2KFHA

Structure of the c-terminal domain of ehd1 with fnyestgpftak
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
105
structure length
105
Chain Sequence
GPLGSDDVEWVVGKDKPTYDEIFYTLSPVNGKITGANAKKEMVKSKLPNTVLGKIWKLADVDKDGLLDDEEFALANHLIKVKLEGHELPADLPPHLVPPSKRRHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords EH domain-containing protein 1
publication title Structural insight into the interaction of proteins containing NPF, DPF, and GPF motifs with the C-terminal EH-domain of EHD1.
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2009-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12763 EF-hand_4 Cytoskeletal-regulatory complex EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2kfhA00
1S5GY 3DVKA 3I5HC 2KOTA 2BKHB 2CTNA 1B7TY 4XJKA 4N1FA 1CFPA 5D69A 4YBHB 1DJZA 2NZ0A 2BBMA 2MLFC 3DVMA 4D1EA 1JF2A 4MZKA 1XFZO 3NSKA 3LL8B 2H61C 2MHHA 1BJFA 4PE7A 1CNPA 2AUCA 3IQQA 5CSJA 2ZNDA 2KYFA 1ZFSA 1B8CA 1KFXS 2LAPA 4A4CA 2LMVA 4NQGA 2EC6C 1SL7A 1TRFA 3PATA 1M45A 3GK2A 2JPTA 1ZUZA 1EH2A 3DVEA 4CFQA 2WOSA 3FWBA 4GGNA 3EK4A 2Y5IA 1CFDA 1BMOA 5TNCA 5I2LA 4YRUA 1M39A 1CLLA 3EVRA 5F6TA 4JPZB 2COLB 3CR2A 1HT9A 4YI9A 2ZN8A 1FBVA 1EG4A 2B1UA 4FQOA 4DIRA 1GGWA 1G33A 1YUTA 5I8NA 1NX0A 3PM8A 5KSZA 1EL4A 2LMUA 2L0PA 2LM5A 3KF9A 3PN7B 4MN0A 2KI4C 2JC2A 3PALA 2ZKMX 1B47A 1UHIA 4MVFA 2I2RE 1KSMA 1V1GA 3WXAA 1EXRA 1ZOTB 2HF5A 1W7JB 1F55A 2OS8B 2JTTA 2K7OA 2Y4QA 1NCXA 1FPWA 1XO5A 1N0YA 1B8RA 2L2EA 5HKYA 1F8HA 3D0YB 2K2AA 1WLMA 1DVIA 1YRUB 2LVIA 1A75B 1K9UA 2I18A 1CTRA 1HQVA 1QVIZ 1A03A 4HRGA 4M2QA 1L2OB 1F4QA 4ICBA 1OQPA 3A4UB 1UURA 3CTNA 1B9AA 1YVHA 3FS7A 3OB2B 3TDZA 3JVTC 4I5JA 4JQ0D 3WHTB 1F71A 1K94A 2WNDA 1TCFA 3O4YA 4XYNA 1XFXO 4C0LA 1KK7Y 2ZN9A 1UWOA 1MR8A 2OTGC 1J7PA 1SR6B 1XFWO 1RROA 2KQYA 1U5IA 1BR1B 2I94A 4GPLB 4YGAA 1QX7A 1SYMA 1WDCB 2LLTA 1UHJA 1TNPA 3LCPC 4JWQA 3EKHA 4YGDB 1FI6A 2MJWB 4YGCB 1QLKA 1KQMC 1KQVA 3NXAA 1CKKA 3JTDC 1XK4C 2ZFDA 4XJKB 1RK9A 2GV5A 1EJ3A 4WQ3A 2KGRA 2LHIA 3KEVA 3ICBA 2SCPA 3EVVA 4GAOA 1J7RA 2LLSA 2BCAA 3CS1A 2HQ8A 1SCVA 2P6BB 3GOFA 4YI8A 2Y1NA 2L98A 2QACA 2MLEC 1JSAA 3LK1A 1SRAA 2LHLA 2GGMA 1SCMC 4PDZA 1KK8B 2JT3A 1TCOB 3BUXB 2K2FA 3I5IC 1YUUA 1F54A 1DGVA 2R2IA 3WNXB 4PHNA 2LP3A 3VRNA 1IGVA 4MZJA 4N5XA 1SMGA 2KHNA 4PHJA 3SG3A 2KFFA 1AP4A 1CMGA 3VROA 1WRKA 5D7FA 5G08A 2CXJA 3DD4A 1B8LA 3NSLA 1IJ5A 1JFKA 4C0JA 1K9KA 1QLSA 1ALWA 1FW4A 1XA5A 1K96A 3BOWA 1SNLA 3GK4X 5DKQA 1UUSA 2F3YA 3VGOA 1DTLA 1G8IA 1S6JA 1DJYA 4MRYA 1OMDA 1GGZA 3CGAA 1SK6D 5DKNA 2WC8A 2IS9A 2JT0A 4HRHA 2Q4UA 1UHKA 4MBEA 2WORA 1VRKA 3NSIA 1SPYA 1NWDA 1QIVA 2ISDA 4GGFC 1RECA 3TUYC 4ZCVA 2DOQA 3CWGA 2BCXA 4F0ZB 2HPSA 4AQJA 5PALA 2JRFA 2WCFA 1NCZA 2M0RA 4BY5A 5I2OA 4CPVA 1Y1UA 2SASA 3D10A 2EC6B 1M31A 1J55A 1OZOA 1YUSA 5ER4X 3BYAA 4CLNA 2E6WA 1TNXA 3EK7A 2M97A 5K89A 1DGUA 1U5IB 3RLZA 1FI5A 1TTXA 4GFTA 4P5OE 1N65A 1B1GA 2LV7A 1K2HA 2JULA 1Q80A 2LC5A 2D8NA 2KBIA 2PRUA 2M9GA 1NPQA 1ALVA 3VRPA 1J1DA 1M63B 2BBNA 4I5LB 5AXIA 2JNFA 1OOJA 2F33A 1CDLA 2NCOA 1SL9A 2WCBA 4A4BA 3FIAA 1NX3A 4CIDA 1PSRA 1K9PA 2AMIA 2PVBA 2LP2A 3H4SE 1BODA 1S1EA 2BE6A 1PRWA 4E68A 4I5NB 1QVIY 1BG1A 2FJUB 1AK8A 3ZWHA 4OV2A 1TIZA 3EK8A 4ORCB 2H61A 3RM1A 1IQ5A 2NXQA 2KAYA 4MSPA 4PE0A 5KU1A 1CFFA 1LA0A 3NSOA 4UPGA 3O2PA 1OMVA 2FCDA 4PHKA 1LA3A 3PSRA 4YGEB 2M7NA 1QS7A 2A4JA 3SIAA 1KWOC 2JT8A 1NIWA 4ETOA 1DMOA 3JVTB 4MRXA 1X02A 1M46A 1LXFC 4NDDA 1W7IB 1WLZA 1WY9A 1L7ZA 2KGBC 1IWQA 3BUMB 1B4CA 1Y1XA 2F3ZA 3BOWB 4IL1A 5CSFA 2M8UA 2OTGB 1KFXL 2ZNEA 1WDCC 4PHMA 1DJGA 1IQ3A 1XVJA 3SG6A 1WRZA 3TS5C 2L50A 2PMYA 1GQMA 3C1VA 3CR5X 3CR4X 1SL8A 3HX4A 4HREE 1C7VA 4FTGA 1K90D 1IKUA 1KQMB 3JTDB 3CLNA 3LLEA 3SG7A 1G4YR 1XYDA 1ZMZA 2BE4A 1XFVO 3A8RA 2LVKA 1RFJA 4OCIA 2BL0B 2RGIA 1KCYA 1BF5A 3KPXA 5B8IB 1CFCA 1KFUS 3OP0A 2LUCA 2M7LA 4ORBB 1LKJA 2KDHA 1JF0A 2FCEA 5HLVA 2Y1MA 4M2OA 1YX7A 3I5GB 1SCMB 2BKIB 1SY9A 3ZNIA 2L4IA 1PVAA 2G2BA 3VRQA 1DJHA 1C7WA 2JOJA 1DF0A 2LVJA 4M2PA 1N2DA 1RTP1 2I7AA 1QX2A 5JOLA 1Y0VH 4AOMA 3O6BA 3VRRA 1JC2A 1YURA 1WRLA 1SBJA 2M1KB 3AKAA 5CPVA 1CLMA 1D1OA 2GGZA 2EHBA 3BUNB 2TN4A 1J1EA 1QXPA 5ER5A 3KO0A 2M1UA 5J3XA 3I5FC 2KAXA 2E30A 4ORAB 3BQ3A 1MHOA 1NYAA 3LK0A 1J7QA 4WRIA 2JWWA 2FOTA 2KQ6A 1CMFA 1OSAA 3WHUB 1PALA 3SJSA 1XK4A 3I5HB 2QPTA 1IH0A 3BXKA 4DRWA 2K7BA 1SW8A 1V1FA 4QJ3B 2KSPA 3EVUA 1MF8B 4HSZA 1AJ5A 2L4HA 1NCYA 3K21A 3BUOB 1JBAA 1H8BA 2BCBA 2PALA 1S5GZ 4NDCA 4U8DA 1YTZC 1BR4B 4DUQA 1NX1A 1B7TZ 1Y6WA 2LLUA 1QATA 4TNCA 5BPJA 1QV0A 2JQ6A 2M3WA 5AERA 4OR9B 3TUYB 1EG3A 1IG5A 4MZLA 1S6CA 1AUIB 2K8MB 1RJVA 1F70A 5FYXA 2LNKA 2H2KA 1K95A 2JZIA 2LCPA 1IJ6A 3OX6A 1C07A 2KI6C 4MEWA 1UP5A 1DJIA 3KHEA 1QX5B 2KFHA 1S36A 4L9MA 1K93D 1DT7B 1CLBA 5IBWA 1NP8A 2KFGA 1XFYO 2KNEA 1LINA 4OKHA 4N1GA 1YX8A 3TDIA 2M49B 4PCWA 2WCEA 3PN7C 2K61A 1TNWA 1RWYA 2HQWA 1R6PA 1MUXA 4USLA 2KI4B 4GBAA 3HCMA 1AJ4A 1TOPA 2CNPA 1KFUL 3MSEB 4QJ4B 2OS8C 3OB1B 3PLFB 4GUKA 1CM1A 3IQOA 5CSNA 3DF0A 2PASA 3E3RA 1R2UA 4YGBB 1OZSA 5HKZA 1E8AA 4Q04A 4BY4A 4OVNF 1UHNA 1IRJA 1LVCD 1A2XA 2OPOA 5HYDA 2CBLA 3F45A 1GJYA 1S6IA 4ZCUA 4GGFA 1L2OC 1ZACA 1QTXA 1MXLC 1MXEA 1BT6A 2G9BA 3DVJA 2VRGA 1MWNA 3PFVA 3TZ1A 2KYCA 2JNXA 2JXCA 1UHHA 2MA2A 1DF0B 1CDPA 1DJWA 1YVLA 2BECA 1KSOA 2MAZA 1S3PA 1QASA 1SR6C 4MLWA 2JTZA 1JWDA 2K0JA 2M29A 2LUXA 1K8UA 1CM4A 4PE4A 4AQIA 1KWOB 2Q91A 2F2OA 2ZRSA 2KAVA 3OHMB 2NCPA 2K7CA 3M0WA 3FWCA 1BLQA 2LE9B 3AAKA 3SG5A 4WQ2A 5AEQA 4P2YB 1KK7Z 2O5GA 4QJ5B 1Y1AA 2LANA 3SG2A 1BU3A 1QIWA 3EKJA 3TDUA 3TS5B 2AAOA 3GK1A 1XFUO 5HLOA 2MRDA 5AANA 1PSBA 1CDMA 3SIBA 4CFRA 2ZRTA 1TN4A 2F8PA 1NX2A 3OX5A 4GNKB 1A29A 2CT9A 1CB1A 1S26D 3BUWB 5DKRA 4I5KA 4R1EA 1CDNA 1J7OA 1KK8C 3CZTX 1AVSA 4PE1A 2BL0C 2L51A 2O60A 1YR5A 1SKTA 1NSHA 3D0YA 1NUBA 3I5IB 2MBXA 5KTYA 3SG4A 1MQ1A 5AFPA 1BOCA 2LVVA 1A75A 1H4BA 1QJTA 3I5GC 3AKBA 3O78A 5CSIA 2KI6D 1OMRA 1JUOA 1YRTB 4C0KA 1QV1A 3QRXA 4DS7A 2L5XB 2HETA 2CCMA 1AHRA 5GQQC 2KBMA 1FF1A 4PALA 5HKWA 1TNQA 1A4PA 2F2PA 1PK0D 2NLNA 5I2QA 4DCKA 2K7DA 1F4OA 3AAJA 1PULA 1PVBA 4NDBA 1DJXA 2PSRA 2LMTA 2JXLA 5JJGA 3DF0B 1ODBA 2EGDA 2V53A 1JFJA 3I5FB 3IF7A 2JU0A 1OE9B
chains in the Genus database with same CATH superfamily
1S5GY 3DVKA 3I5HC 2KOTA 2BKHB 2CTNA 1B7TY 4XJKA 4N1FA 5EL2A 5D69A 1CFPA 4YBHB 1DJZA 2NZ0A 2BBMA 2MLFC 3DVMA 4D1EA 1JF2A 3DXLA 4MZKA 1XFZO 3NSKA 3LL8B 2H61C 2MHHA 1BJFA 4PE7A 1CNPA 2AUCA 3IQQA 5FI6A 5CSJA 2ZNDA 2KYFA 1ZFSA 3R1PA 3S0BA 1B8CA 1KFXS 2LAPA 2BAPA 1DEKA 4A4CA 2LMVA 4NQGA 2EC6C 1SL7A 1TRFA 3PATA 1M45A 3B7AA 2JPTA 1ZUZA 3GK2A 3DVEA 4CFQA 1EH2A 2WOSA 3FWBA 4GGNA 3EK4A 2Y5IA 1CFDA 1BMOA 5TNCA 5I2LA 4YRUA 1M39A 3PJIA 1CLLA 3EVRA 5F6TA 4JPZB 2FJYA 2COLB 3CR2A 1HT9A 2QEVA 4YI9A 2ZN8A 5I94A 1FBVA 1EG4A 2B1UA 4FQOA 4DIRA 1GGWA 1G33A 1YUTA 5I8NA 1NX0A 3PM8A 5KSZA 1EL4A 2LMUA 3FE6A 3FE9A 2L0PA 2LM5A 3B86A 3KF9A 3PN7B 4MN0A 2KI4C 1XFRA 2JC2A 3PALA 2ZKMX 1B47A 4OZDA 1UHIA 4MVFA 2I2RE 1KSMA 1V1GA 3WXAA 1EXRA 1ZOTB 2HF5A 1W7JB 1F55A 2OS8B 2JTTA 2K7OA 2Y4QA 3D73A 1NCXA 1FPWA 1XO5A 1N0YA 1B8RA 2L2EA 2P71A 3PM2A 5HKYA 1F8HA 3D0YB 3VB1A 2K2AA 2PYQA 1WLMA 1DVIA 1YRUB 1Z4HA 2LVIA 1A75B 1K9UA 2I18A 1CTRA 1HQVA 1QVIZ 1A03A 4HRGA 4M2QA 1L2OB 1F4QA 3R72A 1OQPA 3A4UB 1UURA 3CTNA 4ICBA 1B9AA 1YVHA 3FS7A 3OB2B 3TDZA 3JVTC 4I5JA 2KLEA 4JQ0D 3WHTB 1F71A 5D3OA 1K94A 2WNDA 1TCFA 3O4YA 4XYNA 1XFXO 1TUJA 4C0LA 1KK7Y 2ZN9A 1UWOA 1MR8A 2OTGC 1J7PA 1SR6B 1XFWO 3B87A 1RROA 2KQYA 1U5IA 1BR1B 2I94A 4GPLB 4YGAA 1QX7A 1SYMA 1WDCB 2LLTA 3N7HA 1UHJA 1TNPA 1SSEB 3LCPC 4JWQA 3EKHA 4YGDB 1FI6A 2MJWB 4YGCB 1QLKA 1KQMC 1KQVA 3NXAA 3S0GA 3JTDC 1XK4C 1CKKA 2ZFDA 3NHIA 4XJKB 1RK9A 2GV5A 1EJ3A 4INWA 2KGRA 4WQ3A 4F7FA 2LHIA 3KEVA 3ICBA 2SCPA 3EVVA 4GAOA 1J7RA 1ORGA 2LLSA 4FQTA 2BCAA 3CS1A 2HQ8A 1SCVA 2P6BB 3GOFA 4YI8A 3L4LA 2Y1NA 2L98A 2QACA 2MLEC 2BNXA 1JSAA 3LK1A 1SRAA 2LHLA 2GGMA 1SCMC 4PDZA 1KK8B 2JT3A 1TCOB 3BUXB 2K2FA 3I5IC 1YUUA 3L47A 1F54A 1DGVA 2R2IA 3WNXB 3L4AA 4PHNA 2LP3A 3B6XA 3VRNA 1IGVA 4MZJA 4N5XA 1SMGA 2KHNA 4PHJA 3SG3A 2KFFA 1AP4A 1CMGA 3VROA 1WRKA 5D7FA 5G08A 2CXJA 3DD4A 1B8LA 1P28A 3NSLA 1IJ5A 1JFKA 3CDNA 4C0JA 1K9KA 1QLSA 1ALWA 5HL1A 1FW4A 1XA5A 1K96A 3BOWA 1SNLA 3GK4X 5DKQA 1UUSA 2F3YA 3VGOA 1TUZA 1DTLA 1G8IA 1S6JA 1DJYA 4MRYA 1OMDA 1GGZA 3CGAA 1SK6D 5DKNA 2WC8A 2IS9A 2JT0A 4HRHA 2Q4UA 1UHKA 3CYZA 4MBEA 2WORA 1VRKA 3IVTA 3NSIA 1SPYA 1NWDA 1QIVA 2KPHA 2QDIA 2ISDA 4GGFC 1RECA 5FI2A 4ZCVA 3TUYC 2DOQA 3CWGA 2BCXA 4F0ZB 2HPSA 4AQJA 5PALA 2JRFA 2QEBA 2WCFA 1NCZA 3SS3A 2M0RA 4BY5A 5I2OA 4CPVA 1Y1UA 2SASA 3D10A 2EC6B 1M31A 1J55A 1OZOA 1YUSA 5ER4X 3BYAA 3UNWA 2E6WA 4CLNA 1TNXA 3EK7A 2M97A 5K89A 1DGUA 1U5IB 3RLZA 1FI5A 3SS5A 1TTXA 4GFTA 4P5OE 1N65A 1B1GA 2LV7A 1K2HA 2JULA 1Q80A 2LC5A 2D8NA 2KBIA 2PRUA 2M9GA 1NPQA 1ALVA 3VRPA 1J1DA 1M63B 2BBNA 4I5LB 5AXIA 2JNFA 1OOJA 2F33A 1CDLA 2NCOA 1SL9A 2WCBA 4A4BA 3FIAA 1NX3A 1OOIX 4CIDA 1PSRA 2WCMA 1K9PA 2AMIA 2PVBA 2LP2A 3H4SE 1BODA 1S1EA 2BE6A 1PRWA 4E68A 4I5NB 1QVIY 1BG1A 3CABA 2FJUB 3BJHA 1AK8A 3ZWHA 4OV2A 1TIZA 3EK8A 4ORCB 2H61A 3RM1A 1IQ5A 2NXQA 2K60A 2KAYA 4MSPA 4PE0A 5KU1A 1CFFA 1Z2CB 1LA0A 3NSOA 2L5YA 4UPGA 3O2PA 1OMVA 2FCDA 4PHKA 1LA3A 3PSRA 2WCLA 4YGEB 2M7NA 1QS7A 2A4JA 3SIAA 1KWOC 2JT8A 3K1EA 1NIWA 4ETOA 1DMOA 3JVTB 4MRXA 1X02A 1M46A 1LXFC 4NDDA 1W7IB 1WLZA 1WY9A 1L7ZA 2KGBC 1IWQA 2PQLA 3BUMB 1B4CA 1Y1XA 2F3ZA 3BOWB 4IL1A 5CSFA 2ERBA 2M8UA 2OTGB 1KFXL 2ZNEA 1WDCC 4PHMA 3SS4A 2KLDA 1DJGA 1IQ3A 3D77A 1XVJA 3SG6A 1WRZA 3TS5C 2L50A 2PMYA 3IF7A 2QEHA 1GQMA 3C1VA 1OOFA 3CR5X 3CR4X 1SL8A 3HX4A 4HREE 1C7VA 1W9ZA 4FTGA 1K90D 1IKUA 1KQMB 3JTDB 2P70A 3CLNA 3LLEA 3SG7A 1G4YR 1XYDA 1LS8A 1ZMZA 2BE4A 3S0DA 1XFVO 3A8RA 2LVKA 1RFJA 4OCIA 2BL0B 2RGIA 1KCYA 4PT1A 1BF5A 3KPXA 5B8IB 1CFCA 1KFUS 3OP0A 2LUCA 2M7LA 4ORBB 2WCHA 1LKJA 2KDHA 1JF0A 2FCEA 5HLVA 2Y1MA 4M2OA 1YX7A 3I5GB 1SCMB 3S0EA 3OBVA 2BKIB 3RZSA 3R1VA 1SY9A 3ZNIA 2L4IA 1PVAA 3DYEA 2G2BA 3VRQA 1DJHA 1C3YA 1C7WA 2JOJA 1DF0A 2LVJA 3QMEA 1N2DA 4M2PA 1RTP1 2I7AA 1QX2A 5JOLA 1Y0VH 4AOMA 3O6BA 3VRRA 1JC2A 1YURA 1WRLA 1SBJA 2M1KB 3AKAA 5CPVA 1CLMA 1D1OA 2GGZA 2EHBA 3BUNB 2TN4A 1J1EA 1QXPA 5ER5A 4KYNA 3KO0A 2M1UA 5J3XA 3I5FC 2KAXA 2E30A 4ORAB 3BQ3A 1MHOA 1OW4A 1NYAA 3LK0A 1J7QA 4WRIA 2JWWA 2FOTA 2KQ6A 3O4XA 1CMFA 1OSAA 3DZTA 3WHUB 1PALA 3SJSA 1XK4A 3BFHA 2QPTA 3I5HB 3BXKA 1IH0A 3D74A 4DRWA 2K7BA 1SW8A 1V1FA 4QJ3B 2KSPA 3EVUA 1MF8B 4HSZA 1AJ5A 4IJ7A 2L4HA 1NCYA 3K21A 3R1OA 3BUOB 1JBAA 1H8BA 2BCBA 2PALA 1S5GZ 4NDCA 2WCKA 1YTZC 1BR4B 4U8DA 4DUQA 1NX1A 1B7TZ 1Y6WA 2LLUA 1QATA 4TNCA 3B88A 5BPJA 1QV0A 2JQ6A 2M3WA 5AERA 1OOHA 4OR9B 1EG3A 3TUYB 2YGUA 1IG5A 4MZLA 1S6CA 1AUIB 2K8MB 1RJVA 1F70A 5FYXA 1DQEA 2LNKA 2H2KA 1K95A 2JZIA 2LCPA 1IJ6A 2WC5A 3OX6A 1C07A 2KI6C 4MEWA 1UP5A 1DJIA 3KHEA 1QX5B 2KFHA 1S36A 4L9MA 1K93D 1DT7B 1CLBA 5IBWA 1NP8A 2KFGA 1XFYO 2KNEA 1LINA 4OKHA 4N1GA 1YX8A 3TDIA 3BFBA 2M49B 1TWOA 4PCWA 2WCEA 3PN7C 2K61A 1TNWA 1RWYA 2HQWA 1R6PA 1MUXA 5DICA 4USLA 2KI4B 3DY9A 4GBAA 3HCMA 1AJ4A 1TOPA 2CNPA 1KFUL 3MSEB 4QJ4B 3EG5B 2OS8C 3OB1B 3PLFB 1OOGA 1CM1A 1QWVA 3IQOA 3DF0A 2PASA 3E3RA 1R2UA 4GUKA 4YGBB 1OZSA 5HKZA 1E8AA 4Q04A 4BY4A 4OVNF 1UHNA 1IRJA 1LVCD 1A2XA 2OPOA 2WCJA 5HYDA 2CBLA 3UO9A 3F45A 1GJYA 4JKTA 1S6IA 4ZCUA 4GGFA 1L2OC 1ZACA 4JD9A 1QTXA 3CZ2A 1MXLC 1MXEA 3FE8A 1BT6A 3S0FA 2G9BA 1GM0A 3DVJA 3NHTA 1C3ZA 2L2CA 2VRGA 1MWNA 3PFVA 3TZ1A 2KYCA 5CSNA 2JNXA 2H8VA 2JXCA 1UHHA 2MA2A 1DF0B 1CDPA 1DJWA 1YVLA 2BECA 2QEOA 4INXA 1KSOA 5FI7A 2MAZA 1S3PA 1QASA 1SR6C 4MLWA 2JTZA 1JWDA 2K0JA 2M29A 2LUXA 1K8UA 1CM4A 4PE4A 4AQIA 1KWOB 2Q91A 2F2OA 2ZRSA 2KAVA 3OHMB 2NCPA 2K7CA 3M0WA 3FWCA 1BLQA 2LE9B 3AAKA 3SG5A 4WQ2A 5AEQA 4P2YB 1KK7Z 2O5GA 4QJ5B 1Y1AA 1T14A 2LANA 3SG2A 1BU3A 1QIWA 3EKJA 3TDUA 3V2LA 3CZ0A 3TS5B 2AAOA 3GK1A 1XFUO 5HLOA 2MRDA 5AANA 1PSBA 3D78A 3BFAA 1CDMA 3SIBA 4CFRA 2ZRTA 1TN4A 2F8PA 1NX2A 3OX5A 3NGVA 1A29A 2CT9A 4GNKB 1S26D 3BUWB 1CB1A 5DKRA 4I5KA 4R1EA 1CDNA 1J7OA 1KK8C 3CZTX 1AVSA 4PE1A 2BL0C 2L51A 2O60A 1YR5A 1SKTA 1NSHA 3D0YA 1NUBA 3I5IB 2MBXA 5KTYA 3SG4A 1MQ1A 5AFPA 1BOCA 2LVVA 1A75A 1H4BA 3D75A 1QJTA 3I5GC 3AKBA 3S0AA 3O78A 5CSIA 2KI6D 1OMRA 1JUOA 1YRTB 4C0KA 3Q8IA 1QV1A 3QRXA 4DS7A 2L5XB 2HETA 2CCMA 1AHRA 5GQQC 2KBMA 1FF1A 4PALA 3CZ1A 5HKWA 1TNQA 3OGNA 1A4PA 2F2PA 1PK0D 2NLNA 5I2QA 4DCKA 2K7DA 1DELA 1F4OA 3AAJA 1DC1A 1PULA 1PVBA 4NDBA 2GTEA 2JPOA 1DJXA 2PSRA 2LMTA 2JXLA 1IIOA 5JJGA 3DF0B 1ODBA 2EGDA 2V53A 3D76A 1JFJA 3I5FB 2WC6A 2JU0A 1OE9B
chains in the Genus database with same CATH topology
1S5GY 3DVKA 3I5HC 2KOTA 2BKHB 2CTNA 1B7TY 4XJKA 4N1FA 1CFPA 5D69A 4YBHB 1DJZA 2NZ0A 2BBMA 2MLFC 3DVMA 4D1EA 1JF2A 4MZKA 1XFZO 3NSKA 3LL8B 2H61C 2MHHA 1BJFA 4PE7A 1CNPA 2AUCA 3IQQA 5CSJA 2ZNDA 2KYFA 1ZFSA 1B8CA 1KFXS 2LAPA 4A4CA 2LMVA 4NQGA 2EC6C 1SL7A 1TRFA 3PATA 1M45A 3GK2A 2JPTA 1ZUZA 1EH2A 3DVEA 4CFQA 2WOSA 3FWBA 4GGNA 3EK4A 2Y5IA 1CFDA 1BMOA 5TNCA 5I2LA 4YRUA 1M39A 1CLLA 3EVRA 5F6TA 4JPZB 2COLB 3CR2A 1HT9A 4YI9A 2ZN8A 1FBVA 1EG4A 2B1UA 4FQOA 4DIRA 1GGWA 1G33A 1YUTA 5I8NA 1NX0A 3PM8A 5KSZA 1EL4A 2LMUA 2L0PA 2LM5A 3KF9A 3PN7B 4MN0A 2KI4C 2JC2A 3PALA 2ZKMX 1B47A 1UHIA 4MVFA 2I2RE 1KSMA 1V1GA 3WXAA 1EXRA 1ZOTB 2HF5A 1W7JB 1F55A 2OS8B 2JTTA 2K7OA 2Y4QA 1NCXA 1FPWA 1XO5A 1N0YA 1B8RA 2L2EA 5HKYA 1F8HA 3D0YB 2K2AA 1WLMA 1DVIA 1YRUB 2LVIA 1A75B 1K9UA 2I18A 1CTRA 1HQVA 1QVIZ 1A03A 4HRGA 4M2QA 1L2OB 1F4QA 4ICBA 1OQPA 3A4UB 1UURA 3CTNA 1B9AA 1YVHA 3FS7A 3OB2B 3TDZA 3JVTC 4I5JA 4JQ0D 3WHTB 1F71A 1K94A 2WNDA 1TCFA 3O4YA 4XYNA 1XFXO 4C0LA 1KK7Y 2ZN9A 1UWOA 1MR8A 2OTGC 1J7PA 1SR6B 1XFWO 1RROA 2KQYA 1U5IA 1BR1B 2I94A 4GPLB 4YGAA 1QX7A 1SYMA 1WDCB 2LLTA 1UHJA 1TNPA 3LCPC 4JWQA 3EKHA 4YGDB 1FI6A 2MJWB 4YGCB 1QLKA 1KQMC 1KQVA 3NXAA 1CKKA 3JTDC 1XK4C 2ZFDA 4XJKB 1RK9A 2GV5A 1EJ3A 4WQ3A 2KGRA 2LHIA 3KEVA 3ICBA 2SCPA 3EVVA 4GAOA 1J7RA 2LLSA 2BCAA 3CS1A 2HQ8A 1SCVA 2P6BB 3GOFA 4YI8A 2Y1NA 2L98A 2QACA 2MLEC 1JSAA 3LK1A 1SRAA 2LHLA 2GGMA 1SCMC 4PDZA 1KK8B 2JT3A 1TCOB 3BUXB 2K2FA 3I5IC 1YUUA 1F54A 1DGVA 2R2IA 3WNXB 4PHNA 2LP3A 3VRNA 1IGVA 4MZJA 4N5XA 1SMGA 2KHNA 4PHJA 3SG3A 2KFFA 1AP4A 1CMGA 3VROA 1WRKA 5D7FA 5G08A 2CXJA 3DD4A 1B8LA 3NSLA 1IJ5A 1JFKA 4C0JA 1K9KA 1QLSA 1ALWA 1FW4A 1XA5A 1K96A 3BOWA 1SNLA 3GK4X 5DKQA 1UUSA 2F3YA 3VGOA 1DTLA 1G8IA 1S6JA 1DJYA 4MRYA 1OMDA 1GGZA 3CGAA 1SK6D 5DKNA 2WC8A 2IS9A 2JT0A 4HRHA 2Q4UA 1UHKA 4MBEA 2WORA 1VRKA 3NSIA 1SPYA 1NWDA 1QIVA 2ISDA 4GGFC 1RECA 3TUYC 4ZCVA 2DOQA 3CWGA 2BCXA 4F0ZB 2HPSA 4AQJA 5PALA 2JRFA 2WCFA 1NCZA 2M0RA 4BY5A 5I2OA 4CPVA 1Y1UA 2SASA 3D10A 2EC6B 1M31A 1J55A 1OZOA 1YUSA 5ER4X 3BYAA 4CLNA 2E6WA 1TNXA 3EK7A 2M97A 5K89A 1DGUA 1U5IB 3RLZA 1FI5A 1TTXA 4GFTA 4P5OE 1N65A 1B1GA 2LV7A 1K2HA 2JULA 1Q80A 2LC5A 2D8NA 2KBIA 2PRUA 2M9GA 1NPQA 1ALVA 3VRPA 1J1DA 1M63B 2BBNA 4I5LB 5AXIA 2JNFA 1OOJA 2F33A 1CDLA 2NCOA 1SL9A 2WCBA 4A4BA 3FIAA 1NX3A 4CIDA 1PSRA 1K9PA 2AMIA 2PVBA 2LP2A 3H4SE 1BODA 1S1EA 2BE6A 1PRWA 4E68A 4I5NB 1QVIY 1BG1A 2FJUB 1AK8A 3ZWHA 4OV2A 1TIZA 3EK8A 4ORCB 2H61A 3RM1A 1IQ5A 2NXQA 2KAYA 4MSPA 4PE0A 5KU1A 1CFFA 1LA0A 3NSOA 4UPGA 3O2PA 1OMVA 2FCDA 4PHKA 1LA3A 3PSRA 4YGEB 2M7NA 1QS7A 2A4JA 3SIAA 1KWOC 2JT8A 1NIWA 4ETOA 1DMOA 3JVTB 4MRXA 1X02A 1M46A 1LXFC 4NDDA 1W7IB 1WLZA 1WY9A 1L7ZA 2KGBC 1IWQA 3BUMB 1B4CA 1Y1XA 2F3ZA 3BOWB 4IL1A 5CSFA 2M8UA 2OTGB 1KFXL 2ZNEA 1WDCC 4PHMA 1DJGA 1IQ3A 1XVJA 3SG6A 1WRZA 3TS5C 2L50A 2PMYA 1GQMA 3C1VA 3CR5X 3CR4X 1SL8A 3HX4A 4HREE 1C7VA 4FTGA 1K90D 1IKUA 1KQMB 3JTDB 3CLNA 3LLEA 3SG7A 1G4YR 1XYDA 1ZMZA 2BE4A 1XFVO 3A8RA 2LVKA 1RFJA 4OCIA 2BL0B 2RGIA 1KCYA 1BF5A 3KPXA 5B8IB 1CFCA 1KFUS 3OP0A 2LUCA 2M7LA 4ORBB 1LKJA 2KDHA 1JF0A 2FCEA 5HLVA 2Y1MA 4M2OA 1YX7A 3I5GB 1SCMB 2BKIB 1SY9A 3ZNIA 2L4IA 1PVAA 2G2BA 3VRQA 1DJHA 1C7WA 2JOJA 1DF0A 2LVJA 4M2PA 1N2DA 1RTP1 2I7AA 1QX2A 5JOLA 1Y0VH 4AOMA 3O6BA 3VRRA 1JC2A 1YURA 1WRLA 1SBJA 2M1KB 3AKAA 5CPVA 1CLMA 1D1OA 2GGZA 2EHBA 3BUNB 2TN4A 1J1EA 1QXPA 5ER5A 3KO0A 2M1UA 5J3XA 3I5FC 2KAXA 2E30A 4ORAB 3BQ3A 1MHOA 1NYAA 3LK0A 1J7QA 4WRIA 2JWWA 2FOTA 2KQ6A 1CMFA 1OSAA 3WHUB 1PALA 3SJSA 1XK4A 3I5HB 2QPTA 1IH0A 3BXKA 4DRWA 2K7BA 1SW8A 1V1FA 4QJ3B 2KSPA 3EVUA 1MF8B 4HSZA 1AJ5A 2L4HA 1NCYA 3K21A 3BUOB 1JBAA 1H8BA 2BCBA 2PALA 1S5GZ 4NDCA 4U8DA 1YTZC 1BR4B 4DUQA 1NX1A 1B7TZ 1Y6WA 2LLUA 1QATA 4TNCA 5BPJA 1QV0A 2JQ6A 2M3WA 5AERA 4OR9B 3TUYB 1EG3A 1IG5A 4MZLA 1S6CA 1AUIB 2K8MB 1RJVA 1F70A 5FYXA 2LNKA 2H2KA 1K95A 2JZIA 2LCPA 1IJ6A 3OX6A 1C07A 2KI6C 4MEWA 1UP5A 1DJIA 3KHEA 1QX5B 2KFHA 1S36A 4L9MA 1K93D 1DT7B 1CLBA 5IBWA 1NP8A 2KFGA 1XFYO 2KNEA 1LINA 4OKHA 4N1GA 1YX8A 3TDIA 2M49B 4PCWA 2WCEA 3PN7C 2K61A 1TNWA 1RWYA 2HQWA 1R6PA 1MUXA 4USLA 2KI4B 4GBAA 3HCMA 1AJ4A 1TOPA 2CNPA 1KFUL 3MSEB 4QJ4B 2OS8C 3OB1B 3PLFB 4GUKA 1CM1A 3IQOA 5CSNA 3DF0A 2PASA 3E3RA 1R2UA 4YGBB 1OZSA 5HKZA 1E8AA 4Q04A 4BY4A 4OVNF 1UHNA 1IRJA 1LVCD 1A2XA 2OPOA 5HYDA 2CBLA 3F45A 1GJYA 1S6IA 4ZCUA 4GGFA 1L2OC 1ZACA 1QTXA 1MXLC 1MXEA 1BT6A 2G9BA 3DVJA 2VRGA 1MWNA 3PFVA 3TZ1A 2KYCA 2JNXA 2JXCA 1UHHA 2MA2A 1DF0B 1CDPA 1DJWA 1YVLA 2BECA 1KSOA 2MAZA 1S3PA 1QASA 1SR6C 4MLWA 2JTZA 1JWDA 2K0JA 2M29A 2LUXA 1K8UA 1CM4A 4PE4A 4AQIA 1KWOB 2Q91A 2F2OA 2ZRSA 2KAVA 3OHMB 2NCPA 2K7CA 3M0WA 3FWCA 1BLQA 2LE9B 3AAKA 3SG5A 4WQ2A 5AEQA 4P2YB 1KK7Z 2O5GA 4QJ5B 1Y1AA 2LANA 3SG2A 1BU3A 1QIWA 3EKJA 3TDUA 3TS5B 2AAOA 3GK1A 1XFUO 5HLOA 2MRDA 5AANA 1PSBA 1CDMA 3SIBA 4CFRA 2ZRTA 1TN4A 2F8PA 1NX2A 3OX5A 4GNKB 1A29A 2CT9A 1CB1A 1S26D 3BUWB 5DKRA 4I5KA 4R1EA 1CDNA 1J7OA 1KK8C 3CZTX 1AVSA 4PE1A 2BL0C 2L51A 2O60A 1YR5A 1SKTA 1NSHA 3D0YA 1NUBA 3I5IB 2MBXA 5KTYA 3SG4A 1MQ1A 5AFPA 1BOCA 2LVVA 1A75A 1H4BA 1QJTA 3I5GC 3AKBA 3O78A 5CSIA 2KI6D 1OMRA 1JUOA 1YRTB 4C0KA 1QV1A 3QRXA 4DS7A 2L5XB 2HETA 2CCMA 1AHRA 5GQQC 2KBMA 1FF1A 4PALA 5HKWA 1TNQA 1A4PA 2F2PA 1PK0D 2NLNA 5I2QA 4DCKA 2K7DA 1F4OA 3AAJA 1PULA 1PVBA 4NDBA 1DJXA 2PSRA 2LMTA 2JXLA 5JJGA 3DF0B 1ODBA 2EGDA 2V53A 1JFJA 3I5FB 3IF7A 2JU0A 1OE9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S5G Y;  3DVK A;  3I5H C;  2KOT A;  2BKH B;  2CTN A;  1B7T Y;  4XJK A;  4N1F A;  1CFP A;  5D69 A;  4YBH B;  1DJZ A;  2NZ0 A;  2BBM A;  2MLF C;  3DVM A;  4D1E A;  1JF2 A;  4MZK A;  1XFZ O;  3NSK A;  3LL8 B;  2H61 C;  2MHH A;  1BJF A;  4PE7 A;  1CNP A;  2AUC A;  3IQQ A;  5CSJ A;  2ZND A;  2KYF A;  1ZFS A;  1B8C A;  1KFX S;  2LAP A;  4A4C A;  2LMV A;  4NQG A;  2EC6 C;  1SL7 A;  1TRF A;  3PAT A;  1M45 A;  3GK2 A;  2JPT A;  1ZUZ A;  1EH2 A;  3DVE A;  4CFQ A;  2WOS A;  3FWB A;  4GGN A;  3EK4 A;  2Y5I A;  1CFD A;  1BMO A;  5TNC A;  5I2L A;  4YRU A;  1M39 A;  1CLL A;  3EVR A;  5F6T A;  4JPZ B;  2COL B;  3CR2 A;  1HT9 A;  4YI9 A;  2ZN8 A;  1FBV A;  1EG4 A;  2B1U A;  4FQO A;  4DIR A;  1GGW A;  1G33 A;  1YUT A;  5I8N A;  1NX0 A;  3PM8 A;  5KSZ A;  1EL4 A;  2LMU A;  2L0P A;  2LM5 A;  3KF9 A;  3PN7 B;  4MN0 A;  2KI4 C;  2JC2 A;  3PAL A;  2ZKM X;  1B47 A;  1UHI A;  4MVF A;  2I2R E;  1KSM A;  1V1G A;  3WXA A;  1EXR A;  1ZOT B;  2HF5 A;  1W7J B;  1F55 A;  2OS8 B;  2JTT A;  2K7O A;  2Y4Q A;  1NCX A;  1FPW A;  1XO5 A;  1N0Y A;  1B8R A;  2L2E A;  5HKY A;  1F8H A;  3D0Y B;  2K2A A;  1WLM A;  1DVI A;  1YRU B;  2LVI A;  1A75 B;  1K9U A;  2I18 A;  1CTR A;  1HQV A;  1QVI Z;  1A03 A;  4HRG A;  4M2Q A;  1L2O B;  1F4Q A;  4ICB A;  1OQP A;  3A4U B;  1UUR A;  3CTN A;  1B9A A;  1YVH A;  3FS7 A;  3OB2 B;  3TDZ A;  3JVT C;  4I5J A;  4JQ0 D;  3WHT B;  1F71 A;  1K94 A;  2WND A;  1TCF A;  3O4Y A;  4XYN A;  1XFX O;  4C0L A;  1KK7 Y;  2ZN9 A;  1UWO A;  1MR8 A;  2OTG C;  1J7P A;  1SR6 B;  1XFW O;  1RRO A;  2KQY A;  1U5I A;  1BR1 B;  2I94 A;  4GPL B;  4YGA A;  1QX7 A;  1SYM A;  1WDC B;  2LLT A;  1UHJ A;  1TNP A;  3LCP C;  4JWQ A;  3EKH A;  4YGD B;  1FI6 A;  2MJW B;  4YGC B;  1QLK A;  1KQM C;  1KQV A;  3NXA A;  1CKK A;  3JTD C;  1XK4 C;  2ZFD A;  4XJK B;  1RK9 A;  2GV5 A;  1EJ3 A;  4WQ3 A;  2KGR A;  2LHI A;  3KEV A;  3ICB A;  2SCP A;  3EVV A;  4GAO A;  1J7R A;  2LLS A;  2BCA A;  3CS1 A;  2HQ8 A;  1SCV A;  2P6B B;  3GOF A;  4YI8 A;  2Y1N A;  2L98 A;  2QAC A;  2MLE C;  1JSA A;  3LK1 A;  1SRA A;  2LHL A;  2GGM A;  1SCM C;  4PDZ A;  1KK8 B;  2JT3 A;  1TCO B;  3BUX B;  2K2F A;  3I5I C;  1YUU A;  1F54 A;  1DGV A;  2R2I A;  3WNX B;  4PHN A;  2LP3 A;  3VRN A;  1IGV A;  4MZJ A;  4N5X A;  1SMG A;  2KHN A;  4PHJ A;  3SG3 A;  2KFF A;  1AP4 A;  1CMG A;  3VRO A;  1WRK A;  5D7F A;  5G08 A;  2CXJ A;  3DD4 A;  1B8L A;  3NSL A;  1IJ5 A;  1JFK A;  4C0J A;  1K9K A;  1QLS A;  1ALW A;  1FW4 A;  1XA5 A;  1K96 A;  3BOW A;  1SNL A;  3GK4 X;  5DKQ A;  1UUS A;  2F3Y A;  3VGO A;  1DTL A;  1G8I A;  1S6J A;  1DJY A;  4MRY A;  1OMD A;  1GGZ A;  3CGA A;  1SK6 D;  5DKN A;  2WC8 A;  2IS9 A;  2JT0 A;  4HRH A;  2Q4U A;  1UHK A;  4MBE A;  2WOR A;  1VRK A;  3NSI A;  1SPY A;  1NWD A;  1QIV A;  2ISD A;  4GGF C;  1REC A;  3TUY C;  4ZCV A;  2DOQ A;  3CWG A;  2BCX A;  4F0Z B;  2HPS A;  4AQJ A;  5PAL A;  2JRF A;  2WCF A;  1NCZ A;  2M0R A;  4BY5 A;  5I2O A;  4CPV A;  1Y1U A;  2SAS A;  3D10 A;  2EC6 B;  1M31 A;  1J55 A;  1OZO A;  1YUS A;  5ER4 X;  3BYA A;  4CLN A;  2E6W A;  1TNX A;  3EK7 A;  2M97 A;  5K89 A;  1DGU A;  1U5I B;  3RLZ A;  1FI5 A;  1TTX A;  4GFT A;  4P5O E;  1N65 A;  1B1G A;  2LV7 A;  1K2H A;  2JUL A;  1Q80 A;  2LC5 A;  2D8N A;  2KBI A;  2PRU A;  2M9G A;  1NPQ A;  1ALV A;  3VRP A;  1J1D A;  1M63 B;  2BBN A;  4I5L B;  5AXI A;  2JNF A;  1OOJ A;  2F33 A;  1CDL A;  2NCO A;  1SL9 A;  2WCB A;  4A4B A;  3FIA A;  1NX3 A;  4CID A;  1PSR A;  1K9P A;  2AMI A;  2PVB A;  2LP2 A;  3H4S E;  1BOD A;  1S1E A;  2BE6 A;  1PRW A;  4E68 A;  4I5N B;  1QVI Y;  1BG1 A;  2FJU B;  1AK8 A;  3ZWH A;  4OV2 A;  1TIZ A;  3EK8 A;  4ORC B;  2H61 A;  3RM1 A;  1IQ5 A;  2NXQ A;  2KAY A;  4MSP A;  4PE0 A;  5KU1 A;  1CFF A;  1LA0 A;  3NSO A;  4UPG A;  3O2P A;  1OMV A;  2FCD A;  4PHK A;  1LA3 A;  3PSR A;  4YGE B;  2M7N A;  1QS7 A;  2A4J A;  3SIA A;  1KWO C;  2JT8 A;  1NIW A;  4ETO A;  1DMO A;  3JVT B;  4MRX A;  1X02 A;  1M46 A;  1LXF C;  4NDD A;  1W7I B;  1WLZ A;  1WY9 A;  1L7Z A;  2KGB C;  1IWQ A;  3BUM B;  1B4C A;  1Y1X A;  2F3Z A;  3BOW B;  4IL1 A;  5CSF A;  2M8U A;  2OTG B;  1KFX L;  2ZNE A;  1WDC C;  4PHM A;  1DJG A;  1IQ3 A;  1XVJ A;  3SG6 A;  1WRZ A;  3TS5 C;  2L50 A;  2PMY A;  1GQM A;  3C1V A;  3CR5 X;  3CR4 X;  1SL8 A;  3HX4 A;  4HRE E;  1C7V A;  4FTG A;  1K90 D;  1IKU A;  1KQM B;  3JTD B;  3CLN A;  3LLE A;  3SG7 A;  1G4Y R;  1XYD A;  1ZMZ A;  2BE4 A;  1XFV O;  3A8R A;  2LVK A;  1RFJ A;  4OCI A;  2BL0 B;  2RGI A;  1KCY A;  1BF5 A;  3KPX A;  5B8I B;  1CFC A;  1KFU S;  3OP0 A;  2LUC A;  2M7L A;  4ORB B;  1LKJ A;  2KDH A;  1JF0 A;  2FCE A;  5HLV A;  2Y1M A;  4M2O A;  1YX7 A;  3I5G B;  1SCM B;  2BKI B;  1SY9 A;  3ZNI A;  2L4I A;  1PVA A;  2G2B A;  3VRQ A;  1DJH A;  1C7W A;  2JOJ A;  1DF0 A;  2LVJ A;  4M2P A;  1N2D A;  1RTP 1;  2I7A A;  1QX2 A;  5JOL A;  1Y0V H;  4AOM A;  3O6B A;  3VRR A;  1JC2 A;  1YUR A;  1WRL A;  1SBJ A;  2M1K B;  3AKA A;  5CPV A;  1CLM A;  1D1O A;  2GGZ A;  2EHB A;  3BUN B;  2TN4 A;  1J1E A;  1QXP A;  5ER5 A;  3KO0 A;  2M1U A;  5J3X A;  3I5F C;  2KAX A;  2E30 A;  4ORA B;  3BQ3 A;  1MHO A;  1NYA A;  3LK0 A;  1J7Q A;  4WRI A;  2JWW A;  2FOT A;  2KQ6 A;  1CMF A;  1OSA A;  3WHU B;  1PAL A;  3SJS A;  1XK4 A;  3I5H B;  2QPT A;  1IH0 A;  3BXK A;  4DRW A;  2K7B A;  1SW8 A;  1V1F A;  4QJ3 B;  2KSP A;  3EVU A;  1MF8 B;  4HSZ A;  1AJ5 A;  2L4H A;  1NCY A;  3K21 A;  3BUO B;  1JBA A;  1H8B A;  2BCB A;  2PAL A;  1S5G Z;  4NDC A;  4U8D A;  1YTZ C;  1BR4 B;  4DUQ A;  1NX1 A;  1B7T Z;  1Y6W A;  2LLU A;  1QAT A;  4TNC A;  5BPJ A;  1QV0 A;  2JQ6 A;  2M3W A;  5AER A;  4OR9 B;  3TUY B;  1EG3 A;  1IG5 A;  4MZL A;  1S6C A;  1AUI B;  2K8M B;  1RJV A;  1F70 A;  5FYX A;  2LNK A;  2H2K A;  1K95 A;  2JZI A;  2LCP A;  1IJ6 A;  3OX6 A;  1C07 A;  2KI6 C;  4MEW A;  1UP5 A;  1DJI A;  3KHE A;  1QX5 B;  2KFH A;  1S36 A;  4L9M A;  1K93 D;  1DT7 B;  1CLB A;  5IBW A;  1NP8 A;  2KFG A;  1XFY O;  2KNE A;  1LIN A;  4OKH A;  4N1G A;  1YX8 A;  3TDI A;  2M49 B;  4PCW A;  2WCE A;  3PN7 C;  2K61 A;  1TNW A;  1RWY A;  2HQW A;  1R6P A;  1MUX A;  4USL A;  2KI4 B;  4GBA A;  3HCM A;  1AJ4 A;  1TOP A;  2CNP A;  1KFU L;  3MSE B;  4QJ4 B;  2OS8 C;  3OB1 B;  3PLF B;  4GUK A;  1CM1 A;  3IQO A;  5CSN A;  3DF0 A;  2PAS A;  3E3R A;  1R2U A;  4YGB B;  1OZS A;  5HKZ A;  1E8A A;  4Q04 A;  4BY4 A;  4OVN F;  1UHN A;  1IRJ A;  1LVC D;  1A2X A;  2OPO A;  5HYD A;  2CBL A;  3F45 A;  1GJY A;  1S6I A;  4ZCU A;  4GGF A;  1L2O C;  1ZAC A;  1QTX A;  1MXL C;  1MXE A;  1BT6 A;  2G9B A;  3DVJ A;  2VRG A;  1MWN A;  3PFV A;  3TZ1 A;  2KYC A;  2JNX A;  2JXC A;  1UHH A;  2MA2 A;  1DF0 B;  1CDP A;  1DJW A;  1YVL A;  2BEC A;  1KSO A;  2MAZ A;  1S3P A;  1QAS A;  1SR6 C;  4MLW A;  2JTZ A;  1JWD A;  2K0J A;  2M29 A;  2LUX A;  1K8U A;  1CM4 A;  4PE4 A;  4AQI A;  1KWO B;  2Q91 A;  2F2O A;  2ZRS A;  2KAV A;  3OHM B;  2NCP A;  2K7C A;  3M0W A;  3FWC A;  1BLQ A;  2LE9 B;  3AAK A;  3SG5 A;  4WQ2 A;  5AEQ A;  4P2Y B;  1KK7 Z;  2O5G A;  4QJ5 B;  1Y1A A;  2LAN A;  3SG2 A;  1BU3 A;  1QIW A;  3EKJ A;  3TDU A;  3TS5 B;  2AAO A;  3GK1 A;  1XFU O;  5HLO A;  2MRD A;  5AAN A;  1PSB A;  1CDM A;  3SIB A;  4CFR A;  2ZRT A;  1TN4 A;  2F8P A;  1NX2 A;  3OX5 A;  4GNK B;  1A29 A;  2CT9 A;  1CB1 A;  1S26 D;  3BUW B;  5DKR A;  4I5K A;  4R1E A;  1CDN A;  1J7O A;  1KK8 C;  3CZT X;  1AVS A;  4PE1 A;  2BL0 C;  2L51 A;  2O60 A;  1YR5 A;  1SKT A;  1NSH A;  3D0Y A;  1NUB A;  3I5I B;  2MBX A;  5KTY A;  3SG4 A;  1MQ1 A;  5AFP A;  1BOC A;  2LVV A;  1A75 A;  1H4B A;  1QJT A;  3I5G C;  3AKB A;  3O78 A;  5CSI A;  2KI6 D;  1OMR A;  1JUO A;  1YRT B;  4C0K A;  1QV1 A;  3QRX A;  4DS7 A;  2L5X B;  2HET A;  2CCM A;  1AHR A;  5GQQ C;  2KBM A;  1FF1 A;  4PAL A;  5HKW A;  1TNQ A;  1A4P A;  2F2P A;  1PK0 D;  2NLN A;  5I2Q A;  4DCK A;  2K7D A;  1F4O A;  3AAJ A;  1PUL A;  1PVB A;  4NDB A;  1DJX A;  2PSR A;  2LMT A;  2JXL A;  5JJG A;  3DF0 B;  1ODB A;  2EGD A;  2V53 A;  1JFJ A;  3I5F B;  3IF7 A;  2JU0 A;  1OE9 B; 
#chains in the Genus database with same CATH topology
 1S5G Y;  3DVK A;  3I5H C;  2KOT A;  2BKH B;  2CTN A;  1B7T Y;  4XJK A;  4N1F A;  5EL2 A;  5D69 A;  1CFP A;  4YBH B;  1DJZ A;  2NZ0 A;  2BBM A;  2MLF C;  3DVM A;  4D1E A;  1JF2 A;  3DXL A;  4MZK A;  1XFZ O;  3NSK A;  3LL8 B;  2H61 C;  2MHH A;  1BJF A;  4PE7 A;  1CNP A;  2AUC A;  3IQQ A;  5FI6 A;  5CSJ A;  2ZND A;  2KYF A;  1ZFS A;  3R1P A;  3S0B A;  1B8C A;  1KFX S;  2LAP A;  2BAP A;  1DEK A;  4A4C A;  2LMV A;  4NQG A;  2EC6 C;  1SL7 A;  1TRF A;  3PAT A;  1M45 A;  3B7A A;  2JPT A;  1ZUZ A;  3GK2 A;  3DVE A;  4CFQ A;  1EH2 A;  2WOS A;  3FWB A;  4GGN A;  3EK4 A;  2Y5I A;  1CFD A;  1BMO A;  5TNC A;  5I2L A;  4YRU A;  1M39 A;  3PJI A;  1CLL A;  3EVR A;  5F6T A;  4JPZ B;  2FJY A;  2COL B;  3CR2 A;  1HT9 A;  2QEV A;  4YI9 A;  2ZN8 A;  5I94 A;  1FBV A;  1EG4 A;  2B1U A;  4FQO A;  4DIR A;  1GGW A;  1G33 A;  1YUT A;  5I8N A;  1NX0 A;  3PM8 A;  5KSZ A;  1EL4 A;  2LMU A;  3FE6 A;  3FE9 A;  2L0P A;  2LM5 A;  3B86 A;  3KF9 A;  3PN7 B;  4MN0 A;  2KI4 C;  1XFR A;  2JC2 A;  3PAL A;  2ZKM X;  1B47 A;  4OZD A;  1UHI A;  4MVF A;  2I2R E;  1KSM A;  1V1G A;  3WXA A;  1EXR A;  1ZOT B;  2HF5 A;  1W7J B;  1F55 A;  2OS8 B;  2JTT A;  2K7O A;  2Y4Q A;  3D73 A;  1NCX A;  1FPW A;  1XO5 A;  1N0Y A;  1B8R A;  2L2E A;  2P71 A;  3PM2 A;  5HKY A;  1F8H A;  3D0Y B;  3VB1 A;  2K2A A;  2PYQ A;  1WLM A;  1DVI A;  1YRU B;  1Z4H A;  2LVI A;  1A75 B;  1K9U A;  2I18 A;  1CTR A;  1HQV A;  1QVI Z;  1A03 A;  4HRG A;  4M2Q A;  1L2O B;  1F4Q A;  3R72 A;  1OQP A;  3A4U B;  1UUR A;  3CTN A;  4ICB A;  1B9A A;  1YVH A;  3FS7 A;  3OB2 B;  3TDZ A;  3JVT C;  4I5J A;  2KLE A;  4JQ0 D;  3WHT B;  1F71 A;  5D3O A;  1K94 A;  2WND A;  1TCF A;  3O4Y A;  4XYN A;  1XFX O;  1TUJ A;  4C0L A;  1KK7 Y;  2ZN9 A;  1UWO A;  1MR8 A;  2OTG C;  1J7P A;  1SR6 B;  1XFW O;  3B87 A;  1RRO A;  2KQY A;  1U5I A;  1BR1 B;  2I94 A;  4GPL B;  4YGA A;  1QX7 A;  1SYM A;  1WDC B;  2LLT A;  3N7H A;  1UHJ A;  1TNP A;  1SSE B;  3LCP C;  4JWQ A;  3EKH A;  4YGD B;  1FI6 A;  2MJW B;  4YGC B;  1QLK A;  1KQM C;  1KQV A;  3NXA A;  3S0G A;  3JTD C;  1XK4 C;  1CKK A;  2ZFD A;  3NHI A;  4XJK B;  1RK9 A;  2GV5 A;  1EJ3 A;  4INW A;  2KGR A;  4WQ3 A;  4F7F A;  2LHI A;  3KEV A;  3ICB A;  2SCP A;  3EVV A;  4GAO A;  1J7R A;  1ORG A;  2LLS A;  4FQT A;  2BCA A;  3CS1 A;  2HQ8 A;  1SCV A;  2P6B B;  3GOF A;  4YI8 A;  3L4L A;  2Y1N A;  2L98 A;  2QAC A;  2MLE C;  2BNX A;  1JSA A;  3LK1 A;  1SRA A;  2LHL A;  2GGM A;  1SCM C;  4PDZ A;  1KK8 B;  2JT3 A;  1TCO B;  3BUX B;  2K2F A;  3I5I C;  1YUU A;  3L47 A;  1F54 A;  1DGV A;  2R2I A;  3WNX B;  3L4A A;  4PHN A;  2LP3 A;  3B6X A;  3VRN A;  1IGV A;  4MZJ A;  4N5X A;  1SMG A;  2KHN A;  4PHJ A;  3SG3 A;  2KFF A;  1AP4 A;  1CMG A;  3VRO A;  1WRK A;  5D7F A;  5G08 A;  2CXJ A;  3DD4 A;  1B8L A;  1P28 A;  3NSL A;  1IJ5 A;  1JFK A;  3CDN A;  4C0J A;  1K9K A;  1QLS A;  1ALW A;  5HL1 A;  1FW4 A;  1XA5 A;  1K96 A;  3BOW A;  1SNL A;  3GK4 X;  5DKQ A;  1UUS A;  2F3Y A;  3VGO A;  1TUZ A;  1DTL A;  1G8I A;  1S6J A;  1DJY A;  4MRY A;  1OMD A;  1GGZ A;  3CGA A;  1SK6 D;  5DKN A;  2WC8 A;  2IS9 A;  2JT0 A;  4HRH A;  2Q4U A;  1UHK A;  3CYZ A;  4MBE A;  2WOR A;  1VRK A;  3IVT A;  3NSI A;  1SPY A;  1NWD A;  1QIV A;  2KPH A;  2QDI A;  2ISD A;  4GGF C;  1REC A;  5FI2 A;  4ZCV A;  3TUY C;  2DOQ A;  3CWG A;  2BCX A;  4F0Z B;  2HPS A;  4AQJ A;  5PAL A;  2JRF A;  2QEB A;  2WCF A;  1NCZ A;  3SS3 A;  2M0R A;  4BY5 A;  5I2O A;  4CPV A;  1Y1U A;  2SAS A;  3D10 A;  2EC6 B;  1M31 A;  1J55 A;  1OZO A;  1YUS A;  5ER4 X;  3BYA A;  3UNW A;  2E6W A;  4CLN A;  1TNX A;  3EK7 A;  2M97 A;  5K89 A;  1DGU A;  1U5I B;  3RLZ A;  1FI5 A;  3SS5 A;  1TTX A;  4GFT A;  4P5O E;  1N65 A;  1B1G A;  2LV7 A;  1K2H A;  2JUL A;  1Q80 A;  2LC5 A;  2D8N A;  2KBI A;  2PRU A;  2M9G A;  1NPQ A;  1ALV A;  3VRP A;  1J1D A;  1M63 B;  2BBN A;  4I5L B;  5AXI A;  2JNF A;  1OOJ A;  2F33 A;  1CDL A;  2NCO A;  1SL9 A;  2WCB A;  4A4B A;  3FIA A;  1NX3 A;  1OOI X;  4CID A;  1PSR A;  2WCM A;  1K9P A;  2AMI A;  2PVB A;  2LP2 A;  3H4S E;  1BOD A;  1S1E A;  2BE6 A;  1PRW A;  4E68 A;  4I5N B;  1QVI Y;  1BG1 A;  3CAB A;  2FJU B;  3BJH A;  1AK8 A;  3ZWH A;  4OV2 A;  1TIZ A;  3EK8 A;  4ORC B;  2H61 A;  3RM1 A;  1IQ5 A;  2NXQ A;  2K60 A;  2KAY A;  4MSP A;  4PE0 A;  5KU1 A;  1CFF A;  1Z2C B;  1LA0 A;  3NSO A;  2L5Y A;  4UPG A;  3O2P A;  1OMV A;  2FCD A;  4PHK A;  1LA3 A;  3PSR A;  2WCL A;  4YGE B;  2M7N A;  1QS7 A;  2A4J A;  3SIA A;  1KWO C;  2JT8 A;  3K1E A;  1NIW A;  4ETO A;  1DMO A;  3JVT B;  4MRX A;  1X02 A;  1M46 A;  1LXF C;  4NDD A;  1W7I B;  1WLZ A;  1WY9 A;  1L7Z A;  2KGB C;  1IWQ A;  2PQL A;  3BUM B;  1B4C A;  1Y1X A;  2F3Z A;  3BOW B;  4IL1 A;  5CSF A;  2ERB A;  2M8U A;  2OTG B;  1KFX L;  2ZNE A;  1WDC C;  4PHM A;  3SS4 A;  2KLD A;  1DJG A;  1IQ3 A;  3D77 A;  1XVJ A;  3SG6 A;  1WRZ A;  3TS5 C;  2L50 A;  2PMY A;  3IF7 A;  2QEH A;  1GQM A;  3C1V A;  1OOF A;  3CR5 X;  3CR4 X;  1SL8 A;  3HX4 A;  4HRE E;  1C7V A;  1W9Z A;  4FTG A;  1K90 D;  1IKU A;  1KQM B;  3JTD B;  2P70 A;  3CLN A;  3LLE A;  3SG7 A;  1G4Y R;  1XYD A;  1LS8 A;  1ZMZ A;  2BE4 A;  3S0D A;  1XFV O;  3A8R A;  2LVK A;  1RFJ A;  4OCI A;  2BL0 B;  2RGI A;  1KCY A;  4PT1 A;  1BF5 A;  3KPX A;  5B8I B;  1CFC A;  1KFU S;  3OP0 A;  2LUC A;  2M7L A;  4ORB B;  2WCH A;  1LKJ A;  2KDH A;  1JF0 A;  2FCE A;  5HLV A;  2Y1M A;  4M2O A;  1YX7 A;  3I5G B;  1SCM B;  3S0E A;  3OBV A;  2BKI B;  3RZS A;  3R1V A;  1SY9 A;  3ZNI A;  2L4I A;  1PVA A;  3DYE A;  2G2B A;  3VRQ A;  1DJH A;  1C3Y A;  1C7W A;  2JOJ A;  1DF0 A;  2LVJ A;  3QME A;  1N2D A;  4M2P A;  1RTP 1;  2I7A A;  1QX2 A;  5JOL A;  1Y0V H;  4AOM A;  3O6B A;  3VRR A;  1JC2 A;  1YUR A;  1WRL A;  1SBJ A;  2M1K B;  3AKA A;  5CPV A;  1CLM A;  1D1O A;  2GGZ A;  2EHB A;  3BUN B;  2TN4 A;  1J1E A;  1QXP A;  5ER5 A;  4KYN A;  3KO0 A;  2M1U A;  5J3X A;  3I5F C;  2KAX A;  2E30 A;  4ORA B;  3BQ3 A;  1MHO A;  1OW4 A;  1NYA A;  3LK0 A;  1J7Q A;  4WRI A;  2JWW A;  2FOT A;  2KQ6 A;  3O4X A;  1CMF A;  1OSA A;  3DZT A;  3WHU B;  1PAL A;  3SJS A;  1XK4 A;  3BFH A;  2QPT A;  3I5H B;  3BXK A;  1IH0 A;  3D74 A;  4DRW A;  2K7B A;  1SW8 A;  1V1F A;  4QJ3 B;  2KSP A;  3EVU A;  1MF8 B;  4HSZ A;  1AJ5 A;  4IJ7 A;  2L4H A;  1NCY A;  3K21 A;  3R1O A;  3BUO B;  1JBA A;  1H8B A;  2BCB A;  2PAL A;  1S5G Z;  4NDC A;  2WCK A;  1YTZ C;  1BR4 B;  4U8D A;  4DUQ A;  1NX1 A;  1B7T Z;  1Y6W A;  2LLU A;  1QAT A;  4TNC A;  3B88 A;  5BPJ A;  1QV0 A;  2JQ6 A;  2M3W A;  5AER A;  1OOH A;  4OR9 B;  1EG3 A;  3TUY B;  2YGU A;  1IG5 A;  4MZL A;  1S6C A;  1AUI B;  2K8M B;  1RJV A;  1F70 A;  5FYX A;  1DQE A;  2LNK A;  2H2K A;  1K95 A;  2JZI A;  2LCP A;  1IJ6 A;  2WC5 A;  3OX6 A;  1C07 A;  2KI6 C;  4MEW A;  1UP5 A;  1DJI A;  3KHE A;  1QX5 B;  2KFH A;  1S36 A;  4L9M A;  1K93 D;  1DT7 B;  1CLB A;  5IBW A;  1NP8 A;  2KFG A;  1XFY O;  2KNE A;  1LIN A;  4OKH A;  4N1G A;  1YX8 A;  3TDI A;  3BFB A;  2M49 B;  1TWO A;  4PCW A;  2WCE A;  3PN7 C;  2K61 A;  1TNW A;  1RWY A;  2HQW A;  1R6P A;  1MUX A;  5DIC A;  4USL A;  2KI4 B;  3DY9 A;  4GBA A;  3HCM A;  1AJ4 A;  1TOP A;  2CNP A;  1KFU L;  3MSE B;  4QJ4 B;  3EG5 B;  2OS8 C;  3OB1 B;  3PLF B;  1OOG A;  1CM1 A;  1QWV A;  3IQO A;  3DF0 A;  2PAS A;  3E3R A;  1R2U A;  4GUK A;  4YGB B;  1OZS A;  5HKZ A;  1E8A A;  4Q04 A;  4BY4 A;  4OVN F;  1UHN A;  1IRJ A;  1LVC D;  1A2X A;  2OPO A;  2WCJ A;  5HYD A;  2CBL A;  3UO9 A;  3F45 A;  1GJY A;  4JKT A;  1S6I A;  4ZCU A;  4GGF A;  1L2O C;  1ZAC A;  4JD9 A;  1QTX A;  3CZ2 A;  1MXL C;  1MXE A;  3FE8 A;  1BT6 A;  3S0F A;  2G9B A;  1GM0 A;  3DVJ A;  3NHT A;  1C3Z A;  2L2C A;  2VRG A;  1MWN A;  3PFV A;  3TZ1 A;  2KYC A;  5CSN A;  2JNX A;  2H8V A;  2JXC A;  1UHH A;  2MA2 A;  1DF0 B;  1CDP A;  1DJW A;  1YVL A;  2BEC A;  2QEO A;  4INX A;  1KSO A;  5FI7 A;  2MAZ A;  1S3P A;  1QAS A;  1SR6 C;  4MLW A;  2JTZ A;  1JWD A;  2K0J A;  2M29 A;  2LUX A;  1K8U A;  1CM4 A;  4PE4 A;  4AQI A;  1KWO B;  2Q91 A;  2F2O A;  2ZRS A;  2KAV A;  3OHM B;  2NCP A;  2K7C A;  3M0W A;  3FWC A;  1BLQ A;  2LE9 B;  3AAK A;  3SG5 A;  4WQ2 A;  5AEQ A;  4P2Y B;  1KK7 Z;  2O5G A;  4QJ5 B;  1Y1A A;  1T14 A;  2LAN A;  3SG2 A;  1BU3 A;  1QIW A;  3EKJ A;  3TDU A;  3V2L A;  3CZ0 A;  3TS5 B;  2AAO A;  3GK1 A;  1XFU O;  5HLO A;  2MRD A;  5AAN A;  1PSB A;  3D78 A;  3BFA A;  1CDM A;  3SIB A;  4CFR A;  2ZRT A;  1TN4 A;  2F8P A;  1NX2 A;  3OX5 A;  3NGV A;  1A29 A;  2CT9 A;  4GNK B;  1S26 D;  3BUW B;  1CB1 A;  5DKR A;  4I5K A;  4R1E A;  1CDN A;  1J7O A;  1KK8 C;  3CZT X;  1AVS A;  4PE1 A;  2BL0 C;  2L51 A;  2O60 A;  1YR5 A;  1SKT A;  1NSH A;  3D0Y A;  1NUB A;  3I5I B;  2MBX A;  5KTY A;  3SG4 A;  1MQ1 A;  5AFP A;  1BOC A;  2LVV A;  1A75 A;  1H4B A;  3D75 A;  1QJT A;  3I5G C;  3AKB A;  3S0A A;  3O78 A;  5CSI A;  2KI6 D;  1OMR A;  1JUO A;  1YRT B;  4C0K A;  3Q8I A;  1QV1 A;  3QRX A;  4DS7 A;  2L5X B;  2HET A;  2CCM A;  1AHR A;  5GQQ C;  2KBM A;  1FF1 A;  4PAL A;  3CZ1 A;  5HKW A;  1TNQ A;  3OGN A;  1A4P A;  2F2P A;  1PK0 D;  2NLN A;  5I2Q A;  4DCK A;  2K7D A;  1DEL A;  1F4O A;  3AAJ A;  1DC1 A;  1PUL A;  1PVB A;  4NDB A;  2GTE A;  2JPO A;  1DJX A;  2PSR A;  2LMT A;  2JXL A;  1IIO A;  5JJG A;  3DF0 B;  1ODB A;  2EGD A;  2V53 A;  3D76 A;  1JFJ A;  3I5F B;  2WC6 A;  2JU0 A;  1OE9 B; 
#chains in the Genus database with same CATH homology
 1S5G Y;  3DVK A;  3I5H C;  2KOT A;  2BKH B;  2CTN A;  1B7T Y;  4XJK A;  4N1F A;  1CFP A;  5D69 A;  4YBH B;  1DJZ A;  2NZ0 A;  2BBM A;  2MLF C;  3DVM A;  4D1E A;  1JF2 A;  4MZK A;  1XFZ O;  3NSK A;  3LL8 B;  2H61 C;  2MHH A;  1BJF A;  4PE7 A;  1CNP A;  2AUC A;  3IQQ A;  5CSJ A;  2ZND A;  2KYF A;  1ZFS A;  1B8C A;  1KFX S;  2LAP A;  4A4C A;  2LMV A;  4NQG A;  2EC6 C;  1SL7 A;  1TRF A;  3PAT A;  1M45 A;  3GK2 A;  2JPT A;  1ZUZ A;  1EH2 A;  3DVE A;  4CFQ A;  2WOS A;  3FWB A;  4GGN A;  3EK4 A;  2Y5I A;  1CFD A;  1BMO A;  5TNC A;  5I2L A;  4YRU A;  1M39 A;  1CLL A;  3EVR A;  5F6T A;  4JPZ B;  2COL B;  3CR2 A;  1HT9 A;  4YI9 A;  2ZN8 A;  1FBV A;  1EG4 A;  2B1U A;  4FQO A;  4DIR A;  1GGW A;  1G33 A;  1YUT A;  5I8N A;  1NX0 A;  3PM8 A;  5KSZ A;  1EL4 A;  2LMU A;  2L0P A;  2LM5 A;  3KF9 A;  3PN7 B;  4MN0 A;  2KI4 C;  2JC2 A;  3PAL A;  2ZKM X;  1B47 A;  1UHI A;  4MVF A;  2I2R E;  1KSM A;  1V1G A;  3WXA A;  1EXR A;  1ZOT B;  2HF5 A;  1W7J B;  1F55 A;  2OS8 B;  2JTT A;  2K7O A;  2Y4Q A;  1NCX A;  1FPW A;  1XO5 A;  1N0Y A;  1B8R A;  2L2E A;  5HKY A;  1F8H A;  3D0Y B;  2K2A A;  1WLM A;  1DVI A;  1YRU B;  2LVI A;  1A75 B;  1K9U A;  2I18 A;  1CTR A;  1HQV A;  1QVI Z;  1A03 A;  4HRG A;  4M2Q A;  1L2O B;  1F4Q A;  4ICB A;  1OQP A;  3A4U B;  1UUR A;  3CTN A;  1B9A A;  1YVH A;  3FS7 A;  3OB2 B;  3TDZ A;  3JVT C;  4I5J A;  4JQ0 D;  3WHT B;  1F71 A;  1K94 A;  2WND A;  1TCF A;  3O4Y A;  4XYN A;  1XFX O;  4C0L A;  1KK7 Y;  2ZN9 A;  1UWO A;  1MR8 A;  2OTG C;  1J7P A;  1SR6 B;  1XFW O;  1RRO A;  2KQY A;  1U5I A;  1BR1 B;  2I94 A;  4GPL B;  4YGA A;  1QX7 A;  1SYM A;  1WDC B;  2LLT A;  1UHJ A;  1TNP A;  3LCP C;  4JWQ A;  3EKH A;  4YGD B;  1FI6 A;  2MJW B;  4YGC B;  1QLK A;  1KQM C;  1KQV A;  3NXA A;  1CKK A;  3JTD C;  1XK4 C;  2ZFD A;  4XJK B;  1RK9 A;  2GV5 A;  1EJ3 A;  4WQ3 A;  2KGR A;  2LHI A;  3KEV A;  3ICB A;  2SCP A;  3EVV A;  4GAO A;  1J7R A;  2LLS A;  2BCA A;  3CS1 A;  2HQ8 A;  1SCV A;  2P6B B;  3GOF A;  4YI8 A;  2Y1N A;  2L98 A;  2QAC A;  2MLE C;  1JSA A;  3LK1 A;  1SRA A;  2LHL A;  2GGM A;  1SCM C;  4PDZ A;  1KK8 B;  2JT3 A;  1TCO B;  3BUX B;  2K2F A;  3I5I C;  1YUU A;  1F54 A;  1DGV A;  2R2I A;  3WNX B;  4PHN A;  2LP3 A;  3VRN A;  1IGV A;  4MZJ A;  4N5X A;  1SMG A;  2KHN A;  4PHJ A;  3SG3 A;  2KFF A;  1AP4 A;  1CMG A;  3VRO A;  1WRK A;  5D7F A;  5G08 A;  2CXJ A;  3DD4 A;  1B8L A;  3NSL A;  1IJ5 A;  1JFK A;  4C0J A;  1K9K A;  1QLS A;  1ALW A;  1FW4 A;  1XA5 A;  1K96 A;  3BOW A;  1SNL A;  3GK4 X;  5DKQ A;  1UUS A;  2F3Y A;  3VGO A;  1DTL A;  1G8I A;  1S6J A;  1DJY A;  4MRY A;  1OMD A;  1GGZ A;  3CGA A;  1SK6 D;  5DKN A;  2WC8 A;  2IS9 A;  2JT0 A;  4HRH A;  2Q4U A;  1UHK A;  4MBE A;  2WOR A;  1VRK A;  3NSI A;  1SPY A;  1NWD A;  1QIV A;  2ISD A;  4GGF C;  1REC A;  3TUY C;  4ZCV A;  2DOQ A;  3CWG A;  2BCX A;  4F0Z B;  2HPS A;  4AQJ A;  5PAL A;  2JRF A;  2WCF A;  1NCZ A;  2M0R A;  4BY5 A;  5I2O A;  4CPV A;  1Y1U A;  2SAS A;  3D10 A;  2EC6 B;  1M31 A;  1J55 A;  1OZO A;  1YUS A;  5ER4 X;  3BYA A;  4CLN A;  2E6W A;  1TNX A;  3EK7 A;  2M97 A;  5K89 A;  1DGU A;  1U5I B;  3RLZ A;  1FI5 A;  1TTX A;  4GFT A;  4P5O E;  1N65 A;  1B1G A;  2LV7 A;  1K2H A;  2JUL A;  1Q80 A;  2LC5 A;  2D8N A;  2KBI A;  2PRU A;  2M9G A;  1NPQ A;  1ALV A;  3VRP A;  1J1D A;  1M63 B;  2BBN A;  4I5L B;  5AXI A;  2JNF A;  1OOJ A;  2F33 A;  1CDL A;  2NCO A;  1SL9 A;  2WCB A;  4A4B A;  3FIA A;  1NX3 A;  4CID A;  1PSR A;  1K9P A;  2AMI A;  2PVB A;  2LP2 A;  3H4S E;  1BOD A;  1S1E A;  2BE6 A;  1PRW A;  4E68 A;  4I5N B;  1QVI Y;  1BG1 A;  2FJU B;  1AK8 A;  3ZWH A;  4OV2 A;  1TIZ A;  3EK8 A;  4ORC B;  2H61 A;  3RM1 A;  1IQ5 A;  2NXQ A;  2KAY A;  4MSP A;  4PE0 A;  5KU1 A;  1CFF A;  1LA0 A;  3NSO A;  4UPG A;  3O2P A;  1OMV A;  2FCD A;  4PHK A;  1LA3 A;  3PSR A;  4YGE B;  2M7N A;  1QS7 A;  2A4J A;  3SIA A;  1KWO C;  2JT8 A;  1NIW A;  4ETO A;  1DMO A;  3JVT B;  4MRX A;  1X02 A;  1M46 A;  1LXF C;  4NDD A;  1W7I B;  1WLZ A;  1WY9 A;  1L7Z A;  2KGB C;  1IWQ A;  3BUM B;  1B4C A;  1Y1X A;  2F3Z A;  3BOW B;  4IL1 A;  5CSF A;  2M8U A;  2OTG B;  1KFX L;  2ZNE A;  1WDC C;  4PHM A;  1DJG A;  1IQ3 A;  1XVJ A;  3SG6 A;  1WRZ A;  3TS5 C;  2L50 A;  2PMY A;  1GQM A;  3C1V A;  3CR5 X;  3CR4 X;  1SL8 A;  3HX4 A;  4HRE E;  1C7V A;  4FTG A;  1K90 D;  1IKU A;  1KQM B;  3JTD B;  3CLN A;  3LLE A;  3SG7 A;  1G4Y R;  1XYD A;  1ZMZ A;  2BE4 A;  1XFV O;  3A8R A;  2LVK A;  1RFJ A;  4OCI A;  2BL0 B;  2RGI A;  1KCY A;  1BF5 A;  3KPX A;  5B8I B;  1CFC A;  1KFU S;  3OP0 A;  2LUC A;  2M7L A;  4ORB B;  1LKJ A;  2KDH A;  1JF0 A;  2FCE A;  5HLV A;  2Y1M A;  4M2O A;  1YX7 A;  3I5G B;  1SCM B;  2BKI B;  1SY9 A;  3ZNI A;  2L4I A;  1PVA A;  2G2B A;  3VRQ A;  1DJH A;  1C7W A;  2JOJ A;  1DF0 A;  2LVJ A;  4M2P A;  1N2D A;  1RTP 1;  2I7A A;  1QX2 A;  5JOL A;  1Y0V H;  4AOM A;  3O6B A;  3VRR A;  1JC2 A;  1YUR A;  1WRL A;  1SBJ A;  2M1K B;  3AKA A;  5CPV A;  1CLM A;  1D1O A;  2GGZ A;  2EHB A;  3BUN B;  2TN4 A;  1J1E A;  1QXP A;  5ER5 A;  3KO0 A;  2M1U A;  5J3X A;  3I5F C;  2KAX A;  2E30 A;  4ORA B;  3BQ3 A;  1MHO A;  1NYA A;  3LK0 A;  1J7Q A;  4WRI A;  2JWW A;  2FOT A;  2KQ6 A;  1CMF A;  1OSA A;  3WHU B;  1PAL A;  3SJS A;  1XK4 A;  3I5H B;  2QPT A;  1IH0 A;  3BXK A;  4DRW A;  2K7B A;  1SW8 A;  1V1F A;  4QJ3 B;  2KSP A;  3EVU A;  1MF8 B;  4HSZ A;  1AJ5 A;  2L4H A;  1NCY A;  3K21 A;  3BUO B;  1JBA A;  1H8B A;  2BCB A;  2PAL A;  1S5G Z;  4NDC A;  4U8D A;  1YTZ C;  1BR4 B;  4DUQ A;  1NX1 A;  1B7T Z;  1Y6W A;  2LLU A;  1QAT A;  4TNC A;  5BPJ A;  1QV0 A;  2JQ6 A;  2M3W A;  5AER A;  4OR9 B;  3TUY B;  1EG3 A;  1IG5 A;  4MZL A;  1S6C A;  1AUI B;  2K8M B;  1RJV A;  1F70 A;  5FYX A;  2LNK A;  2H2K A;  1K95 A;  2JZI A;  2LCP A;  1IJ6 A;  3OX6 A;  1C07 A;  2KI6 C;  4MEW A;  1UP5 A;  1DJI A;  3KHE A;  1QX5 B;  2KFH A;  1S36 A;  4L9M A;  1K93 D;  1DT7 B;  1CLB A;  5IBW A;  1NP8 A;  2KFG A;  1XFY O;  2KNE A;  1LIN A;  4OKH A;  4N1G A;  1YX8 A;  3TDI A;  2M49 B;  4PCW A;  2WCE A;  3PN7 C;  2K61 A;  1TNW A;  1RWY A;  2HQW A;  1R6P A;  1MUX A;  4USL A;  2KI4 B;  4GBA A;  3HCM A;  1AJ4 A;  1TOP A;  2CNP A;  1KFU L;  3MSE B;  4QJ4 B;  2OS8 C;  3OB1 B;  3PLF B;  4GUK A;  1CM1 A;  3IQO A;  5CSN A;  3DF0 A;  2PAS A;  3E3R A;  1R2U A;  4YGB B;  1OZS A;  5HKZ A;  1E8A A;  4Q04 A;  4BY4 A;  4OVN F;  1UHN A;  1IRJ A;  1LVC D;  1A2X A;  2OPO A;  5HYD A;  2CBL A;  3F45 A;  1GJY A;  1S6I A;  4ZCU A;  4GGF A;  1L2O C;  1ZAC A;  1QTX A;  1MXL C;  1MXE A;  1BT6 A;  2G9B A;  3DVJ A;  2VRG A;  1MWN A;  3PFV A;  3TZ1 A;  2KYC A;  2JNX A;  2JXC A;  1UHH A;  2MA2 A;  1DF0 B;  1CDP A;  1DJW A;  1YVL A;  2BEC A;  1KSO A;  2MAZ A;  1S3P A;  1QAS A;  1SR6 C;  4MLW A;  2JTZ A;  1JWD A;  2K0J A;  2M29 A;  2LUX A;  1K8U A;  1CM4 A;  4PE4 A;  4AQI A;  1KWO B;  2Q91 A;  2F2O A;  2ZRS A;  2KAV A;  3OHM B;  2NCP A;  2K7C A;  3M0W A;  3FWC A;  1BLQ A;  2LE9 B;  3AAK A;  3SG5 A;  4WQ2 A;  5AEQ A;  4P2Y B;  1KK7 Z;  2O5G A;  4QJ5 B;  1Y1A A;  2LAN A;  3SG2 A;  1BU3 A;  1QIW A;  3EKJ A;  3TDU A;  3TS5 B;  2AAO A;  3GK1 A;  1XFU O;  5HLO A;  2MRD A;  5AAN A;  1PSB A;  1CDM A;  3SIB A;  4CFR A;  2ZRT A;  1TN4 A;  2F8P A;  1NX2 A;  3OX5 A;  4GNK B;  1A29 A;  2CT9 A;  1CB1 A;  1S26 D;  3BUW B;  5DKR A;  4I5K A;  4R1E A;  1CDN A;  1J7O A;  1KK8 C;  3CZT X;  1AVS A;  4PE1 A;  2BL0 C;  2L51 A;  2O60 A;  1YR5 A;  1SKT A;  1NSH A;  3D0Y A;  1NUB A;  3I5I B;  2MBX A;  5KTY A;  3SG4 A;  1MQ1 A;  5AFP A;  1BOC A;  2LVV A;  1A75 A;  1H4B A;  1QJT A;  3I5G C;  3AKB A;  3O78 A;  5CSI A;  2KI6 D;  1OMR A;  1JUO A;  1YRT B;  4C0K A;  1QV1 A;  3QRX A;  4DS7 A;  2L5X B;  2HET A;  2CCM A;  1AHR A;  5GQQ C;  2KBM A;  1FF1 A;  4PAL A;  5HKW A;  1TNQ A;  1A4P A;  2F2P A;  1PK0 D;  2NLN A;  5I2Q A;  4DCK A;  2K7D A;  1F4O A;  3AAJ A;  1PUL A;  1PVB A;  4NDB A;  1DJX A;  2PSR A;  2LMT A;  2JXL A;  5JJG A;  3DF0 B;  1ODB A;  2EGD A;  2V53 A;  1JFJ A;  3I5F B;  3IF7 A;  2JU0 A;  1OE9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...