM C;  1F55 A;  2TN4 A;  1KFX L;  1S6J A;  1SBJ A;  3S0D A;  4DCK A;  1SCV A;  3AKA A;  3EKJ A;  4ICB A;  2M7L A;  2E6W A;  3DVE A;  1CMG A;  3CWG A;  2ZNE A;  2KI6 C;  1CDN A;  5FI6 A;  3DF0 B;  1REC A;  1OZO A;  1LIN A;  1UUS A;  1B9A A;  3FE9 A;  2L98 A;  4FQT A;  5AFP A;  2ZN9 A;  4DUQ A;  2KAY A;  2WC6 A;  3DF0 A;  3EK7 A;  1BT6 A;  2GGM A;  3S0F A;  5AXI A;  5D3O A;  2R2I A;  1SCM C;  5G08 A;  1X02 A;  2WCH A;  5I2Q A;  3JTD C;  3L47 A;  3KO0 A;  3BUW B;  1C3Y A;  1OMR A;  2EHB A;  3GOF A;  3WHU B;  3PLF B;  2KFF A;  2LVJ A;  4M2Q A;  1QX5 B;  4ORC B;  1LXF C;  1CNP A;  1ORG A;  4CID A;  4GUK A;  3FWC A;  2BEC A;  1GM0 A;  1QS7 A;  2LCP A;  1S3P A;  1V1G A;  4AQI A;  1FI5 A;  2JZI A;  1WRL A;  2ZRS A;  2JNF A;  1LA0 A;  2M1K B;  2KI4 B;  2M0R A;  3D76 A;  1F71 A;  5DIC A;  3DXL A;  2Q91 A;  2K60 A;  1QLS A;  1Y1A A;  5I2O A;  3PFV A;  1ALV A;  2KQY A;  1CDL A;  1W9Z A;  3PAT A;  3TS5 C;  4QJ4 B;  1JUO A;  1KQM B;  1P28 A;  2JQ6 A;  3B6X A;  1OOH A;  1B8C A;  1M63 B;  1NYA A;  2BE4 A;  3SS4 A;  5J3X A;  5I94 A;  1RFJ A;  2LVI A;  4MRX A;  4GGF C;  1GGW A;  5HKZ A;  3NHT A;  1BOD A;  3PM2 A;  4E68 A;  3VRN A;  1XFZ O;  1FBV A;  2QEO A;  4AQJ A;  1PRW A;  1JFJ A;  3WXA A;  1SCM B;  3R1O A;  1MXL C;  1UUR A;  1QAT A;  1ZAC A;  3JTD B;  4YI9 A;  1ZUZ A;  1QVI Y;  2HQW A;  2KAV A;  4OR9 B;  4HRG A;  1QIW A;  1QIV A;  3O2P A;  2LUX A;  1DF0 B;  2AUC A;  4A4B A;  3BUM B;  2JT0 A;  1MR8 A;  2WOS A;  1K2H A;  4PHJ A;  3M0W A;  1DF0 A;  5CSN A;  2LLS A;  1PUL A;  3SG3 A;  1B4C A;  1TN4 A;  5BPJ A;  4MZL A;  3FWB A;  1J55 A;  5ER4 X;  1L7Z A;  1JFK A;  2COL B;  3QME A;  3EVV A;  3R1P A;  3VRO A;  2M29 A;  3AAK A;  1DMO A;  1KSM A;  4CPV A;  1XK4 C;  3OB2 B;  3R1V A;  3RLZ A;  1N2D A;  1PSR A;  2F3Y A;  2PAS A;  1DJY A;  2Y4Q A;  1TNP A;  2LP3 A;  1F4Q A;  2PVB A;  3TS5 B;  2OPO A;  3AAJ A;  1TTX A;  1DT7 B;  1QJT A;  1KK7 Y;  4YRU A;  1D1O A;  1CDM A;  4Q04 A;  3B88 A;  1XVJ A;  1Y1X A;  1S6I A;  2K7D A;  4MN0 A;  2G9B A;  3BQ3 A;  2WCJ A;  5JJG A;  4YBH B;  1S26 D;  1EXR A;  1S36 A;  1SL9 A;  2ISD A;  1YRU B;  2JC2 A;  2QEV A;  3FE6 A;  3EK4 A;  4GGF A;  2WCL A;  3FE8 A;  1CFD A;  1CM4 A;  2JTZ A;  1K9U A;  2BCX A;  2WC5 A;  1Y1U A;  2CT9 A;  4MZK A;  3S0B A;  4PE1 A;  2G2B A;  3CS1 A;  1MHO A;  1BG1 A;  1OMV A;  2KYF A;  3ZNI A;  3CR2 A;  3D78 A;  1UHK A;  2F2P A;  3JVT C;  4MRY A;  2CBL A;  1G33 A;  4PCW A;  2QEH A;  2LLU A;  3VB1 A;  3BUN B;  2HQ8 A;  2L0P A;  2Y1M A;  4QJ3 B;  1FPW A;  1IQ3 A;  1CLM A;  1PK0 D;  1YVL A;  4PAL A;  1KCY A;  2I94 A;  1Z2C B;  4N1G A;  3LLE A;  4MBE A;  1XFX O;  1AVS A;  4I5K A;  1QX7 A;  1OE9 B;  3CZT X;  1XK4 A;  2CNP A;  4NDD A;  2PRU A;  1TNW A;  1CDP A;  2BE6 A;  1QXP A;  4YGE B;  3PN7 C;  2KHN A;  3SIB A;  5KSZ A;  3DZT A;  2L4I A;  2PSR A;  4CFR A;  1ODB A;  3D73 A;  3DY9 A;  5HL1 A;  4C0K A;  1J7R A;  1QTX A;  4JQ0 D;  1IQ5 A;  2L51 A;  4A4C A;  4JD9 A;  5AAN A;  3D75 A;  1K93 D;  2BBN A;  3NHI A;  1YUS A;  2SAS A;  3B7A A;  3SG4 A;  1AUI B;  2CCM A;  3CR5 X;  1S1E A;  3I5F C;  3KF9 A;  2KLE A;  4OVN F;  2RGI A;  2LAP A;  1E8A A;  1WDC C;  1YR5 A;  3I5G C;  3JVT B;  4U8D A;  2V53 A;  4BY5 A;  3TUY C;  4ZCV A;  4WQ3 A;  1V1F A;  4OCI A;  1DJH A;  1TIZ A;  2WCM A;  1LVC D;  1RK9 A;  1JWD A;  3C1V A;  2E30 A;  3K1E A;  4JWQ A;  2WND A;  2K2A A;  2LMT A;  3O78 A;  2LP2 A;  1NX1 A;  1SKT A;  1SR6 C;  3LK0 A;  1S6C A;  1BR1 B;  2JWW A;  2KNE A;  1DGU A;  2PMY A;  3V2L A;  1FW4 A;  1MXE A;  1SL8 A;  2P6B B;  3K21 A;  2M3W A;  1KFX S;  3DVJ A;  1UHJ A;  1XO5 A;  1SNL A;  2FJY A;  3OHM B;  1JBA A;  3PN7 B;  2MAZ A;  2EC6 C;  3NGV A;  2KGR A;  1ZMZ A;  4IL1 A;  5EL2 A;  1B8R A;  5CSJ A;  1Z4H A;  3RM1 A;  1OQP A;  3H4S E;  1M31 A;  1XFY O;  2Q4U A;  3KPX A;  1BLQ A;  1MF8 B;  1OW4 A;  2LHI A;  5KU1 A;  1RRO A;  3BOW B;  2BL0 C;  2LV7 A;  5I2L A;  2ZFD A;  2FOT A;  1NCY A;  3BOW A;  3DVK A;  1AJ5 A;  1B1G A;  2OTG B;  5IBW A;  1UWO A;  2WC8 A;  3I5F B;  3SJS A;  2L5X B;  1WDC B;  3I5G B;  2O5G A;  2Y1N A;  3TUY B;  3UO9 A;  1NP8 A;  1YUR A;  1B7T Z;  1JF2 A;  2F3Z A;  2KSP A;  1SK6 D;  1F70 A;  3CZ2 A;  4PE4 A;  1EH2 A;  3D0Y B;  1SY9 A;  1XA5 A;  3S0G A;  1A2X A;  1TCF A;  4DRW A;  1K96 A;  1UHH A;  4PHM A;  1QV0 A;  4FQO A;  3D0Y A;  1JF0 A;  2ERB A;  3OBV A;  1CMF A;  3TDU A;  1N65 A;  2GGZ A;  4YGA A;  4F0Z B;  1BF5 A;  1IJ5 A;  1UP5 A;  2A4J A;  1KWO C;  3ICB A;  2LVV A;  3EKH A;  4HRH A;  3GK1 A;  1A03 A;  1CTR A;  2FJU B;  1SR6 B;  2NCP A;  3R72 A;  1B47 A;  2PAL A;  3O4Y A;  3SG2 A;  4OKH A;  1DJZ A;  2HET A;  1OMD A;  3TDZ A;  2BCA A;  1LKJ A;  2QEB A;  2QPT A;  1QVI Z;  4GFT A;  4KYN A;  1RTP 1;  1VRK A;  4ORB B;  3WHT B;  2DOQ A;  2EC6 B;  2HPS A;  5DKR A;  2Y5I A;  2M97 A;  3SG6 A;  1Y6W A;  3IF7 A;  2IS9 A;  2K0J A;  3KEV A;  2JT8 A;  3PJI A;  2NLN A;  3VGO A;  4F7F A;  1XFR A;  1W7J B;  2OS8 C;  4XJK B;  3L4A A;  1BJF A;  2KOT A;  2BL0 B;  1F54 A;  1A75 B;  3FS7 A;  3SG7 A;  1BOC A;  1K9K A;  1W7I B;  4XJK A;  3VRQ A;  1OOJ A;  2AMI A;  1KFU L;  1C7W A;  1A75 A;  1EJ3 A;  1MWN A;  5CSI A;  5TNC A;  3NXA A;  4USL A;  5HLV A;  1G4Y R;  1AK8 A;  2LUC A; 
#chains in the Genus database with same CATH homology
 1M46 A;  1RWY A;  2WOR A;  2LC5 A;  1WRK A;  2M8U A;  3PSR A;  4HSZ A;  1KK8 C;  1YRT B;  3DD4 A;  1JSA A;  1C07 A;  2WCF A;  4PHK A;  2JT3 A;  5HLO A;  5HKW A;  1PVA A;  3LK1 A;  1IKU A;  3LL8 B;  4YI8 A;  1U5I B;  3EVU A;  3D10 A;  3A4U B;  1IG5 A;  1NX2 A;  1KWO B;  1SMG A;  2KBI A;  2QAC A;  3BUX B;  1PAL A;  4M2O A;  1U5I A;  3E3R A;  4I5J A;  3GK4 X;  4XYN A;  4PE0 A;  2JTT A;  1HT9 A;  3I5H C;  1TNQ A;  2M1U A;  1EG3 A;  1IWQ A;  5PAL A;  1DVI A;  1J7Q A;  1B8L A;  1BMO A;  3HCM A;  4WQ2 A;  4R1E A;  1NWD A;  2I7A A;  5I8N A;  3IQO A;  5GQQ C;  2OS8 B;  4MVF A;  4ZCU A;  3TDI A;  2HF5 A;  3DVM A;  1CFP A;  3EVR A;  3OP0 A;  5D7F A;  1K90 D;  1S5G Z;  2H61 A;  5B8I B;  4YGD B;  3EK8 A;  1CM1 A;  4GNK B;  1AJ4 A;  2JRF A;  3WNX B;  1OZS A;  5D69 A;  2OTG C;  3HX4 A;  1J7P A;  1NCZ A;  1KK8 B;  1XFV O;  1YX7 A;  3MSE B;  2F2O A;  1DJW A;  1NCX A;  1SRA A;  1A4P A;  1ALW A;  2ZND A;  5KTY A;  2K7C A;  2AAO A;  5AER A;  2BKH B;  1CFF A;  2KFG A;  1L2O C;  1YUT A;  2MLE C;  3GK2 A;  1F4O A;  1WLM A;  1FF1 A;  1NSH A;  2JUL A;  1KQV A;  1SPY A;  5HYD A;  1MUX A;  5ER5 A;  2LAN A;  1A29 A;  2LLT A;  5FYX A;  5HKY A;  1GQM A;  5DKN A;  3I5H B;  2CXJ A;  1TNX A;  1IRJ A;  1Q80 A;  4I5N B;  3A8R A;  3KHE A;  2MHH A;  1KSO A;  1WRZ A;  1YVH A;  1F8H A;  1N0Y A;  3CGA A;  2KGB C;  1K95 A;  1M45 A;  1C7V A;  4UPG A;  2GV5 A;  3PAL A;  1CLB A;  5CPV A;  2F33 A;  4NDC A;  3LCP C;  2CTN A;  1GGZ A;  1AHR A;  4NDB A;  2KAX A;  3NSL A;  4GGN A;  2FCE A;  5JOL A;  1R2U A;  4C0L A;  2D8N A;  4CFQ A;  3NSI A;  1QV1 A;  1BR4 B;  2KBM A;  4YGC B;  2BKI B;  3CR4 X;  1MQ1 A;  4DIR A;  3CLN A;  2H2K A;  4BY4 A;  2LMU A;  4C0J A;  1DTL A;  4PDZ A;  4P2Y B;  1EG4 A;  3OX5 A;  4TNC A;  2M49 B;  4YGB B;  3VRP A;  1UHI A;  2JXC A;  2K7B A;  2M9G A;  2K2F A;  3PM8 A;  3QRX A;  4CLN A;  3I5I C;  1UHN A;  4MZJ A;  1IJ6 A;  1B7T Y;  1L2O B;  2K8M B;  4GPL B;  1BU3 A;  1JC2 A;  2ZKM X;  1DJG A;  1K9P A;  1H4B A;  1YUU A;  5DKQ A;  2MRD A;  2NCO A;  1Y0V H;  3OX6 A;  2JOJ A;  2K7O A;  2K61 A;  1QX2 A;  4D1E A;  3F45 A;  1IGV A;  2KI6 D;  2I2R E;  2M7N A;  1WY9 A;  4DS7 A;  3TZ1 A;  4P5O E;  2LE9 B;  3SIA A;  2KDH A;  2KYC A;  1DJI A;  4FTG A;  2BBM A;  4AOM A;  2KFH A;  5F6T A;  1TRF A;  1CLL A;  2LNK A;  3NSO A;  2LM5 A;  2H61 C;  4ETO A;  2LHL A;  1XYD A;  2NXQ A;  1EL4 A;  1NX0 A;  1J7O A;  3FIA A;  1RJV A;  2L2E A;  5CSF A;  2F8P A;  2O60 A;  2ZRT A;  1SYM A;  2VRG A;  1CFC A;  1QLK A;  3AKB A;  2MLF C;  2KQ6 A;  5AEQ A;  1K94 A;  2FCD A;  4GBA A;  4ORA B;  3SG5 A;  2BCB A;  2WCB A;  1SL7 A;  1H8B A;  1HQV A;  1KK7 Z;  3I5I B;  3BYA A;  1OSA A;  3IQQ A;  1QAS A;  2JU0 A;  4N1F A;  2MJW B;  4OV2 A;  4I5L B;  4L9M A;  3BUO B;  4MEW A;  1TCO B;  3BXK A;  1GJY A;  2JNX A;  2SCP A;  3OB1 B;  4JPZ B;  2WCE A;  1NX3 A;  2MBX A;  3VRR A;  1NPQ A;  4M2P A;  1AP4 A;  2ZN8 A;  2I18 A;  4N5X A;  1J1D A;  3CTN A;  1CKK A;  4MSP A;  3NSK A;  1DJX A;  4HRE E;  1SW8 A;  4MLW A;  4QJ5 B;  3ZWH A;  1K8U A;  1PSB A;  1KFU S;  4NQG A;  4PE7 A;  1ZFS A;  1J1E A;  1M39 A;  1LA3 A;  2LVK A;  1XFW O;  4WRI A;  1IH0 A;  2LMV A;  1TOP A;  4GAO A;  1ZOT B;  1PVB A;  1S5G Y;  2L50 A;  2NZ0 A;  1XFU O;  1YTZ C;  1CB1 A;  1NIW A;  2JXL A;  5K89 A;  2KI4 C;  3O6B A;  1DGV A;  1NUB A;  2JPT A;  1WLZ A;  1FI6 A;  2MA2 A;  1G8I A;  1R6P A;  2L4H A;  4PHN A;  2B1U A;  2EGD A;  1F55 A;  1YX8 A;  1KQM C;  2TN4 A;  1KFX L;  1S6J A;  1SBJ A;  4DCK A;  1SCV A;  3AKA A;  3EKJ A;  4ICB A;  2M7L A;  2E6W A;  3DVE A;  1CMG A;  3CWG A;  2ZNE A;  2KI6 C;  1CDN A;  3DF0 B;  1REC A;  1OZO A;  1LIN A;  1UUS A;  1B9A A;  5AFP A;  2L98 A;  2ZN9 A;  4DUQ A;  2KAY A;  3DF0 A;  3EK7 A;  1BT6 A;  2GGM A;  5AXI A;  2R2I A;  1SCM C;  5G08 A;  1X02 A;  5I2Q A;  3JTD C;  3KO0 A;  3BUW B;  1OMR A;  2EHB A;  3GOF A;  3WHU B;  3PLF B;  2KFF A;  2LVJ A;  4M2Q A;  1QX5 B;  4ORC B;  1LXF C;  1CNP A;  4CID A;  4GUK A;  3FWC A;  2BEC A;  1QS7 A;  2LCP A;  1S3P A;  1V1G A;  4AQI A;  1FI5 A;  2JZI A;  1WRL A;  2ZRS A;  2JNF A;  1LA0 A;  2M1K B;  2KI4 B;  2M0R A;  1F71 A;  2Q91 A;  1QLS A;  1Y1A A;  5I2O A;  3PFV A;  1ALV A;  2KQY A;  1CDL A;  4QJ4 B;  3PAT A;  3TS5 C;  1JUO A;  1KQM B;  2JQ6 A;  1B8C A;  1M63 B;  1NYA A;  2BE4 A;  5J3X A;  1RFJ A;  2LVI A;  4MRX A;  4GGF C;  1GGW A;  5HKZ A;  1BOD A;  4E68 A;  3VRN A;  1XFZ O;  1FBV A;  4AQJ A;  1PRW A;  1JFJ A;  3WXA A;  1SCM B;  1MXL C;  1UUR A;  1QAT A;  1ZAC A;  3JTD B;  4YI9 A;  1ZUZ A;  1QVI Y;  2HQW A;  2KAV A;  4OR9 B;  4HRG A;  1QIW A;  1QIV A;  3O2P A;  2LUX A;  1DF0 B;  2AUC A;  4A4B A;  3BUM B;  2JT0 A;  1MR8 A;  2WOS A;  1K2H A;  4PHJ A;  3M0W A;  1DF0 A;  5CSN A;  2LLS A;  1PUL A;  3SG3 A;  1B4C A;  1TN4 A;  5BPJ A;  4MZL A;  3FWB A;  1J55 A;  5ER4 X;  1L7Z A;  1JFK A;  2COL B;  3VRO A;  3EVV A;  2M29 A;  3AAK A;  1DMO A;  1KSM A;  4CPV A;  1XK4 C;  3OB2 B;  3RLZ A;  1N2D A;  1PSR A;  2F3Y A;  2PAS A;  1DJY A;  2Y4Q A;  1TNP A;  2LP3 A;  1F4Q A;  2PVB A;  3TS5 B;  2OPO A;  3AAJ A;  1TTX A;  1DT7 B;  1QJT A;  1KK7 Y;  4YRU A;  1D1O A;  1CDM A;  4Q04 A;  4MN0 A;  1XVJ A;  1Y1X A;  1S6I A;  2K7D A;  2G9B A;  3BQ3 A;  5JJG A;  4YBH B;  1S26 D;  1EXR A;  1S36 A;  1SL9 A;  2ISD A;  1YRU B;  2JC2 A;  4GGF A;  3EK4 A;  1CFD A;  1CM4 A;  2JTZ A;  1K9U A;  2BCX A;  1Y1U A;  2CT9 A;  4MZK A;  4PE1 A;  2G2B A;  3CS1 A;  1MHO A;  1BG1 A;  1OMV A;  2KYF A;  3ZNI A;  3CR2 A;  1UHK A;  2F2P A;  3JVT C;  4MRY A;  2CBL A;  1G33 A;  4PCW A;  2LLU A;  3BUN B;  2HQ8 A;  2L0P A;  2Y1M A;  4QJ3 B;  1FPW A;  1IQ3 A;  1CLM A;  1PK0 D;  1YVL A;  4PAL A;  1KCY A;  2I94 A;  4N1G A;  3LLE A;  4MBE A;  1XFX O;  1AVS A;  4I5K A;  1QX7 A;  1OE9 B;  3CZT X;  1XK4 A;  2CNP A;  4NDD A;  2PRU A;  1TNW A;  1CDP A;  2BE6 A;  1QXP A;  4YGE B;  3PN7 C;  2KHN A;  3SIB A;  5KSZ A;  2L4I A;  2PSR A;  4CFR A;  1ODB A;  4C0K A;  1J7R A;  1QTX A;  4JQ0 D;  1IQ5 A;  2L51 A;  4A4C A;  5AAN A;  1K93 D;  2BBN A;  1YUS A;  2SAS A;  3SG4 A;  1AUI B;  2CCM A;  3CR5 X;  1S1E A;  3I5F C;  3KF9 A;  4OVN F;  2RGI A;  2LAP A;  1E8A A;  1WDC C;  1YR5 A;  3I5G C;  3JVT B;  4U8D A;  2V53 A;  4BY5 A;  3TUY C;  4ZCV A;  4WQ3 A;  1V1F A;  4OCI A;  1DJH A;  1TIZ A;  1LVC D;  1RK9 A;  1JWD A;  3C1V A;  2E30 A;  4JWQ A;  2WND A;  2K2A A;  2LMT A;  3O78 A;  2LP2 A;  1NX1 A;  1SKT A;  1SR6 C;  3LK0 A;  1S6C A;  1BR1 B;  2JWW A;  2KNE A;  1DGU A;  2PMY A;  1FW4 A;  1MXE A;  1SL8 A;  2P6B B;  3K21 A;  2M3W A;  1KFX S;  3DVJ A;  1UHJ A;  1XO5 A;  1SNL A;  3OHM B;  1JBA A;  3PN7 B;  2MAZ A;  2EC6 C;  2KGR A;  1ZMZ A;  4IL1 A;  1B8R A;  5CSJ A;  3RM1 A;  1OQP A;  3H4S E;  1M31 A;  1XFY O;  2Q4U A;  3KPX A;  1BLQ A;  1MF8 B;  2LHI A;  5KU1 A;  1RRO A;  3BOW B;  2BL0 C;  2LV7 A;  5I2L A;  2ZFD A;  2FOT A;  1NCY A;  3BOW A;  3DVK A;  1AJ5 A;  1B1G A;  2OTG B;  5IBW A;  1UWO A;  2WC8 A;  3I5F B;  3SJS A;  2L5X B;  1WDC B;  3I5G B;  2O5G A;  2Y1N A;  3TUY B;  1NP8 A;  1YUR A;  1B7T Z;  1JF2 A;  2F3Z A;  2KSP A;  1SK6 D;  1F70 A;  4PE4 A;  1EH2 A;  3D0Y B;  1SY9 A;  1XA5 A;  1A2X A;  1TCF A;  4DRW A;  1K96 A;  1UHH A;  4PHM A;  1QV0 A;  4FQO A;  3D0Y A;  1JF0 A;  1CMF A;  3TDU A;  1N65 A;  2GGZ A;  4YGA A;  4F0Z B;  1BF5 A;  1IJ5 A;  1UP5 A;  2A4J A;  1KWO C;  3ICB A;  2LVV A;  3EKH A;  4HRH A;  3GK1 A;  1A03 A;  1CTR A;  2FJU B;  1SR6 B;  2NCP A;  1B47 A;  2PAL A;  3O4Y A;  3SG2 A;  4OKH A;  1DJZ A;  2HET A;  1OMD A;  3TDZ A;  2BCA A;  1LKJ A;  2QPT A;  1QVI Z;  4GFT A;  1RTP 1;  1VRK A;  4ORB B;  3WHT B;  2DOQ A;  2EC6 B;  2HPS A;  5DKR A;  2Y5I A;  2M97 A;  3SG6 A;  1Y6W A;  3IF7 A;  2IS9 A;  2K0J A;  3KEV A;  2JT8 A;  2NLN A;  3VGO A;  1W7J B;  2OS8 C;  4XJK B;  1BJF A;  2KOT A;  2BL0 B;  1F54 A;  1A75 B;  3FS7 A;  3SG7 A;  1BOC A;  1K9K A;  1W7I B;  4XJK A;  3VRQ A;  1OOJ A;  2AMI A;  1KFU L;  1C7W A;  1A75 A;  1EJ3 A;  1MWN A;  5CSI A;  5TNC A;  3NXA A;  4USL A;  5HLV A;  1G4Y R;  1AK8 A;  2LUC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...