2KFHA

Structure of the c-terminal domain of ehd1 with fnyestgpftak
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
105
structure length
105
Chain Sequence
GPLGSDDVEWVVGKDKPTYDEIFYTLSPVNGKITGANAKKEMVKSKLPNTVLGKIWKLADVDKDGLLDDEEFALANHLIKVKLEGHELPADLPPHLVPPSKRRHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EH domain-containing protein 1
publication title Structural insight into the interaction of proteins containing NPF, DPF, and GPF motifs with the C-terminal EH-domain of EHD1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 30
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2009-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12763 EF-hand_4 Cytoskeletal-regulatory complex EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2kfhA00
3H4SE 1K93D 2F2PA 3LCPC 1TNWA 1CLMA 2F3YA 1IQ3A 2JT8A 1X02A 2AMIA 1JWDA 2M1KB 4GUKA 1TIZA 1NX0A 1EG3A 3BOWA 1XFYO 2K2FA 2M1UA 1QV0A 2L4IA 3LK0A 1BR1B 1S6CA 4WQ2A 2HPSA 2PVBA 3CWGA 3FIAA 1SRAA 4WRIA 2ZNEA 1UP5A 1PVBA 1WDCB 2JNFA 3SG2A 1CM4A 3SG5A 1LKJA 5ER5A 4AQIA 1QIVA 1WRKA 4PE7A 4MEWA 2CCMA 3O2PA 1FBVA 3CR2A 3SIBA 2M49B 1DJGA 2KNEA 3E3RA 3GK1A 4M2QA 4YBHB 3JVTB 2OTGB 2PSRA 1NP8A 2NCOA 2BKHB 5CSNA 2FJUB 4N1GA 1RK9A 4YGAA 2Y1NA 5DKRA 5KTYA 5CSFA 1WRLA 1YR5A 2KSPA 1QASA 2ZRTA 1SCMC 1UHNA 1NCXA 1XK4A 1XK4C 3I5HC 1KCYA 1SCVA 1K2HA 1YVHA 2LLTA 1GQMA 2WC8A 1YX7A 2KQ6A 1CM1A 4C0JA 3GOFA 2E30A 1YURA 1LXFC 2JOJA 4ZCVA 2MJWB 3D0YB 1WY9A 2FOTA 1J1EA 1SMGA 2M7LA 2SASA 1MXEA 4P2YB 1FF1A 4MN0A 5D7FA 1DJIA 3SG7A 2LNKA 1KQMB 1W7JB 4HREE 4YI9A 2D8NA 2LUXA 1Y1UA 3TUYB 1LA3A 3BYAA 3MSEB 3PALA 4MZKA 4YRUA 1CNPA 2CBLA 3VRPA 4C0KA 1OOJA 1ZACA 1TCOB 1K9UA 1SK6D 2L0PA 2BCAA 1DJZA 4BY5A 1S6IA 3WXAA 1KWOC 2L50A 1TTXA 4MRXA 1CFPA 2FCDA 3SJSA 1SBJA 1OMVA 1C7VA 1RJVA 5AFPA 2LE9B 5DKQA 1UHIA 1QV1A 5F6TA 2LVKA 1F55A 1NX3A 1Y6WA 1WDCC 2WCBA 1QX7A 1YTZC 1NSHA 2F8PA 4JPZB 1CLLA 1Y1XA 3OHMB 2KAXA 1S36A 1YUSA 3I5GB 1ZFSA 4XYNA 2ZRSA 1ALWA 2MHHA 1IJ6A 3CR5X 3JVTC 2OTGC 3DVMA 1KFUL 3WHTB 2L98A 3PM8A 4YGBB 5CSJA 1CFDA 1C7WA 4PHMA 3VROA 3EKJA 3VRRA 4AQJA 1W7IB 1K94A 3OX6A 3A8RA 4CIDA 1ODBA 2GGMA 3WNXB 1OQPA 1AJ5A 5HKWA 1IJ5A 4NDCA 3EVRA 3TS5C 1KK8B 1LINA 3D0YA 1IH0A 1J7QA 1MR8A 1J7RA 1KK7Z 1M31A 3BUXB 3KF9A 2EC6B 1F8HA 1JF2A 1CMGA 3IQQA 1XFZO 1SL7A 4I5KA 2M7NA 4XJKB 4P5OE 1KQMC 1OE9B 4CFQA 3A4UB 1SNLA 2H2KA 2WCFA 3BUNB 2G9BA 5AXIA 1TNPA 4AOMA 4CPVA 4DIRA 1IRJA 1EL4A 1A29A 1SPYA 1K90D 2KI4B 2SCPA 2OS8C 4L9MA 3VRNA 2JXCA 3C1VA 1XFVO 1DVIA 1PRWA 1PSBA 2QPTA 3KEVA 1B7TY 2LLSA 4DCKA 1E8AA 1SKTA 1TNQA 4OR9B 2EHBA 1KWOB 1M39A 2IS9A 1DJXA 2V53A 5HKZA 4ICBA 1S6JA 1C07A 1ZMZA 3DF0A 1FW4A 3ZNIA 4DUQA 3AAKA 5AANA 1K96A 3I5GC 2JU0A 3SG4A 1FPWA 1S1EA 1DGVA 4GNKB 1RFJA 1S5GY 2LUCA 2LP2A 4QJ4B 2I94A 4U8DA 2LV7A 5DKNA 1KSOA 3FWBA 1K9KA 2BCXA 1IGVA 2JPTA 4PHJA 2BE6A 2HETA 1N2DA 2HQWA 2M9GA 2WCEA 2A4JA 3EKHA 3EVVA 2ISDA 3NSIA 1CLBA 1KK8C 1S3PA 3F45A 5TNCA 4A4BA 1XFWO 2P6BB 5IBWA 1QX2A 3BQ3A 1B9AA 2WOSA 4HRHA 2EC6C 1FI5A 1F4QA 4XJKA 1MXLC 3PATA 3TS5B 1V1FA 2L51A 1TNXA 1VRKA 3FWCA 1AVSA 1TN4A 4E68A 1UHHA 4NDBA 2NXQA 2L2EA 2JTZA 4FQOA 3CLNA 4PCWA 2NLNA 3EK8A 1GJYA 2LVVA 2Y1MA 3NXAA 1G8IA 2L4HA 2HQ8A 2KI4C 1PK0D 1B1GA 1U5IA 3OB2B 2K7DA 2MA2A 5FYXA 4OV2A 1R2UA 1UUSA 2I18A 3CR4X 1QTXA 1HT9A 1Y0VH 4PE4A 4GPLB 4YGEB 2OS8B 1AJ4A 1BU3A 1NWDA 3VRQA 1J7OA 1PULA 2LANA 5I2QA 3NSKA 4I5JA 1DMOA 2KBMA 1MQ1A 2OPOA 2AAOA 2KQYA 3WHUB 4ORAB 2CNPA 1JBAA 1XFXO 3CS1A 4ETOA 1GGZA 4QJ3B 4WQ3A 2BBNA 2DOQA 5B8IB 2Q4UA 1BLQA 1QJTA 1K9PA 3EK4A 1OMRA 2JQ6A 1CDMA 3DF0B 3K21A 4BY4A 1TOPA 5AERA 1B4CA 1OSAA 1UHJA 1A2XA 1QS7A 1JSAA 5HLOA 1K8UA 2O5GA 1XO5A 1LVCD 1QVIZ 2AUCA 3TDZA 4YGDB 2KFHA 1R6PA 2MLEC 3PN7C 4OKHA 2COLB 1L7ZA 2M29A 2PRUA 1YRTB 3LK1A 5JOLA 4PALA 4M2OA 3EVUA 1NIWA 2KGBC 1KFXS 1QVIY 4Q04A 1CKKA 2KOTA 2LHIA 2ZN8A 3CGAA 3SG6A 2M97A 2ZNDA 2NZ0A 1A75A 1AHRA 1BF5A 2G2BA 3AKBA 2Y4QA 1CFFA 4FTGA 4USLA 1QATA 1NUBA 2KAYA 1K95A 3TDIA 1PVAA 2WNDA 1GGWA 2BL0B 1M45A 1B7TZ 1YUTA 2JT3A 3EK7A 2LHLA 4OVNF 1PALA 2K7BA 1JFKA 5HKYA 1H8BA 1B8CA 1YVLA 1F71A 1YUUA 4GBAA 5D69A 3SG3A 3O4YA 1U5IB 2HF5A 5AEQA 4MVFA 4JQ0D 4R1EA 4CFRA 2K7CA 3OP0A 1CDLA 4ORCB 1BT6A 1DGUA 1SYMA 5I2OA 1BJFA 2JT0A 3SIAA 1SL9A 3OB1B 4UPGA 1S5GZ 2BECA 1TCFA 1RECA 3RLZA 2R2IA 1F70A 4HRGA 2CT9A 1SR6B 2KFFA 4HSZA 4D1EA 2KYFA 3DVEA 2KYCA 4PHKA 2Y5IA 3I5IB 4NQGA 2VRGA 2LMVA 1B47A 1AK8A 3BUWB 1N65A 2EGDA 4MLWA 1DJYA 4I5LB 3M0WA 5HLVA 3IQOA 1UWOA 1QX5B 2E6WA 5ER4X 3I5FB 2FCEA 2H61A 2H61C 3CTNA 2KAVA 1J55A 1JUOA 2BCBA 2PALA 1EXRA 3TDUA 4GGNA 2GGZA 1WRZA 1XA5A 4MZJA 2RGIA 3NSLA 1DT7B 1QLSA 3BXKA 1DF0A 1MHOA 3PN7B 5HYDA 2QACA 1SL8A 3OX5A 2KBIA 2M3WA 1JF0A 2O60A 5CSIA 2I2RE 1MUXA 1RROA 1S26D 1F54A 1Q80A 1UHKA 2B1UA 1MF8B 1NX1A 2JXLA 1L2OB 2BL0C 1A75B 5PALA 5KU1A 4GGFA 4GGFC 3BUOB 2BE4A 2Q91A 2L5XB 4CLNA 2I7AA 1NPQA 2LMUA 1CTRA 2MAZA 1JC2A 1EG4A 2LC5A 1CDPA 3CZTX 2KHNA 1AUIB 1ZUZA 5BPJA 4MBEA 3LLEA 2PASA 4IL1A 5I2LA 4A4CA 1PSRA 4DS7A 1DJWA 1SW8A 2LP3A 1V1GA 1QLKA 4C0LA 1CB1A 1DJHA 1ZOTB 4GAOA 5CPVA 2MLFC 1UURA 1M63B 1LA0A 4PE0A 1CFCA 2MBXA 3QRXA 1NCZA 1IWQA 1SR6C 1NCYA 3GK2A 3GK4X 1TRFA 3DD4A 3I5IC 2K2AA 3NSOA 4JWQA 1JFJA 3DVKA 2JWWA 2K61A 4QJ5B 1WLMA 3FS7A 4ORBB 1OZOA 1G4YR 1XVJA 2F3ZA 1OMDA 3I5FC 3JTDC 4OCIA 2K8MB 2F33A 4PE1A 1NYAA 1OZSA 4YGCB 2LLUA 1BODA 1IG5A 1YRUB 3LL8B 4MZLA 2KFGA 2JNXA 2LMTA 2MRDA 1B8LA 3AAJA 3DVJA 5K89A 3PSRA 4N5XA 1J7PA 1KFXL 2NCPA 2M8UA 3KPXA 1YX8A 2JZIA 1BR4B 2K0JA 3O6BA 3PFVA 1A03A 2PMYA 1DTLA 2GV5A 4MRYA 4MSPA 3RM1A 5G08A 1J1DA 1G33A 3BOWB 4TNCA 3ZWHA 1BG1A 1DF0B 1XFUO 5I8NA 2BBMA 2JRFA 3D10A 3PLFB 1KSMA 2LM5A 1ALVA 1BOCA 1L2OC 1CMFA 2KGRA 1IKUA 2ZN9A 3HCMA 3ICBA 1QXPA 1FI6A 2LVIA 2KI6D 4I5NB 2KDHA 1AP4A 1KFUS 4PDZA 2K7OA 2F2OA 2JULA 2LAPA 3IF7A 1H4BA 1BMOA 1SY9A 1A4PA 2LVJA 4M2PA 5JJGA 4NDDA 3VGOA 1SCMB 3I5HB 1MWNA 2LCPA 4DRWA 3TZ1A 1NX2A 3KO0A 1M46A 2CTNA 1D1OA 3AKAA 1B8RA 3O78A 2ZKMX 1KQVA 3HX4A 5GQQC 2TN4A 5J3XA 4N1FA 3TUYC 1WLZA 2CXJA 1QIWA 1RTP1 4YI8A 1RWYA 2WORA 3KHEA 1KK7Y 2JC2A 1XYDA 2ZFDA 1F4OA 4ZCUA 5KSZA 1EJ3A 2JTTA 1Y1AA 1N0YA 2KI6C 1EH2A 3JTDB 1HQVA 4GFTA 2M0RA 4F0ZB 3BUMB 2BKIB 1IQ5A 1CDNA 4PHNA
chains in the Genus database with same CATH superfamily
3H4SE 1K93D 2F2PA 3LCPC 1TNWA 1CLMA 2F3YA 1IQ3A 2JT8A 1X02A 2AMIA 1JWDA 2M1KB 4GUKA 1TIZA 1NX0A 1EG3A 3BOWA 1XFYO 2K2FA 2M1UA 1QV0A 2L4IA 3LK0A 1BR1B 1S6CA 4WQ2A 2HPSA 2PVBA 3CWGA 3FIAA 1SRAA 4WRIA 2ZNEA 1UP5A 1PVBA 1WDCB 2JNFA 3SG2A 1CM4A 3SG5A 1LKJA 5ER5A 4AQIA 1QIVA 1WRKA 2H8VA 4PE7A 4MEWA 2CCMA 3O2PA 1FBVA 3CR2A 3SIBA 2M49B 2WCLA 1DJGA 2KNEA 3E3RA 3GK1A 4M2QA 4YBHB 3JVTB 3CABA 2OTGB 2PSRA 1NP8A 2NCOA 2BKHB 5CSNA 2FJUB 4N1GA 1RK9A 4YGAA 2Y1NA 5DKRA 5KTYA 1P28A 5CSFA 1WRLA 1YR5A 2KSPA 1QASA 3UNWA 5D3OA 2ZRTA 1SCMC 1UHNA 1NCXA 1XK4A 1Z4HA 3K1EA 1XK4C 3I5HC 1KCYA 1SCVA 1K2HA 1YVHA 2LLTA 1DEKA 1GQMA 1YX7A 2WC8A 2KQ6A 1CM1A 4C0JA 3GOFA 2E30A 3B87A 1YURA 1LXFC 2JOJA 4ZCVA 2MJWB 3D0YB 1WY9A 2FOTA 1IIOA 1J1EA 1SMGA 2M7LA 2SASA 1MXEA 4P2YB 1FF1A 4MN0A 5D7FA 1DJIA 3FE8A 2LNKA 3SG7A 1KQMB 1W7JB 4HREE 4YI9A 2D8NA 2LUXA 1Y1UA 3CZ2A 3TUYB 1LA3A 3BYAA 3MSEB 3PALA 4MZKA 3R1OA 4YRUA 1CNPA 2CBLA 3VRPA 4C0KA 1OOJA 1ZACA 1TCOB 1K9UA 1SK6D 2L0PA 2BCAA 1DJZA 4BY5A 1S6IA 3WXAA 1KWOC 2L50A 1TTXA 4MRXA 1CFPA 2FCDA 3SJSA 1SBJA 1OMVA 1C7VA 3FE6A 1RJVA 5AFPA 2LE9B 1TWOA 5DKQA 1UHIA 1QV1A 5F6TA 2L5YA 2LVKA 1F55A 1NX3A 1OOHA 1Y6WA 1WDCC 2WCBA 3V2LA 1QX7A 1YTZC 1NSHA 2F8PA 4JPZB 1CLLA 3S0DA 1Y1XA 3OHMB 2KAXA 1S36A 1YUSA 3I5GB 1ZFSA 4XYNA 2ZRSA 1ALWA 2MHHA 1DQEA 3B88A 1IJ6A 3CR5X 3JVTC 3UO9A 2OTGC 2WCMA 3DVMA 1KFUL 3WHTB 3L4AA 2L98A 3PM8A 4YGBB 3EG5B 5CSJA 1CFDA 1C7WA 4PHMA 3VROA 3EKJA 3VRRA 4AQJA 1W7IB 1K94A 3DZTA 3OX6A 3R72A 3A8RA 4CIDA 1DELA 1ODBA 2GGMA 3WNXB 1OQPA 1AJ5A 5HKWA 1IJ5A 4NDCA 3EVRA 3TS5C 1KK8B 1LINA 3DY9A 3D0YA 5FI7A 3N7HA 1IH0A 1J7QA 3NGVA 1MR8A 1J7RA 4F7FA 1KK7Z 1M31A 3BUXB 3KF9A 2EC6B 1F8HA 1JF2A 1CMGA 3IQQA 3D73A 1XFZO 1SL7A 4I5KA 2M7NA 4XJKB 4P5OE 1KQMC 1OE9B 4CFQA 3A4UB 1SNLA 2H2KA 2WCFA 3BUNB 2G9BA 5AXIA 1OOFA 1TNPA 2WCJA 4INWA 4AOMA 4CPVA 4DIRA 1IRJA 1EL4A 1A29A 1SPYA 1K90D 2KI4B 2SCPA 1DC1A 2OS8C 4L9MA 3VRNA 3D75A 2JXCA 3C1VA 1XFVO 3OGNA 1DVIA 1PRWA 1PSBA 2QPTA 3KEVA 2KLDA 1B7TY 2LLSA 4DCKA 1E8AA 1SKTA 1TUZA 1TNQA 4JD9A 4OR9B 2EHBA 1KWOB 1M39A 2IS9A 1DJXA 2V53A 5HKZA 4ICBA 1S6JA 1C07A 1ZMZA 3DF0A 1FW4A 3ZNIA 4DUQA 3AAKA 5AANA 1K96A 3I5GC 3PJIA 2JU0A 3SG4A 2GTEA 1FPWA 3D76A 1S1EA 1DGVA 4GNKB 1RFJA 1TUJA 1S5GY 2LUCA 2LP2A 3B7AA 4QJ4B 5DICA 2I94A 4U8DA 2LV7A 5DKNA 1KSOA 3FWBA 1K9KA 2BCXA 1IGVA 2JPTA 3L4LA 4PHJA 2BE6A 2HETA 1N2DA 2HQWA 2M9GA 2WCEA 2A4JA 3EKHA 3EVVA 2ISDA 3NSIA 4PT1A 2WC5A 1CLBA 3SS3A 1KK8C 1S3PA 3F45A 5TNCA 4A4BA 1XFWO 2P6BB 5IBWA 1QX2A 3BQ3A 3R1PA 1B9AA 2WOSA 4HRHA 2EC6C 1FI5A 1F4QA 4XJKA 1MXLC 3PATA 3TS5B 1V1FA 2L51A 1TNXA 1VRKA 3FWCA 1AVSA 1TN4A 4E68A 1UHHA 4NDBA 2NXQA 2L2EA 2JTZA 4FQOA 3CLNA 4PCWA 2NLNA 3B86A 3EK8A 1GJYA 2LVVA 2Y1MA 3NXAA 1G8IA 2L4HA 2HQ8A 2KI4C 1PK0D 1B1GA 1U5IA 3CYZA 3OB2B 2K7DA 2MA2A 5FYXA 4OV2A 1R2UA 1UUSA 2I18A 3CR4X 1QTXA 1HT9A 1Y0VH 4PE4A 1GM0A 3IVTA 4GPLB 1XFRA 4YGEB 2OS8B 1AJ4A 1BU3A 1NWDA 4JKTA 3VRQA 1J7OA 1PULA 2LANA 2L2CA 3NSKA 5I2QA 4I5JA 3BFBA 1DMOA 2KBMA 1MQ1A 2OPOA 2AAOA 2KQYA 3WHUB 2BNXA 4ORAB 2CNPA 1JBAA 1XFXO 3CS1A 4ETOA 1GGZA 4QJ3B 4WQ3A 2BBNA 2DOQA 5B8IB 2Q4UA 1BLQA 1QJTA 1K9PA 3EK4A 1OMRA 2JQ6A 1CDMA 3DF0B 3K21A 4BY4A 1TOPA 5AERA 1B4CA 1OSAA 3CZ1A 1UHJA 1A2XA 1QS7A 1JSAA 1W9ZA 5HLOA 1K8UA 2O5GA 1XO5A 1LVCD 1QVIZ 3R1VA 3SS4A 2AUCA 3TDZA 3S0BA 4YGDB 2KFHA 1R6PA 3DYEA 2MLEC 3PN7C 4OKHA 2COLB 1L7ZA 2M29A 2PRUA 1YRTB 3LK1A 5JOLA 4PALA 4M2OA 2K60A 3EVUA 1NIWA 3B6XA 2KGBC 1KFXS 1QVIY 3OBVA 4Q04A 3L47A 1CKKA 2KOTA 2LHIA 2ZN8A 3CGAA 3SG6A 1Z2CB 2M97A 2ZNDA 4OZDA 2NZ0A 1A75A 1AHRA 1BF5A 2G2BA 3AKBA 2Y4QA 5HL1A 4FTGA 1CFFA 4USLA 1QATA 3D77A 1NUBA 2KAYA 4INXA 1K95A 3BJHA 3TDIA 1PVAA 2WNDA 4KYNA 1GGWA 2BL0B 1M45A 1B7TZ 1YUTA 2JT3A 3EK7A 2LHLA 4OVNF 1PALA 2K7BA 2ERBA 1JFKA 3S0AA 5HKYA 1H8BA 1B8CA 1YVLA 1F71A 1YUUA 4GBAA 5D69A 2QDIA 3SG3A 3O4YA 1U5IB 2HF5A 5AEQA 4MVFA 4JQ0D 4R1EA 4CFRA 2K7CA 3OP0A 1CDLA 3CZ0A 4ORCB 1BT6A 1DGUA 1SYMA 5I2OA 1BJFA 1OOIX 2JT0A 3SIAA 1SL9A 3OB1B 4UPGA 1S5GZ 3FE9A 2BECA 1TCFA 2BAPA 1RECA 3RLZA 2R2IA 1F70A 4HRGA 2CT9A 3S0EA 1SR6B 2KFFA 4HSZA 4D1EA 2KYFA 3DVEA 2KYCA 4PHKA 2Y5IA 3I5IB 4NQGA 2VRGA 2FJYA 2LMVA 1B47A 1AK8A 3BUWB 1N65A 2EGDA 4MLWA 1DJYA 1C3YA 4I5LB 3M0WA 3NHTA 5HLVA 3IQOA 1UWOA 1QX5B 2E6WA 5ER4X 3I5FB 2FCEA 1QWVA 2H61A 2H61C 3CTNA 2KAVA 1J55A 1JUOA 2BCBA 2JPOA 2QEBA 2PALA 1EXRA 3TDUA 4GGNA 2GGZA 1WRZA 1XA5A 4MZJA 2RGIA 3BFAA 3NSLA 1DT7B 1QLSA 3BXKA 1DF0A 1MHOA 3PN7B 5HYDA 2QACA 1SL8A 3OX5A 2KBIA 2M3WA 1JF0A 2O60A 5CSIA 2I2RE 2WCKA 1MUXA 1RROA 1S26D 1F54A 1Q80A 1LS8A 1UHKA 2B1UA 1MF8B 1NX1A 3VB1A 3S0FA 2QEVA 2JXLA 1L2OB 2BL0C 1A75B 2P71A 5EL2A 5PALA 5I94A 5KU1A 4GGFA 4GGFC 3BUOB 2BE4A 2Q91A 2L5XB 1OOGA 4CLNA 2I7AA 1NPQA 2LMUA 1CTRA 2MAZA 1JC2A 1EG4A 2LC5A 1CDPA 3CZTX 2KHNA 1AUIB 1ZUZA 5BPJA 4MBEA 3LLEA 2KPHA 2PASA 4IL1A 5I2LA 4A4CA 3RZSA 1PSRA 4DS7A 1DJWA 5FI6A 1SW8A 2LP3A 1V1GA 1QLKA 4C0LA 4FQTA 1CB1A 1DJHA 1ZOTB 2QEOA 4GAOA 5CPVA 2MLFC 2PYQA 1UURA 1M63B 1LA0A 4PE0A 1CFCA 2MBXA 2PQLA 1NCZA 3D74A 3QRXA 1IWQA 1SR6C 1NCYA 3GK2A 3GK4X 1TRFA 3DD4A 3I5IC 3BFHA 3CDNA 2K2AA 3NSOA 4JWQA 1JFJA 3DVKA 2JWWA 2K61A 4QJ5B 2P70A 1WLMA 3FS7A 4ORBB 1OZOA 1G4YR 1XVJA 2F3ZA 3SS5A 1OMDA 3I5FC 3JTDC 4OCIA 2K8MB 2F33A 4PE1A 1NYAA 1OZSA 3O4XA 4YGCB 2LLUA 2KLEA 1BODA 1IG5A 1YRUB 3LL8B 4MZLA 1OW4A 2KFGA 3QMEA 2JNXA 2LMTA 2MRDA 1B8LA 3AAJA 3DVJA 5K89A 3PSRA 4N5XA 1J7PA 1KFXL 2NCPA 3PM2A 2M8UA 3KPXA 1ORGA 1YX8A 2JZIA 1BR4B 1C3ZA 2K0JA 3O6BA 3PFVA 1A03A 2PMYA 1DTLA 2GV5A 4MRYA 4MSPA 3RM1A 5G08A 1J1DA 4IJ7A 1G33A 3BOWB 4TNCA 3ZWHA 1BG1A 1DF0B 1XFUO 5I8NA 3Q8IA 2BBMA 2JRFA 3D10A 3PLFB 1KSMA 2LM5A 1ALVA 1BOCA 1L2OC 1CMFA 2QEHA 2KGRA 1IKUA 2ZN9A 3HCMA 3ICBA 2WCHA 1QXPA 1FI6A 2LVIA 2KI6D 4I5NB 2KDHA 1AP4A 3NHIA 1KFUS 4PDZA 1SSEB 2F2OA 2K7OA 3D78A 2JULA 2LAPA 3IF7A 1H4BA 1BMOA 1SY9A 1A4PA 2LVJA 4M2PA 3S0GA 5JJGA 4NDDA 3VGOA 1SCMB 3I5HB 1MWNA 2LCPA 4DRWA 3TZ1A 1NX2A 3KO0A 1M46A 2CTNA 1D1OA 3AKAA 1B8RA 3O78A 2ZKMX 2YGUA 1KQVA 3HX4A 5GQQC 2TN4A 5J3XA 4N1FA 3TUYC 1WLZA 2CXJA 3DXLA 1QIWA 1RTP1 4YI8A 5FI2A 1RWYA 2WORA 3KHEA 1KK7Y 2JC2A 1T14A 1XYDA 2ZFDA 1F4OA 4ZCUA 5KSZA 1EJ3A 2WC6A 2JTTA 1Y1AA 1N0YA 2KI6C 1EH2A 3JTDB 1HQVA 4GFTA 2M0RA 4F0ZB 3BUMB 2BKIB 1IQ5A 1CDNA 4PHNA
chains in the Genus database with same CATH topology
3H4SE 1K93D 2F2PA 3LCPC 1TNWA 1CLMA 2F3YA 1IQ3A 2JT8A 1X02A 2AMIA 1JWDA 2M1KB 4GUKA 1TIZA 1NX0A 1EG3A 3BOWA 1XFYO 2K2FA 2M1UA 1QV0A 2L4IA 3LK0A 1BR1B 1S6CA 4WQ2A 2HPSA 2PVBA 3CWGA 3FIAA 1SRAA 4WRIA 2ZNEA 1UP5A 1PVBA 1WDCB 2JNFA 3SG2A 1CM4A 3SG5A 1LKJA 5ER5A 4AQIA 1QIVA 1WRKA 4PE7A 4MEWA 2CCMA 3O2PA 1FBVA 3CR2A 3SIBA 2M49B 1DJGA 2KNEA 3E3RA 3GK1A 4M2QA 4YBHB 3JVTB 2OTGB 2PSRA 1NP8A 2NCOA 2BKHB 5CSNA 2FJUB 4N1GA 1RK9A 4YGAA 2Y1NA 5DKRA 5KTYA 5CSFA 1WRLA 1YR5A 2KSPA 1QASA 2ZRTA 1SCMC 1UHNA 1NCXA 1XK4A 1XK4C 3I5HC 1KCYA 1SCVA 1K2HA 1YVHA 2LLTA 1GQMA 2WC8A 1YX7A 2KQ6A 1CM1A 4C0JA 3GOFA 2E30A 1YURA 1LXFC 2JOJA 4ZCVA 2MJWB 3D0YB 1WY9A 2FOTA 1J1EA 1SMGA 2M7LA 2SASA 1MXEA 4P2YB 1FF1A 4MN0A 5D7FA 1DJIA 3SG7A 2LNKA 1KQMB 1W7JB 4HREE 4YI9A 2D8NA 2LUXA 1Y1UA 3TUYB 1LA3A 3BYAA 3MSEB 3PALA 4MZKA 4YRUA 1CNPA 2CBLA 3VRPA 4C0KA 1OOJA 1ZACA 1TCOB 1K9UA 1SK6D 2L0PA 2BCAA 1DJZA 4BY5A 1S6IA 3WXAA 1KWOC 2L50A 1TTXA 4MRXA 1CFPA 2FCDA 3SJSA 1SBJA 1OMVA 1C7VA 1RJVA 5AFPA 2LE9B 5DKQA 1UHIA 1QV1A 5F6TA 2LVKA 1F55A 1NX3A 1Y6WA 1WDCC 2WCBA 1QX7A 1YTZC 1NSHA 2F8PA 4JPZB 1CLLA 1Y1XA 3OHMB 2KAXA 1S36A 1YUSA 3I5GB 1ZFSA 4XYNA 2ZRSA 1ALWA 2MHHA 1IJ6A 3CR5X 3JVTC 2OTGC 3DVMA 1KFUL 3WHTB 2L98A 3PM8A 4YGBB 5CSJA 1CFDA 1C7WA 4PHMA 3VROA 3EKJA 3VRRA 4AQJA 1W7IB 1K94A 3OX6A 3A8RA 4CIDA 1ODBA 2GGMA 3WNXB 1OQPA 1AJ5A 5HKWA 1IJ5A 4NDCA 3EVRA 3TS5C 1KK8B 1LINA 3D0YA 1IH0A 1J7QA 1MR8A 1J7RA 1KK7Z 1M31A 3BUXB 3KF9A 2EC6B 1F8HA 1JF2A 1CMGA 3IQQA 1XFZO 1SL7A 4I5KA 2M7NA 4XJKB 4P5OE 1KQMC 1OE9B 4CFQA 3A4UB 1SNLA 2H2KA 2WCFA 3BUNB 2G9BA 5AXIA 1TNPA 4AOMA 4CPVA 4DIRA 1IRJA 1EL4A 1A29A 1SPYA 1K90D 2KI4B 2SCPA 2OS8C 4L9MA 3VRNA 2JXCA 3C1VA 1XFVO 1DVIA 1PRWA 1PSBA 2QPTA 3KEVA 1B7TY 2LLSA 4DCKA 1E8AA 1SKTA 1TNQA 4OR9B 2EHBA 1KWOB 1M39A 2IS9A 1DJXA 2V53A 5HKZA 4ICBA 1S6JA 1C07A 1ZMZA 3DF0A 1FW4A 3ZNIA 4DUQA 3AAKA 5AANA 1K96A 3I5GC 2JU0A 3SG4A 1FPWA 1S1EA 1DGVA 4GNKB 1RFJA 1S5GY 2LUCA 2LP2A 4QJ4B 2I94A 4U8DA 2LV7A 5DKNA 1KSOA 3FWBA 1K9KA 2BCXA 1IGVA 2JPTA 4PHJA 2BE6A 2HETA 1N2DA 2HQWA 2M9GA 2WCEA 2A4JA 3EKHA 3EVVA 2ISDA 3NSIA 1CLBA 1KK8C 1S3PA 3F45A 5TNCA 4A4BA 1XFWO 2P6BB 5IBWA 1QX2A 3BQ3A 1B9AA 2WOSA 4HRHA 2EC6C 1FI5A 1F4QA 4XJKA 1MXLC 3PATA 3TS5B 1V1FA 2L51A 1TNXA 1VRKA 3FWCA 1AVSA 1TN4A 4E68A 1UHHA 4NDBA 2NXQA 2L2EA 2JTZA 4FQOA 3CLNA 4PCWA 2NLNA 3EK8A 1GJYA 2LVVA 2Y1MA 3NXAA 1G8IA 2L4HA 2HQ8A 2KI4C 1PK0D 1B1GA 1U5IA 3OB2B 2K7DA 2MA2A 5FYXA 4OV2A 1R2UA 1UUSA 2I18A 3CR4X 1QTXA 1HT9A 1Y0VH 4PE4A 4GPLB 4YGEB 2OS8B 1AJ4A 1BU3A 1NWDA 3VRQA 1J7OA 1PULA 2LANA 5I2QA 3NSKA 4I5JA 1DMOA 2KBMA 1MQ1A 2OPOA 2AAOA 2KQYA 3WHUB 4ORAB 2CNPA 1JBAA 1XFXO 3CS1A 4ETOA 1GGZA 4QJ3B 4WQ3A 2BBNA 2DOQA 5B8IB 2Q4UA 1BLQA 1QJTA 1K9PA 3EK4A 1OMRA 2JQ6A 1CDMA 3DF0B 3K21A 4BY4A 1TOPA 5AERA 1B4CA 1OSAA 1UHJA 1A2XA 1QS7A 1JSAA 5HLOA 1K8UA 2O5GA 1XO5A 1LVCD 1QVIZ 2AUCA 3TDZA 4YGDB 2KFHA 1R6PA 2MLEC 3PN7C 4OKHA 2COLB 1L7ZA 2M29A 2PRUA 1YRTB 3LK1A 5JOLA 4PALA 4M2OA 3EVUA 1NIWA 2KGBC 1KFXS 1QVIY 4Q04A 1CKKA 2KOTA 2LHIA 2ZN8A 3CGAA 3SG6A 2M97A 2ZNDA 2NZ0A 1A75A 1AHRA 1BF5A 2G2BA 3AKBA 2Y4QA 1CFFA 4FTGA 4USLA 1QATA 1NUBA 2KAYA 1K95A 3TDIA 1PVAA 2WNDA 1GGWA 2BL0B 1M45A 1B7TZ 1YUTA 2JT3A 3EK7A 2LHLA 4OVNF 1PALA 2K7BA 1JFKA 5HKYA 1H8BA 1B8CA 1YVLA 1F71A 1YUUA 4GBAA 5D69A 3SG3A 3O4YA 1U5IB 2HF5A 5AEQA 4MVFA 4JQ0D 4R1EA 4CFRA 2K7CA 3OP0A 1CDLA 4ORCB 1BT6A 1DGUA 1SYMA 5I2OA 1BJFA 2JT0A 3SIAA 1SL9A 3OB1B 4UPGA 1S5GZ 2BECA 1TCFA 1RECA 3RLZA 2R2IA 1F70A 4HRGA 2CT9A 1SR6B 2KFFA 4HSZA 4D1EA 2KYFA 3DVEA 2KYCA 4PHKA 2Y5IA 3I5IB 4NQGA 2VRGA 2LMVA 1B47A 1AK8A 3BUWB 1N65A 2EGDA 4MLWA 1DJYA 4I5LB 3M0WA 5HLVA 3IQOA 1UWOA 1QX5B 2E6WA 5ER4X 3I5FB 2FCEA 2H61A 2H61C 3CTNA 2KAVA 1J55A 1JUOA 2BCBA 2PALA 1EXRA 3TDUA 4GGNA 2GGZA 1WRZA 1XA5A 4MZJA 2RGIA 3NSLA 1DT7B 1QLSA 3BXKA 1DF0A 1MHOA 3PN7B 5HYDA 2QACA 1SL8A 3OX5A 2KBIA 2M3WA 1JF0A 2O60A 5CSIA 2I2RE 1MUXA 1RROA 1S26D 1F54A 1Q80A 1UHKA 2B1UA 1MF8B 1NX1A 2JXLA 1L2OB 2BL0C 1A75B 5PALA 5KU1A 4GGFA 4GGFC 3BUOB 2BE4A 2Q91A 2L5XB 4CLNA 2I7AA 1NPQA 2LMUA 1CTRA 2MAZA 1JC2A 1EG4A 2LC5A 1CDPA 3CZTX 2KHNA 1AUIB 1ZUZA 5BPJA 4MBEA 3LLEA 2PASA 4IL1A 5I2LA 4A4CA 1PSRA 4DS7A 1DJWA 1SW8A 2LP3A 1V1GA 1QLKA 4C0LA 1CB1A 1DJHA 1ZOTB 4GAOA 5CPVA 2MLFC 1UURA 1M63B 1LA0A 4PE0A 1CFCA 2MBXA 3QRXA 1NCZA 1IWQA 1SR6C 1NCYA 3GK2A 3GK4X 1TRFA 3DD4A 3I5IC 2K2AA 3NSOA 4JWQA 1JFJA 3DVKA 2JWWA 2K61A 4QJ5B 1WLMA 3FS7A 4ORBB 1OZOA 1G4YR 1XVJA 2F3ZA 1OMDA 3I5FC 3JTDC 4OCIA 2K8MB 2F33A 4PE1A 1NYAA 1OZSA 4YGCB 2LLUA 1BODA 1IG5A 1YRUB 3LL8B 4MZLA 2KFGA 2JNXA 2LMTA 2MRDA 1B8LA 3AAJA 3DVJA 5K89A 3PSRA 4N5XA 1J7PA 1KFXL 2NCPA 2M8UA 3KPXA 1YX8A 2JZIA 1BR4B 2K0JA 3O6BA 3PFVA 1A03A 2PMYA 1DTLA 2GV5A 4MRYA 4MSPA 3RM1A 5G08A 1J1DA 1G33A 3BOWB 4TNCA 3ZWHA 1BG1A 1DF0B 1XFUO 5I8NA 2BBMA 2JRFA 3D10A 3PLFB 1KSMA 2LM5A 1ALVA 1BOCA 1L2OC 1CMFA 2KGRA 1IKUA 2ZN9A 3HCMA 3ICBA 1QXPA 1FI6A 2LVIA 2KI6D 4I5NB 2KDHA 1AP4A 1KFUS 4PDZA 2K7OA 2F2OA 2JULA 2LAPA 3IF7A 1H4BA 1BMOA 1SY9A 1A4PA 2LVJA 4M2PA 5JJGA 4NDDA 3VGOA 1SCMB 3I5HB 1MWNA 2LCPA 4DRWA 3TZ1A 1NX2A 3KO0A 1M46A 2CTNA 1D1OA 3AKAA 1B8RA 3O78A 2ZKMX 1KQVA 3HX4A 5GQQC 2TN4A 5J3XA 4N1FA 3TUYC 1WLZA 2CXJA 1QIWA 1RTP1 4YI8A 1RWYA 2WORA 3KHEA 1KK7Y 2JC2A 1XYDA 2ZFDA 1F4OA 4ZCUA 5KSZA 1EJ3A 2JTTA 1Y1AA 1N0YA 2KI6C 1EH2A 3JTDB 1HQVA 4GFTA 2M0RA 4F0ZB 3BUMB 2BKIB 1IQ5A 1CDNA 4PHNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H4S E;  1K93 D;  2F2P A;  3LCP C;  1TNW A;  1CLM A;  2F3Y A;  1IQ3 A;  2JT8 A;  1X02 A;  2AMI A;  1JWD A;  2M1K B;  4GUK A;  1TIZ A;  1NX0 A;  1EG3 A;  3BOW A;  1XFY O;  2K2F A;  2M1U A;  1QV0 A;  2L4I A;  3LK0 A;  1BR1 B;  1S6C A;  4WQ2 A;  2HPS A;  2PVB A;  3CWG A;  3FIA A;  1SRA A;  4WRI A;  2ZNE A;  1UP5 A;  1PVB A;  1WDC B;  2JNF A;  3SG2 A;  1CM4 A;  3SG5 A;  1LKJ A;  5ER5 A;  4AQI A;  1QIV A;  1WRK A;  4PE7 A;  4MEW A;  2CCM A;  3O2P A;  1FBV A;  3CR2 A;  3SIB A;  2M49 B;  1DJG A;  2KNE A;  3E3R A;  3GK1 A;  4M2Q A;  4YBH B;  3JVT B;  2OTG B;  2PSR A;  1NP8 A;  2NCO A;  2BKH B;  5CSN A;  2FJU B;  4N1G A;  1RK9 A;  4YGA A;  2Y1N A;  5DKR A;  5KTY A;  5CSF A;  1WRL A;  1YR5 A;  2KSP A;  1QAS A;  2ZRT A;  1SCM C;  1UHN A;  1NCX A;  1XK4 A;  1XK4 C;  3I5H C;  1KCY A;  1SCV A;  1K2H A;  1YVH A;  2LLT A;  1GQM A;  2WC8 A;  1YX7 A;  2KQ6 A;  1CM1 A;  4C0J A;  3GOF A;  2E30 A;  1YUR A;  1LXF C;  2JOJ A;  4ZCV A;  2MJW B;  3D0Y B;  1WY9 A;  2FOT A;  1J1E A;  1SMG A;  2M7L A;  2SAS A;  1MXE A;  4P2Y B;  1FF1 A;  4MN0 A;  5D7F A;  1DJI A;  3SG7 A;  2LNK A;  1KQM B;  1W7J B;  4HRE E;  4YI9 A;  2D8N A;  2LUX A;  1Y1U A;  3TUY B;  1LA3 A;  3BYA A;  3MSE B;  3PAL A;  4MZK A;  4YRU A;  1CNP A;  2CBL A;  3VRP A;  4C0K A;  1OOJ A;  1ZAC A;  1TCO B;  1K9U A;  1SK6 D;  2L0P A;  2BCA A;  1DJZ A;  4BY5 A;  1S6I A;  3WXA A;  1KWO C;  2L50 A;  1TTX A;  4MRX A;  1CFP A;  2FCD A;  3SJS A;  1SBJ A;  1OMV A;  1C7V A;  1RJV A;  5AFP A;  2LE9 B;  5DKQ A;  1UHI A;  1QV1 A;  5F6T A;  2LVK A;  1F55 A;  1NX3 A;  1Y6W A;  1WDC C;  2WCB A;  1QX7 A;  1YTZ C;  1NSH A;  2F8P A;  4JPZ B;  1CLL A;  1Y1X A;  3OHM B;  2KAX A;  1S36 A;  1YUS A;  3I5G B;  1ZFS A;  4XYN A;  2ZRS A;  1ALW A;  2MHH A;  1IJ6 A;  3CR5 X;  3JVT C;  2OTG C;  3DVM A;  1KFU L;  3WHT B;  2L98 A;  3PM8 A;  4YGB B;  5CSJ A;  1CFD A;  1C7W A;  4PHM A;  3VRO A;  3EKJ A;  3VRR A;  4AQJ A;  1W7I B;  1K94 A;  3OX6 A;  3A8R A;  4CID A;  1ODB A;  2GGM A;  3WNX B;  1OQP A;  1AJ5 A;  5HKW A;  1IJ5 A;  4NDC A;  3EVR A;  3TS5 C;  1KK8 B;  1LIN A;  3D0Y A;  1IH0 A;  1J7Q A;  1MR8 A;  1J7R A;  1KK7 Z;  1M31 A;  3BUX B;  3KF9 A;  2EC6 B;  1F8H A;  1JF2 A;  1CMG A;  3IQQ A;  1XFZ O;  1SL7 A;  4I5K A;  2M7N A;  4XJK B;  4P5O E;  1KQM C;  1OE9 B;  4CFQ A;  3A4U B;  1SNL A;  2H2K A;  2WCF A;  3BUN B;  2G9B A;  5AXI A;  1TNP A;  4AOM A;  4CPV A;  4DIR A;  1IRJ A;  1EL4 A;  1A29 A;  1SPY A;  1K90 D;  2KI4 B;  2SCP A;  2OS8 C;  4L9M A;  3VRN A;  2JXC A;  3C1V A;  1XFV O;  1DVI A;  1PRW A;  1PSB A;  2QPT A;  3KEV A;  1B7T Y;  2LLS A;  4DCK A;  1E8A A;  1SKT A;  1TNQ A;  4OR9 B;  2EHB A;  1KWO B;  1M39 A;  2IS9 A;  1DJX A;  2V53 A;  5HKZ A;  4ICB A;  1S6J A;  1C07 A;  1ZMZ A;  3DF0 A;  1FW4 A;  3ZNI A;  4DUQ A;  3AAK A;  5AAN A;  1K96 A;  3I5G C;  2JU0 A;  3SG4 A;  1FPW A;  1S1E A;  1DGV A;  4GNK B;  1RFJ A;  1S5G Y;  2LUC A;  2LP2 A;  4QJ4 B;  2I94 A;  4U8D A;  2LV7 A;  5DKN A;  1KSO A;  3FWB A;  1K9K A;  2BCX A;  1IGV A;  2JPT A;  4PHJ A;  2BE6 A;  2HET A;  1N2D A;  2HQW A;  2M9G A;  2WCE A;  2A4J A;  3EKH A;  3EVV A;  2ISD A;  3NSI A;  1CLB A;  1KK8 C;  1S3P A;  3F45 A;  5TNC A;  4A4B A;  1XFW O;  2P6B B;  5IBW A;  1QX2 A;  3BQ3 A;  1B9A A;  2WOS A;  4HRH A;  2EC6 C;  1FI5 A;  1F4Q A;  4XJK A;  1MXL C;  3PAT A;  3TS5 B;  1V1F A;  2L51 A;  1TNX A;  1VRK A;  3FWC A;  1AVS A;  1TN4 A;  4E68 A;  1UHH A;  4NDB A;  2NXQ A;  2L2E A;  2JTZ A;  4FQO A;  3CLN A;  4PCW A;  2NLN A;  3EK8 A;  1GJY A;  2LVV A;  2Y1M A;  3NXA A;  1G8I A;  2L4H A;  2HQ8 A;  2KI4 C;  1PK0 D;  1B1G A;  1U5I A;  3OB2 B;  2K7D A;  2MA2 A;  5FYX A;  4OV2 A;  1R2U A;  1UUS A;  2I18 A;  3CR4 X;  1QTX A;  1HT9 A;  1Y0V H;  4PE4 A;  4GPL B;  4YGE B;  2OS8 B;  1AJ4 A;  1BU3 A;  1NWD A;  3VRQ A;  1J7O A;  1PUL A;  2LAN A;  5I2Q A;  3NSK A;  4I5J A;  1DMO A;  2KBM A;  1MQ1 A;  2OPO A;  2AAO A;  2KQY A;  3WHU B;  4ORA B;  2CNP A;  1JBA A;  1XFX O;  3CS1 A;  4ETO A;  1GGZ A;  4QJ3 B;  4WQ3 A;  2BBN A;  2DOQ A;  5B8I B;  2Q4U A;  1BLQ A;  1QJT A;  1K9P A;  3EK4 A;  1OMR A;  2JQ6 A;  1CDM A;  3DF0 B;  3K21 A;  4BY4 A;  1TOP A;  5AER A;  1B4C A;  1OSA A;  1UHJ A;  1A2X A;  1QS7 A;  1JSA A;  5HLO A;  1K8U A;  2O5G A;  1XO5 A;  1LVC D;  1QVI Z;  2AUC A;  3TDZ A;  4YGD B;  2KFH A;  1R6P A;  2MLE C;  3PN7 C;  4OKH A;  2COL B;  1L7Z A;  2M29 A;  2PRU A;  1YRT B;  3LK1 A;  5JOL A;  4PAL A;  4M2O A;  3EVU A;  1NIW A;  2KGB C;  1KFX S;  1QVI Y;  4Q04 A;  1CKK A;  2KOT A;  2LHI A;  2ZN8 A;  3CGA A;  3SG6 A;  2M97 A;  2ZND A;  2NZ0 A;  1A75 A;  1AHR A;  1BF5 A;  2G2B A;  3AKB A;  2Y4Q A;  1CFF A;  4FTG A;  4USL A;  1QAT A;  1NUB A;  2KAY A;  1K95 A;  3TDI A;  1PVA A;  2WND A;  1GGW A;  2BL0 B;  1M45 A;  1B7T Z;  1YUT A;  2JT3 A;  3EK7 A;  2LHL A;  4OVN F;  1PAL A;  2K7B A;  1JFK A;  5HKY A;  1H8B A;  1B8C A;  1YVL A;  1F71 A;  1YUU A;  4GBA A;  5D69 A;  3SG3 A;  3O4Y A;  1U5I B;  2HF5 A;  5AEQ A;  4MVF A;  4JQ0 D;  4R1E A;  4CFR A;  2K7C A;  3OP0 A;  1CDL A;  4ORC B;  1BT6 A;  1DGU A;  1SYM A;  5I2O A;  1BJF A;  2JT0 A;  3SIA A;  1SL9 A;  3OB1 B;  4UPG A;  1S5G Z;  2BEC A;  1TCF A;  1REC A;  3RLZ A;  2R2I A;  1F70 A;  4HRG A;  2CT9 A;  1SR6 B;  2KFF A;  4HSZ A;  4D1E A;  2KYF A;  3DVE A;  2KYC A;  4PHK A;  2Y5I A;  3I5I B;  4NQG A;  2VRG A;  2LMV A;  1B47 A;  1AK8 A;  3BUW B;  1N65 A;  2EGD A;  4MLW A;  1DJY A;  4I5L B;  3M0W A;  5HLV A;  3IQO A;  1UWO A;  1QX5 B;  2E6W A;  5ER4 X;  3I5F B;  2FCE A;  2H61 A;  2H61 C;  3CTN A;  2KAV A;  1J55 A;  1JUO A;  2BCB A;  2PAL A;  1EXR A;  3TDU A;  4GGN A;  2GGZ A;  1WRZ A;  1XA5 A;  4MZJ A;  2RGI A;  3NSL A;  1DT7 B;  1QLS A;  3BXK A;  1DF0 A;  1MHO A;  3PN7 B;  5HYD A;  2QAC A;  1SL8 A;  3OX5 A;  2KBI A;  2M3W A;  1JF0 A;  2O60 A;  5CSI A;  2I2R E;  1MUX A;  1RRO A;  1S26 D;  1F54 A;  1Q80 A;  1UHK A;  2B1U A;  1MF8 B;  1NX1 A;  2JXL A;  1L2O B;  2BL0 C;  1A75 B;  5PAL A;  5KU1 A;  4GGF A;  4GGF C;  3BUO B;  2BE4 A;  2Q91 A;  2L5X B;  4CLN A;  2I7A A;  1NPQ A;  2LMU A;  1CTR A;  2MAZ A;  1JC2 A;  1EG4 A;  2LC5 A;  1CDP A;  3CZT X;  2KHN A;  1AUI B;  1ZUZ A;  5BPJ A;  4MBE A;  3LLE A;  2PAS A;  4IL1 A;  5I2L A;  4A4C A;  1PSR A;  4DS7 A;  1DJW A;  1SW8 A;  2LP3 A;  1V1G A;  1QLK A;  4C0L A;  1CB1 A;  1DJH A;  1ZOT B;  4GAO A;  5CPV A;  2MLF C;  1UUR A;  1M63 B;  1LA0 A;  4PE0 A;  1CFC A;  2MBX A;  3QRX A;  1NCZ A;  1IWQ A;  1SR6 C;  1NCY A;  3GK2 A;  3GK4 X;  1TRF A;  3DD4 A;  3I5I C;  2K2A A;  3NSO A;  4JWQ A;  1JFJ A;  3DVK A;  2JWW A;  2K61 A;  4QJ5 B;  1WLM A;  3FS7 A;  4ORB B;  1OZO A;  1G4Y R;  1XVJ A;  2F3Z A;  1OMD A;  3I5F C;  3JTD C;  4OCI A;  2K8M B;  2F33 A;  4PE1 A;  1NYA A;  1OZS A;  4YGC B;  2LLU A;  1BOD A;  1IG5 A;  1YRU B;  3LL8 B;  4MZL A;  2KFG A;  2JNX A;  2LMT A;  2MRD A;  1B8L A;  3AAJ A;  3DVJ A;  5K89 A;  3PSR A;  4N5X A;  1J7P A;  1KFX L;  2NCP A;  2M8U A;  3KPX A;  1YX8 A;  2JZI A;  1BR4 B;  2K0J A;  3O6B A;  3PFV A;  1A03 A;  2PMY A;  1DTL A;  2GV5 A;  4MRY A;  4MSP A;  3RM1 A;  5G08 A;  1J1D A;  1G33 A;  3BOW B;  4TNC A;  3ZWH A;  1BG1 A;  1DF0 B;  1XFU O;  5I8N A;  2BBM A;  2JRF A;  3D10 A;  3PLF B;  1KSM A;  2LM5 A;  1ALV A;  1BOC A;  1L2O C;  1CMF A;  2KGR A;  1IKU A;  2ZN9 A;  3HCM A;  3ICB A;  1QXP A;  1FI6 A;  2LVI A;  2KI6 D;  4I5N B;  2KDH A;  1AP4 A;  1KFU S;  4PDZ A;  2K7O A;  2F2O A;  2JUL A;  2LAP A;  3IF7 A;  1H4B A;  1BMO A;  1SY9 A;  1A4P A;  2LVJ A;  4M2P A;  5JJG A;  4NDD A;  3VGO A;  1SCM B;  3I5H B;  1MWN A;  2LCP A;  4DRW A;  3TZ1 A;  1NX2 A;  3KO0 A;  1M46 A;  2CTN A;  1D1O A;  3AKA A;  1B8R A;  3O78 A;  2ZKM X;  1KQV A;  3HX4 A;  5GQQ C;  2TN4 A;  5J3X A;  4N1F A;  3TUY C;  1WLZ A;  2CXJ A;  1QIW A;  1RTP 1;  4YI8 A;  1RWY A;  2WOR A;  3KHE A;  1KK7 Y;  2JC2 A;  1XYD A;  2ZFD A;  1F4O A;  4ZCU A;  5KSZ A;  1EJ3 A;  2JTT A;  1Y1A A;  1N0Y A;  2KI6 C;  1EH2 A;  3JTD B;  1HQV A;  4GFT A;  2M0R A;  4F0Z B;  3BUM B;  2BKI B;  1IQ5 A;  1CDN A;  4PHN A; 
#chains in the Genus database with same CATH topology
 3H4S E;  1K93 D;  2F2P A;  3LCP C;  1TNW A;  1CLM A;  2F3Y A;  1IQ3 A;  2JT8 A;  1X02 A;  2AMI A;  1JWD A;  2M1K B;  4GUK A;  1TIZ A;  1NX0 A;  1EG3 A;  3BOW A;  1XFY O;  2K2F A;  2M1U A;  1QV0 A;  2L4I A;  3LK0 A;  1BR1 B;  1S6C A;  4WQ2 A;  2HPS A;  2PVB A;  3CWG A;  3FIA A;  1SRA A;  4WRI A;  2ZNE A;  1UP5 A;  1PVB A;  1WDC B;  2JNF A;  3SG2 A;  1CM4 A;  3SG5 A;  1LKJ A;  5ER5 A;  4AQI A;  1QIV A;  1WRK A;  2H8V A;  4PE7 A;  4MEW A;  2CCM A;  3O2P A;  1FBV A;  3CR2 A;  3SIB A;  2M49 B;  2WCL A;  1DJG A;  2KNE A;  3E3R A;  3GK1 A;  4M2Q A;  4YBH B;  3JVT B;  3CAB A;  2OTG B;  2PSR A;  1NP8 A;  2NCO A;  2BKH B;  5CSN A;  2FJU B;  4N1G A;  1RK9 A;  4YGA A;  2Y1N A;  5DKR A;  5KTY A;  1P28 A;  5CSF A;  1WRL A;  1YR5 A;  2KSP A;  1QAS A;  3UNW A;  5D3O A;  2ZRT A;  1SCM C;  1UHN A;  1NCX A;  1XK4 A;  1Z4H A;  3K1E A;  1XK4 C;  3I5H C;  1KCY A;  1SCV A;  1K2H A;  1YVH A;  2LLT A;  1DEK A;  1GQM A;  1YX7 A;  2WC8 A;  2KQ6 A;  1CM1 A;  4C0J A;  3GOF A;  2E30 A;  3B87 A;  1YUR A;  1LXF C;  2JOJ A;  4ZCV A;  2MJW B;  3D0Y B;  1WY9 A;  2FOT A;  1IIO A;  1J1E A;  1SMG A;  2M7L A;  2SAS A;  1MXE A;  4P2Y B;  1FF1 A;  4MN0 A;  5D7F A;  1DJI A;  3FE8 A;  2LNK A;  3SG7 A;  1KQM B;  1W7J B;  4HRE E;  4YI9 A;  2D8N A;  2LUX A;  1Y1U A;  3CZ2 A;  3TUY B;  1LA3 A;  3BYA A;  3MSE B;  3PAL A;  4MZK A;  3R1O A;  4YRU A;  1CNP A;  2CBL A;  3VRP A;  4C0K A;  1OOJ A;  1ZAC A;  1TCO B;  1K9U A;  1SK6 D;  2L0P A;  2BCA A;  1DJZ A;  4BY5 A;  1S6I A;  3WXA A;  1KWO C;  2L50 A;  1TTX A;  4MRX A;  1CFP A;  2FCD A;  3SJS A;  1SBJ A;  1OMV A;  1C7V A;  3FE6 A;  1RJV A;  5AFP A;  2LE9 B;  1TWO A;  5DKQ A;  1UHI A;  1QV1 A;  5F6T A;  2L5Y A;  2LVK A;  1F55 A;  1NX3 A;  1OOH A;  1Y6W A;  1WDC C;  2WCB A;  3V2L A;  1QX7 A;  1YTZ C;  1NSH A;  2F8P A;  4JPZ B;  1CLL A;  3S0D A;  1Y1X A;  3OHM B;  2KAX A;  1S36 A;  1YUS A;  3I5G B;  1ZFS A;  4XYN A;  2ZRS A;  1ALW A;  2MHH A;  1DQE A;  3B88 A;  1IJ6 A;  3CR5 X;  3JVT C;  3UO9 A;  2OTG C;  2WCM A;  3DVM A;  1KFU L;  3WHT B;  3L4A A;  2L98 A;  3PM8 A;  4YGB B;  3EG5 B;  5CSJ A;  1CFD A;  1C7W A;  4PHM A;  3VRO A;  3EKJ A;  3VRR A;  4AQJ A;  1W7I B;  1K94 A;  3DZT A;  3OX6 A;  3R72 A;  3A8R A;  4CID A;  1DEL A;  1ODB A;  2GGM A;  3WNX B;  1OQP A;  1AJ5 A;  5HKW A;  1IJ5 A;  4NDC A;  3EVR A;  3TS5 C;  1KK8 B;  1LIN A;  3DY9 A;  3D0Y A;  5FI7 A;  3N7H A;  1IH0 A;  1J7Q A;  3NGV A;  1MR8 A;  1J7R A;  4F7F A;  1KK7 Z;  1M31 A;  3BUX B;  3KF9 A;  2EC6 B;  1F8H A;  1JF2 A;  1CMG A;  3IQQ A;  3D73 A;  1XFZ O;  1SL7 A;  4I5K A;  2M7N A;  4XJK B;  4P5O E;  1KQM C;  1OE9 B;  4CFQ A;  3A4U B;  1SNL A;  2H2K A;  2WCF A;  3BUN B;  2G9B A;  5AXI A;  1OOF A;  1TNP A;  2WCJ A;  4INW A;  4AOM A;  4CPV A;  4DIR A;  1IRJ A;  1EL4 A;  1A29 A;  1SPY A;  1K90 D;  2KI4 B;  2SCP A;  1DC1 A;  2OS8 C;  4L9M A;  3VRN A;  3D75 A;  2JXC A;  3C1V A;  1XFV O;  3OGN A;  1DVI A;  1PRW A;  1PSB A;  2QPT A;  3KEV A;  2KLD A;  1B7T Y;  2LLS A;  4DCK A;  1E8A A;  1SKT A;  1TUZ A;  1TNQ A;  4JD9 A;  4OR9 B;  2EHB A;  1KWO B;  1M39 A;  2IS9 A;  1DJX A;  2V53 A;  5HKZ A;  4ICB A;  1S6J A;  1C07 A;  1ZMZ A;  3DF0 A;  1FW4 A;  3ZNI A;  4DUQ A;  3AAK A;  5AAN A;  1K96 A;  3I5G C;  3PJI A;  2JU0 A;  3SG4 A;  2GTE A;  1FPW A;  3D76 A;  1S1E A;  1DGV A;  4GNK B;  1RFJ A;  1TUJ A;  1S5G Y;  2LUC A;  2LP2 A;  3B7A A;  4QJ4 B;  5DIC A;  2I94 A;  4U8D A;  2LV7 A;  5DKN A;  1KSO A;  3FWB A;  1K9K A;  2BCX A;  1IGV A;  2JPT A;  3L4L A;  4PHJ A;  2BE6 A;  2HET A;  1N2D A;  2HQW A;  2M9G A;  2WCE A;  2A4J A;  3EKH A;  3EVV A;  2ISD A;  3NSI A;  4PT1 A;  2WC5 A;  1CLB A;  3SS3 A;  1KK8 C;  1S3P A;  3F45 A;  5TNC A;  4A4B A;  1XFW O;  2P6B B;  5IBW A;  1QX2 A;  3BQ3 A;  3R1P A;  1B9A A;  2WOS A;  4HRH A;  2EC6 C;  1FI5 A;  1F4Q A;  4XJK A;  1MXL C;  3PAT A;  3TS5 B;  1V1F A;  2L51 A;  1TNX A;  1VRK A;  3FWC A;  1AVS A;  1TN4 A;  4E68 A;  1UHH A;  4NDB A;  2NXQ A;  2L2E A;  2JTZ A;  4FQO A;  3CLN A;  4PCW A;  2NLN A;  3B86 A;  3EK8 A;  1GJY A;  2LVV A;  2Y1M A;  3NXA A;  1G8I A;  2L4H A;  2HQ8 A;  2KI4 C;  1PK0 D;  1B1G A;  1U5I A;  3CYZ A;  3OB2 B;  2K7D A;  2MA2 A;  5FYX A;  4OV2 A;  1R2U A;  1UUS A;  2I18 A;  3CR4 X;  1QTX A;  1HT9 A;  1Y0V H;  4PE4 A;  1GM0 A;  3IVT A;  4GPL B;  1XFR A;  4YGE B;  2OS8 B;  1AJ4 A;  1BU3 A;  1NWD A;  4JKT A;  3VRQ A;  1J7O A;  1PUL A;  2LAN A;  2L2C A;  3NSK A;  5I2Q A;  4I5J A;  3BFB A;  1DMO A;  2KBM A;  1MQ1 A;  2OPO A;  2AAO A;  2KQY A;  3WHU B;  2BNX A;  4ORA B;  2CNP A;  1JBA A;  1XFX O;  3CS1 A;  4ETO A;  1GGZ A;  4QJ3 B;  4WQ3 A;  2BBN A;  2DOQ A;  5B8I B;  2Q4U A;  1BLQ A;  1QJT A;  1K9P A;  3EK4 A;  1OMR A;  2JQ6 A;  1CDM A;  3DF0 B;  3K21 A;  4BY4 A;  1TOP A;  5AER A;  1B4C A;  1OSA A;  3CZ1 A;  1UHJ A;  1A2X A;  1QS7 A;  1JSA A;  1W9Z A;  5HLO A;  1K8U A;  2O5G A;  1XO5 A;  1LVC D;  1QVI Z;  3R1V A;  3SS4 A;  2AUC A;  3TDZ A;  3S0B A;  4YGD B;  2KFH A;  1R6P A;  3DYE A;  2MLE C;  3PN7 C;  4OKH A;  2COL B;  1L7Z A;  2M29 A;  2PRU A;  1YRT B;  3LK1 A;  5JOL A;  4PAL A;  4M2O A;  2K60 A;  3EVU A;  1NIW A;  3B6X A;  2KGB C;  1KFX S;  1QVI Y;  3OBV A;  4Q04 A;  3L47 A;  1CKK A;  2KOT A;  2LHI A;  2ZN8 A;  3CGA A;  3SG6 A;  1Z2C B;  2M97 A;  2ZND A;  4OZD A;  2NZ0 A;  1A75 A;  1AHR A;  1BF5 A;  2G2B A;  3AKB A;  2Y4Q A;  5HL1 A;  4FTG A;  1CFF A;  4USL A;  1QAT A;  3D77 A;  1NUB A;  2KAY A;  4INX A;  1K95 A;  3BJH A;  3TDI A;  1PVA A;  2WND A;  4KYN A;  1GGW A;  2BL0 B;  1M45 A;  1B7T Z;  1YUT A;  2JT3 A;  3EK7 A;  2LHL A;  4OVN F;  1PAL A;  2K7B A;  2ERB A;  1JFK A;  3S0A A;  5HKY A;  1H8B A;  1B8C A;  1YVL A;  1F71 A;  1YUU A;  4GBA A;  5D69 A;  2QDI A;  3SG3 A;  3O4Y A;  1U5I B;  2HF5 A;  5AEQ A;  4MVF A;  4JQ0 D;  4R1E A;  4CFR A;  2K7C A;  3OP0 A;  1CDL A;  3CZ0 A;  4ORC B;  1BT6 A;  1DGU A;  1SYM A;  5I2O A;  1BJF A;  1OOI X;  2JT0 A;  3SIA A;  1SL9 A;  3OB1 B;  4UPG A;  1S5G Z;  3FE9 A;  2BEC A;  1TCF A;  2BAP A;  1REC A;  3RLZ A;  2R2I A;  1F70 A;  4HRG A;  2CT9 A;  3S0E A;  1SR6 B;  2KFF A;  4HSZ A;  4D1E A;  2KYF A;  3DVE A;  2KYC A;  4PHK A;  2Y5I A;  3I5I B;  4NQG A;  2VRG A;  2FJY A;  2LMV A;  1B47 A;  1AK8 A;  3BUW B;  1N65 A;  2EGD A;  4MLW A;  1DJY A;  1C3Y A;  4I5L B;  3M0W A;  3NHT A;  5HLV A;  3IQO A;  1UWO A;  1QX5 B;  2E6W A;  5ER4 X;  3I5F B;  2FCE A;  1QWV A;  2H61 A;  2H61 C;  3CTN A;  2KAV A;  1J55 A;  1JUO A;  2BCB A;  2JPO A;  2QEB A;  2PAL A;  1EXR A;  3TDU A;  4GGN A;  2GGZ A;  1WRZ A;  1XA5 A;  4MZJ A;  2RGI A;  3BFA A;  3NSL A;  1DT7 B;  1QLS A;  3BXK A;  1DF0 A;  1MHO A;  3PN7 B;  5HYD A;  2QAC A;  1SL8 A;  3OX5 A;  2KBI A;  2M3W A;  1JF0 A;  2O60 A;  5CSI A;  2I2R E;  2WCK A;  1MUX A;  1RRO A;  1S26 D;  1F54 A;  1Q80 A;  1LS8 A;  1UHK A;  2B1U A;  1MF8 B;  1NX1 A;  3VB1 A;  3S0F A;  2QEV A;  2JXL A;  1L2O B;  2BL0 C;  1A75 B;  2P71 A;  5EL2 A;  5PAL A;  5I94 A;  5KU1 A;  4GGF A;  4GGF C;  3BUO B;  2BE4 A;  2Q91 A;  2L5X B;  1OOG A;  4CLN A;  2I7A A;  1NPQ A;  2LMU A;  1CTR A;  2MAZ A;  1JC2 A;  1EG4 A;  2LC5 A;  1CDP A;  3CZT X;  2KHN A;  1AUI B;  1ZUZ A;  5BPJ A;  4MBE A;  3LLE A;  2KPH A;  2PAS A;  4IL1 A;  5I2L A;  4A4C A;  3RZS A;  1PSR A;  4DS7 A;  1DJW A;  5FI6 A;  1SW8 A;  2LP3 A;  1V1G A;  1QLK A;  4C0L A;  4FQT A;  1CB1 A;  1DJH A;  1ZOT B;  2QEO A;  4GAO A;  5CPV A;  2MLF C;  2PYQ A;  1UUR A;  1M63 B;  1LA0 A;  4PE0 A;  1CFC A;  2MBX A;  2PQL A;  1NCZ A;  3D74 A;  3QRX A;  1IWQ A;  1SR6 C;  1NCY A;  3GK2 A;  3GK4 X;  1TRF A;  3DD4 A;  3I5I C;  3BFH A;  3CDN A;  2K2A A;  3NSO A;  4JWQ A;  1JFJ A;  3DVK A;  2JWW A;  2K61 A;  4QJ5 B;  2P70 A;  1WLM A;  3FS7 A;  4ORB B;  1OZO A;  1G4Y R;  1XVJ A;  2F3Z A;  3SS5 A;  1OMD A;  3I5F C;  3JTD C;  4OCI A;  2K8M B;  2F33 A;  4PE1 A;  1NYA A;  1OZS A;  3O4X A;  4YGC B;  2LLU A;  2KLE A;  1BOD A;  1IG5 A;  1YRU B;  3LL8 B;  4MZL A;  1OW4 A;  2KFG A;  3QME A;  2JNX A;  2LMT A;  2MRD A;  1B8L A;  3AAJ A;  3DVJ A;  5K89 A;  3PSR A;  4N5X A;  1J7P A;  1KFX L;  2NCP A;  3PM2 A;  2M8U A;  3KPX A;  1ORG A;  1YX8 A;  2JZI A;  1BR4 B;  1C3Z A;  2K0J A;  3O6B A;  3PFV A;  1A03 A;  2PMY A;  1DTL A;  2GV5 A;  4MRY A;  4MSP A;  3RM1 A;  5G08 A;  1J1D A;  4IJ7 A;  1G33 A;  3BOW B;  4TNC A;  3ZWH A;  1BG1 A;  1DF0 B;  1XFU O;  5I8N A;  3Q8I A;  2BBM A;  2JRF A;  3D10 A;  3PLF B;  1KSM A;  2LM5 A;  1ALV A;  1BOC A;  1L2O C;  1CMF A;  2QEH A;  2KGR A;  1IKU A;  2ZN9 A;  3HCM A;  3ICB A;  2WCH A;  1QXP A;  1FI6 A;  2LVI A;  2KI6 D;  4I5N B;  2KDH A;  1AP4 A;  3NHI A;  1KFU S;  4PDZ A;  1SSE B;  2F2O A;  2K7O A;  3D78 A;  2JUL A;  2LAP A;  3IF7 A;  1H4B A;  1BMO A;  1SY9 A;  1A4P A;  2LVJ A;  4M2P A;  3S0G A;  5JJG A;  4NDD A;  3VGO A;  1SCM B;  3I5H B;  1MWN A;  2LCP A;  4DRW A;  3TZ1 A;  1NX2 A;  3KO0 A;  1M46 A;  2CTN A;  1D1O A;  3AKA A;  1B8R A;  3O78 A;  2ZKM X;  2YGU A;  1KQV A;  3HX4 A;  5GQQ C;  2TN4 A;  5J3X A;  4N1F A;  3TUY C;  1WLZ A;  2CXJ A;  3DXL A;  1QIW A;  1RTP 1;  4YI8 A;  5FI2 A;  1RWY A;  2WOR A;  3KHE A;  1KK7 Y;  2JC2 A;  1T14 A;  1XYD A;  2ZFD A;  1F4O A;  4ZCU A;  5KSZ A;  1EJ3 A;  2WC6 A;  2JTT A;  1Y1A A;  1N0Y A;  2KI6 C;  1EH2 A;  3JTD B;  1HQV A;  4GFT A;  2M0R A;  4F0Z B;  3BUM B;  2BKI B;  1IQ5 A;  1CDN A;  4PHN A; 
#chains in the Genus database with same CATH homology
 3H4S E;  1K93 D;  2F2P A;  3LCP C;  1TNW A;  1CLM A;  2F3Y A;  1IQ3 A;  2JT8 A;  1X02 A;  2AMI A;  1JWD A;  2M1K B;  4GUK A;  1TIZ A;  1NX0 A;  1EG3 A;  3BOW A;  1XFY O;  2K2F A;  2M1U A;  1QV0 A;  2L4I A;  3LK0 A;  1BR1 B;  1S6C A;  4WQ2 A;  2HPS A;  2PVB A;  3CWG A;  3FIA A;  1SRA A;  4WRI A;  2ZNE A;  1UP5 A;  1PVB A;  1WDC B;  2JNF A;  3SG2 A;  1CM4 A;  3SG5 A;  1LKJ A;  5ER5 A;  4AQI A;  1QIV A;  1WRK A;  4PE7 A;  4MEW A;  2CCM A;  3O2P A;  1FBV A;  3CR2 A;  3SIB A;  2M49 B;  1DJG A;  2KNE A;  3E3R A;  3GK1 A;  4M2Q A;  4YBH B;  3JVT B;  2OTG B;  2PSR A;  1NP8 A;  2NCO A;  2BKH B;  5CSN A;  2FJU B;  4N1G A;  1RK9 A;  4YGA A;  2Y1N A;  5DKR A;  5KTY A;  5CSF A;  1WRL A;  1YR5 A;  2KSP A;  1QAS A;  2ZRT A;  1SCM C;  1UHN A;  1NCX A;  1XK4 A;  1XK4 C;  3I5H C;  1KCY A;  1SCV A;  1K2H A;  1YVH A;  2LLT A;  1GQM A;  2WC8 A;  1YX7 A;  2KQ6 A;  1CM1 A;  4C0J A;  3GOF A;  2E30 A;  1YUR A;  1LXF C;  2JOJ A;  4ZCV A;  2MJW B;  3D0Y B;  1WY9 A;  2FOT A;  1J1E A;  1SMG A;  2M7L A;  2SAS A;  1MXE A;  4P2Y B;  1FF1 A;  4MN0 A;  5D7F A;  1DJI A;  3SG7 A;  2LNK A;  1KQM B;  1W7J B;  4HRE E;  4YI9 A;  2D8N A;  2LUX A;  1Y1U A;  3TUY B;  1LA3 A;  3BYA A;  3MSE B;  3PAL A;  4MZK A;  4YRU A;  1CNP A;  2CBL A;  3VRP A;  4C0K A;  1OOJ A;  1ZAC A;  1TCO B;  1K9U A;  1SK6 D;  2L0P A;  2BCA A;  1DJZ A;  4BY5 A;  1S6I A;  3WXA A;  1KWO C;  2L50 A;  1TTX A;  4MRX A;  1CFP A;  2FCD A;  3SJS A;  1SBJ A;  1OMV A;  1C7V A;  1RJV A;  5AFP A;  2LE9 B;  5DKQ A;  1UHI A;  1QV1 A;  5F6T A;  2LVK A;  1F55 A;  1NX3 A;  1Y6W A;  1WDC C;  2WCB A;  1QX7 A;  1YTZ C;  1NSH A;  2F8P A;  4JPZ B;  1CLL A;  1Y1X A;  3OHM B;  2KAX A;  1S36 A;  1YUS A;  3I5G B;  1ZFS A;  4XYN A;  2ZRS A;  1ALW A;  2MHH A;  1IJ6 A;  3CR5 X;  3JVT C;  2OTG C;  3DVM A;  1KFU L;  3WHT B;  2L98 A;  3PM8 A;  4YGB B;  5CSJ A;  1CFD A;  1C7W A;  4PHM A;  3VRO A;  3EKJ A;  3VRR A;  4AQJ A;  1W7I B;  1K94 A;  3OX6 A;  3A8R A;  4CID A;  1ODB A;  2GGM A;  3WNX B;  1OQP A;  1AJ5 A;  5HKW A;  1IJ5 A;  4NDC A;  3EVR A;  3TS5 C;  1KK8 B;  1LIN A;  3D0Y A;  1IH0 A;  1J7Q A;  1MR8 A;  1J7R A;  1KK7 Z;  1M31 A;  3BUX B;  3KF9 A;  2EC6 B;  1F8H A;  1JF2 A;  1CMG A;  3IQQ A;  1XFZ O;  1SL7 A;  4I5K A;  2M7N A;  4XJK B;  4P5O E;  1KQM C;  1OE9 B;  4CFQ A;  3A4U B;  1SNL A;  2H2K A;  2WCF A;  3BUN B;  2G9B A;  5AXI A;  1TNP A;  4AOM A;  4CPV A;  4DIR A;  1IRJ A;  1EL4 A;  1A29 A;  1SPY A;  1K90 D;  2KI4 B;  2SCP A;  2OS8 C;  4L9M A;  3VRN A;  2JXC A;  3C1V A;  1XFV O;  1DVI A;  1PRW A;  1PSB A;  2QPT A;  3KEV A;  1B7T Y;  2LLS A;  4DCK A;  1E8A A;  1SKT A;  1TNQ A;  4OR9 B;  2EHB A;  1KWO B;  1M39 A;  2IS9 A;  1DJX A;  2V53 A;  5HKZ A;  4ICB A;  1S6J A;  1C07 A;  1ZMZ A;  3DF0 A;  1FW4 A;  3ZNI A;  4DUQ A;  3AAK A;  5AAN A;  1K96 A;  3I5G C;  2JU0 A;  3SG4 A;  1FPW A;  1S1E A;  1DGV A;  4GNK B;  1RFJ A;  1S5G Y;  2LUC A;  2LP2 A;  4QJ4 B;  2I94 A;  4U8D A;  2LV7 A;  5DKN A;  1KSO A;  3FWB A;  1K9K A;  2BCX A;  1IGV A;  2JPT A;  4PHJ A;  2BE6 A;  2HET A;  1N2D A;  2HQW A;  2M9G A;  2WCE A;  2A4J A;  3EKH A;  3EVV A;  2ISD A;  3NSI A;  1CLB A;  1KK8 C;  1S3P A;  3F45 A;  5TNC A;  4A4B A;  1XFW O;  2P6B B;  5IBW A;  1QX2 A;  3BQ3 A;  1B9A A;  2WOS A;  4HRH A;  2EC6 C;  1FI5 A;  1F4Q A;  4XJK A;  1MXL C;  3PAT A;  3TS5 B;  1V1F A;  2L51 A;  1TNX A;  1VRK A;  3FWC A;  1AVS A;  1TN4 A;  4E68 A;  1UHH A;  4NDB A;  2NXQ A;  2L2E A;  2JTZ A;  4FQO A;  3CLN A;  4PCW A;  2NLN A;  3EK8 A;  1GJY A;  2LVV A;  2Y1M A;  3NXA A;  1G8I A;  2L4H A;  2HQ8 A;  2KI4 C;  1PK0 D;  1B1G A;  1U5I A;  3OB2 B;  2K7D A;  2MA2 A;  5FYX A;  4OV2 A;  1R2U A;  1UUS A;  2I18 A;  3CR4 X;  1QTX A;  1HT9 A;  1Y0V H;  4PE4 A;  4GPL B;  4YGE B;  2OS8 B;  1AJ4 A;  1BU3 A;  1NWD A;  3VRQ A;  1J7O A;  1PUL A;  2LAN A;  5I2Q A;  3NSK A;  4I5J A;  1DMO A;  2KBM A;  1MQ1 A;  2OPO A;  2AAO A;  2KQY A;  3WHU B;  4ORA B;  2CNP A;  1JBA A;  1XFX O;  3CS1 A;  4ETO A;  1GGZ A;  4QJ3 B;  4WQ3 A;  2BBN A;  2DOQ A;  5B8I B;  2Q4U A;  1BLQ A;  1QJT A;  1K9P A;  3EK4 A;  1OMR A;  2JQ6 A;  1CDM A;  3DF0 B;  3K21 A;  4BY4 A;  1TOP A;  5AER A;  1B4C A;  1OSA A;  1UHJ A;  1A2X A;  1QS7 A;  1JSA A;  5HLO A;  1K8U A;  2O5G A;  1XO5 A;  1LVC D;  1QVI Z;  2AUC A;  3TDZ A;  4YGD B;  2KFH A;  1R6P A;  2MLE C;  3PN7 C;  4OKH A;  2COL B;  1L7Z A;  2M29 A;  2PRU A;  1YRT B;  3LK1 A;  5JOL A;  4PAL A;  4M2O A;  3EVU A;  1NIW A;  2KGB C;  1KFX S;  1QVI Y;  4Q04 A;  1CKK A;  2KOT A;  2LHI A;  2ZN8 A;  3CGA A;  3SG6 A;  2M97 A;  2ZND A;  2NZ0 A;  1A75 A;  1AHR A;  1BF5 A;  2G2B A;  3AKB A;  2Y4Q A;  1CFF A;  4FTG A;  4USL A;  1QAT A;  1NUB A;  2KAY A;  1K95 A;  3TDI A;  1PVA A;  2WND A;  1GGW A;  2BL0 B;  1M45 A;  1B7T Z;  1YUT A;  2JT3 A;  3EK7 A;  2LHL A;  4OVN F;  1PAL A;  2K7B A;  1JFK A;  5HKY A;  1H8B A;  1B8C A;  1YVL A;  1F71 A;  1YUU A;  4GBA A;  5D69 A;  3SG3 A;  3O4Y A;  1U5I B;  2HF5 A;  5AEQ A;  4MVF A;  4JQ0 D;  4R1E A;  4CFR A;  2K7C A;  3OP0 A;  1CDL A;  4ORC B;  1BT6 A;  1DGU A;  1SYM A;  5I2O A;  1BJF A;  2JT0 A;  3SIA A;  1SL9 A;  3OB1 B;  4UPG A;  1S5G Z;  2BEC A;  1TCF A;  1REC A;  3RLZ A;  2R2I A;  1F70 A;  4HRG A;  2CT9 A;  1SR6 B;  2KFF A;  4HSZ A;  4D1E A;  2KYF A;  3DVE A;  2KYC A;  4PHK A;  2Y5I A;  3I5I B;  4NQG A;  2VRG A;  2LMV A;  1B47 A;  1AK8 A;  3BUW B;  1N65 A;  2EGD A;  4MLW A;  1DJY A;  4I5L B;  3M0W A;  5HLV A;  3IQO A;  1UWO A;  1QX5 B;  2E6W A;  5ER4 X;  3I5F B;  2FCE A;  2H61 A;  2H61 C;  3CTN A;  2KAV A;  1J55 A;  1JUO A;  2BCB A;  2PAL A;  1EXR A;  3TDU A;  4GGN A;  2GGZ A;  1WRZ A;  1XA5 A;  4MZJ A;  2RGI A;  3NSL A;  1DT7 B;  1QLS A;  3BXK A;  1DF0 A;  1MHO A;  3PN7 B;  5HYD A;  2QAC A;  1SL8 A;  3OX5 A;  2KBI A;  2M3W A;  1JF0 A;  2O60 A;  5CSI A;  2I2R E;  1MUX A;  1RRO A;  1S26 D;  1F54 A;  1Q80 A;  1UHK A;  2B1U A;  1MF8 B;  1NX1 A;  2JXL A;  1L2O B;  2BL0 C;  1A75 B;  5PAL A;  5KU1 A;  4GGF A;  4GGF C;  3BUO B;  2BE4 A;  2Q91 A;  2L5X B;  4CLN A;  2I7A A;  1NPQ A;  2LMU A;  1CTR A;  2MAZ A;  1JC2 A;  1EG4 A;  2LC5 A;  1CDP A;  3CZT X;  2KHN A;  1AUI B;  1ZUZ A;  5BPJ A;  4MBE A;  3LLE A;  2PAS A;  4IL1 A;  5I2L A;  4A4C A;  1PSR A;  4DS7 A;  1DJW A;  1SW8 A;  2LP3 A;  1V1G A;  1QLK A;  4C0L A;  1CB1 A;  1DJH A;  1ZOT B;  4GAO A;  5CPV A;  2MLF C;  1UUR A;  1M63 B;  1LA0 A;  4PE0 A;  1CFC A;  2MBX A;  3QRX A;  1NCZ A;  1IWQ A;  1SR6 C;  1NCY A;  3GK2 A;  3GK4 X;  1TRF A;  3DD4 A;  3I5I C;  2K2A A;  3NSO A;  4JWQ A;  1JFJ A;  3DVK A;  2JWW A;  2K61 A;  4QJ5 B;  1WLM A;  3FS7 A;  4ORB B;  1OZO A;  1G4Y R;  1XVJ A;  2F3Z A;  1OMD A;  3I5F C;  3JTD C;  4OCI A;  2K8M B;  2F33 A;  4PE1 A;  1NYA A;  1OZS A;  4YGC B;  2LLU A;  1BOD A;  1IG5 A;  1YRU B;  3LL8 B;  4MZL A;  2KFG A;  2JNX A;  2LMT A;  2MRD A;  1B8L A;  3AAJ A;  3DVJ A;  5K89 A;  3PSR A;  4N5X A;  1J7P A;  1KFX L;  2NCP A;  2M8U A;  3KPX A;  1YX8 A;  2JZI A;  1BR4 B;  2K0J A;  3O6B A;  3PFV A;  1A03 A;  2PMY A;  1DTL A;  2GV5 A;  4MRY A;  4MSP A;  3RM1 A;  5G08 A;  1J1D A;  1G33 A;  3BOW B;  4TNC A;  3ZWH A;  1BG1 A;  1DF0 B;  1XFU O;  5I8N A;  2BBM A;  2JRF A;  3D10 A;  3PLF B;  1KSM A;  2LM5 A;  1ALV A;  1BOC A;  1L2O C;  1CMF A;  2KGR A;  1IKU A;  2ZN9 A;  3HCM A;  3ICB A;  1QXP A;  1FI6 A;  2LVI A;  2KI6 D;  4I5N B;  2KDH A;  1AP4 A;  1KFU S;  4PDZ A;  2K7O A;  2F2O A;  2JUL A;  2LAP A;  3IF7 A;  1H4B A;  1BMO A;  1SY9 A;  1A4P A;  2LVJ A;  4M2P A;  5JJG A;  4NDD A;  3VGO A;  1SCM B;  3I5H B;  1MWN A;  2LCP A;  4DRW A;  3TZ1 A;  1NX2 A;  3KO0 A;  1M46 A;  2CTN A;  1D1O A;  3AKA A;  1B8R A;  3O78 A;  2ZKM X;  1KQV A;  3HX4 A;  5GQQ C;  2TN4 A;  5J3X A;  4N1F A;  3TUY C;  1WLZ A;  2CXJ A;  1QIW A;  1RTP 1;  4YI8 A;  1RWY A;  2WOR A;  3KHE A;  1KK7 Y;  2JC2 A;  1XYD A;  2ZFD A;  1F4O A;  4ZCU A;  5KSZ A;  1EJ3 A;  2JTT A;  1Y1A A;  1N0Y A;  2KI6 C;  1EH2 A;  3JTD B;  1HQV A;  4GFT A;  2M0R A;  4F0Z B;  3BUM B;  2BKI B;  1IQ5 A;  1CDN A;  4PHN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...