1OOJA

Structural genomics of caenorhabditis elegans : calmodulin
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
141
structure length
141
Chain Sequence
TEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVTMM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Calmodulin CMD-1
publication title Structural genomics of caenorhabditis elegans: crystal structure of calmodulin.
pubmed doi rcsb
source organism Caenorhabditis elegans
total genus 54
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2003-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1oojA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1oojA02
1V1GA 2LCPA 1MQ1A 4FTGA 2NZ0A 2K7CA 4P5OE 5HLOA 4M2QA 4E68A 2KNEA 4YGDB 1F4QA 1GGWA 1CFPA 3VGOA 2MA2A 4JWQA 2M7LA 1YTZC 5I2LA 1AK8A 1XO5A 4GNKB 5BPJA 2K0JA 2JNFA 4WRIA 4YI8A 3DF0B 1G8IA 2LUCA 1V1FA 1W7IB 4OV2A 4HSZA 4D1EA 2CTNA 1QVIZ 1MHOA 2KDHA 3JTDC 2DOQA 2KFFA 4NDDA 1SY9A 3EVRA 2BBMA 1YRTB 1JC2A 1AUIB 2M49B 1JBAA 1TNWA 3CTNA 3DVKA 2GGZA 4MZKA 1RWYA 3WHTB 1CM1A 1U5IA 1GQMA 3D0YB 1J7QA 2K61A 3IQOA 2PRUA 2SASA 4N5XA 1OMRA 4GGFA 2MLEC 1A03A 1CDLA 5G08A 3SG3A 2GV5A 1KK7Z 5FYXA 1CFCA 4ETOA 2F3ZA 2KGBC 3EK7A 3BOWA 3I5GC 1JFKA 2H61A 5D7FA 1RTP1 4DCKA 1RECA 2I2RE 1IGVA 3FWCA 1BODA 2A4JA 1ZUZA 1K9PA 1K2HA 1Y6WA 2KI4C 4GUKA 3EVUA 4I5JA 1CFFA 1JF0A 3BUNB 2Y4QA 2NCOA 5CPVA 1K9KA 1K96A 3SG7A 4PE0A 2LMVA 3WNXB 2TN4A 3CLNA 2MRDA 2Y1MA 1SCMC 4MRYA 3TDZA 1CLBA 1Y1AA 1S36A 2CCMA 4PHKA 2PASA 2WNDA 1S5GZ 4OR9B 2KYCA 1LVCD 4HRGA 1WDCC 3LLEA 5DKRA 4ORAB 1AP4A 1SYMA 2H2KA 4HRHA 1CLLA 2LHLA 3DD4A 1B47A 1KFUS 2BCXA 2AUCA 2CBLA 1SBJA 1TIZA 3OB1B 4YBHB 2LE9B 3VRQA 3NXAA 1CKKA 1J1DA 4I5KA 4JPZB 4DS7A 1B9AA 5GQQC 3OX5A 1BLQA 2HETA 4YGAA 4ZCVA 1L7ZA 4XJKA 4BY4A 1B8RA 1OMDA 1OSAA 1NUBA 1C7VA 3OX6A 1LA0A 2F2PA 1YVHA 2EGDA 3BXKA 3JVTB 2RGIA 3JVTC 4ORCB 1F4OA 1GGZA 2IS9A 5CSIA 2JNXA 4JQ0D 2PVBA 5DKNA 2L0PA 4MZLA 3VRNA 1SL7A 1MUXA 4CIDA 3QRXA 2L4HA 1QX2A 1CB1A 4MRXA 4C0KA 1ALVA 4GPLB 4ICBA 1WLZA 3I5FC 3CGAA 1WRLA 3EK8A 1PVAA 3EVVA 3K21A 1FPWA 1SNLA 1A75A 3CWGA 2KBMA 3KPXA 1JWDA 1KCYA 1G4YR 4XYNA 3HX4A 3BUMB 2K7OA 2ZN9A 2BBNA 1TN4A 1EJ3A 4ORBB 4GGNA 2ZRSA 4IL1A 1QXPA 1DJWA 1PK0D 1X02A 1QVIY 2Q4UA 1CLMA 3KF9A 1OMVA 3I5IB 4WQ3A 1U5IB 3TZ1A 2M29A 2JPTA 4ZCUA 1SR6B 3GK2A 2AAOA 2KFGA 3OP0A 5AERA 1UURA 1QLKA 3SG5A 2LMUA 3VROA 2ZNDA 1BF5A 4PE7A 3O6BA 3CZTX 4Q04A 2KHNA 3BOWB 2E30A 3F45A 4M2OA 5HKWA 1KK7Y 1IJ6A 1WY9A 1KFXS 1TCOB 1G33A 1RK9A 2M0RA 2NCPA 1TNQA 2F3YA 1SW8A 1PALA 2CXJA 1BOCA 2FCDA 3WHUB 1OZOA 3H4SE 2BE4A 3SJSA 3HCMA 4N1GA 1R6PA 4MBEA 4USLA 2G2BA 1HQVA 1UHJA 1XFVO 2QACA 1NCXA 1GJYA 3KO0A 3DVEA 4PCWA 1J7PA 3PATA 5ER4X 1FF1A 1S6IA 1IG5A 1W7JB 1Y1XA 5HLVA 2O60A 3CR4X 3OHMB 1OE9B 1IRJA 3GK1A 2PALA 1QX7A 2HQWA 2BKHB 1DF0A 3PALA 4PE4A 1B8CA 5J3XA 1MF8B 1IWQA 3VRRA 2EHBA 4DUQA 2BCAA 1VRKA 1NWDA 4QJ3B 3PN7B 1KK8B 1NIWA 2I94A 5I8NA 1DT7B 5AXIA 3FIAA 1UHNA 2CNPA 1AJ5A 2LP2A 2EC6B 2JT0A 2V53A 4CLNA 1R2UA 1PRWA 4C0JA 4GAOA 2Y1NA 2LM5A 4XJKB 1J7OA 1QV0A 2JTTA 2JXLA 1ZOTB 5KSZA 4A4CA 5CSJA 2MHHA 2OS8B 2Q91A 5JJGA 1FBVA 2COLB 2OS8C 2BECA 2R2IA 2BL0B 3LL8B 3ICBA 3AKBA 1TNPA 1RROA 4AQIA 1ZMZA 1LKJA 1YVLA 1FW4A 4MZJA 1F71A 2BE6A 1A75B 5KTYA 1F54A 1B7TZ 3BUWB 4AQJA 2MLFC 1DJIA 2M7NA 2KAVA 1NCYA 2ZNEA 2L5XB 1CDMA 3LK1A 2OTGB 3E3RA 1IKUA 2MBXA 3AAKA 2PSRA 1CMGA 4I5LB 3CR2A 2NLNA 1BR4B 1F55A 1UHKA 3AAJA 1SRAA 2OPOA 3BYAA 1K94A 2F2OA 1MXLC 3PLFB 3ZNIA 1KQVA 1EG3A 4YGCB 2LLTA 1RFJA 1IJ5A 2LVKA 3OB2B 1NP8A 4BY5A 2JT3A 1KSOA 1XK4C 1EXRA 4YGEB 4F0ZB 3TUYB 3SIAA 5AANA 1XFZO 5ER5A 1FI6A 1OQPA 2LMTA 2HPSA 5AFPA 5HYDA 5CSFA 1TTXA 1A4PA 1QATA 1QJTA 2JZIA 1AVSA 4L9MA 1DVIA 2KAXA 4CFQA 3IQQA 1XVJA 2BKIB 2K2FA 2LAPA 2ZFDA 1DJXA 2B1UA 2JOJA 4UPGA 1L2OB 1SMGA 1D1OA 1M31A 2L4IA 2I18A 1BU3A 1KQMB 3AKAA 1S1EA 1BMOA 2G9BA 3I5IC 2LLUA 1NYAA 2LNKA 2LUXA 2HF5A 4I5NB 2LVVA 1NX0A 1CFDA 1S6JA 1DF0B 1SR6C 2LV7A 4HREE 1B4CA 4GGFC 1OZSA 2GGMA 1K90D 1UWOA 3RM1A 1H8BA 1N65A 1PSRA 1XA5A 2L50A 2KFHA 2LHIA 4YRUA 3NSIA 2H61C 1C7WA 4QJ5B 1KWOB 1CMFA 4P2YB 5IBWA 1IH0A 1JSAA 3CS1A 2KOTA 1F8HA 1WRZA 1K93D 2L51A 2LLSA 3FWBA 1DGVA 3NSOA 3O78A 2K7BA 2KYFA 1HT9A 1MXEA 5KU1A 1LXFC 1UUSA 4YGBB 2M8UA 1WRKA 4FQOA 2ISDA 1XFWO 2SCPA 3LK0A 3D10A 3SG4A 3NSLA 2KAYA 1S5GY 1UHIA 3M0WA 4C0LA 5D69A 3KEVA 1F70A 1YX8A 1S3PA 4U8DA 1ODBA 2E6WA 2QPTA 5F6TA 1YRUB 3EKHA 2M1UA 1UP5A 2JULA 2P6BB 1B7TY 1E8AA 3PN7C 1KK8C 2WCEA 2KQYA 3JTDB 1CNPA 1DJGA 1J7RA 2ZKMX 4PDZA 1N0YA 1QIWA 1QIVA 5CSNA 3EK4A 1KFUL 1Q80A 2EC6C 2KI6C 3GK4X 4OCIA 5I2OA 1DJZA 2AMIA 1NX3A 2LP3A 1K9UA 2WOSA 1SL9A 1SKTA 1QV1A 1Y0VH 1BT6A 1J1EA 2JTZA 3WXAA 3LCPC 2LANA 2BCBA 4R1EA 5I2QA 2LC5A 2F8PA 2L98A 1Y1UA 2VRGA 4MVFA 1BR1B 2M1KB 1DMOA 1SCVA 1FI5A 2JQ6A 3GOFA 1NCZA 2WCFA 1CTRA 1DTLA 3I5GB 2BL0C 1C07A 1CDNA 1JUOA 1YUUA 1BG1A 4GBAA 1A2XA 1A29A 2KSPA 1NPQA 1M63B 5JOLA 4M2PA 2KI4B 1J55A 1TNXA 1SPYA 4YI9A 4PHJA 4OVNF 4NDCA 3TDIA 5AEQA 3PSRA 1IQ5A 2KGRA 1YURA 3DF0A 1UHHA 1NSHA 2JXCA 4PHNA 2K2AA 1MR8A 1BJFA 1LA3A 1M39A 1NX2A 2O5GA 1XFXO 2KBIA 1SCMB 4MEWA 1QX5B 2F33A 1SL8A 2OTGC 1H4BA 4PHMA 5K89A 2PMYA 1AHRA 2K7DA 4MN0A 4DRWA 3D0YA 1KSMA 1OOJA 1WDCB 3BQ3A 3VRPA 2K8MB 3RLZA 1CDPA 3A4UB 4NDBA 1DJYA 1QS7A 1DJHA 4AOMA 2HQ8A 1SK6D 5HKZA 1EG4A 2ZN8A 4MLWA 2JU0A 3PM8A 5PALA 3C1VA 2L2EA 3TDUA 2FOTA 3TUYC 2LVJA 4N1FA 5HKYA 1XFUO 1B1GA 3KHEA 1YX7A 4TNCA 2KQ6A 1YUSA 3A8RA 4A4BA 4MSPA 1QLSA 1JF2A 1M45A 2WORA 1B8LA 4DIRA 1MWNA 3CR5X 2I7AA 3O4YA 1KFXL 1ZACA 4CPVA 2WCBA 2JRFA 2Y5IA 2JC2A 1XYDA 2D8NA 1DGUA 2JWWA 3BUXB 3FS7A 2M97A 4PE1A 3ZWHA 1EH2A 3MSEB 1L2OC 1M46A 2FJUB 3I5HB 3TS5B 3I5HC 3DVJA 3TS5C 1KQMC 1JFJA 4CFRA 4QJ4B 2KI6D 1PSBA 1YR5A 2MJWB 3I5FB 3DVMA 2CT9A 1N2DA 4OKHA 3SG2A 1PULA 2ZRTA 1K8UA 3BUOB 1QTXA 1S26D 1RJVA 1YUTA 3IF7A 2NXQA 5TNCA 5B8IB 1QASA 1ALWA 1XFYO 3O2PA 1PVBA 1EL4A 1KWOC 1IQ3A 5DKQA 1TOPA 4GFTA 1LINA 1S6CA 3SIBA 2FCEA 1K95A 4NQGA 2JT8A 1WLMA 3EKJA 1AJ4A 1TCFA 1CM4A 2M9GA 1NX1A 4PALA 1ZFSA 2LVIA 2M3WA 1TRFA 3PFVA 3SG6A 1XK4A 2WC8A 4WQ2A 2MAZA 3NSKA
chains in the Genus database with same CATH superfamily
1V1GA 2LCPA 1MQ1A 4FTGA 2NZ0A 2K7CA 4P5OE 5HLOA 4M2QA 4E68A 3UNWA 2KNEA 4YGDB 1Z4HA 1F4QA 1GGWA 3V2LA 1CFPA 3VGOA 2MA2A 1C3YA 4JWQA 2M7LA 1YTZC 2GTEA 5I2LA 1XO5A 4GNKB 5BPJA 2K0JA 2JNFA 4WRIA 4YI8A 3DF0B 1G8IA 2LUCA 1V1FA 2H8VA 1W7IB 4OV2A 4HSZA 4D1EA 2CTNA 1QVIZ 1MHOA 2KDHA 3JTDC 2DOQA 3CZ0A 2WC6A 5I94A 2KFFA 4NDDA 1SY9A 3IVTA 3EVRA 2BBMA 1YRTB 3BFAA 1JC2A 1AUIB 2M49B 1JBAA 1TNWA 3CTNA 3DVKA 2GGZA 4MZKA 1RWYA 3WHTB 1CM1A 1U5IA 1GQMA 3D0YB 1J7QA 2K61A 3IQOA 2PRUA 2SASA 4N5XA 1OMRA 3CZ1A 4GGFA 2MLEC 1A03A 1CDLA 5G08A 3SG3A 2GV5A 3L4AA 1KK7Z 5FYXA 1CFCA 3B6XA 2F3ZA 2KGBC 3EK7A 4ETOA 3BOWA 3I5GC 1JFKA 2H61A 5D7FA 1RTP1 4DCKA 1RECA 2I2RE 2PYQA 1IGVA 3FWCA 1BODA 2A4JA 2WCMA 1ZUZA 1DC1A 1K9PA 1K2HA 1Y6WA 2KI4C 4GUKA 4PT1A 3EVUA 4I5JA 1CFFA 1OOFA 1JF0A 3BUNB 2Y4QA 2NCOA 5CPVA 1K9KA 1K96A 3SG7A 4PE0A 2LMVA 3WNXB 2TN4A 3CLNA 2MRDA 2Y1MA 1SCMC 4MRYA 3TDZA 1CLBA 1Y1AA 1S36A 2CCMA 4PHKA 2PASA 2WNDA 1S5GZ 4OR9B 2KYCA 1LVCD 4OZDA 4HRGA 3R1PA 1WDCC 3LLEA 5DKRA 4ORAB 1AP4A 1SYMA 2H2KA 4HRHA 1CLLA 2LHLA 3DD4A 1B47A 5FI6A 1KFUS 2BCXA 2AUCA 2CBLA 1DELA 1SBJA 1TIZA 3OB1B 4YBHB 2LE9B 3VRQA 3NXAA 1CKKA 1J1DA 4I5KA 4JPZB 4DS7A 1B9AA 5GQQC 3OX5A 1BLQA 2HETA 4YGAA 4ZCVA 1L7ZA 4XJKA 4BY4A 1B8RA 1OMDA 1OSAA 1NUBA 1C7VA 3OX6A 1LA0A 2F2PA 1YVHA 2EGDA 3BXKA 3JVTB 2RGIA 3JVTC 4ORCB 1F4OA 1GGZA 2IS9A 5CSIA 2JNXA 3DXLA 2PVBA 4JQ0D 2L0PA 5DKNA 4MZLA 5AERA 3VRNA 1SL7A 1MUXA 4CIDA 3QRXA 2L4HA 1QX2A 1CB1A 4MRXA 3SS4A 1ALVA 4GPLB 4ICBA 1WLZA 3I5FC 3CGAA 1WRLA 2K60A 1PVAA 3EK8A 3BJHA 3EVVA 3K21A 1GM0A 1FPWA 3L47A 1SNLA 1A75A 3CWGA 2KBMA 3KPXA 1JWDA 1KCYA 1G4YR 4XYNA 3HX4A 3BUMB 2K7OA 2ZN9A 2BBNA 1TN4A 1EJ3A 4ORBB 4GGNA 2ZRSA 4IL1A 1QXPA 1DJWA 1PK0D 1X02A 1QVIY 2Q4UA 1CLMA 3KF9A 1OMVA 3I5IB 4WQ3A 1U5IB 3TZ1A 2M29A 2JPTA 4ZCUA 1SR6B 3GK2A 2AAOA 2KFGA 3OP0A 3R1VA 1UURA 1QLKA 3R72A 3SG5A 2KPHA 2LMUA 3S0EA 3VROA 3DY9A 2ZNDA 1BF5A 4PE7A 3O6BA 3CZTX 4Q04A 2KHNA 3BOWB 2E30A 2WCKA 3F45A 4M2OA 5HKWA 2WCHA 1KK7Y 1IJ6A 1WY9A 1KFXS 1TCOB 1G33A 1RK9A 2M0RA 2NCPA 1TNQA 2F3YA 1SW8A 1PALA 2CXJA 1BOCA 2FCDA 3WHUB 1OZOA 3H4SE 2BE4A 3SJSA 3HCMA 4N1GA 1R6PA 4MBEA 4USLA 2G2BA 1HQVA 1UHJA 4KYNA 4JKTA 1XFVO 2P71A 2QACA 1NCXA 1GJYA 3KO0A 1TWOA 3DVEA 4PCWA 1OOIX 1J7PA 3D75A 3PATA 5ER4X 1FF1A 1S6IA 1IG5A 1W7JB 1Y1XA 5HLVA 2O60A 3CR4X 3OHMB 1OE9B 1IRJA 3Q8IA 3GK1A 2PALA 1QX7A 2HQWA 4INXA 2BKHB 3S0AA 1DF0A 3PALA 4PE4A 1B8CA 5J3XA 1MF8B 1IWQA 3VRRA 2EHBA 4DUQA 2BCAA 1VRKA 1NWDA 4INWA 3PN7B 1KK8B 1NIWA 2I94A 4QJ3B 5I8NA 2QEVA 1DT7B 5AXIA 1AK8A 3FIAA 1UHNA 2CNPA 1AJ5A 2LP2A 2EC6B 2JT0A 2V53A 4CLNA 1R2UA 1PRWA 4C0JA 1C3ZA 4GAOA 2Y1NA 2LM5A 4XJKB 3O4XA 1QV0A 2JTTA 2JXLA 1ZOTB 5KSZA 1J7OA 3OGNA 4A4CA 3NHTA 5CSJA 2MHHA 2OS8B 2Q91A 5JJGA 1FBVA 2COLB 2OS8C 2BECA 2R2IA 2QEBA 2BL0B 3LL8B 4C0KA 3ICBA 3AKBA 1TNPA 1RROA 2WCJA 4AQIA 1ZMZA 1LKJA 1YVLA 1FW4A 4MZJA 1F71A 2BE6A 1A75B 5KTYA 1F54A 1B7TZ 3BUWB 4AQJA 2MLFC 1DJIA 2M7NA 3SS5A 3B86A 2KAVA 1NCYA 2WC5A 2ZNEA 2L5XB 1CDMA 3LK1A 2OTGB 3E3RA 1IKUA 2MBXA 3AAKA 2PSRA 1CMGA 4I5LB 3CR2A 2NLNA 1BR4B 4F7FA 1F55A 1UHKA 3AAJA 1SRAA 2OPOA 3BYAA 3D74A 1K94A 2F2OA 5D3OA 1MXLC 3B7AA 3PLFB 3ZNIA 1KQVA 1EG3A 2WCLA 4YGCB 2LLTA 1RFJA 1IJ5A 3S0BA 2LVKA 3OB2B 1NP8A 3SS3A 4BY5A 2JT3A 1KSOA 1XK4C 2L2CA 1EXRA 4YGEB 4F0ZB 3FE6A 3TUYB 3SIAA 5AANA 1XFZO 4IJ7A 5ER5A 1FI6A 1OQPA 2LMTA 2HPSA 5AFPA 5HYDA 5CSFA 1TTXA 1XFRA 1A4PA 2P70A 1QATA 1QJTA 2JZIA 3NGVA 1AVSA 1ORGA 4L9MA 1DVIA 2KAXA 4CFQA 3IQQA 1XVJA 2BKIB 2K2FA 2LAPA 2ZFDA 1DJXA 2B1UA 1IIOA 2JOJA 4UPGA 2QEOA 1L2OB 1SMGA 1D1OA 1M31A 2L4IA 2I18A 1BU3A 1KQMB 3AKAA 1S1EA 1BMOA 2G9BA 3I5IC 2LLUA 1NYAA 2LNKA 2LUXA 2HF5A 4I5NB 2LVVA 1NX0A 1CFDA 1S6JA 1DF0B 1SR6C 2LV7A 4HREE 1B4CA 4GGFC 1OZSA 2GGMA 5HL1A 1K90D 1UWOA 3RM1A 1H8BA 1N65A 1PSRA 3DZTA 1XA5A 2L50A 2KFHA 2LHIA 3BFBA 3CDNA 4YRUA 3NSIA 2H61C 3D76A 1C7WA 1SSEB 4QJ5B 1KWOB 1CMFA 4P2YB 5IBWA 1IH0A 1JSAA 3CS1A 2KOTA 1F8HA 1WRZA 1K93D 2L51A 2LLSA 2KLDA 5EL2A 3FWBA 3S0FA 1DGVA 3NSOA 3O78A 2K7BA 2KYFA 1HT9A 1MXEA 5KU1A 3CABA 1LXFC 1UUSA 4YGBB 1OOHA 2M8UA 3B88A 1WRKA 2BNXA 4FQOA 2ISDA 1XFWO 3VB1A 3RZSA 2SCPA 3LK0A 3D10A 3S0DA 3NSLA 3SG4A 2KAYA 1S5GY 1UHIA 2KLEA 3UO9A 4JD9A 3M0WA 4C0LA 1TUJA 5D69A 3KEVA 1F70A 1YX8A 1S3PA 3FE8A 4U8DA 3N7HA 1ODBA 2E6WA 2QPTA 5F6TA 5FI2A 1YRUB 3EKHA 2M1UA 1UP5A 2JULA 2P6BB 1B7TY 1E8AA 3PN7C 1KK8C 2WCEA 2KQYA 3JTDB 1CNPA 1DJGA 3PJIA 1J7RA 2ZKMX 4PDZA 1N0YA 1QIWA 1QIVA 5CSNA 3EK4A 1KFUL 1Q80A 2EC6C 2KI6C 3GK4X 3NHIA 4OCIA 5I2OA 1DJZA 2AMIA 1NX3A 2LP3A 1K9UA 2WOSA 1SL9A 1SKTA 1QV1A 1Y0VH 1BT6A 1LS8A 1J1EA 2JTZA 3WXAA 3LCPC 2LANA 2BCBA 1P28A 4R1EA 5I2QA 3R1OA 2LC5A 2F8PA 2L98A 3PM2A 1Y1UA 2VRGA 4MVFA 1BR1B 2M1KB 1DMOA 1SCVA 1FI5A 2JQ6A 3GOFA 1NCZA 2WCFA 1CTRA 1DTLA 3I5GB 2BL0C 1C07A 1CDNA 1JUOA 1YUUA 5FI7A 4GBAA 1BG1A 1A2XA 1A29A 2KSPA 1NPQA 1W9ZA 1M63B 5JOLA 4M2PA 2KI4B 1J55A 2YGUA 1TNXA 1SPYA 3D78A 4PHJA 4OVNF 4YI9A 4NDCA 3TDIA 3BFHA 3D73A 3PSRA 5AEQA 1IQ5A 2KGRA 1YURA 3DF0A 1QWVA 1NSHA 1UHHA 2JXCA 4PHNA 2K2AA 1MR8A 1BJFA 1LA3A 1M39A 1NX2A 1TUZA 2O5GA 1XFXO 2PQLA 2KBIA 1SCMB 4MEWA 1QX5B 2F33A 1SL8A 1DQEA 2OTGC 4PHMA 1H4BA 3K1EA 5K89A 1Z2CB 2PMYA 1AHRA 2K7DA 2FJYA 3L4LA 4MN0A 4DRWA 1DEKA 3D0YA 1KSMA 1OOJA 1WDCB 3BQ3A 3VRPA 2K8MB 3RLZA 1CDPA 3A4UB 3DYEA 4NDBA 1DJYA 1QS7A 1DJHA 4AOMA 2HQ8A 1SK6D 2BAPA 1EG4A 2QEHA 5HKZA 2ZN8A 4MLWA 2JU0A 3PM8A 5PALA 5DICA 3C1VA 2L2EA 3TDUA 2FOTA 3TUYC 2LVJA 4N1FA 5HKYA 1XFUO 1B1GA 3KHEA 1YX7A 4TNCA 2KQ6A 1YUSA 3A8RA 1OW4A 4A4BA 4MSPA 1QLSA 1JF2A 1M45A 2WORA 1B8LA 4DIRA 1MWNA 3CR5X 2I7AA 1OOGA 3O4YA 1KFXL 1ZACA 4CPVA 3QMEA 3D77A 2WCBA 2JRFA 3EG5B 3B87A 2Y5IA 2ERBA 2JC2A 1XYDA 2D8NA 1DGUA 2JWWA 3BUXB 3FS7A 2M97A 4PE1A 3ZWHA 1EH2A 3MSEB 1L2OC 1M46A 2FJUB 3I5HB 3TS5B 3I5HC 3DVJA 3FE9A 1KQMC 3TS5C 1JFJA 4CFRA 4QJ4B 2KI6D 1PSBA 1YR5A 2MJWB 3I5FB 3DVMA 2CT9A 1N2DA 4OKHA 3CYZA 3SG2A 1PULA 2ZRTA 1K8UA 3BUOB 1QTXA 1S26D 1RJVA 1YUTA 3IF7A 2NXQA 5TNCA 5B8IB 1QASA 1ALWA 1XFYO 3OBVA 3O2PA 1PVBA 1EL4A 1KWOC 1IQ3A 5DKQA 1TOPA 4GFTA 1T14A 2L5YA 1LINA 1S6CA 2QDIA 2FCEA 3SIBA 1K95A 4NQGA 2JPOA 2JT8A 1WLMA 3EKJA 4FQTA 1AJ4A 1TCFA 1CM4A 2M9GA 1NX1A 4PALA 3S0GA 1ZFSA 2LVIA 2M3WA 1TRFA 3PFVA 3SG6A 1XK4A 2WC8A 4WQ2A 2MAZA 3CZ2A 3NSKA
chains in the Genus database with same CATH topology
1V1GA 2LCPA 1MQ1A 4FTGA 2NZ0A 2K7CA 4P5OE 5HLOA 4M2QA 4E68A 2KNEA 4YGDB 1F4QA 1GGWA 1CFPA 3VGOA 2MA2A 4JWQA 2M7LA 1YTZC 5I2LA 1AK8A 1XO5A 4GNKB 5BPJA 2K0JA 2JNFA 4WRIA 4YI8A 3DF0B 1G8IA 2LUCA 1V1FA 1W7IB 4OV2A 4HSZA 4D1EA 2CTNA 1QVIZ 1MHOA 2KDHA 3JTDC 2DOQA 2KFFA 4NDDA 1SY9A 3EVRA 2BBMA 1YRTB 1JC2A 1AUIB 2M49B 1JBAA 1TNWA 3CTNA 3DVKA 2GGZA 4MZKA 1RWYA 3WHTB 1CM1A 1U5IA 1GQMA 3D0YB 1J7QA 2K61A 3IQOA 2PRUA 2SASA 4N5XA 1OMRA 4GGFA 2MLEC 1A03A 1CDLA 5G08A 3SG3A 2GV5A 1KK7Z 5FYXA 1CFCA 4ETOA 2F3ZA 2KGBC 3EK7A 3BOWA 3I5GC 1JFKA 2H61A 5D7FA 1RTP1 4DCKA 1RECA 2I2RE 1IGVA 3FWCA 1BODA 2A4JA 1ZUZA 1K9PA 1K2HA 1Y6WA 2KI4C 4GUKA 3EVUA 4I5JA 1CFFA 1JF0A 3BUNB 2Y4QA 2NCOA 5CPVA 1K9KA 1K96A 3SG7A 4PE0A 2LMVA 3WNXB 2TN4A 3CLNA 2MRDA 2Y1MA 1SCMC 4MRYA 3TDZA 1CLBA 1Y1AA 1S36A 2CCMA 4PHKA 2PASA 2WNDA 1S5GZ 4OR9B 2KYCA 1LVCD 4HRGA 1WDCC 3LLEA 5DKRA 4ORAB 1AP4A 1SYMA 2H2KA 4HRHA 1CLLA 2LHLA 3DD4A 1B47A 1KFUS 2BCXA 2AUCA 2CBLA 1SBJA 1TIZA 3OB1B 4YBHB 2LE9B 3VRQA 3NXAA 1CKKA 1J1DA 4I5KA 4JPZB 4DS7A 1B9AA 5GQQC 3OX5A 1BLQA 2HETA 4YGAA 4ZCVA 1L7ZA 4XJKA 4BY4A 1B8RA 1OMDA 1OSAA 1NUBA 1C7VA 3OX6A 1LA0A 2F2PA 1YVHA 2EGDA 3BXKA 3JVTB 2RGIA 3JVTC 4ORCB 1F4OA 1GGZA 2IS9A 5CSIA 2JNXA 4JQ0D 2PVBA 5DKNA 2L0PA 4MZLA 3VRNA 1SL7A 1MUXA 4CIDA 3QRXA 2L4HA 1QX2A 1CB1A 4MRXA 4C0KA 1ALVA 4GPLB 4ICBA 1WLZA 3I5FC 3CGAA 1WRLA 3EK8A 1PVAA 3EVVA 3K21A 1FPWA 1SNLA 1A75A 3CWGA 2KBMA 3KPXA 1JWDA 1KCYA 1G4YR 4XYNA 3HX4A 3BUMB 2K7OA 2ZN9A 2BBNA 1TN4A 1EJ3A 4ORBB 4GGNA 2ZRSA 4IL1A 1QXPA 1DJWA 1PK0D 1X02A 1QVIY 2Q4UA 1CLMA 3KF9A 1OMVA 3I5IB 4WQ3A 1U5IB 3TZ1A 2M29A 2JPTA 4ZCUA 1SR6B 3GK2A 2AAOA 2KFGA 3OP0A 5AERA 1UURA 1QLKA 3SG5A 2LMUA 3VROA 2ZNDA 1BF5A 4PE7A 3O6BA 3CZTX 4Q04A 2KHNA 3BOWB 2E30A 3F45A 4M2OA 5HKWA 1KK7Y 1IJ6A 1WY9A 1KFXS 1TCOB 1G33A 1RK9A 2M0RA 2NCPA 1TNQA 2F3YA 1SW8A 1PALA 2CXJA 1BOCA 2FCDA 3WHUB 1OZOA 3H4SE 2BE4A 3SJSA 3HCMA 4N1GA 1R6PA 4MBEA 4USLA 2G2BA 1HQVA 1UHJA 1XFVO 2QACA 1NCXA 1GJYA 3KO0A 3DVEA 4PCWA 1J7PA 3PATA 5ER4X 1FF1A 1S6IA 1IG5A 1W7JB 1Y1XA 5HLVA 2O60A 3CR4X 3OHMB 1OE9B 1IRJA 3GK1A 2PALA 1QX7A 2HQWA 2BKHB 1DF0A 3PALA 4PE4A 1B8CA 5J3XA 1MF8B 1IWQA 3VRRA 2EHBA 4DUQA 2BCAA 1VRKA 1NWDA 4QJ3B 3PN7B 1KK8B 1NIWA 2I94A 5I8NA 1DT7B 5AXIA 3FIAA 1UHNA 2CNPA 1AJ5A 2LP2A 2EC6B 2JT0A 2V53A 4CLNA 1R2UA 1PRWA 4C0JA 4GAOA 2Y1NA 2LM5A 4XJKB 1J7OA 1QV0A 2JTTA 2JXLA 1ZOTB 5KSZA 4A4CA 5CSJA 2MHHA 2OS8B 2Q91A 5JJGA 1FBVA 2COLB 2OS8C 2BECA 2R2IA 2BL0B 3LL8B 3ICBA 3AKBA 1TNPA 1RROA 4AQIA 1ZMZA 1LKJA 1YVLA 1FW4A 4MZJA 1F71A 2BE6A 1A75B 5KTYA 1F54A 1B7TZ 3BUWB 4AQJA 2MLFC 1DJIA 2M7NA 2KAVA 1NCYA 2ZNEA 2L5XB 1CDMA 3LK1A 2OTGB 3E3RA 1IKUA 2MBXA 3AAKA 2PSRA 1CMGA 4I5LB 3CR2A 2NLNA 1BR4B 1F55A 1UHKA 3AAJA 1SRAA 2OPOA 3BYAA 1K94A 2F2OA 1MXLC 3PLFB 3ZNIA 1KQVA 1EG3A 4YGCB 2LLTA 1RFJA 1IJ5A 2LVKA 3OB2B 1NP8A 4BY5A 2JT3A 1KSOA 1XK4C 1EXRA 4YGEB 4F0ZB 3TUYB 3SIAA 5AANA 1XFZO 5ER5A 1FI6A 1OQPA 2LMTA 2HPSA 5AFPA 5HYDA 5CSFA 1TTXA 1A4PA 1QATA 1QJTA 2JZIA 1AVSA 4L9MA 1DVIA 2KAXA 4CFQA 3IQQA 1XVJA 2BKIB 2K2FA 2LAPA 2ZFDA 1DJXA 2B1UA 2JOJA 4UPGA 1L2OB 1SMGA 1D1OA 1M31A 2L4IA 2I18A 1BU3A 1KQMB 3AKAA 1S1EA 1BMOA 2G9BA 3I5IC 2LLUA 1NYAA 2LNKA 2LUXA 2HF5A 4I5NB 2LVVA 1NX0A 1CFDA 1S6JA 1DF0B 1SR6C 2LV7A 4HREE 1B4CA 4GGFC 1OZSA 2GGMA 1K90D 1UWOA 3RM1A 1H8BA 1N65A 1PSRA 1XA5A 2L50A 2KFHA 2LHIA 4YRUA 3NSIA 2H61C 1C7WA 4QJ5B 1KWOB 1CMFA 4P2YB 5IBWA 1IH0A 1JSAA 3CS1A 2KOTA 1F8HA 1WRZA 1K93D 2L51A 2LLSA 3FWBA 1DGVA 3NSOA 3O78A 2K7BA 2KYFA 1HT9A 1MXEA 5KU1A 1LXFC 1UUSA 4YGBB 2M8UA 1WRKA 4FQOA 2ISDA 1XFWO 2SCPA 3LK0A 3D10A 3SG4A 3NSLA 2KAYA 1S5GY 1UHIA 3M0WA 4C0LA 5D69A 3KEVA 1F70A 1YX8A 1S3PA 4U8DA 1ODBA 2E6WA 2QPTA 5F6TA 1YRUB 3EKHA 2M1UA 1UP5A 2JULA 2P6BB 1B7TY 1E8AA 3PN7C 1KK8C 2WCEA 2KQYA 3JTDB 1CNPA 1DJGA 1J7RA 2ZKMX 4PDZA 1N0YA 1QIWA 1QIVA 5CSNA 3EK4A 1KFUL 1Q80A 2EC6C 2KI6C 3GK4X 4OCIA 5I2OA 1DJZA 2AMIA 1NX3A 2LP3A 1K9UA 2WOSA 1SL9A 1SKTA 1QV1A 1Y0VH 1BT6A 1J1EA 2JTZA 3WXAA 3LCPC 2LANA 2BCBA 4R1EA 5I2QA 2LC5A 2F8PA 2L98A 1Y1UA 2VRGA 4MVFA 1BR1B 2M1KB 1DMOA 1SCVA 1FI5A 2JQ6A 3GOFA 1NCZA 2WCFA 1CTRA 1DTLA 3I5GB 2BL0C 1C07A 1CDNA 1JUOA 1YUUA 1BG1A 4GBAA 1A2XA 1A29A 2KSPA 1NPQA 1M63B 5JOLA 4M2PA 2KI4B 1J55A 1TNXA 1SPYA 4YI9A 4PHJA 4OVNF 4NDCA 3TDIA 5AEQA 3PSRA 1IQ5A 2KGRA 1YURA 3DF0A 1UHHA 1NSHA 2JXCA 4PHNA 2K2AA 1MR8A 1BJFA 1LA3A 1M39A 1NX2A 2O5GA 1XFXO 2KBIA 1SCMB 4MEWA 1QX5B 2F33A 1SL8A 2OTGC 1H4BA 4PHMA 5K89A 2PMYA 1AHRA 2K7DA 4MN0A 4DRWA 3D0YA 1KSMA 1OOJA 1WDCB 3BQ3A 3VRPA 2K8MB 3RLZA 1CDPA 3A4UB 4NDBA 1DJYA 1QS7A 1DJHA 4AOMA 2HQ8A 1SK6D 5HKZA 1EG4A 2ZN8A 4MLWA 2JU0A 3PM8A 5PALA 3C1VA 2L2EA 3TDUA 2FOTA 3TUYC 2LVJA 4N1FA 5HKYA 1XFUO 1B1GA 3KHEA 1YX7A 4TNCA 2KQ6A 1YUSA 3A8RA 4A4BA 4MSPA 1QLSA 1JF2A 1M45A 2WORA 1B8LA 4DIRA 1MWNA 3CR5X 2I7AA 3O4YA 1KFXL 1ZACA 4CPVA 2WCBA 2JRFA 2Y5IA 2JC2A 1XYDA 2D8NA 1DGUA 2JWWA 3BUXB 3FS7A 2M97A 4PE1A 3ZWHA 1EH2A 3MSEB 1L2OC 1M46A 2FJUB 3I5HB 3TS5B 3I5HC 3DVJA 3TS5C 1KQMC 1JFJA 4CFRA 4QJ4B 2KI6D 1PSBA 1YR5A 2MJWB 3I5FB 3DVMA 2CT9A 1N2DA 4OKHA 3SG2A 1PULA 2ZRTA 1K8UA 3BUOB 1QTXA 1S26D 1RJVA 1YUTA 3IF7A 2NXQA 5TNCA 5B8IB 1QASA 1ALWA 1XFYO 3O2PA 1PVBA 1EL4A 1KWOC 1IQ3A 5DKQA 1TOPA 4GFTA 1LINA 1S6CA 3SIBA 2FCEA 1K95A 4NQGA 2JT8A 1WLMA 3EKJA 1AJ4A 1TCFA 1CM4A 2M9GA 1NX1A 4PALA 1ZFSA 2LVIA 2M3WA 1TRFA 3PFVA 3SG6A 1XK4A 2WC8A 4WQ2A 2MAZA 3NSKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V1G A;  2LCP A;  1MQ1 A;  4FTG A;  2NZ0 A;  2K7C A;  4P5O E;  5HLO A;  4M2Q A;  4E68 A;  2KNE A;  4YGD B;  1F4Q A;  1GGW A;  1CFP A;  3VGO A;  2MA2 A;  4JWQ A;  2M7L A;  1YTZ C;  5I2L A;  1AK8 A;  1XO5 A;  4GNK B;  5BPJ A;  2K0J A;  2JNF A;  4WRI A;  4YI8 A;  3DF0 B;  1G8I A;  2LUC A;  1V1F A;  1W7I B;  4OV2 A;  4HSZ A;  4D1E A;  2CTN A;  1QVI Z;  1MHO A;  2KDH A;  3JTD C;  2DOQ A;  2KFF A;  4NDD A;  1SY9 A;  3EVR A;  2BBM A;  1YRT B;  1JC2 A;  1AUI B;  2M49 B;  1JBA A;  1TNW A;  3CTN A;  3DVK A;  2GGZ A;  4MZK A;  1RWY A;  3WHT B;  1CM1 A;  1U5I A;  1GQM A;  3D0Y B;  1J7Q A;  2K61 A;  3IQO A;  2PRU A;  2SAS A;  4N5X A;  1OMR A;  4GGF A;  2MLE C;  1A03 A;  1CDL A;  5G08 A;  3SG3 A;  2GV5 A;  1KK7 Z;  5FYX A;  1CFC A;  4ETO A;  2F3Z A;  2KGB C;  3EK7 A;  3BOW A;  3I5G C;  1JFK A;  2H61 A;  5D7F A;  1RTP 1;  4DCK A;  1REC A;  2I2R E;  1IGV A;  3FWC A;  1BOD A;  2A4J A;  1ZUZ A;  1K9P A;  1K2H A;  1Y6W A;  2KI4 C;  4GUK A;  3EVU A;  4I5J A;  1CFF A;  1JF0 A;  3BUN B;  2Y4Q A;  2NCO A;  5CPV A;  1K9K A;  1K96 A;  3SG7 A;  4PE0 A;  2LMV A;  3WNX B;  2TN4 A;  3CLN A;  2MRD A;  2Y1M A;  1SCM C;  4MRY A;  3TDZ A;  1CLB A;  1Y1A A;  1S36 A;  2CCM A;  4PHK A;  2PAS A;  2WND A;  1S5G Z;  4OR9 B;  2KYC A;  1LVC D;  4HRG A;  1WDC C;  3LLE A;  5DKR A;  4ORA B;  1AP4 A;  1SYM A;  2H2K A;  4HRH A;  1CLL A;  2LHL A;  3DD4 A;  1B47 A;  1KFU S;  2BCX A;  2AUC A;  2CBL A;  1SBJ A;  1TIZ A;  3OB1 B;  4YBH B;  2LE9 B;  3VRQ A;  3NXA A;  1CKK A;  1J1D A;  4I5K A;  4JPZ B;  4DS7 A;  1B9A A;  5GQQ C;  3OX5 A;  1BLQ A;  2HET A;  4YGA A;  4ZCV A;  1L7Z A;  4XJK A;  4BY4 A;  1B8R A;  1OMD A;  1OSA A;  1NUB A;  1C7V A;  3OX6 A;  1LA0 A;  2F2P A;  1YVH A;  2EGD A;  3BXK A;  3JVT B;  2RGI A;  3JVT C;  4ORC B;  1F4O A;  1GGZ A;  2IS9 A;  5CSI A;  2JNX A;  4JQ0 D;  2PVB A;  5DKN A;  2L0P A;  4MZL A;  3VRN A;  1SL7 A;  1MUX A;  4CID A;  3QRX A;  2L4H A;  1QX2 A;  1CB1 A;  4MRX A;  4C0K A;  1ALV A;  4GPL B;  4ICB A;  1WLZ A;  3I5F C;  3CGA A;  1WRL A;  3EK8 A;  1PVA A;  3EVV A;  3K21 A;  1FPW A;  1SNL A;  1A75 A;  3CWG A;  2KBM A;  3KPX A;  1JWD A;  1KCY A;  1G4Y R;  4XYN A;  3HX4 A;  3BUM B;  2K7O A;  2ZN9 A;  2BBN A;  1TN4 A;  1EJ3 A;  4ORB B;  4GGN A;  2ZRS A;  4IL1 A;  1QXP A;  1DJW A;  1PK0 D;  1X02 A;  1QVI Y;  2Q4U A;  1CLM A;  3KF9 A;  1OMV A;  3I5I B;  4WQ3 A;  1U5I B;  3TZ1 A;  2M29 A;  2JPT A;  4ZCU A;  1SR6 B;  3GK2 A;  2AAO A;  2KFG A;  3OP0 A;  5AER A;  1UUR A;  1QLK A;  3SG5 A;  2LMU A;  3VRO A;  2ZND A;  1BF5 A;  4PE7 A;  3O6B A;  3CZT X;  4Q04 A;  2KHN A;  3BOW B;  2E30 A;  3F45 A;  4M2O A;  5HKW A;  1KK7 Y;  1IJ6 A;  1WY9 A;  1KFX S;  1TCO B;  1G33 A;  1RK9 A;  2M0R A;  2NCP A;  1TNQ A;  2F3Y A;  1SW8 A;  1PAL A;  2CXJ A;  1BOC A;  2FCD A;  3WHU B;  1OZO A;  3H4S E;  2BE4 A;  3SJS A;  3HCM A;  4N1G A;  1R6P A;  4MBE A;  4USL A;  2G2B A;  1HQV A;  1UHJ A;  1XFV O;  2QAC A;  1NCX A;  1GJY A;  3KO0 A;  3DVE A;  4PCW A;  1J7P A;  3PAT A;  5ER4 X;  1FF1 A;  1S6I A;  1IG5 A;  1W7J B;  1Y1X A;  5HLV A;  2O60 A;  3CR4 X;  3OHM B;  1OE9 B;  1IRJ A;  3GK1 A;  2PAL A;  1QX7 A;  2HQW A;  2BKH B;  1DF0 A;  3PAL A;  4PE4 A;  1B8C A;  5J3X A;  1MF8 B;  1IWQ A;  3VRR A;  2EHB A;  4DUQ A;  2BCA A;  1VRK A;  1NWD A;  4QJ3 B;  3PN7 B;  1KK8 B;  1NIW A;  2I94 A;  5I8N A;  1DT7 B;  5AXI A;  3FIA A;  1UHN A;  2CNP A;  1AJ5 A;  2LP2 A;  2EC6 B;  2JT0 A;  2V53 A;  4CLN A;  1R2U A;  1PRW A;  4C0J A;  4GAO A;  2Y1N A;  2LM5 A;  4XJK B;  1J7O A;  1QV0 A;  2JTT A;  2JXL A;  1ZOT B;  5KSZ A;  4A4C A;  5CSJ A;  2MHH A;  2OS8 B;  2Q91 A;  5JJG A;  1FBV A;  2COL B;  2OS8 C;  2BEC A;  2R2I A;  2BL0 B;  3LL8 B;  3ICB A;  3AKB A;  1TNP A;  1RRO A;  4AQI A;  1ZMZ A;  1LKJ A;  1YVL A;  1FW4 A;  4MZJ A;  1F71 A;  2BE6 A;  1A75 B;  5KTY A;  1F54 A;  1B7T Z;  3BUW B;  4AQJ A;  2MLF C;  1DJI A;  2M7N A;  2KAV A;  1NCY A;  2ZNE A;  2L5X B;  1CDM A;  3LK1 A;  2OTG B;  3E3R A;  1IKU A;  2MBX A;  3AAK A;  2PSR A;  1CMG A;  4I5L B;  3CR2 A;  2NLN A;  1BR4 B;  1F55 A;  1UHK A;  3AAJ A;  1SRA A;  2OPO A;  3BYA A;  1K94 A;  2F2O A;  1MXL C;  3PLF B;  3ZNI A;  1KQV A;  1EG3 A;  4YGC B;  2LLT A;  1RFJ A;  1IJ5 A;  2LVK A;  3OB2 B;  1NP8 A;  4BY5 A;  2JT3 A;  1KSO A;  1XK4 C;  1EXR A;  4YGE B;  4F0Z B;  3TUY B;  3SIA A;  5AAN A;  1XFZ O;  5ER5 A;  1FI6 A;  1OQP A;  2LMT A;  2HPS A;  5AFP A;  5HYD A;  5CSF A;  1TTX A;  1A4P A;  1QAT A;  1QJT A;  2JZI A;  1AVS A;  4L9M A;  1DVI A;  2KAX A;  4CFQ A;  3IQQ A;  1XVJ A;  2BKI B;  2K2F A;  2LAP A;  2ZFD A;  1DJX A;  2B1U A;  2JOJ A;  4UPG A;  1L2O B;  1SMG A;  1D1O A;  1M31 A;  2L4I A;  2I18 A;  1BU3 A;  1KQM B;  3AKA A;  1S1E A;  1BMO A;  2G9B A;  3I5I C;  2LLU A;  1NYA A;  2LNK A;  2LUX A;  2HF5 A;  4I5N B;  2LVV A;  1NX0 A;  1CFD A;  1S6J A;  1DF0 B;  1SR6 C;  2LV7 A;  4HRE E;  1B4C A;  4GGF C;  1OZS A;  2GGM A;  1K90 D;  1UWO A;  3RM1 A;  1H8B A;  1N65 A;  1PSR A;  1XA5 A;  2L50 A;  2KFH A;  2LHI A;  4YRU A;  3NSI A;  2H61 C;  1C7W A;  4QJ5 B;  1KWO B;  1CMF A;  4P2Y B;  5IBW A;  1IH0 A;  1JSA A;  3CS1 A;  2KOT A;  1F8H A;  1WRZ A;  1K93 D;  2L51 A;  2LLS A;  3FWB A;  1DGV A;  3NSO A;  3O78 A;  2K7B A;  2KYF A;  1HT9 A;  1MXE A;  5KU1 A;  1LXF C;  1UUS A;  4YGB B;  2M8U A;  1WRK A;  4FQO A;  2ISD A;  1XFW O;  2SCP A;  3LK0 A;  3D10 A;  3SG4 A;  3NSL A;  2KAY A;  1S5G Y;  1UHI A;  3M0W A;  4C0L A;  5D69 A;  3KEV A;  1F70 A;  1YX8 A;  1S3P A;  4U8D A;  1ODB A;  2E6W A;  2QPT A;  5F6T A;  1YRU B;  3EKH A;  2M1U A;  1UP5 A;  2JUL A;  2P6B B;  1B7T Y;  1E8A A;  3PN7 C;  1KK8 C;  2WCE A;  2KQY A;  3JTD B;  1CNP A;  1DJG A;  1J7R A;  2ZKM X;  4PDZ A;  1N0Y A;  1QIW A;  1QIV A;  5CSN A;  3EK4 A;  1KFU L;  1Q80 A;  2EC6 C;  2KI6 C;  3GK4 X;  4OCI A;  5I2O A;  1DJZ A;  2AMI A;  1NX3 A;  2LP3 A;  1K9U A;  2WOS A;  1SL9 A;  1SKT A;  1QV1 A;  1Y0V H;  1BT6 A;  1J1E A;  2JTZ A;  3WXA A;  3LCP C;  2LAN A;  2BCB A;  4R1E A;  5I2Q A;  2LC5 A;  2F8P A;  2L98 A;  1Y1U A;  2VRG A;  4MVF A;  1BR1 B;  2M1K B;  1DMO A;  1SCV A;  1FI5 A;  2JQ6 A;  3GOF A;  1NCZ A;  2WCF A;  1CTR A;  1DTL A;  3I5G B;  2BL0 C;  1C07 A;  1CDN A;  1JUO A;  1YUU A;  1BG1 A;  4GBA A;  1A2X A;  1A29 A;  2KSP A;  1NPQ A;  1M63 B;  5JOL A;  4M2P A;  2KI4 B;  1J55 A;  1TNX A;  1SPY A;  4YI9 A;  4PHJ A;  4OVN F;  4NDC A;  3TDI A;  5AEQ A;  3PSR A;  1IQ5 A;  2KGR A;  1YUR A;  3DF0 A;  1UHH A;  1NSH A;  2JXC A;  4PHN A;  2K2A A;  1MR8 A;  1BJF A;  1LA3 A;  1M39 A;  1NX2 A;  2O5G A;  1XFX O;  2KBI A;  1SCM B;  4MEW A;  1QX5 B;  2F33 A;  1SL8 A;  2OTG C;  1H4B A;  4PHM A;  5K89 A;  2PMY A;  1AHR A;  2K7D A;  4MN0 A;  4DRW A;  3D0Y A;  1KSM A;  1OOJ A;  1WDC B;  3BQ3 A;  3VRP A;  2K8M B;  3RLZ A;  1CDP A;  3A4U B;  4NDB A;  1DJY A;  1QS7 A;  1DJH A;  4AOM A;  2HQ8 A;  1SK6 D;  5HKZ A;  1EG4 A;  2ZN8 A;  4MLW A;  2JU0 A;  3PM8 A;  5PAL A;  3C1V A;  2L2E A;  3TDU A;  2FOT A;  3TUY C;  2LVJ A;  4N1F A;  5HKY A;  1XFU O;  1B1G A;  3KHE A;  1YX7 A;  4TNC A;  2KQ6 A;  1YUS A;  3A8R A;  4A4B A;  4MSP A;  1QLS A;  1JF2 A;  1M45 A;  2WOR A;  1B8L A;  4DIR A;  1MWN A;  3CR5 X;  2I7A A;  3O4Y A;  1KFX L;  1ZAC A;  4CPV A;  2WCB A;  2JRF A;  2Y5I A;  2JC2 A;  1XYD A;  2D8N A;  1DGU A;  2JWW A;  3BUX B;  3FS7 A;  2M97 A;  4PE1 A;  3ZWH A;  1EH2 A;  3MSE B;  1L2O C;  1M46 A;  2FJU B;  3I5H B;  3TS5 B;  3I5H C;  3DVJ A;  3TS5 C;  1KQM C;  1JFJ A;  4CFR A;  4QJ4 B;  2KI6 D;  1PSB A;  1YR5 A;  2MJW B;  3I5F B;  3DVM A;  2CT9 A;  1N2D A;  4OKH A;  3SG2 A;  1PUL A;  2ZRT A;  1K8U A;  3BUO B;  1QTX A;  1S26 D;  1RJV A;  1YUT A;  3IF7 A;  2NXQ A;  5TNC A;  5B8I B;  1QAS A;  1ALW A;  1XFY O;  3O2P A;  1PVB A;  1EL4 A;  1KWO C;  1IQ3 A;  5DKQ A;  1TOP A;  4GFT A;  1LIN A;  1S6C A;  3SIB A;  2FCE A;  1K95 A;  4NQG A;  2JT8 A;  1WLM A;  3EKJ A;  1AJ4 A;  1TCF A;  1CM4 A;  2M9G A;  1NX1 A;  4PAL A;  1ZFS A;  2LVI A;  2M3W A;  1TRF A;  3PFV A;  3SG6 A;  1XK4 A;  2WC8 A;  4WQ2 A;  2MAZ A;  3NSK A; 
#chains in the Genus database with same CATH topology
 1V1G A;  2LCP A;  1MQ1 A;  4FTG A;  2NZ0 A;  2K7C A;  4P5O E;  5HLO A;  4M2Q A;  4E68 A;  3UNW A;  2KNE A;  4YGD B;  1Z4H A;  1F4Q A;  1GGW A;  3V2L A;  1CFP A;  3VGO A;  2MA2 A;  1C3Y A;  4JWQ A;  2M7L A;  1YTZ C;  2GTE A;  5I2L A;  1XO5 A;  4GNK B;  5BPJ A;  2K0J A;  2JNF A;  4WRI A;  4YI8 A;  3DF0 B;  1G8I A;  2LUC A;  1V1F A;  2H8V A;  1W7I B;  4OV2 A;  4HSZ A;  4D1E A;  2CTN A;  1QVI Z;  1MHO A;  2KDH A;  3JTD C;  2DOQ A;  3CZ0 A;  2WC6 A;  5I94 A;  2KFF A;  4NDD A;  1SY9 A;  3IVT A;  3EVR A;  2BBM A;  1YRT B;  3BFA A;  1JC2 A;  1AUI B;  2M49 B;  1JBA A;  1TNW A;  3CTN A;  3DVK A;  2GGZ A;  4MZK A;  1RWY A;  3WHT B;  1CM1 A;  1U5I A;  1GQM A;  3D0Y B;  1J7Q A;  2K61 A;  3IQO A;  2PRU A;  2SAS A;  4N5X A;  1OMR A;  3CZ1 A;  4GGF A;  2MLE C;  1A03 A;  1CDL A;  5G08 A;  3SG3 A;  2GV5 A;  3L4A A;  1KK7 Z;  5FYX A;  1CFC A;  3B6X A;  2F3Z A;  2KGB C;  3EK7 A;  4ETO A;  3BOW A;  3I5G C;  1JFK A;  2H61 A;  5D7F A;  1RTP 1;  4DCK A;  1REC A;  2I2R E;  2PYQ A;  1IGV A;  3FWC A;  1BOD A;  2A4J A;  2WCM A;  1ZUZ A;  1DC1 A;  1K9P A;  1K2H A;  1Y6W A;  2KI4 C;  4GUK A;  4PT1 A;  3EVU A;  4I5J A;  1CFF A;  1OOF A;  1JF0 A;  3BUN B;  2Y4Q A;  2NCO A;  5CPV A;  1K9K A;  1K96 A;  3SG7 A;  4PE0 A;  2LMV A;  3WNX B;  2TN4 A;  3CLN A;  2MRD A;  2Y1M A;  1SCM C;  4MRY A;  3TDZ A;  1CLB A;  1Y1A A;  1S36 A;  2CCM A;  4PHK A;  2PAS A;  2WND A;  1S5G Z;  4OR9 B;  2KYC A;  1LVC D;  4OZD A;  4HRG A;  3R1P A;  1WDC C;  3LLE A;  5DKR A;  4ORA B;  1AP4 A;  1SYM A;  2H2K A;  4HRH A;  1CLL A;  2LHL A;  3DD4 A;  1B47 A;  5FI6 A;  1KFU S;  2BCX A;  2AUC A;  2CBL A;  1DEL A;  1SBJ A;  1TIZ A;  3OB1 B;  4YBH B;  2LE9 B;  3VRQ A;  3NXA A;  1CKK A;  1J1D A;  4I5K A;  4JPZ B;  4DS7 A;  1B9A A;  5GQQ C;  3OX5 A;  1BLQ A;  2HET A;  4YGA A;  4ZCV A;  1L7Z A;  4XJK A;  4BY4 A;  1B8R A;  1OMD A;  1OSA A;  1NUB A;  1C7V A;  3OX6 A;  1LA0 A;  2F2P A;  1YVH A;  2EGD A;  3BXK A;  3JVT B;  2RGI A;  3JVT C;  4ORC B;  1F4O A;  1GGZ A;  2IS9 A;  5CSI A;  2JNX A;  3DXL A;  2PVB A;  4JQ0 D;  2L0P A;  5DKN A;  4MZL A;  5AER A;  3VRN A;  1SL7 A;  1MUX A;  4CID A;  3QRX A;  2L4H A;  1QX2 A;  1CB1 A;  4MRX A;  3SS4 A;  1ALV A;  4GPL B;  4ICB A;  1WLZ A;  3I5F C;  3CGA A;  1WRL A;  2K60 A;  1PVA A;  3EK8 A;  3BJH A;  3EVV A;  3K21 A;  1GM0 A;  1FPW A;  3L47 A;  1SNL A;  1A75 A;  3CWG A;  2KBM A;  3KPX A;  1JWD A;  1KCY A;  1G4Y R;  4XYN A;  3HX4 A;  3BUM B;  2K7O A;  2ZN9 A;  2BBN A;  1TN4 A;  1EJ3 A;  4ORB B;  4GGN A;  2ZRS A;  4IL1 A;  1QXP A;  1DJW A;  1PK0 D;  1X02 A;  1QVI Y;  2Q4U A;  1CLM A;  3KF9 A;  1OMV A;  3I5I B;  4WQ3 A;  1U5I B;  3TZ1 A;  2M29 A;  2JPT A;  4ZCU A;  1SR6 B;  3GK2 A;  2AAO A;  2KFG A;  3OP0 A;  3R1V A;  1UUR A;  1QLK A;  3R72 A;  3SG5 A;  2KPH A;  2LMU A;  3S0E A;  3VRO A;  3DY9 A;  2ZND A;  1BF5 A;  4PE7 A;  3O6B A;  3CZT X;  4Q04 A;  2KHN A;  3BOW B;  2E30 A;  2WCK A;  3F45 A;  4M2O A;  5HKW A;  2WCH A;  1KK7 Y;  1IJ6 A;  1WY9 A;  1KFX S;  1TCO B;  1G33 A;  1RK9 A;  2M0R A;  2NCP A;  1TNQ A;  2F3Y A;  1SW8 A;  1PAL A;  2CXJ A;  1BOC A;  2FCD A;  3WHU B;  1OZO A;  3H4S E;  2BE4 A;  3SJS A;  3HCM A;  4N1G A;  1R6P A;  4MBE A;  4USL A;  2G2B A;  1HQV A;  1UHJ A;  4KYN A;  4JKT A;  1XFV O;  2P71 A;  2QAC A;  1NCX A;  1GJY A;  3KO0 A;  1TWO A;  3DVE A;  4PCW A;  1OOI X;  1J7P A;  3D75 A;  3PAT A;  5ER4 X;  1FF1 A;  1S6I A;  1IG5 A;  1W7J B;  1Y1X A;  5HLV A;  2O60 A;  3CR4 X;  3OHM B;  1OE9 B;  1IRJ A;  3Q8I A;  3GK1 A;  2PAL A;  1QX7 A;  2HQW A;  4INX A;  2BKH B;  3S0A A;  1DF0 A;  3PAL A;  4PE4 A;  1B8C A;  5J3X A;  1MF8 B;  1IWQ A;  3VRR A;  2EHB A;  4DUQ A;  2BCA A;  1VRK A;  1NWD A;  4INW A;  3PN7 B;  1KK8 B;  1NIW A;  2I94 A;  4QJ3 B;  5I8N A;  2QEV A;  1DT7 B;  5AXI A;  1AK8 A;  3FIA A;  1UHN A;  2CNP A;  1AJ5 A;  2LP2 A;  2EC6 B;  2JT0 A;  2V53 A;  4CLN A;  1R2U A;  1PRW A;  4C0J A;  1C3Z A;  4GAO A;  2Y1N A;  2LM5 A;  4XJK B;  3O4X A;  1QV0 A;  2JTT A;  2JXL A;  1ZOT B;  5KSZ A;  1J7O A;  3OGN A;  4A4C A;  3NHT A;  5CSJ A;  2MHH A;  2OS8 B;  2Q91 A;  5JJG A;  1FBV A;  2COL B;  2OS8 C;  2BEC A;  2R2I A;  2QEB A;  2BL0 B;  3LL8 B;  4C0K A;  3ICB A;  3AKB A;  1TNP A;  1RRO A;  2WCJ A;  4AQI A;  1ZMZ A;  1LKJ A;  1YVL A;  1FW4 A;  4MZJ A;  1F71 A;  2BE6 A;  1A75 B;  5KTY A;  1F54 A;  1B7T Z;  3BUW B;  4AQJ A;  2MLF C;  1DJI A;  2M7N A;  3SS5 A;  3B86 A;  2KAV A;  1NCY A;  2WC5 A;  2ZNE A;  2L5X B;  1CDM A;  3LK1 A;  2OTG B;  3E3R A;  1IKU A;  2MBX A;  3AAK A;  2PSR A;  1CMG A;  4I5L B;  3CR2 A;  2NLN A;  1BR4 B;  4F7F A;  1F55 A;  1UHK A;  3AAJ A;  1SRA A;  2OPO A;  3BYA A;  3D74 A;  1K94 A;  2F2O A;  5D3O A;  1MXL C;  3B7A A;  3PLF B;  3ZNI A;  1KQV A;  1EG3 A;  2WCL A;  4YGC B;  2LLT A;  1RFJ A;  1IJ5 A;  3S0B A;  2LVK A;  3OB2 B;  1NP8 A;  3SS3 A;  4BY5 A;  2JT3 A;  1KSO A;  1XK4 C;  2L2C A;  1EXR A;  4YGE B;  4F0Z B;  3FE6 A;  3TUY B;  3SIA A;  5AAN A;  1XFZ O;  4IJ7 A;  5ER5 A;  1FI6 A;  1OQP A;  2LMT A;  2HPS A;  5AFP A;  5HYD A;  5CSF A;  1TTX A;  1XFR A;  1A4P A;  2P70 A;  1QAT A;  1QJT A;  2JZI A;  3NGV A;  1AVS A;  1ORG A;  4L9M A;  1DVI A;  2KAX A;  4CFQ A;  3IQQ A;  1XVJ A;  2BKI B;  2K2F A;  2LAP A;  2ZFD A;  1DJX A;  2B1U A;  1IIO A;  2JOJ A;  4UPG A;  2QEO A;  1L2O B;  1SMG A;  1D1O A;  1M31 A;  2L4I A;  2I18 A;  1BU3 A;  1KQM B;  3AKA A;  1S1E A;  1BMO A;  2G9B A;  3I5I C;  2LLU A;  1NYA A;  2LNK A;  2LUX A;  2HF5 A;  4I5N B;  2LVV A;  1NX0 A;  1CFD A;  1S6J A;  1DF0 B;  1SR6 C;  2LV7 A;  4HRE E;  1B4C A;  4GGF C;  1OZS A;  2GGM A;  5HL1 A;  1K90 D;  1UWO A;  3RM1 A;  1H8B A;  1N65 A;  1PSR A;  3DZT A;  1XA5 A;  2L50 A;  2KFH A;  2LHI A;  3BFB A;  3CDN A;  4YRU A;  3NSI A;  2H61 C;  3D76 A;  1C7W A;  1SSE B;  4QJ5 B;  1KWO B;  1CMF A;  4P2Y B;  5IBW A;  1IH0 A;  1JSA A;  3CS1 A;  2KOT A;  1F8H A;  1WRZ A;  1K93 D;  2L51 A;  2LLS A;  2KLD A;  5EL2 A;  3FWB A;  3S0F A;  1DGV A;  3NSO A;  3O78 A;  2K7B A;  2KYF A;  1HT9 A;  1MXE A;  5KU1 A;  3CAB A;  1LXF C;  1UUS A;  4YGB B;  1OOH A;  2M8U A;  3B88 A;  1WRK A;  2BNX A;  4FQO A;  2ISD A;  1XFW O;  3VB1 A;  3RZS A;  2SCP A;  3LK0 A;  3D10 A;  3S0D A;  3NSL A;  3SG4 A;  2KAY A;  1S5G Y;  1UHI A;  2KLE A;  3UO9 A;  4JD9 A;  3M0W A;  4C0L A;  1TUJ A;  5D69 A;  3KEV A;  1F70 A;  1YX8 A;  1S3P A;  3FE8 A;  4U8D A;  3N7H A;  1ODB A;  2E6W A;  2QPT A;  5F6T A;  5FI2 A;  1YRU B;  3EKH A;  2M1U A;  1UP5 A;  2JUL A;  2P6B B;  1B7T Y;  1E8A A;  3PN7 C;  1KK8 C;  2WCE A;  2KQY A;  3JTD B;  1CNP A;  1DJG A;  3PJI A;  1J7R A;  2ZKM X;  4PDZ A;  1N0Y A;  1QIW A;  1QIV A;  5CSN A;  3EK4 A;  1KFU L;  1Q80 A;  2EC6 C;  2KI6 C;  3GK4 X;  3NHI A;  4OCI A;  5I2O A;  1DJZ A;  2AMI A;  1NX3 A;  2LP3 A;  1K9U A;  2WOS A;  1SL9 A;  1SKT A;  1QV1 A;  1Y0V H;  1BT6 A;  1LS8 A;  1J1E A;  2JTZ A;  3WXA A;  3LCP C;  2LAN A;  2BCB A;  1P28 A;  4R1E A;  5I2Q A;  3R1O A;  2LC5 A;  2F8P A;  2L98 A;  3PM2 A;  1Y1U A;  2VRG A;  4MVF A;  1BR1 B;  2M1K B;  1DMO A;  1SCV A;  1FI5 A;  2JQ6 A;  3GOF A;  1NCZ A;  2WCF A;  1CTR A;  1DTL A;  3I5G B;  2BL0 C;  1C07 A;  1CDN A;  1JUO A;  1YUU A;  5FI7 A;  4GBA A;  1BG1 A;  1A2X A;  1A29 A;  2KSP A;  1NPQ A;  1W9Z A;  1M63 B;  5JOL A;  4M2P A;  2KI4 B;  1J55 A;  2YGU A;  1TNX A;  1SPY A;  3D78 A;  4PHJ A;  4OVN F;  4YI9 A;  4NDC A;  3TDI A;  3BFH A;  3D73 A;  3PSR A;  5AEQ A;  1IQ5 A;  2KGR A;  1YUR A;  3DF0 A;  1QWV A;  1NSH A;  1UHH A;  2JXC A;  4PHN A;  2K2A A;  1MR8 A;  1BJF A;  1LA3 A;  1M39 A;  1NX2 A;  1TUZ A;  2O5G A;  1XFX O;  2PQL A;  2KBI A;  1SCM B;  4MEW A;  1QX5 B;  2F33 A;  1SL8 A;  1DQE A;  2OTG C;  4PHM A;  1H4B A;  3K1E A;  5K89 A;  1Z2C B;  2PMY A;  1AHR A;  2K7D A;  2FJY A;  3L4L A;  4MN0 A;  4DRW A;  1DEK A;  3D0Y A;  1KSM A;  1OOJ A;  1WDC B;  3BQ3 A;  3VRP A;  2K8M B;  3RLZ A;  1CDP A;  3A4U B;  3DYE A;  4NDB A;  1DJY A;  1QS7 A;  1DJH A;  4AOM A;  2HQ8 A;  1SK6 D;  2BAP A;  1EG4 A;  2QEH A;  5HKZ A;  2ZN8 A;  4MLW A;  2JU0 A;  3PM8 A;  5PAL A;  5DIC A;  3C1V A;  2L2E A;  3TDU A;  2FOT A;  3TUY C;  2LVJ A;  4N1F A;  5HKY A;  1XFU O;  1B1G A;  3KHE A;  1YX7 A;  4TNC A;  2KQ6 A;  1YUS A;  3A8R A;  1OW4 A;  4A4B A;  4MSP A;  1QLS A;  1JF2 A;  1M45 A;  2WOR A;  1B8L A;  4DIR A;  1MWN A;  3CR5 X;  2I7A A;  1OOG A;  3O4Y A;  1KFX L;  1ZAC A;  4CPV A;  3QME A;  3D77 A;  2WCB A;  2JRF A;  3EG5 B;  3B87 A;  2Y5I A;  2ERB A;  2JC2 A;  1XYD A;  2D8N A;  1DGU A;  2JWW A;  3BUX B;  3FS7 A;  2M97 A;  4PE1 A;  3ZWH A;  1EH2 A;  3MSE B;  1L2O C;  1M46 A;  2FJU B;  3I5H B;  3TS5 B;  3I5H C;  3DVJ A;  3FE9 A;  1KQM C;  3TS5 C;  1JFJ A;  4CFR A;  4QJ4 B;  2KI6 D;  1PSB A;  1YR5 A;  2MJW B;  3I5F B;  3DVM A;  2CT9 A;  1N2D A;  4OKH A;  3CYZ A;  3SG2 A;  1PUL A;  2ZRT A;  1K8U A;  3BUO B;  1QTX A;  1S26 D;  1RJV A;  1YUT A;  3IF7 A;  2NXQ A;  5TNC A;  5B8I B;  1QAS A;  1ALW A;  1XFY O;  3OBV A;  3O2P A;  1PVB A;  1EL4 A;  1KWO C;  1IQ3 A;  5DKQ A;  1TOP A;  4GFT A;  1T14 A;  2L5Y A;  1LIN A;  1S6C A;  2QDI A;  2FCE A;  3SIB A;  1K95 A;  4NQG A;  2JPO A;  2JT8 A;  1WLM A;  3EKJ A;  4FQT A;  1AJ4 A;  1TCF A;  1CM4 A;  2M9G A;  1NX1 A;  4PAL A;  3S0G A;  1ZFS A;  2LVI A;  2M3W A;  1TRF A;  3PFV A;  3SG6 A;  1XK4 A;  2WC8 A;  4WQ2 A;  2MAZ A;  3CZ2 A;  3NSK A; 
#chains in the Genus database with same CATH homology
 1V1G A;  2LCP A;  1MQ1 A;  4FTG A;  2NZ0 A;  2K7C A;  4P5O E;  5HLO A;  4M2Q A;  4E68 A;  2KNE A;  4YGD B;  1F4Q A;  1GGW A;  1CFP A;  3VGO A;  2MA2 A;  4JWQ A;  2M7L A;  1YTZ C;  5I2L A;  1AK8 A;  1XO5 A;  4GNK B;  5BPJ A;  2K0J A;  2JNF A;  4WRI A;  4YI8 A;  3DF0 B;  1G8I A;  2LUC A;  1V1F A;  1W7I B;  4OV2 A;  4HSZ A;  4D1E A;  2CTN A;  1QVI Z;  1MHO A;  2KDH A;  3JTD C;  2DOQ A;  2KFF A;  4NDD A;  1SY9 A;  3EVR A;  2BBM A;  1YRT B;  1JC2 A;  1AUI B;  2M49 B;  1JBA A;  1TNW A;  3CTN A;  3DVK A;  2GGZ A;  4MZK A;  1RWY A;  3WHT B;  1CM1 A;  1U5I A;  1GQM A;  3D0Y B;  1J7Q A;  2K61 A;  3IQO A;  2PRU A;  2SAS A;  4N5X A;  1OMR A;  4GGF A;  2MLE C;  1A03 A;  1CDL A;  5G08 A;  3SG3 A;  2GV5 A;  1KK7 Z;  5FYX A;  1CFC A;  4ETO A;  2F3Z A;  2KGB C;  3EK7 A;  3BOW A;  3I5G C;  1JFK A;  2H61 A;  5D7F A;  1RTP 1;  4DCK A;  1REC A;  2I2R E;  1IGV A;  3FWC A;  1BOD A;  2A4J A;  1ZUZ A;  1K9P A;  1K2H A;  1Y6W A;  2KI4 C;  4GUK A;  3EVU A;  4I5J A;  1CFF A;  1JF0 A;  3BUN B;  2Y4Q A;  2NCO A;  5CPV A;  1K9K A;  1K96 A;  3SG7 A;  4PE0 A;  2LMV A;  3WNX B;  2TN4 A;  3CLN A;  2MRD A;  2Y1M A;  1SCM C;  4MRY A;  3TDZ A;  1CLB A;  1Y1A A;  1S36 A;  2CCM A;  4PHK A;  2PAS A;  2WND A;  1S5G Z;  4OR9 B;  2KYC A;  1LVC D;  4HRG A;  1WDC C;  3LLE A;  5DKR A;  4ORA B;  1AP4 A;  1SYM A;  2H2K A;  4HRH A;  1CLL A;  2LHL A;  3DD4 A;  1B47 A;  1KFU S;  2BCX A;  2AUC A;  2CBL A;  1SBJ A;  1TIZ A;  3OB1 B;  4YBH B;  2LE9 B;  3VRQ A;  3NXA A;  1CKK A;  1J1D A;  4I5K A;  4JPZ B;  4DS7 A;  1B9A A;  5GQQ C;  3OX5 A;  1BLQ A;  2HET A;  4YGA A;  4ZCV A;  1L7Z A;  4XJK A;  4BY4 A;  1B8R A;  1OMD A;  1OSA A;  1NUB A;  1C7V A;  3OX6 A;  1LA0 A;  2F2P A;  1YVH A;  2EGD A;  3BXK A;  3JVT B;  2RGI A;  3JVT C;  4ORC B;  1F4O A;  1GGZ A;  2IS9 A;  5CSI A;  2JNX A;  4JQ0 D;  2PVB A;  5DKN A;  2L0P A;  4MZL A;  3VRN A;  1SL7 A;  1MUX A;  4CID A;  3QRX A;  2L4H A;  1QX2 A;  1CB1 A;  4MRX A;  4C0K A;  1ALV A;  4GPL B;  4ICB A;  1WLZ A;  3I5F C;  3CGA A;  1WRL A;  3EK8 A;  1PVA A;  3EVV A;  3K21 A;  1FPW A;  1SNL A;  1A75 A;  3CWG A;  2KBM A;  3KPX A;  1JWD A;  1KCY A;  1G4Y R;  4XYN A;  3HX4 A;  3BUM B;  2K7O A;  2ZN9 A;  2BBN A;  1TN4 A;  1EJ3 A;  4ORB B;  4GGN A;  2ZRS A;  4IL1 A;  1QXP A;  1DJW A;  1PK0 D;  1X02 A;  1QVI Y;  2Q4U A;  1CLM A;  3KF9 A;  1OMV A;  3I5I B;  4WQ3 A;  1U5I B;  3TZ1 A;  2M29 A;  2JPT A;  4ZCU A;  1SR6 B;  3GK2 A;  2AAO A;  2KFG A;  3OP0 A;  5AER A;  1UUR A;  1QLK A;  3SG5 A;  2LMU A;  3VRO A;  2ZND A;  1BF5 A;  4PE7 A;  3O6B A;  3CZT X;  4Q04 A;  2KHN A;  3BOW B;  2E30 A;  3F45 A;  4M2O A;  5HKW A;  1KK7 Y;  1IJ6 A;  1WY9 A;  1KFX S;  1TCO B;  1G33 A;  1RK9 A;  2M0R A;  2NCP A;  1TNQ A;  2F3Y A;  1SW8 A;  1PAL A;  2CXJ A;  1BOC A;  2FCD A;  3WHU B;  1OZO A;  3H4S E;  2BE4 A;  3SJS A;  3HCM A;  4N1G A;  1R6P A;  4MBE A;  4USL A;  2G2B A;  1HQV A;  1UHJ A;  1XFV O;  2QAC A;  1NCX A;  1GJY A;  3KO0 A;  3DVE A;  4PCW A;  1J7P A;  3PAT A;  5ER4 X;  1FF1 A;  1S6I A;  1IG5 A;  1W7J B;  1Y1X A;  5HLV A;  2O60 A;  3CR4 X;  3OHM B;  1OE9 B;  1IRJ A;  3GK1 A;  2PAL A;  1QX7 A;  2HQW A;  2BKH B;  1DF0 A;  3PAL A;  4PE4 A;  1B8C A;  5J3X A;  1MF8 B;  1IWQ A;  3VRR A;  2EHB A;  4DUQ A;  2BCA A;  1VRK A;  1NWD A;  4QJ3 B;  3PN7 B;  1KK8 B;  1NIW A;  2I94 A;  5I8N A;  1DT7 B;  5AXI A;  3FIA A;  1UHN A;  2CNP A;  1AJ5 A;  2LP2 A;  2EC6 B;  2JT0 A;  2V53 A;  4CLN A;  1R2U A;  1PRW A;  4C0J A;  4GAO A;  2Y1N A;  2LM5 A;  4XJK B;  1J7O A;  1QV0 A;  2JTT A;  2JXL A;  1ZOT B;  5KSZ A;  4A4C A;  5CSJ A;  2MHH A;  2OS8 B;  2Q91 A;  5JJG A;  1FBV A;  2COL B;  2OS8 C;  2BEC A;  2R2I A;  2BL0 B;  3LL8 B;  3ICB A;  3AKB A;  1TNP A;  1RRO A;  4AQI A;  1ZMZ A;  1LKJ A;  1YVL A;  1FW4 A;  4MZJ A;  1F71 A;  2BE6 A;  1A75 B;  5KTY A;  1F54 A;  1B7T Z;  3BUW B;  4AQJ A;  2MLF C;  1DJI A;  2M7N A;  2KAV A;  1NCY A;  2ZNE A;  2L5X B;  1CDM A;  3LK1 A;  2OTG B;  3E3R A;  1IKU A;  2MBX A;  3AAK A;  2PSR A;  1CMG A;  4I5L B;  3CR2 A;  2NLN A;  1BR4 B;  1F55 A;  1UHK A;  3AAJ A;  1SRA A;  2OPO A;  3BYA A;  1K94 A;  2F2O A;  1MXL C;  3PLF B;  3ZNI A;  1KQV A;  1EG3 A;  4YGC B;  2LLT A;  1RFJ A;  1IJ5 A;  2LVK A;  3OB2 B;  1NP8 A;  4BY5 A;  2JT3 A;  1KSO A;  1XK4 C;  1EXR A;  4YGE B;  4F0Z B;  3TUY B;  3SIA A;  5AAN A;  1XFZ O;  5ER5 A;  1FI6 A;  1OQP A;  2LMT A;  2HPS A;  5AFP A;  5HYD A;  5CSF A;  1TTX A;  1A4P A;  1QAT A;  1QJT A;  2JZI A;  1AVS A;  4L9M A;  1DVI A;  2KAX A;  4CFQ A;  3IQQ A;  1XVJ A;  2BKI B;  2K2F A;  2LAP A;  2ZFD A;  1DJX A;  2B1U A;  2JOJ A;  4UPG A;  1L2O B;  1SMG A;  1D1O A;  1M31 A;  2L4I A;  2I18 A;  1BU3 A;  1KQM B;  3AKA A;  1S1E A;  1BMO A;  2G9B A;  3I5I C;  2LLU A;  1NYA A;  2LNK A;  2LUX A;  2HF5 A;  4I5N B;  2LVV A;  1NX0 A;  1CFD A;  1S6J A;  1DF0 B;  1SR6 C;  2LV7 A;  4HRE E;  1B4C A;  4GGF C;  1OZS A;  2GGM A;  1K90 D;  1UWO A;  3RM1 A;  1H8B A;  1N65 A;  1PSR A;  1XA5 A;  2L50 A;  2KFH A;  2LHI A;  4YRU A;  3NSI A;  2H61 C;  1C7W A;  4QJ5 B;  1KWO B;  1CMF A;  4P2Y B;  5IBW A;  1IH0 A;  1JSA A;  3CS1 A;  2KOT A;  1F8H A;  1WRZ A;  1K93 D;  2L51 A;  2LLS A;  3FWB A;  1DGV A;  3NSO A;  3O78 A;  2K7B A;  2KYF A;  1HT9 A;  1MXE A;  5KU1 A;  1LXF C;  1UUS A;  4YGB B;  2M8U A;  1WRK A;  4FQO A;  2ISD A;  1XFW O;  2SCP A;  3LK0 A;  3D10 A;  3SG4 A;  3NSL A;  2KAY A;  1S5G Y;  1UHI A;  3M0W A;  4C0L A;  5D69 A;  3KEV A;  1F70 A;  1YX8 A;  1S3P A;  4U8D A;  1ODB A;  2E6W A;  2QPT A;  5F6T A;  1YRU B;  3EKH A;  2M1U A;  1UP5 A;  2JUL A;  2P6B B;  1B7T Y;  1E8A A;  3PN7 C;  1KK8 C;  2WCE A;  2KQY A;  3JTD B;  1CNP A;  1DJG A;  1J7R A;  2ZKM X;  4PDZ A;  1N0Y A;  1QIW A;  1QIV A;  5CSN A;  3EK4 A;  1KFU L;  1Q80 A;  2EC6 C;  2KI6 C;  3GK4 X;  4OCI A;  5I2O A;  1DJZ A;  2AMI A;  1NX3 A;  2LP3 A;  1K9U A;  2WOS A;  1SL9 A;  1SKT A;  1QV1 A;  1Y0V H;  1BT6 A;  1J1E A;  2JTZ A;  3WXA A;  3LCP C;  2LAN A;  2BCB A;  4R1E A;  5I2Q A;  2LC5 A;  2F8P A;  2L98 A;  1Y1U A;  2VRG A;  4MVF A;  1BR1 B;  2M1K B;  1DMO A;  1SCV A;  1FI5 A;  2JQ6 A;  3GOF A;  1NCZ A;  2WCF A;  1CTR A;  1DTL A;  3I5G B;  2BL0 C;  1C07 A;  1CDN A;  1JUO A;  1YUU A;  1BG1 A;  4GBA A;  1A2X A;  1A29 A;  2KSP A;  1NPQ A;  1M63 B;  5JOL A;  4M2P A;  2KI4 B;  1J55 A;  1TNX A;  1SPY A;  4YI9 A;  4PHJ A;  4OVN F;  4NDC A;  3TDI A;  5AEQ A;  3PSR A;  1IQ5 A;  2KGR A;  1YUR A;  3DF0 A;  1UHH A;  1NSH A;  2JXC A;  4PHN A;  2K2A A;  1MR8 A;  1BJF A;  1LA3 A;  1M39 A;  1NX2 A;  2O5G A;  1XFX O;  2KBI A;  1SCM B;  4MEW A;  1QX5 B;  2F33 A;  1SL8 A;  2OTG C;  1H4B A;  4PHM A;  5K89 A;  2PMY A;  1AHR A;  2K7D A;  4MN0 A;  4DRW A;  3D0Y A;  1KSM A;  1OOJ A;  1WDC B;  3BQ3 A;  3VRP A;  2K8M B;  3RLZ A;  1CDP A;  3A4U B;  4NDB A;  1DJY A;  1QS7 A;  1DJH A;  4AOM A;  2HQ8 A;  1SK6 D;  5HKZ A;  1EG4 A;  2ZN8 A;  4MLW A;  2JU0 A;  3PM8 A;  5PAL A;  3C1V A;  2L2E A;  3TDU A;  2FOT A;  3TUY C;  2LVJ A;  4N1F A;  5HKY A;  1XFU O;  1B1G A;  3KHE A;  1YX7 A;  4TNC A;  2KQ6 A;  1YUS A;  3A8R A;  4A4B A;  4MSP A;  1QLS A;  1JF2 A;  1M45 A;  2WOR A;  1B8L A;  4DIR A;  1MWN A;  3CR5 X;  2I7A A;  3O4Y A;  1KFX L;  1ZAC A;  4CPV A;  2WCB A;  2JRF A;  2Y5I A;  2JC2 A;  1XYD A;  2D8N A;  1DGU A;  2JWW A;  3BUX B;  3FS7 A;  2M97 A;  4PE1 A;  3ZWH A;  1EH2 A;  3MSE B;  1L2O C;  1M46 A;  2FJU B;  3I5H B;  3TS5 B;  3I5H C;  3DVJ A;  3TS5 C;  1KQM C;  1JFJ A;  4CFR A;  4QJ4 B;  2KI6 D;  1PSB A;  1YR5 A;  2MJW B;  3I5F B;  3DVM A;  2CT9 A;  1N2D A;  4OKH A;  3SG2 A;  1PUL A;  2ZRT A;  1K8U A;  3BUO B;  1QTX A;  1S26 D;  1RJV A;  1YUT A;  3IF7 A;  2NXQ A;  5TNC A;  5B8I B;  1QAS A;  1ALW A;  1XFY O;  3O2P A;  1PVB A;  1EL4 A;  1KWO C;  1IQ3 A;  5DKQ A;  1TOP A;  4GFT A;  1LIN A;  1S6C A;  3SIB A;  2FCE A;  1K95 A;  4NQG A;  2JT8 A;  1WLM A;  3EKJ A;  1AJ4 A;  1TCF A;  1CM4 A;  2M9G A;  1NX1 A;  4PAL A;  1ZFS A;  2LVI A;  2M3W A;  1TRF A;  3PFV A;  3SG6 A;  1XK4 A;  2WC8 A;  4WQ2 A;  2MAZ A;  3NSK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...