2M0RA

Solution structure and dynamics of human s100a14
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
104
structure length
104
Chain Sequence
b'MGQCRSANAEDAQEFSDVERAIETLIKNFHQYSVEGGKETLTPSELRDLVTQQLPHLMPSNCGLEEKIANLGSCNDSKLEFRSFWELIGEAAKSVKLERPVRGH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-A14
publication title Solution structure and dynamics of human S100A14.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 23
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2m0rA00
1RK9A 5G08A 4NQGA 4FTGA 1SK6D 3AAJA 3DVJA 2JZIA 3FIAA 4MVFA 2BE6A 1S6JA 4DUQA 1YTZC 5AFPA 1FI6A 4OR9B 2KBMA 2CT9A 3OX5A 2PVBA 1MHOA 1RWYA 2LMVA 1VRKA 1DJXA 2L51A 1DTLA 4GPLB 5CSNA 1XFVO 4BY5A 1XK4C 1K2HA 4JQ0D 1WY9A 1JSAA 1DJGA 1OE9B 1NX0A 1NCXA 3SIBA 3DVMA 1S3PA 4QJ4B 1J1EA 2R2IA 3D0YA 2NZ0A 1A4PA 5I2OA 1GGZA 5CSJA 3ICBA 3AKAA 2OS8C 1B8RA 1K90D 2K7CA 2WNDA 2LVIA 5HKZA 1KFXL 1FW4A 4AQJA 1S5GY 2L5XB 1TNQA 1WRZA 1CMFA 1KWOC 3NSOA 3EKHA 3KF9A 1V1GA 1K96A 1NCYA 3CS1A 3OB1B 1AJ5A 3KHEA 1NCZA 1Y1AA 2GGMA 4BY4A 1NPQA 2OPOA 1UP5A 1FPWA 4I5LB 1XFZO 3JVTC 1J7QA 1XFUO 3FWBA 1BR4B 2BCAA 3NSIA 1XFXO 1G33A 2BKHB 3EVRA 1DJWA 2M9GA 4A4BA 1RTP1 1SL7A 3GK4X 4OVNF 4ETOA 3EVUA 1GJYA 3CR5X 3DF0A 2WCEA 1Y0VH 1NP8A 5HYDA 4DS7A 1G4YR 4U8DA 2F2PA 3OHMB 2JNXA 1BR1B 1OMVA 2D8NA 3TDIA 1CB1A 1OOJA 4P2YB 3BUXB 4YGBB 1DJHA 1K93D 1NSHA 1QASA 2LHLA 2QPTA 1ODBA 2JT3A 2LCPA 1S1EA 2KGBC 1C07A 1QS7A 1SNLA 3D10A 4N1GA 4QJ5B 3OP0A 1M39A 4HRGA 2WCFA 5DKQA 4OV2A 2BECA 5HLOA 1TN4A 2K7BA 3I5HB 2I18A 1DGUA 2WCBA 1WRKA 3PATA 4ORAB 2V53A 3JTDC 5ER4X 1QLKA 1IQ3A 1WLMA 2COLB 2LE9B 2SASA 1ZOTB 1BJFA 2JQ6A 3I5GB 3MSEB 1ZFSA 1SRAA 1F71A 5KTYA 1UWOA 3KO0A 1QV1A 5D69A 4ICBA 1M46A 1KFUL 2Q91A 3BUMB 3GK1A 2JXLA 3EVVA 2F2OA 4HRHA 3TUYC 2JT0A 3LL8B 1A75B 2MAZA 3EK8A 2LVVA 3OX6A 4HREE 4NDBA 4DCKA 3ZNIA 3SG3A 2Y1NA 1GGWA 1AUIB 4MBEA 2KYCA 5AEQA 3WXAA 5JJGA 2WC8A 1YURA 1UHJA 2KFGA 1IWQA 5DKNA 3FWCA 4YBHB 1JFJA 1H8BA 1B7TY 2K7DA 2F8PA 2JNFA 2JRFA 4NDCA 2JULA 1IH0A 1PSRA 3DVKA 3VRNA 2CTNA 1SKTA 1QJTA 2ZKMX 2WOSA 2P6BB 1SW8A 1S6IA 1V1FA 2MBXA 4C0JA 1DF0B 3SIAA 1R2UA 1ZUZA 2LM5A 2KHNA 5CSFA 1OSAA 2ZRTA 2BCBA 2KNEA 1KQMC 2M29A 2MHHA 3EKJA 4CLNA 3O78A 1B8CA 2JTTA 1CM1A 2MJWB 2G2BA 2WORA 4C0LA 3BUOB 1DVIA 1QVIY 2HQ8A 2M1UA 2L4IA 1JF2A 2L2EA 3PSRA 1YX7A 1KFUS 3FS7A 2I94A 1SL9A 1NIWA 3I5IB 2F3ZA 1LXFC 1EG4A 1Q80A 1QX7A 1SY9A 2A4JA 3LCPC 2ZN9A 2OTGB 4PE0A 1LA0A 2LLSA 1YVLA 1AVSA 1QATA 4GGNA 3VROA 1JF0A 1IQ5A 1CDPA 1KSOA 3F45A 1YRUB 4UPGA 1XYDA 1YUTA 4PHMA 1PVAA 2HF5A 2LNKA 2L50A 5KU1A 2GV5A 1CTRA 2LP2A 2I2RE 4PHJA 2KI4C 2IS9A 1R6PA 2PASA 3PFVA 5D7FA 1L2OC 4XYNA 1DJYA 4YGEB 1B4CA 3JVTB 2JWWA 2LUXA 3WHUB 2ZNDA 2Y1MA 3SJSA 1AK8A 4I5KA 1S5GZ 5K89A 1ALWA 1CFCA 1K9KA 4GFTA 1YR5A 2KSPA 4YGDB 4OCIA 4MZJA 1CNPA 1YUSA 2E6WA 3M0WA 4IL1A 1DT7B 2BBNA 1Y6WA 1QIVA 4JWQA 4PE7A 1NX3A 2BCXA 1K9UA 2K2FA 2KAYA 2M8UA 4QJ3B 1WDCB 5DKRA 1SCMB 1E8AA 2HETA 4MSPA 2M7LA 2K0JA 1CKKA 3QRXA 4NDDA 1B1GA 4FQOA 5TNCA 1IRJA 3BUNB 2KI6C 1BF5A 1HQVA 4L9MA 1SBJA 2PMYA 2Y4QA 1FBVA 1PVBA 2AAOA 1K9PA 1MR8A 3K21A 4I5NB 2CXJA 4ORCB 1D1OA 1W7IB 3EK7A 3PN7B 3KPXA 1WLZA 4M2QA 4MN0A 2KYFA 2HPSA 1CLMA 2TN4A 1OQPA 1QLSA 1KK8B 1C7WA 2DOQA 2AUCA 1PK0D 2PRUA 4MZLA 1JBAA 1AJ4A 4PALA 3LK1A 4WQ2A 3SG7A 2LMTA 2ZNEA 3O4YA 3CZTX 1IKUA 3LK0A 1N0YA 2KDHA 3I5FC 3CR4X 4PHNA 1F4OA 2KFHA 1CDNA 1N2DA 3OB2B 1BLQA 3IF7A 1MXLC 1TCOB 4PDZA 2HQWA 4GNKB 1CM4A 2L4HA 2BBMA 4Q04A 1TRFA 4YI9A 1IGVA 1PALA 2JTZA 2PSRA 1U5IA 2EC6B 4R1EA 3WNXB 5I2QA 2KGRA 4F0ZB 5FYXA 1PRWA 1HT9A 3RM1A 1L7ZA 3SG2A 3VRPA 2M1KB 3CR2A 2EGDA 2MLFC 1TCFA 3CTNA 5J3XA 4DIRA 4YRUA 3VRRA 1XFWO 1MUXA 4YGCB 1MWNA 2KFFA 1X02A 2VRGA 2CCMA 3I5HC 1OZOA 1CFPA 3VRQA 5AXIA 4PE4A 1NYAA 1CLLA 2PALA 3ZWHA 1A75A 3HX4A 3WHTB 3IQOA 3TS5C 1B7TZ 1JUOA 1SMGA 1CMGA 1J7RA 4CFQA 1DMOA 2LV7A 1KQMB 3BOWB 4TNCA 5BPJA 2Y5IA 1FF1A 1RJVA 2K7OA 1BMOA 1PULA 1KK7Y 1XA5A 1SR6C 2ZRSA 3LLEA 1ZMZA 4PCWA 1XO5A 1EL4A 4USLA 1BT6A 5AANA 4CIDA 1DGVA 2F33A 1TNWA 4XJKB 2FCDA 2BL0C 2M49B 4GUKA 1F8HA 4HSZA 2MA2A 4N1FA 1QVIZ 2JC2A 1KQVA 2K2AA 2JU0A 1K8UA 2NLNA 1SYMA 3DD4A 2BE4A 2B1UA 2LHIA 2KOTA 3NSKA 2CNPA 2OS8B 3IQQA 3PLFB 4YI8A 1QTXA 5B8IB 2KQ6A 1N65A 1IJ6A 4JPZB 1YRTB 3H4SE 4MEWA 2EHBA 1XVJA 3BUWB 1CLBA 2I7AA 1YX8A 1KWOB 4OKHA 2NCPA 1IJ5A 3E3RA 3PM8A 1OMRA 4PHKA 1BG1A 3EK4A 1UURA 3D0YB 1NX1A 2KBIA 1JC2A 1BODA 1BU3A 1OZSA 5HKWA 3C1VA 1CFFA 2LC5A 2MRDA 1OMDA 2ISDA 2G9BA 1ZACA 1C7VA 1J55A 2LMUA 1CFDA 1LINA 4D1EA 1EXRA 1QXPA 4DRWA 2SCPA 4ORBB 3I5IC 2MLEC 5PALA 1DJZA 1SL8A 1G8IA 1QV0A 1F70A 1A03A 2KQYA 4AQIA 2OTGC 1UHNA 1CDMA 1F54A 5KSZA 5GQQC 3SG6A 4MRXA 1JWDA 4GGFA 2AMIA 1YUUA 3BXKA 2BKIB 2LVKA 2NXQA 3GK2A 1H4BA 1M31A 1Y1XA 1KSMA 3DF0B 2GGZA 1M63B 4GBAA 1QX2A 2H61A 2NCOA 1MF8B 2QACA 4MZKA 2K8MB 2M0RA 1UHKA 2ZN8A 1S26D 1NUBA 1J7PA 4GGFC 3CWGA 1DJIA 1WRLA 3SG4A 4M2PA 5I8NA 3NXAA 1RECA 2E30A 3I5FB 3TDUA 1TTXA 3AKBA 3JTDB 1A29A 3A8RA 3NSLA 3RLZA 1M45A 2H61C 2O60A 3CLNA 3BQ3A 2M3WA 1CDLA 1W7JB 1WDCC 1MXEA 1SCMC 5CPVA 1F55A 3GOFA 3O6BA 5CSIA 1UUSA 1Y1UA 3DVEA 1AHRA 4C0KA 5IBWA 1TNXA 4MRYA 1EH2A 2LLTA 4GAOA 1XFYO 2LUCA 3TUYB 3PALA 3BYAA 1NWDA 1RROA 2FOTA 3A4UB 1KFXS 1SCVA 1AP4A 4M2OA 2LANA 1QIWA 2FJUB 1B47A 1TOPA 1BOCA 4WQ3A 3PN7C 1MQ1A 1GQMA 4P5OE 1FI5A 1IG5A 5ER5A 2KI6D 1KK8C 4WRIA 2JOJA 3KEVA 1U5IB 2KAVA 2L0PA 4A4CA 1UHIA 2L98A 2RGIA 2O5GA 1TIZA 3TS5B 1LKJA 4ZCVA 1SR6B 2LAPA 5AERA 2F3YA 2JT8A 1KCYA 1PSBA 3SG5A 3O2PA 4N5XA 4I5JA 1EG3A 1A2XA 1JFKA 1K94A 3I5GC 3VGOA 2M7NA 3AAKA 4CFRA 2LP3A 5JOLA 1S6CA 1J1DA 4ZCUA 2K61A 4PE1A 1SPYA 2ZFDA 2BL0B 4MLWA 1RFJA 1K95A 2CBLA 2EC6C 4AOMA 1KK7Z 1J7OA 2KAXA 1F4QA 2JXCA 1QX5B 2LLUA 3BOWA 5F6TA 1B9AA 3HCMA 1YVHA 1DF0A 1TNPA 2LVJA 5HLVA 3CGAA 5HKYA 4YGAA 1S36A 1UHHA 2Q4UA 3TDZA 1LVCD 2M97A 1NX2A 2KI4B 1ALVA 2FCEA 1EJ3A 1L2OB 1B8LA 1LA3A 4CPVA 2JPTA 5I2LA 3TZ1A 4XJKA 4E68A 1XK4A 2H2KA
chains in the Genus database with same CATH superfamily
1RK9A 2P70A 5G08A 4NQGA 4FTGA 1SK6D 3AAJA 3DVJA 2JZIA 3FIAA 4MVFA 3S0AA 2BE6A 1S6JA 2KLDA 1YTZC 4DUQA 2KLEA 5AFPA 1FI6A 4OR9B 2KBMA 2CT9A 3FE9A 3OX5A 2PVBA 1MHOA 1RWYA 2LMVA 3BFHA 1VRKA 1DJXA 2L51A 1DTLA 4GPLB 5CSNA 1OOFA 1XFVO 1Z2CB 4BY5A 1XK4C 1K2HA 4JQ0D 1WY9A 3BFBA 1JSAA 3NGVA 1DJGA 1OE9B 1NX0A 1NCXA 3CDNA 3SIBA 3DVMA 1S3PA 4QJ4B 3CZ1A 1J1EA 2R2IA 3D0YA 2NZ0A 1A4PA 5I2OA 1GGZA 5CSJA 3ICBA 3AKAA 2OS8C 1B8RA 1K90D 2K7CA 2WNDA 2LVIA 5HKZA 1KFXL 1FW4A 4AQJA 1S5GY 2L5XB 1TNQA 1WRZA 1CMFA 1KWOC 3NSOA 3EKHA 3KF9A 1V1GA 1K96A 1NCYA 3CS1A 3OB1B 1AJ5A 3KHEA 1NCZA 1Y1AA 2GGMA 4BY4A 1NPQA 2OPOA 1UP5A 1FPWA 4I5LB 1XFZO 3JVTC 1J7QA 1XFUO 3FWBA 1GM0A 1BR4B 3DXLA 2BCAA 3D78A 3NSIA 2PYQA 1XFXO 1G33A 2BKHB 3EVRA 1DJWA 2M9GA 4A4BA 1RTP1 1SL7A 3GK4X 4OVNF 4ETOA 3EVUA 1GJYA 3CR5X 3DF0A 2WCEA 1Y0VH 1NP8A 5HYDA 4DS7A 1G4YR 2K60A 4U8DA 1W9ZA 2F2PA 3OHMB 2JNXA 1BR1B 1OMVA 1T14A 2D8NA 3TDIA 1CB1A 1OOJA 4P2YB 3BUXB 2WCJA 4YGBB 1DJHA 1K93D 1NSHA 1QASA 2LHLA 2QPTA 1ODBA 2JT3A 2LCPA 4JKTA 4F7FA 1S1EA 4INWA 2KGBC 1C07A 1QS7A 3VB1A 1SNLA 3D10A 4N1GA 4QJ5B 3OP0A 1M39A 4HRGA 2WCFA 5DKQA 4OV2A 2BECA 5HLOA 2BNXA 3O4XA 1TN4A 2K7BA 3CABA 3I5HB 1DELA 2I18A 1DGUA 2WCBA 3S0GA 1WRKA 3PATA 3L47A 2WCLA 4ORAB 2V53A 3JTDC 5ER4X 1QLKA 1IQ3A 1WLMA 3D75A 3S0EA 2COLB 2LE9B 2SASA 1ZOTB 5FI2A 1BJFA 2JQ6A 3I5GB 3MSEB 1ZFSA 1SRAA 1F71A 5KTYA 1UWOA 3D73A 3KO0A 1QV1A 5D69A 2WC6A 4FQTA 4ICBA 1M46A 1KFUL 2Q91A 3BUMB 3GK1A 2JXLA 3EVVA 3D76A 2F2OA 4HRHA 4INXA 3TUYC 2L5YA 2JT0A 3LL8B 1A75B 2MAZA 3EK8A 2LVVA 3OX6A 4HREE 4NDBA 4DCKA 3ZNIA 3SG3A 2Y1NA 1GGWA 1AUIB 4IJ7A 2KYCA 4MBEA 5AEQA 3WXAA 2WC8A 1YURA 1UHJA 2KFGA 1IWQA 5DKNA 3FWCA 4YBHB 1JFJA 1H8BA 1B7TY 2K7DA 2F8PA 2JNFA 2JRFA 4NDCA 2JULA 1IH0A 3DYEA 2QEHA 1PSRA 3DVKA 3VRNA 3CYZA 2CTNA 1SKTA 1QJTA 2ZKMX 2WOSA 2P6BB 5FI7A 3V2LA 1SW8A 1Z4HA 1S6IA 1V1FA 2MBXA 4C0JA 1DF0B 3SIAA 1R2UA 1ZUZA 2LM5A 2KHNA 4OZDA 5CSFA 1OSAA 2ZRTA 2BCBA 2KNEA 1KQMC 2M29A 2MHHA 3EKJA 3DY9A 3O78A 4CLNA 1B8CA 2JTTA 1CM1A 2MJWB 2G2BA 2WORA 4C0LA 3BUOB 1DVIA 1QVIY 2HQ8A 2M1UA 2FJYA 2L4IA 1JF2A 2L2EA 3PSRA 1YX7A 1KFUS 3FS7A 2I94A 1SL9A 3OBVA 1NIWA 1OOGA 3I5IB 2F3ZA 1LXFC 1EG4A 1Q80A 1QX7A 1TUJA 1SY9A 2A4JA 3LCPC 1OOHA 2ZN9A 2OTGB 4PE0A 1LA0A 2LLSA 1YVLA 1AVSA 1QATA 4GGNA 3VROA 1JF0A 1IQ5A 3RZSA 1CDPA 1KSOA 3F45A 1YRUB 4UPGA 1XYDA 1YUTA 4PHMA 1PVAA 2HF5A 2LNKA 2L50A 5KU1A 2GV5A 2P71A 1CTRA 1OW4A 2I2RE 2LP2A 4PHJA 2KI4C 2IS9A 1R6PA 2PASA 3FE6A 3L4LA 3PFVA 5D7FA 1L2OC 4XYNA 1DJYA 4YGEB 1B4CA 1TWOA 3JVTB 2JWWA 2LUXA 3WHUB 2ZNDA 2Y1MA 3SJSA 1AK8A 4I5KA 1S5GZ 5K89A 1ALWA 1CFCA 1K9KA 4GFTA 1YR5A 2KSPA 2JPOA 4YGDB 4OCIA 4MZJA 1CNPA 1YUSA 2E6WA 3M0WA 4IL1A 1DT7B 2BBNA 1Y6WA 1QIVA 2ERBA 4JWQA 4PE7A 3R1VA 1NX3A 2BCXA 1K9UA 2K2FA 3NHTA 2KAYA 2M8UA 4QJ3B 1WDCB 5DKRA 1SCMB 1E8AA 2HETA 4MSPA 2M7LA 2K0JA 1CKKA 3BFAA 3QRXA 4NDDA 1B1GA 4FQOA 5TNCA 3OGNA 1IRJA 3BUNB 2KI6C 1BF5A 1HQVA 4L9MA 1SBJA 2PMYA 2Y4QA 1FBVA 1PVBA 2AAOA 1K9PA 1MR8A 3K21A 4I5NB 2CXJA 4ORCB 3S0BA 1D1OA 1W7IB 3EK7A 3PN7B 1DQEA 3KPXA 1WLZA 4M2QA 4MN0A 2KYFA 2HPSA 1CLMA 2TN4A 1OQPA 1QLSA 1KK8B 1C7WA 2DOQA 3SS4A 1C3YA 3B6XA 2AUCA 1PK0D 3R1OA 2PRUA 4MZLA 1JBAA 1AJ4A 4PALA 3LK1A 4WQ2A 3SG7A 2LMTA 2ZNEA 3O4YA 3CZTX 1IKUA 3LK0A 1N0YA 2KDHA 3I5FC 3CR4X 1TUZA 4PHNA 1F4OA 2KFHA 1DMOA 1CDNA 1N2DA 3OB2B 1BLQA 3IF7A 1MXLC 1TCOB 4PDZA 2HQWA 4GNKB 1CM4A 2L4HA 2YGUA 2BBMA 4Q04A 1TRFA 4YI9A 2QEBA 1IGVA 3R72A 1PALA 2JTZA 2PSRA 1U5IA 2EC6B 4R1EA 3WNXB 3B88A 5I2QA 2KGRA 4F0ZB 5FYXA 3SS5A 1PRWA 1HT9A 3RM1A 1L7ZA 3SG2A 3VRPA 2M1KB 3CR2A 2EGDA 2MLFC 1TCFA 3CTNA 5J3XA 4DIRA 4YRUA 3VRRA 1DEKA 1XFWO 1MUXA 4YGCB 1MWNA 2KFFA 1X02A 2VRGA 2CCMA 3I5HC 1OZOA 2WCMA 3VRQA 1CFPA 5AXIA 4PE4A 1NYAA 3EG5B 1CLLA 2PALA 3ZWHA 1A75A 3B86A 2GTEA 2QEVA 3HX4A 3WHTB 3IQOA 3TS5C 1B7TZ 1JUOA 1SMGA 1CMGA 1J7RA 4CFQA 3FE8A 2LV7A 1KQMB 3BOWB 4TNCA 5BPJA 2Y5IA 3DZTA 5I94A 1FF1A 1RJVA 2K7OA 1BMOA 1PULA 1KK7Y 1XA5A 1SR6C 1ORGA 5JJGA 2ZRSA 3LLEA 1ZMZA 4PCWA 1XO5A 1EL4A 4USLA 1BT6A 3QMEA 5AANA 4CIDA 3PM2A 1DGVA 2F33A 3N7HA 1TNWA 4XJKB 2FCDA 2BL0C 2WC5A 2M49B 4GUKA 1F8HA 4HSZA 2MA2A 4N1FA 1QVIZ 2JC2A 3K1EA 1KQVA 2K2AA 2JU0A 1K8UA 2NLNA 1SYMA 3DD4A 2BE4A 2B1UA 2LHIA 2KPHA 2KOTA 3NSKA 2CNPA 3R1PA 2OS8B 3IQQA 3PLFB 4YI8A 1QTXA 5EL2A 2KQ6A 1N65A 1IJ6A 5B8IB 4JPZB 1DC1A 1YRTB 3D74A 3H4SE 4MEWA 2EHBA 1XVJA 3BUWB 1CLBA 2I7AA 1YX8A 1KWOB 3B87A 2NCPA 2L2CA 4OKHA 1IJ5A 3E3RA 3PM8A 3NHIA 1OMRA 4PHKA 1BG1A 3EK4A 1UURA 3D0YB 5D3OA 1NX1A 2KBIA 1JC2A 1BODA 1BU3A 1OZSA 5HKWA 3C1VA 1CFFA 3CZ0A 2LC5A 2MRDA 1OMDA 2ISDA 3D77A 2G9BA 1ZACA 1C7VA 1J55A 2LMUA 1CFDA 1LINA 3PJIA 4D1EA 1EXRA 1QXPA 4DRWA 2SCPA 4ORBB 3I5IC 5FI6A 2MLEC 5PALA 1DJZA 1SL8A 1G8IA 2H8VA 1QV0A 1SSEB 1F70A 1A03A 2KQYA 4AQIA 2OTGC 1UHNA 1CDMA 1F54A 5KSZA 5DICA 2BAPA 5GQQC 3SG6A 4MRXA 1JWDA 4GGFA 2AMIA 1YUUA 1P28A 3BXKA 3S0DA 2BKIB 2LVKA 2NXQA 3GK2A 1H4BA 1M31A 1Y1XA 1KSMA 3DF0B 2GGZA 1M63B 4GBAA 1QX2A 2H61A 2NCOA 1MF8B 2QACA 4MZKA 2K8MB 2M0RA 1UHKA 2ZN8A 1S26D 1NUBA 1J7PA 4GGFC 3CWGA 1DJIA 1WRLA 2WCKA 3SG4A 4M2PA 5I8NA 3NXAA 1RECA 2E30A 3I5FB 3TDUA 1TTXA 3AKBA 3JTDB 1A29A 3A8RA 3NSLA 3RLZA 1M45A 1LS8A 1QWVA 2H61C 2O60A 3IVTA 3CLNA 3BQ3A 2M3WA 1CDLA 1W7JB 1WDCC 3L4AA 1MXEA 1SCMC 5CPVA 1F55A 3GOFA 3O6BA 5CSIA 1UUSA 1Y1UA 3DVEA 1AHRA 4C0KA 5IBWA 1TNXA 4MRYA 1EH2A 4KYNA 2LLTA 4GAOA 1XFYO 2LUCA 3TUYB 3PALA 3BYAA 1NWDA 1RROA 2FOTA 2PQLA 3A4UB 1KFXS 1SCVA 1AP4A 4M2OA 2LANA 1QIWA 2FJUB 5HL1A 1B47A 1TOPA 1BOCA 4WQ3A 3PN7C 1MQ1A 1GQMA 4P5OE 1FI5A 1IG5A 5ER5A 2KI6D 1KK8C 1C3ZA 2JOJA 3KEVA 4WRIA 1U5IB 2KAVA 2L0PA 4A4CA 1UHIA 2L98A 2RGIA 4JD9A 2QEOA 2O5GA 1OOIX 1TIZA 3TS5B 3B7AA 1LKJA 4ZCVA 3UNWA 1SR6B 2LAPA 5AERA 2F3YA 2JT8A 1KCYA 1PSBA 3SG5A 3O2PA 4N5XA 4I5JA 1EG3A 1A2XA 1JFKA 1K94A 3I5GC 3VGOA 2M7NA 3AAKA 4CFRA 3S0FA 2LP3A 5JOLA 1S6CA 1J1DA 4ZCUA 2K61A 4PE1A 1SPYA 2ZFDA 2BL0B 4MLWA 1RFJA 1K95A 2CBLA 2EC6C 4AOMA 1KK7Z 1J7OA 1XFRA 2KAXA 3SS3A 1F4QA 2JXCA 3UO9A 1QX5B 2LLUA 3BOWA 5F6TA 1B9AA 3HCMA 1YVHA 1DF0A 1TNPA 2LVJA 5HLVA 3CGAA 5HKYA 4YGAA 1S36A 1UHHA 4PT1A 3BJHA 2Q4UA 3CZ2A 3TDZA 3Q8IA 1LVCD 2M97A 1NX2A 2WCHA 2KI4B 1IIOA 1ALVA 2FCEA 1EJ3A 1L2OB 1B8LA 1LA3A 4CPVA 2JPTA 5I2LA 3TZ1A 4XJKA 4E68A 2QDIA 1XK4A 2H2KA
chains in the Genus database with same CATH topology
1RK9A 5G08A 4NQGA 4FTGA 1SK6D 3AAJA 3DVJA 2JZIA 3FIAA 4MVFA 2BE6A 1S6JA 4DUQA 1YTZC 5AFPA 1FI6A 4OR9B 2KBMA 2CT9A 3OX5A 2PVBA 1MHOA 1RWYA 2LMVA 1VRKA 1DJXA 2L51A 1DTLA 4GPLB 5CSNA 1XFVO 4BY5A 1XK4C 1K2HA 4JQ0D 1WY9A 1JSAA 1DJGA 1OE9B 1NX0A 1NCXA 3SIBA 3DVMA 1S3PA 4QJ4B 1J1EA 2R2IA 3D0YA 2NZ0A 1A4PA 5I2OA 1GGZA 5CSJA 3ICBA 3AKAA 2OS8C 1B8RA 1K90D 2K7CA 2WNDA 2LVIA 5HKZA 1KFXL 1FW4A 4AQJA 1S5GY 2L5XB 1TNQA 1WRZA 1CMFA 1KWOC 3NSOA 3EKHA 3KF9A 1V1GA 1K96A 1NCYA 3CS1A 3OB1B 1AJ5A 3KHEA 1NCZA 1Y1AA 2GGMA 4BY4A 1NPQA 2OPOA 1UP5A 1FPWA 4I5LB 1XFZO 3JVTC 1J7QA 1XFUO 3FWBA 1BR4B 2BCAA 3NSIA 1XFXO 1G33A 2BKHB 3EVRA 1DJWA 2M9GA 4A4BA 1RTP1 1SL7A 3GK4X 4OVNF 4ETOA 3EVUA 1GJYA 3CR5X 3DF0A 2WCEA 1Y0VH 1NP8A 5HYDA 4DS7A 1G4YR 4U8DA 2F2PA 3OHMB 2JNXA 1BR1B 1OMVA 2D8NA 3TDIA 1CB1A 1OOJA 4P2YB 3BUXB 4YGBB 1DJHA 1K93D 1NSHA 1QASA 2LHLA 2QPTA 1ODBA 2JT3A 2LCPA 1S1EA 2KGBC 1C07A 1QS7A 1SNLA 3D10A 4N1GA 4QJ5B 3OP0A 1M39A 4HRGA 2WCFA 5DKQA 4OV2A 2BECA 5HLOA 1TN4A 2K7BA 3I5HB 2I18A 1DGUA 2WCBA 1WRKA 3PATA 4ORAB 2V53A 3JTDC 5ER4X 1QLKA 1IQ3A 1WLMA 2COLB 2LE9B 2SASA 1ZOTB 1BJFA 2JQ6A 3I5GB 3MSEB 1ZFSA 1SRAA 1F71A 5KTYA 1UWOA 3KO0A 1QV1A 5D69A 4ICBA 1M46A 1KFUL 2Q91A 3BUMB 3GK1A 2JXLA 3EVVA 2F2OA 4HRHA 3TUYC 2JT0A 3LL8B 1A75B 2MAZA 3EK8A 2LVVA 3OX6A 4HREE 4NDBA 4DCKA 3ZNIA 3SG3A 2Y1NA 1GGWA 1AUIB 4MBEA 2KYCA 5AEQA 3WXAA 5JJGA 2WC8A 1YURA 1UHJA 2KFGA 1IWQA 5DKNA 3FWCA 4YBHB 1JFJA 1H8BA 1B7TY 2K7DA 2F8PA 2JNFA 2JRFA 4NDCA 2JULA 1IH0A 1PSRA 3DVKA 3VRNA 2CTNA 1SKTA 1QJTA 2ZKMX 2WOSA 2P6BB 1SW8A 1S6IA 1V1FA 2MBXA 4C0JA 1DF0B 3SIAA 1R2UA 1ZUZA 2LM5A 2KHNA 5CSFA 1OSAA 2ZRTA 2BCBA 2KNEA 1KQMC 2M29A 2MHHA 3EKJA 4CLNA 3O78A 1B8CA 2JTTA 1CM1A 2MJWB 2G2BA 2WORA 4C0LA 3BUOB 1DVIA 1QVIY 2HQ8A 2M1UA 2L4IA 1JF2A 2L2EA 3PSRA 1YX7A 1KFUS 3FS7A 2I94A 1SL9A 1NIWA 3I5IB 2F3ZA 1LXFC 1EG4A 1Q80A 1QX7A 1SY9A 2A4JA 3LCPC 2ZN9A 2OTGB 4PE0A 1LA0A 2LLSA 1YVLA 1AVSA 1QATA 4GGNA 3VROA 1JF0A 1IQ5A 1CDPA 1KSOA 3F45A 1YRUB 4UPGA 1XYDA 1YUTA 4PHMA 1PVAA 2HF5A 2LNKA 2L50A 5KU1A 2GV5A 1CTRA 2LP2A 2I2RE 4PHJA 2KI4C 2IS9A 1R6PA 2PASA 3PFVA 5D7FA 1L2OC 4XYNA 1DJYA 4YGEB 1B4CA 3JVTB 2JWWA 2LUXA 3WHUB 2ZNDA 2Y1MA 3SJSA 1AK8A 4I5KA 1S5GZ 5K89A 1ALWA 1CFCA 1K9KA 4GFTA 1YR5A 2KSPA 4YGDB 4OCIA 4MZJA 1CNPA 1YUSA 2E6WA 3M0WA 4IL1A 1DT7B 2BBNA 1Y6WA 1QIVA 4JWQA 4PE7A 1NX3A 2BCXA 1K9UA 2K2FA 2KAYA 2M8UA 4QJ3B 1WDCB 5DKRA 1SCMB 1E8AA 2HETA 4MSPA 2M7LA 2K0JA 1CKKA 3QRXA 4NDDA 1B1GA 4FQOA 5TNCA 1IRJA 3BUNB 2KI6C 1BF5A 1HQVA 4L9MA 1SBJA 2PMYA 2Y4QA 1FBVA 1PVBA 2AAOA 1K9PA 1MR8A 3K21A 4I5NB 2CXJA 4ORCB 1D1OA 1W7IB 3EK7A 3PN7B 3KPXA 1WLZA 4M2QA 4MN0A 2KYFA 2HPSA 1CLMA 2TN4A 1OQPA 1QLSA 1KK8B 1C7WA 2DOQA 2AUCA 1PK0D 2PRUA 4MZLA 1JBAA 1AJ4A 4PALA 3LK1A 4WQ2A 3SG7A 2LMTA 2ZNEA 3O4YA 3CZTX 1IKUA 3LK0A 1N0YA 2KDHA 3I5FC 3CR4X 4PHNA 1F4OA 2KFHA 1CDNA 1N2DA 3OB2B 1BLQA 3IF7A 1MXLC 1TCOB 4PDZA 2HQWA 4GNKB 1CM4A 2L4HA 2BBMA 4Q04A 1TRFA 4YI9A 1IGVA 1PALA 2JTZA 2PSRA 1U5IA 2EC6B 4R1EA 3WNXB 5I2QA 2KGRA 4F0ZB 5FYXA 1PRWA 1HT9A 3RM1A 1L7ZA 3SG2A 3VRPA 2M1KB 3CR2A 2EGDA 2MLFC 1TCFA 3CTNA 5J3XA 4DIRA 4YRUA 3VRRA 1XFWO 1MUXA 4YGCB 1MWNA 2KFFA 1X02A 2VRGA 2CCMA 3I5HC 1OZOA 1CFPA 3VRQA 5AXIA 4PE4A 1NYAA 1CLLA 2PALA 3ZWHA 1A75A 3HX4A 3WHTB 3IQOA 3TS5C 1B7TZ 1JUOA 1SMGA 1CMGA 1J7RA 4CFQA 1DMOA 2LV7A 1KQMB 3BOWB 4TNCA 5BPJA 2Y5IA 1FF1A 1RJVA 2K7OA 1BMOA 1PULA 1KK7Y 1XA5A 1SR6C 2ZRSA 3LLEA 1ZMZA 4PCWA 1XO5A 1EL4A 4USLA 1BT6A 5AANA 4CIDA 1DGVA 2F33A 1TNWA 4XJKB 2FCDA 2BL0C 2M49B 4GUKA 1F8HA 4HSZA 2MA2A 4N1FA 1QVIZ 2JC2A 1KQVA 2K2AA 2JU0A 1K8UA 2NLNA 1SYMA 3DD4A 2BE4A 2B1UA 2LHIA 2KOTA 3NSKA 2CNPA 2OS8B 3IQQA 3PLFB 4YI8A 1QTXA 5B8IB 2KQ6A 1N65A 1IJ6A 4JPZB 1YRTB 3H4SE 4MEWA 2EHBA 1XVJA 3BUWB 1CLBA 2I7AA 1YX8A 1KWOB 4OKHA 2NCPA 1IJ5A 3E3RA 3PM8A 1OMRA 4PHKA 1BG1A 3EK4A 1UURA 3D0YB 1NX1A 2KBIA 1JC2A 1BODA 1BU3A 1OZSA 5HKWA 3C1VA 1CFFA 2LC5A 2MRDA 1OMDA 2ISDA 2G9BA 1ZACA 1C7VA 1J55A 2LMUA 1CFDA 1LINA 4D1EA 1EXRA 1QXPA 4DRWA 2SCPA 4ORBB 3I5IC 2MLEC 5PALA 1DJZA 1SL8A 1G8IA 1QV0A 1F70A 1A03A 2KQYA 4AQIA 2OTGC 1UHNA 1CDMA 1F54A 5KSZA 5GQQC 3SG6A 4MRXA 1JWDA 4GGFA 2AMIA 1YUUA 3BXKA 2BKIB 2LVKA 2NXQA 3GK2A 1H4BA 1M31A 1Y1XA 1KSMA 3DF0B 2GGZA 1M63B 4GBAA 1QX2A 2H61A 2NCOA 1MF8B 2QACA 4MZKA 2K8MB 2M0RA 1UHKA 2ZN8A 1S26D 1NUBA 1J7PA 4GGFC 3CWGA 1DJIA 1WRLA 3SG4A 4M2PA 5I8NA 3NXAA 1RECA 2E30A 3I5FB 3TDUA 1TTXA 3AKBA 3JTDB 1A29A 3A8RA 3NSLA 3RLZA 1M45A 2H61C 2O60A 3CLNA 3BQ3A 2M3WA 1CDLA 1W7JB 1WDCC 1MXEA 1SCMC 5CPVA 1F55A 3GOFA 3O6BA 5CSIA 1UUSA 1Y1UA 3DVEA 1AHRA 4C0KA 5IBWA 1TNXA 4MRYA 1EH2A 2LLTA 4GAOA 1XFYO 2LUCA 3TUYB 3PALA 3BYAA 1NWDA 1RROA 2FOTA 3A4UB 1KFXS 1SCVA 1AP4A 4M2OA 2LANA 1QIWA 2FJUB 1B47A 1TOPA 1BOCA 4WQ3A 3PN7C 1MQ1A 1GQMA 4P5OE 1FI5A 1IG5A 5ER5A 2KI6D 1KK8C 4WRIA 2JOJA 3KEVA 1U5IB 2KAVA 2L0PA 4A4CA 1UHIA 2L98A 2RGIA 2O5GA 1TIZA 3TS5B 1LKJA 4ZCVA 1SR6B 2LAPA 5AERA 2F3YA 2JT8A 1KCYA 1PSBA 3SG5A 3O2PA 4N5XA 4I5JA 1EG3A 1A2XA 1JFKA 1K94A 3I5GC 3VGOA 2M7NA 3AAKA 4CFRA 2LP3A 5JOLA 1S6CA 1J1DA 4ZCUA 2K61A 4PE1A 1SPYA 2ZFDA 2BL0B 4MLWA 1RFJA 1K95A 2CBLA 2EC6C 4AOMA 1KK7Z 1J7OA 2KAXA 1F4QA 2JXCA 1QX5B 2LLUA 3BOWA 5F6TA 1B9AA 3HCMA 1YVHA 1DF0A 1TNPA 2LVJA 5HLVA 3CGAA 5HKYA 4YGAA 1S36A 1UHHA 2Q4UA 3TDZA 1LVCD 2M97A 1NX2A 2KI4B 1ALVA 2FCEA 1EJ3A 1L2OB 1B8LA 1LA3A 4CPVA 2JPTA 5I2LA 3TZ1A 4XJKA 4E68A 1XK4A 2H2KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RK9 A;  5G08 A;  4NQG A;  4FTG A;  1SK6 D;  3AAJ A;  3DVJ A;  2JZI A;  3FIA A;  4MVF A;  2BE6 A;  1S6J A;  4DUQ A;  1YTZ C;  5AFP A;  1FI6 A;  4OR9 B;  2KBM A;  2CT9 A;  3OX5 A;  2PVB A;  1MHO A;  1RWY A;  2LMV A;  1VRK A;  1DJX A;  2L51 A;  1DTL A;  4GPL B;  5CSN A;  1XFV O;  4BY5 A;  1XK4 C;  1K2H A;  4JQ0 D;  1WY9 A;  1JSA A;  1DJG A;  1OE9 B;  1NX0 A;  1NCX A;  3SIB A;  3DVM A;  1S3P A;  4QJ4 B;  1J1E A;  2R2I A;  3D0Y A;  2NZ0 A;  1A4P A;  5I2O A;  1GGZ A;  5CSJ A;  3ICB A;  3AKA A;  2OS8 C;  1B8R A;  1K90 D;  2K7C A;  2WND A;  2LVI A;  5HKZ A;  1KFX L;  1FW4 A;  4AQJ A;  1S5G Y;  2L5X B;  1TNQ A;  1WRZ A;  1CMF A;  1KWO C;  3NSO A;  3EKH A;  3KF9 A;  1V1G A;  1K96 A;  1NCY A;  3CS1 A;  3OB1 B;  1AJ5 A;  3KHE A;  1NCZ A;  1Y1A A;  2GGM A;  4BY4 A;  1NPQ A;  2OPO A;  1UP5 A;  1FPW A;  4I5L B;  1XFZ O;  3JVT C;  1J7Q A;  1XFU O;  3FWB A;  1BR4 B;  2BCA A;  3NSI A;  1XFX O;  1G33 A;  2BKH B;  3EVR A;  1DJW A;  2M9G A;  4A4B A;  1RTP 1;  1SL7 A;  3GK4 X;  4OVN F;  4ETO A;  3EVU A;  1GJY A;  3CR5 X;  3DF0 A;  2WCE A;  1Y0V H;  1NP8 A;  5HYD A;  4DS7 A;  1G4Y R;  4U8D A;  2F2P A;  3OHM B;  2JNX A;  1BR1 B;  1OMV A;  2D8N A;  3TDI A;  1CB1 A;  1OOJ A;  4P2Y B;  3BUX B;  4YGB B;  1DJH A;  1K93 D;  1NSH A;  1QAS A;  2LHL A;  2QPT A;  1ODB A;  2JT3 A;  2LCP A;  1S1E A;  2KGB C;  1C07 A;  1QS7 A;  1SNL A;  3D10 A;  4N1G A;  4QJ5 B;  3OP0 A;  1M39 A;  4HRG A;  2WCF A;  5DKQ A;  4OV2 A;  2BEC A;  5HLO A;  1TN4 A;  2K7B A;  3I5H B;  2I18 A;  1DGU A;  2WCB A;  1WRK A;  3PAT A;  4ORA B;  2V53 A;  3JTD C;  5ER4 X;  1QLK A;  1IQ3 A;  1WLM A;  2COL B;  2LE9 B;  2SAS A;  1ZOT B;  1BJF A;  2JQ6 A;  3I5G B;  3MSE B;  1ZFS A;  1SRA A;  1F71 A;  5KTY A;  1UWO A;  3KO0 A;  1QV1 A;  5D69 A;  4ICB A;  1M46 A;  1KFU L;  2Q91 A;  3BUM B;  3GK1 A;  2JXL A;  3EVV A;  2F2O A;  4HRH A;  3TUY C;  2JT0 A;  3LL8 B;  1A75 B;  2MAZ A;  3EK8 A;  2LVV A;  3OX6 A;  4HRE E;  4NDB A;  4DCK A;  3ZNI A;  3SG3 A;  2Y1N A;  1GGW A;  1AUI B;  4MBE A;  2KYC A;  5AEQ A;  3WXA A;  5JJG A;  2WC8 A;  1YUR A;  1UHJ A;  2KFG A;  1IWQ A;  5DKN A;  3FWC A;  4YBH B;  1JFJ A;  1H8B A;  1B7T Y;  2K7D A;  2F8P A;  2JNF A;  2JRF A;  4NDC A;  2JUL A;  1IH0 A;  1PSR A;  3DVK A;  3VRN A;  2CTN A;  1SKT A;  1QJT A;  2ZKM X;  2WOS A;  2P6B B;  1SW8 A;  1S6I A;  1V1F A;  2MBX A;  4C0J A;  1DF0 B;  3SIA A;  1R2U A;  1ZUZ A;  2LM5 A;  2KHN A;  5CSF A;  1OSA A;  2ZRT A;  2BCB A;  2KNE A;  1KQM C;  2M29 A;  2MHH A;  3EKJ A;  4CLN A;  3O78 A;  1B8C A;  2JTT A;  1CM1 A;  2MJW B;  2G2B A;  2WOR A;  4C0L A;  3BUO B;  1DVI A;  1QVI Y;  2HQ8 A;  2M1U A;  2L4I A;  1JF2 A;  2L2E A;  3PSR A;  1YX7 A;  1KFU S;  3FS7 A;  2I94 A;  1SL9 A;  1NIW A;  3I5I B;  2F3Z A;  1LXF C;  1EG4 A;  1Q80 A;  1QX7 A;  1SY9 A;  2A4J A;  3LCP C;  2ZN9 A;  2OTG B;  4PE0 A;  1LA0 A;  2LLS A;  1YVL A;  1AVS A;  1QAT A;  4GGN A;  3VRO A;  1JF0 A;  1IQ5 A;  1CDP A;  1KSO A;  3F45 A;  1YRU B;  4UPG A;  1XYD A;  1YUT A;  4PHM A;  1PVA A;  2HF5 A;  2LNK A;  2L50 A;  5KU1 A;  2GV5 A;  1CTR A;  2LP2 A;  2I2R E;  4PHJ A;  2KI4 C;  2IS9 A;  1R6P A;  2PAS A;  3PFV A;  5D7F A;  1L2O C;  4XYN A;  1DJY A;  4YGE B;  1B4C A;  3JVT B;  2JWW A;  2LUX A;  3WHU B;  2ZND A;  2Y1M A;  3SJS A;  1AK8 A;  4I5K A;  1S5G Z;  5K89 A;  1ALW A;  1CFC A;  1K9K A;  4GFT A;  1YR5 A;  2KSP A;  4YGD B;  4OCI A;  4MZJ A;  1CNP A;  1YUS A;  2E6W A;  3M0W A;  4IL1 A;  1DT7 B;  2BBN A;  1Y6W A;  1QIV A;  4JWQ A;  4PE7 A;  1NX3 A;  2BCX A;  1K9U A;  2K2F A;  2KAY A;  2M8U A;  4QJ3 B;  1WDC B;  5DKR A;  1SCM B;  1E8A A;  2HET A;  4MSP A;  2M7L A;  2K0J A;  1CKK A;  3QRX A;  4NDD A;  1B1G A;  4FQO A;  5TNC A;  1IRJ A;  3BUN B;  2KI6 C;  1BF5 A;  1HQV A;  4L9M A;  1SBJ A;  2PMY A;  2Y4Q A;  1FBV A;  1PVB A;  2AAO A;  1K9P A;  1MR8 A;  3K21 A;  4I5N B;  2CXJ A;  4ORC B;  1D1O A;  1W7I B;  3EK7 A;  3PN7 B;  3KPX A;  1WLZ A;  4M2Q A;  4MN0 A;  2KYF A;  2HPS A;  1CLM A;  2TN4 A;  1OQP A;  1QLS A;  1KK8 B;  1C7W A;  2DOQ A;  2AUC A;  1PK0 D;  2PRU A;  4MZL A;  1JBA A;  1AJ4 A;  4PAL A;  3LK1 A;  4WQ2 A;  3SG7 A;  2LMT A;  2ZNE A;  3O4Y A;  3CZT X;  1IKU A;  3LK0 A;  1N0Y A;  2KDH A;  3I5F C;  3CR4 X;  4PHN A;  1F4O A;  2KFH A;  1CDN A;  1N2D A;  3OB2 B;  1BLQ A;  3IF7 A;  1MXL C;  1TCO B;  4PDZ A;  2HQW A;  4GNK B;  1CM4 A;  2L4H A;  2BBM A;  4Q04 A;  1TRF A;  4YI9 A;  1IGV A;  1PAL A;  2JTZ A;  2PSR A;  1U5I A;  2EC6 B;  4R1E A;  3WNX B;  5I2Q A;  2KGR A;  4F0Z B;  5FYX A;  1PRW A;  1HT9 A;  3RM1 A;  1L7Z A;  3SG2 A;  3VRP A;  2M1K B;  3CR2 A;  2EGD A;  2MLF C;  1TCF A;  3CTN A;  5J3X A;  4DIR A;  4YRU A;  3VRR A;  1XFW O;  1MUX A;  4YGC B;  1MWN A;  2KFF A;  1X02 A;  2VRG A;  2CCM A;  3I5H C;  1OZO A;  1CFP A;  3VRQ A;  5AXI A;  4PE4 A;  1NYA A;  1CLL A;  2PAL A;  3ZWH A;  1A75 A;  3HX4 A;  3WHT B;  3IQO A;  3TS5 C;  1B7T Z;  1JUO A;  1SMG A;  1CMG A;  1J7R A;  4CFQ A;  1DMO A;  2LV7 A;  1KQM B;  3BOW B;  4TNC A;  5BPJ A;  2Y5I A;  1FF1 A;  1RJV A;  2K7O A;  1BMO A;  1PUL A;  1KK7 Y;  1XA5 A;  1SR6 C;  2ZRS A;  3LLE A;  1ZMZ A;  4PCW A;  1XO5 A;  1EL4 A;  4USL A;  1BT6 A;  5AAN A;  4CID A;  1DGV A;  2F33 A;  1TNW A;  4XJK B;  2FCD A;  2BL0 C;  2M49 B;  4GUK A;  1F8H A;  4HSZ A;  2MA2 A;  4N1F A;  1QVI Z;  2JC2 A;  1KQV A;  2K2A A;  2JU0 A;  1K8U A;  2NLN A;  1SYM A;  3DD4 A;  2BE4 A;  2B1U A;  2LHI A;  2KOT A;  3NSK A;  2CNP A;  2OS8 B;  3IQQ A;  3PLF B;  4YI8 A;  1QTX A;  5B8I B;  2KQ6 A;  1N65 A;  1IJ6 A;  4JPZ B;  1YRT B;  3H4S E;  4MEW A;  2EHB A;  1XVJ A;  3BUW B;  1CLB A;  2I7A A;  1YX8 A;  1KWO B;  4OKH A;  2NCP A;  1IJ5 A;  3E3R A;  3PM8 A;  1OMR A;  4PHK A;  1BG1 A;  3EK4 A;  1UUR A;  3D0Y B;  1NX1 A;  2KBI A;  1JC2 A;  1BOD A;  1BU3 A;  1OZS A;  5HKW A;  3C1V A;  1CFF A;  2LC5 A;  2MRD A;  1OMD A;  2ISD A;  2G9B A;  1ZAC A;  1C7V A;  1J55 A;  2LMU A;  1CFD A;  1LIN A;  4D1E A;  1EXR A;  1QXP A;  4DRW A;  2SCP A;  4ORB B;  3I5I C;  2MLE C;  5PAL A;  1DJZ A;  1SL8 A;  1G8I A;  1QV0 A;  1F70 A;  1A03 A;  2KQY A;  4AQI A;  2OTG C;  1UHN A;  1CDM A;  1F54 A;  5KSZ A;  5GQQ C;  3SG6 A;  4MRX A;  1JWD A;  4GGF A;  2AMI A;  1YUU A;  3BXK A;  2BKI B;  2LVK A;  2NXQ A;  3GK2 A;  1H4B A;  1M31 A;  1Y1X A;  1KSM A;  3DF0 B;  2GGZ A;  1M63 B;  4GBA A;  1QX2 A;  2H61 A;  2NCO A;  1MF8 B;  2QAC A;  4MZK A;  2K8M B;  2M0R A;  1UHK A;  2ZN8 A;  1S26 D;  1NUB A;  1J7P A;  4GGF C;  3CWG A;  1DJI A;  1WRL A;  3SG4 A;  4M2P A;  5I8N A;  3NXA A;  1REC A;  2E30 A;  3I5F B;  3TDU A;  1TTX A;  3AKB A;  3JTD B;  1A29 A;  3A8R A;  3NSL A;  3RLZ A;  1M45 A;  2H61 C;  2O60 A;  3CLN A;  3BQ3 A;  2M3W A;  1CDL A;  1W7J B;  1WDC C;  1MXE A;  1SCM C;  5CPV A;  1F55 A;  3GOF A;  3O6B A;  5CSI A;  1UUS A;  1Y1U A;  3DVE A;  1AHR A;  4C0K A;  5IBW A;  1TNX A;  4MRY A;  1EH2 A;  2LLT A;  4GAO A;  1XFY O;  2LUC A;  3TUY B;  3PAL A;  3BYA A;  1NWD A;  1RRO A;  2FOT A;  3A4U B;  1KFX S;  1SCV A;  1AP4 A;  4M2O A;  2LAN A;  1QIW A;  2FJU B;  1B47 A;  1TOP A;  1BOC A;  4WQ3 A;  3PN7 C;  1MQ1 A;  1GQM A;  4P5O E;  1FI5 A;  1IG5 A;  5ER5 A;  2KI6 D;  1KK8 C;  4WRI A;  2JOJ A;  3KEV A;  1U5I B;  2KAV A;  2L0P A;  4A4C A;  1UHI A;  2L98 A;  2RGI A;  2O5G A;  1TIZ A;  3TS5 B;  1LKJ A;  4ZCV A;  1SR6 B;  2LAP A;  5AER A;  2F3Y A;  2JT8 A;  1KCY A;  1PSB A;  3SG5 A;  3O2P A;  4N5X A;  4I5J A;  1EG3 A;  1A2X A;  1JFK A;  1K94 A;  3I5G C;  3VGO A;  2M7N A;  3AAK A;  4CFR A;  2LP3 A;  5JOL A;  1S6C A;  1J1D A;  4ZCU A;  2K61 A;  4PE1 A;  1SPY A;  2ZFD A;  2BL0 B;  4MLW A;  1RFJ A;  1K95 A;  2CBL A;  2EC6 C;  4AOM A;  1KK7 Z;  1J7O A;  2KAX A;  1F4Q A;  2JXC A;  1QX5 B;  2LLU A;  3BOW A;  5F6T A;  1B9A A;  3HCM A;  1YVH A;  1DF0 A;  1TNP A;  2LVJ A;  5HLV A;  3CGA A;  5HKY A;  4YGA A;  1S36 A;  1UHH A;  2Q4U A;  3TDZ A;  1LVC D;  2M97 A;  1NX2 A;  2KI4 B;  1ALV A;  2FCE A;  1EJ3 A;  1L2O B;  1B8L A;  1LA3 A;  4CPV A;  2JPT A;  5I2L A;  3TZ1 A;  4XJK A;  4E68 A;  1XK4 A;  2H2K A; 
#chains in the Genus database with same CATH topology
 1RK9 A;  2P70 A;  5G08 A;  4NQG A;  4FTG A;  1SK6 D;  3AAJ A;  3DVJ A;  2JZI A;  3FIA A;  4MVF A;  3S0A A;  2BE6 A;  1S6J A;  2KLD A;  1YTZ C;  4DUQ A;  2KLE A;  5AFP A;  1FI6 A;  4OR9 B;  2KBM A;  2CT9 A;  3FE9 A;  3OX5 A;  2PVB A;  1MHO A;  1RWY A;  2LMV A;  3BFH A;  1VRK A;  1DJX A;  2L51 A;  1DTL A;  4GPL B;  5CSN A;  1OOF A;  1XFV O;  1Z2C B;  4BY5 A;  1XK4 C;  1K2H A;  4JQ0 D;  1WY9 A;  3BFB A;  1JSA A;  3NGV A;  1DJG A;  1OE9 B;  1NX0 A;  1NCX A;  3CDN A;  3SIB A;  3DVM A;  1S3P A;  4QJ4 B;  3CZ1 A;  1J1E A;  2R2I A;  3D0Y A;  2NZ0 A;  1A4P A;  5I2O A;  1GGZ A;  5CSJ A;  3ICB A;  3AKA A;  2OS8 C;  1B8R A;  1K90 D;  2K7C A;  2WND A;  2LVI A;  5HKZ A;  1KFX L;  1FW4 A;  4AQJ A;  1S5G Y;  2L5X B;  1TNQ A;  1WRZ A;  1CMF A;  1KWO C;  3NSO A;  3EKH A;  3KF9 A;  1V1G A;  1K96 A;  1NCY A;  3CS1 A;  3OB1 B;  1AJ5 A;  3KHE A;  1NCZ A;  1Y1A A;  2GGM A;  4BY4 A;  1NPQ A;  2OPO A;  1UP5 A;  1FPW A;  4I5L B;  1XFZ O;  3JVT C;  1J7Q A;  1XFU O;  3FWB A;  1GM0 A;  1BR4 B;  3DXL A;  2BCA A;  3D78 A;  3NSI A;  2PYQ A;  1XFX O;  1G33 A;  2BKH B;  3EVR A;  1DJW A;  2M9G A;  4A4B A;  1RTP 1;  1SL7 A;  3GK4 X;  4OVN F;  4ETO A;  3EVU A;  1GJY A;  3CR5 X;  3DF0 A;  2WCE A;  1Y0V H;  1NP8 A;  5HYD A;  4DS7 A;  1G4Y R;  2K60 A;  4U8D A;  1W9Z A;  2F2P A;  3OHM B;  2JNX A;  1BR1 B;  1OMV A;  1T14 A;  2D8N A;  3TDI A;  1CB1 A;  1OOJ A;  4P2Y B;  3BUX B;  2WCJ A;  4YGB B;  1DJH A;  1K93 D;  1NSH A;  1QAS A;  2LHL A;  2QPT A;  1ODB A;  2JT3 A;  2LCP A;  4JKT A;  4F7F A;  1S1E A;  4INW A;  2KGB C;  1C07 A;  1QS7 A;  3VB1 A;  1SNL A;  3D10 A;  4N1G A;  4QJ5 B;  3OP0 A;  1M39 A;  4HRG A;  2WCF A;  5DKQ A;  4OV2 A;  2BEC A;  5HLO A;  2BNX A;  3O4X A;  1TN4 A;  2K7B A;  3CAB A;  3I5H B;  1DEL A;  2I18 A;  1DGU A;  2WCB A;  3S0G A;  1WRK A;  3PAT A;  3L47 A;  2WCL A;  4ORA B;  2V53 A;  3JTD C;  5ER4 X;  1QLK A;  1IQ3 A;  1WLM A;  3D75 A;  3S0E A;  2COL B;  2LE9 B;  2SAS A;  1ZOT B;  5FI2 A;  1BJF A;  2JQ6 A;  3I5G B;  3MSE B;  1ZFS A;  1SRA A;  1F71 A;  5KTY A;  1UWO A;  3D73 A;  3KO0 A;  1QV1 A;  5D69 A;  2WC6 A;  4FQT A;  4ICB A;  1M46 A;  1KFU L;  2Q91 A;  3BUM B;  3GK1 A;  2JXL A;  3EVV A;  3D76 A;  2F2O A;  4HRH A;  4INX A;  3TUY C;  2L5Y A;  2JT0 A;  3LL8 B;  1A75 B;  2MAZ A;  3EK8 A;  2LVV A;  3OX6 A;  4HRE E;  4NDB A;  4DCK A;  3ZNI A;  3SG3 A;  2Y1N A;  1GGW A;  1AUI B;  4IJ7 A;  2KYC A;  4MBE A;  5AEQ A;  3WXA A;  2WC8 A;  1YUR A;  1UHJ A;  2KFG A;  1IWQ A;  5DKN A;  3FWC A;  4YBH B;  1JFJ A;  1H8B A;  1B7T Y;  2K7D A;  2F8P A;  2JNF A;  2JRF A;  4NDC A;  2JUL A;  1IH0 A;  3DYE A;  2QEH A;  1PSR A;  3DVK A;  3VRN A;  3CYZ A;  2CTN A;  1SKT A;  1QJT A;  2ZKM X;  2WOS A;  2P6B B;  5FI7 A;  3V2L A;  1SW8 A;  1Z4H A;  1S6I A;  1V1F A;  2MBX A;  4C0J A;  1DF0 B;  3SIA A;  1R2U A;  1ZUZ A;  2LM5 A;  2KHN A;  4OZD A;  5CSF A;  1OSA A;  2ZRT A;  2BCB A;  2KNE A;  1KQM C;  2M29 A;  2MHH A;  3EKJ A;  3DY9 A;  3O78 A;  4CLN A;  1B8C A;  2JTT A;  1CM1 A;  2MJW B;  2G2B A;  2WOR A;  4C0L A;  3BUO B;  1DVI A;  1QVI Y;  2HQ8 A;  2M1U A;  2FJY A;  2L4I A;  1JF2 A;  2L2E A;  3PSR A;  1YX7 A;  1KFU S;  3FS7 A;  2I94 A;  1SL9 A;  3OBV A;  1NIW A;  1OOG A;  3I5I B;  2F3Z A;  1LXF C;  1EG4 A;  1Q80 A;  1QX7 A;  1TUJ A;  1SY9 A;  2A4J A;  3LCP C;  1OOH A;  2ZN9 A;  2OTG B;  4PE0 A;  1LA0 A;  2LLS A;  1YVL A;  1AVS A;  1QAT A;  4GGN A;  3VRO A;  1JF0 A;  1IQ5 A;  3RZS A;  1CDP A;  1KSO A;  3F45 A;  1YRU B;  4UPG A;  1XYD A;  1YUT A;  4PHM A;  1PVA A;  2HF5 A;  2LNK A;  2L50 A;  5KU1 A;  2GV5 A;  2P71 A;  1CTR A;  1OW4 A;  2I2R E;  2LP2 A;  4PHJ A;  2KI4 C;  2IS9 A;  1R6P A;  2PAS A;  3FE6 A;  3L4L A;  3PFV A;  5D7F A;  1L2O C;  4XYN A;  1DJY A;  4YGE B;  1B4C A;  1TWO A;  3JVT B;  2JWW A;  2LUX A;  3WHU B;  2ZND A;  2Y1M A;  3SJS A;  1AK8 A;  4I5K A;  1S5G Z;  5K89 A;  1ALW A;  1CFC A;  1K9K A;  4GFT A;  1YR5 A;  2KSP A;  2JPO A;  4YGD B;  4OCI A;  4MZJ A;  1CNP A;  1YUS A;  2E6W A;  3M0W A;  4IL1 A;  1DT7 B;  2BBN A;  1Y6W A;  1QIV A;  2ERB A;  4JWQ A;  4PE7 A;  3R1V A;  1NX3 A;  2BCX A;  1K9U A;  2K2F A;  3NHT A;  2KAY A;  2M8U A;  4QJ3 B;  1WDC B;  5DKR A;  1SCM B;  1E8A A;  2HET A;  4MSP A;  2M7L A;  2K0J A;  1CKK A;  3BFA A;  3QRX A;  4NDD A;  1B1G A;  4FQO A;  5TNC A;  3OGN A;  1IRJ A;  3BUN B;  2KI6 C;  1BF5 A;  1HQV A;  4L9M A;  1SBJ A;  2PMY A;  2Y4Q A;  1FBV A;  1PVB A;  2AAO A;  1K9P A;  1MR8 A;  3K21 A;  4I5N B;  2CXJ A;  4ORC B;  3S0B A;  1D1O A;  1W7I B;  3EK7 A;  3PN7 B;  1DQE A;  3KPX A;  1WLZ A;  4M2Q A;  4MN0 A;  2KYF A;  2HPS A;  1CLM A;  2TN4 A;  1OQP A;  1QLS A;  1KK8 B;  1C7W A;  2DOQ A;  3SS4 A;  1C3Y A;  3B6X A;  2AUC A;  1PK0 D;  3R1O A;  2PRU A;  4MZL A;  1JBA A;  1AJ4 A;  4PAL A;  3LK1 A;  4WQ2 A;  3SG7 A;  2LMT A;  2ZNE A;  3O4Y A;  3CZT X;  1IKU A;  3LK0 A;  1N0Y A;  2KDH A;  3I5F C;  3CR4 X;  1TUZ A;  4PHN A;  1F4O A;  2KFH A;  1DMO A;  1CDN A;  1N2D A;  3OB2 B;  1BLQ A;  3IF7 A;  1MXL C;  1TCO B;  4PDZ A;  2HQW A;  4GNK B;  1CM4 A;  2L4H A;  2YGU A;  2BBM A;  4Q04 A;  1TRF A;  4YI9 A;  2QEB A;  1IGV A;  3R72 A;  1PAL A;  2JTZ A;  2PSR A;  1U5I A;  2EC6 B;  4R1E A;  3WNX B;  3B88 A;  5I2Q A;  2KGR A;  4F0Z B;  5FYX A;  3SS5 A;  1PRW A;  1HT9 A;  3RM1 A;  1L7Z A;  3SG2 A;  3VRP A;  2M1K B;  3CR2 A;  2EGD A;  2MLF C;  1TCF A;  3CTN A;  5J3X A;  4DIR A;  4YRU A;  3VRR A;  1DEK A;  1XFW O;  1MUX A;  4YGC B;  1MWN A;  2KFF A;  1X02 A;  2VRG A;  2CCM A;  3I5H C;  1OZO A;  2WCM A;  3VRQ A;  1CFP A;  5AXI A;  4PE4 A;  1NYA A;  3EG5 B;  1CLL A;  2PAL A;  3ZWH A;  1A75 A;  3B86 A;  2GTE A;  2QEV A;  3HX4 A;  3WHT B;  3IQO A;  3TS5 C;  1B7T Z;  1JUO A;  1SMG A;  1CMG A;  1J7R A;  4CFQ A;  3FE8 A;  2LV7 A;  1KQM B;  3BOW B;  4TNC A;  5BPJ A;  2Y5I A;  3DZT A;  5I94 A;  1FF1 A;  1RJV A;  2K7O A;  1BMO A;  1PUL A;  1KK7 Y;  1XA5 A;  1SR6 C;  1ORG A;  5JJG A;  2ZRS A;  3LLE A;  1ZMZ A;  4PCW A;  1XO5 A;  1EL4 A;  4USL A;  1BT6 A;  3QME A;  5AAN A;  4CID A;  3PM2 A;  1DGV A;  2F33 A;  3N7H A;  1TNW A;  4XJK B;  2FCD A;  2BL0 C;  2WC5 A;  2M49 B;  4GUK A;  1F8H A;  4HSZ A;  2MA2 A;  4N1F A;  1QVI Z;  2JC2 A;  3K1E A;  1KQV A;  2K2A A;  2JU0 A;  1K8U A;  2NLN A;  1SYM A;  3DD4 A;  2BE4 A;  2B1U A;  2LHI A;  2KPH A;  2KOT A;  3NSK A;  2CNP A;  3R1P A;  2OS8 B;  3IQQ A;  3PLF B;  4YI8 A;  1QTX A;  5EL2 A;  2KQ6 A;  1N65 A;  1IJ6 A;  5B8I B;  4JPZ B;  1DC1 A;  1YRT B;  3D74 A;  3H4S E;  4MEW A;  2EHB A;  1XVJ A;  3BUW B;  1CLB A;  2I7A A;  1YX8 A;  1KWO B;  3B87 A;  2NCP A;  2L2C A;  4OKH A;  1IJ5 A;  3E3R A;  3PM8 A;  3NHI A;  1OMR A;  4PHK A;  1BG1 A;  3EK4 A;  1UUR A;  3D0Y B;  5D3O A;  1NX1 A;  2KBI A;  1JC2 A;  1BOD A;  1BU3 A;  1OZS A;  5HKW A;  3C1V A;  1CFF A;  3CZ0 A;  2LC5 A;  2MRD A;  1OMD A;  2ISD A;  3D77 A;  2G9B A;  1ZAC A;  1C7V A;  1J55 A;  2LMU A;  1CFD A;  1LIN A;  3PJI A;  4D1E A;  1EXR A;  1QXP A;  4DRW A;  2SCP A;  4ORB B;  3I5I C;  5FI6 A;  2MLE C;  5PAL A;  1DJZ A;  1SL8 A;  1G8I A;  2H8V A;  1QV0 A;  1SSE B;  1F70 A;  1A03 A;  2KQY A;  4AQI A;  2OTG C;  1UHN A;  1CDM A;  1F54 A;  5KSZ A;  5DIC A;  2BAP A;  5GQQ C;  3SG6 A;  4MRX A;  1JWD A;  4GGF A;  2AMI A;  1YUU A;  1P28 A;  3BXK A;  3S0D A;  2BKI B;  2LVK A;  2NXQ A;  3GK2 A;  1H4B A;  1M31 A;  1Y1X A;  1KSM A;  3DF0 B;  2GGZ A;  1M63 B;  4GBA A;  1QX2 A;  2H61 A;  2NCO A;  1MF8 B;  2QAC A;  4MZK A;  2K8M B;  2M0R A;  1UHK A;  2ZN8 A;  1S26 D;  1NUB A;  1J7P A;  4GGF C;  3CWG A;  1DJI A;  1WRL A;  2WCK A;  3SG4 A;  4M2P A;  5I8N A;  3NXA A;  1REC A;  2E30 A;  3I5F B;  3TDU A;  1TTX A;  3AKB A;  3JTD B;  1A29 A;  3A8R A;  3NSL A;  3RLZ A;  1M45 A;  1LS8 A;  1QWV A;  2H61 C;  2O60 A;  3IVT A;  3CLN A;  3BQ3 A;  2M3W A;  1CDL A;  1W7J B;  1WDC C;  3L4A A;  1MXE A;  1SCM C;  5CPV A;  1F55 A;  3GOF A;  3O6B A;  5CSI A;  1UUS A;  1Y1U A;  3DVE A;  1AHR A;  4C0K A;  5IBW A;  1TNX A;  4MRY A;  1EH2 A;  4KYN A;  2LLT A;  4GAO A;  1XFY O;  2LUC A;  3TUY B;  3PAL A;  3BYA A;  1NWD A;  1RRO A;  2FOT A;  2PQL A;  3A4U B;  1KFX S;  1SCV A;  1AP4 A;  4M2O A;  2LAN A;  1QIW A;  2FJU B;  5HL1 A;  1B47 A;  1TOP A;  1BOC A;  4WQ3 A;  3PN7 C;  1MQ1 A;  1GQM A;  4P5O E;  1FI5 A;  1IG5 A;  5ER5 A;  2KI6 D;  1KK8 C;  1C3Z A;  2JOJ A;  3KEV A;  4WRI A;  1U5I B;  2KAV A;  2L0P A;  4A4C A;  1UHI A;  2L98 A;  2RGI A;  4JD9 A;  2QEO A;  2O5G A;  1OOI X;  1TIZ A;  3TS5 B;  3B7A A;  1LKJ A;  4ZCV A;  3UNW A;  1SR6 B;  2LAP A;  5AER A;  2F3Y A;  2JT8 A;  1KCY A;  1PSB A;  3SG5 A;  3O2P A;  4N5X A;  4I5J A;  1EG3 A;  1A2X A;  1JFK A;  1K94 A;  3I5G C;  3VGO A;  2M7N A;  3AAK A;  4CFR A;  3S0F A;  2LP3 A;  5JOL A;  1S6C A;  1J1D A;  4ZCU A;  2K61 A;  4PE1 A;  1SPY A;  2ZFD A;  2BL0 B;  4MLW A;  1RFJ A;  1K95 A;  2CBL A;  2EC6 C;  4AOM A;  1KK7 Z;  1J7O A;  1XFR A;  2KAX A;  3SS3 A;  1F4Q A;  2JXC A;  3UO9 A;  1QX5 B;  2LLU A;  3BOW A;  5F6T A;  1B9A A;  3HCM A;  1YVH A;  1DF0 A;  1TNP A;  2LVJ A;  5HLV A;  3CGA A;  5HKY A;  4YGA A;  1S36 A;  1UHH A;  4PT1 A;  3BJH A;  2Q4U A;  3CZ2 A;  3TDZ A;  3Q8I A;  1LVC D;  2M97 A;  1NX2 A;  2WCH A;  2KI4 B;  1IIO A;  1ALV A;  2FCE A;  1EJ3 A;  1L2O B;  1B8L A;  1LA3 A;  4CPV A;  2JPT A;  5I2L A;  3TZ1 A;  4XJK A;  4E68 A;  2QDI A;  1XK4 A;  2H2K A; 
#chains in the Genus database with same CATH homology
 1RK9 A;  5G08 A;  4NQG A;  4FTG A;  1SK6 D;  3AAJ A;  3DVJ A;  2JZI A;  3FIA A;  4MVF A;  2BE6 A;  1S6J A;  4DUQ A;  1YTZ C;  5AFP A;  1FI6 A;  4OR9 B;  2KBM A;  2CT9 A;  3OX5 A;  2PVB A;  1MHO A;  1RWY A;  2LMV A;  1VRK A;  1DJX A;  2L51 A;  1DTL A;  4GPL B;  5CSN A;  1XFV O;  4BY5 A;  1XK4 C;  1K2H A;  4JQ0 D;  1WY9 A;  1JSA A;  1DJG A;  1OE9 B;  1NX0 A;  1NCX A;  3SIB A;  3DVM A;  1S3P A;  4QJ4 B;  1J1E A;  2R2I A;  3D0Y A;  2NZ0 A;  1A4P A;  5I2O A;  1GGZ A;  5CSJ A;  3ICB A;  3AKA A;  2OS8 C;  1B8R A;  1K90 D;  2K7C A;  2WND A;  2LVI A;  5HKZ A;  1KFX L;  1FW4 A;  4AQJ A;  1S5G Y;  2L5X B;  1TNQ A;  1WRZ A;  1CMF A;  1KWO C;  3NSO A;  3EKH A;  3KF9 A;  1V1G A;  1K96 A;  1NCY A;  3CS1 A;  3OB1 B;  1AJ5 A;  3KHE A;  1NCZ A;  1Y1A A;  2GGM A;  4BY4 A;  1NPQ A;  2OPO A;  1UP5 A;  1FPW A;  4I5L B;  1XFZ O;  3JVT C;  1J7Q A;  1XFU O;  3FWB A;  1BR4 B;  2BCA A;  3NSI A;  1XFX O;  1G33 A;  2BKH B;  3EVR A;  1DJW A;  2M9G A;  4A4B A;  1RTP 1;  1SL7 A;  3GK4 X;  4OVN F;  4ETO A;  3EVU A;  1GJY A;  3CR5 X;  3DF0 A;  2WCE A;  1Y0V H;  1NP8 A;  5HYD A;  4DS7 A;  1G4Y R;  4U8D A;  2F2P A;  3OHM B;  2JNX A;  1BR1 B;  1OMV A;  2D8N A;  3TDI A;  1CB1 A;  1OOJ A;  4P2Y B;  3BUX B;  4YGB B;  1DJH A;  1K93 D;  1NSH A;  1QAS A;  2LHL A;  2QPT A;  1ODB A;  2JT3 A;  2LCP A;  1S1E A;  2KGB C;  1C07 A;  1QS7 A;  1SNL A;  3D10 A;  4N1G A;  4QJ5 B;  3OP0 A;  1M39 A;  4HRG A;  2WCF A;  5DKQ A;  4OV2 A;  2BEC A;  5HLO A;  1TN4 A;  2K7B A;  3I5H B;  2I18 A;  1DGU A;  2WCB A;  1WRK A;  3PAT A;  4ORA B;  2V53 A;  3JTD C;  5ER4 X;  1QLK A;  1IQ3 A;  1WLM A;  2COL B;  2LE9 B;  2SAS A;  1ZOT B;  1BJF A;  2JQ6 A;  3I5G B;  3MSE B;  1ZFS A;  1SRA A;  1F71 A;  5KTY A;  1UWO A;  3KO0 A;  1QV1 A;  5D69 A;  4ICB A;  1M46 A;  1KFU L;  2Q91 A;  3BUM B;  3GK1 A;  2JXL A;  3EVV A;  2F2O A;  4HRH A;  3TUY C;  2JT0 A;  3LL8 B;  1A75 B;  2MAZ A;  3EK8 A;  2LVV A;  3OX6 A;  4HRE E;  4NDB A;  4DCK A;  3ZNI A;  3SG3 A;  2Y1N A;  1GGW A;  1AUI B;  4MBE A;  2KYC A;  5AEQ A;  3WXA A;  5JJG A;  2WC8 A;  1YUR A;  1UHJ A;  2KFG A;  1IWQ A;  5DKN A;  3FWC A;  4YBH B;  1JFJ A;  1H8B A;  1B7T Y;  2K7D A;  2F8P A;  2JNF A;  2JRF A;  4NDC A;  2JUL A;  1IH0 A;  1PSR A;  3DVK A;  3VRN A;  2CTN A;  1SKT A;  1QJT A;  2ZKM X;  2WOS A;  2P6B B;  1SW8 A;  1S6I A;  1V1F A;  2MBX A;  4C0J A;  1DF0 B;  3SIA A;  1R2U A;  1ZUZ A;  2LM5 A;  2KHN A;  5CSF A;  1OSA A;  2ZRT A;  2BCB A;  2KNE A;  1KQM C;  2M29 A;  2MHH A;  3EKJ A;  4CLN A;  3O78 A;  1B8C A;  2JTT A;  1CM1 A;  2MJW B;  2G2B A;  2WOR A;  4C0L A;  3BUO B;  1DVI A;  1QVI Y;  2HQ8 A;  2M1U A;  2L4I A;  1JF2 A;  2L2E A;  3PSR A;  1YX7 A;  1KFU S;  3FS7 A;  2I94 A;  1SL9 A;  1NIW A;  3I5I B;  2F3Z A;  1LXF C;  1EG4 A;  1Q80 A;  1QX7 A;  1SY9 A;  2A4J A;  3LCP C;  2ZN9 A;  2OTG B;  4PE0 A;  1LA0 A;  2LLS A;  1YVL A;  1AVS A;  1QAT A;  4GGN A;  3VRO A;  1JF0 A;  1IQ5 A;  1CDP A;  1KSO A;  3F45 A;  1YRU B;  4UPG A;  1XYD A;  1YUT A;  4PHM A;  1PVA A;  2HF5 A;  2LNK A;  2L50 A;  5KU1 A;  2GV5 A;  1CTR A;  2LP2 A;  2I2R E;  4PHJ A;  2KI4 C;  2IS9 A;  1R6P A;  2PAS A;  3PFV A;  5D7F A;  1L2O C;  4XYN A;  1DJY A;  4YGE B;  1B4C A;  3JVT B;  2JWW A;  2LUX A;  3WHU B;  2ZND A;  2Y1M A;  3SJS A;  1AK8 A;  4I5K A;  1S5G Z;  5K89 A;  1ALW A;  1CFC A;  1K9K A;  4GFT A;  1YR5 A;  2KSP A;  4YGD B;  4OCI A;  4MZJ A;  1CNP A;  1YUS A;  2E6W A;  3M0W A;  4IL1 A;  1DT7 B;  2BBN A;  1Y6W A;  1QIV A;  4JWQ A;  4PE7 A;  1NX3 A;  2BCX A;  1K9U A;  2K2F A;  2KAY A;  2M8U A;  4QJ3 B;  1WDC B;  5DKR A;  1SCM B;  1E8A A;  2HET A;  4MSP A;  2M7L A;  2K0J A;  1CKK A;  3QRX A;  4NDD A;  1B1G A;  4FQO A;  5TNC A;  1IRJ A;  3BUN B;  2KI6 C;  1BF5 A;  1HQV A;  4L9M A;  1SBJ A;  2PMY A;  2Y4Q A;  1FBV A;  1PVB A;  2AAO A;  1K9P A;  1MR8 A;  3K21 A;  4I5N B;  2CXJ A;  4ORC B;  1D1O A;  1W7I B;  3EK7 A;  3PN7 B;  3KPX A;  1WLZ A;  4M2Q A;  4MN0 A;  2KYF A;  2HPS A;  1CLM A;  2TN4 A;  1OQP A;  1QLS A;  1KK8 B;  1C7W A;  2DOQ A;  2AUC A;  1PK0 D;  2PRU A;  4MZL A;  1JBA A;  1AJ4 A;  4PAL A;  3LK1 A;  4WQ2 A;  3SG7 A;  2LMT A;  2ZNE A;  3O4Y A;  3CZT X;  1IKU A;  3LK0 A;  1N0Y A;  2KDH A;  3I5F C;  3CR4 X;  4PHN A;  1F4O A;  2KFH A;  1CDN A;  1N2D A;  3OB2 B;  1BLQ A;  3IF7 A;  1MXL C;  1TCO B;  4PDZ A;  2HQW A;  4GNK B;  1CM4 A;  2L4H A;  2BBM A;  4Q04 A;  1TRF A;  4YI9 A;  1IGV A;  1PAL A;  2JTZ A;  2PSR A;  1U5I A;  2EC6 B;  4R1E A;  3WNX B;  5I2Q A;  2KGR A;  4F0Z B;  5FYX A;  1PRW A;  1HT9 A;  3RM1 A;  1L7Z A;  3SG2 A;  3VRP A;  2M1K B;  3CR2 A;  2EGD A;  2MLF C;  1TCF A;  3CTN A;  5J3X A;  4DIR A;  4YRU A;  3VRR A;  1XFW O;  1MUX A;  4YGC B;  1MWN A;  2KFF A;  1X02 A;  2VRG A;  2CCM A;  3I5H C;  1OZO A;  1CFP A;  3VRQ A;  5AXI A;  4PE4 A;  1NYA A;  1CLL A;  2PAL A;  3ZWH A;  1A75 A;  3HX4 A;  3WHT B;  3IQO A;  3TS5 C;  1B7T Z;  1JUO A;  1SMG A;  1CMG A;  1J7R A;  4CFQ A;  1DMO A;  2LV7 A;  1KQM B;  3BOW B;  4TNC A;  5BPJ A;  2Y5I A;  1FF1 A;  1RJV A;  2K7O A;  1BMO A;  1PUL A;  1KK7 Y;  1XA5 A;  1SR6 C;  2ZRS A;  3LLE A;  1ZMZ A;  4PCW A;  1XO5 A;  1EL4 A;  4USL A;  1BT6 A;  5AAN A;  4CID A;  1DGV A;  2F33 A;  1TNW A;  4XJK B;  2FCD A;  2BL0 C;  2M49 B;  4GUK A;  1F8H A;  4HSZ A;  2MA2 A;  4N1F A;  1QVI Z;  2JC2 A;  1KQV A;  2K2A A;  2JU0 A;  1K8U A;  2NLN A;  1SYM A;  3DD4 A;  2BE4 A;  2B1U A;  2LHI A;  2KOT A;  3NSK A;  2CNP A;  2OS8 B;  3IQQ A;  3PLF B;  4YI8 A;  1QTX A;  5B8I B;  2KQ6 A;  1N65 A;  1IJ6 A;  4JPZ B;  1YRT B;  3H4S E;  4MEW A;  2EHB A;  1XVJ A;  3BUW B;  1CLB A;  2I7A A;  1YX8 A;  1KWO B;  4OKH A;  2NCP A;  1IJ5 A;  3E3R A;  3PM8 A;  1OMR A;  4PHK A;  1BG1 A;  3EK4 A;  1UUR A;  3D0Y B;  1NX1 A;  2KBI A;  1JC2 A;  1BOD A;  1BU3 A;  1OZS A;  5HKW A;  3C1V A;  1CFF A;  2LC5 A;  2MRD A;  1OMD A;  2ISD A;  2G9B A;  1ZAC A;  1C7V A;  1J55 A;  2LMU A;  1CFD A;  1LIN A;  4D1E A;  1EXR A;  1QXP A;  4DRW A;  2SCP A;  4ORB B;  3I5I C;  2MLE C;  5PAL A;  1DJZ A;  1SL8 A;  1G8I A;  1QV0 A;  1F70 A;  1A03 A;  2KQY A;  4AQI A;  2OTG C;  1UHN A;  1CDM A;  1F54 A;  5KSZ A;  5GQQ C;  3SG6 A;  4MRX A;  1JWD A;  4GGF A;  2AMI A;  1YUU A;  3BXK A;  2BKI B;  2LVK A;  2NXQ A;  3GK2 A;  1H4B A;  1M31 A;  1Y1X A;  1KSM A;  3DF0 B;  2GGZ A;  1M63 B;  4GBA A;  1QX2 A;  2H61 A;  2NCO A;  1MF8 B;  2QAC A;  4MZK A;  2K8M B;  2M0R A;  1UHK A;  2ZN8 A;  1S26 D;  1NUB A;  1J7P A;  4GGF C;  3CWG A;  1DJI A;  1WRL A;  3SG4 A;  4M2P A;  5I8N A;  3NXA A;  1REC A;  2E30 A;  3I5F B;  3TDU A;  1TTX A;  3AKB A;  3JTD B;  1A29 A;  3A8R A;  3NSL A;  3RLZ A;  1M45 A;  2H61 C;  2O60 A;  3CLN A;  3BQ3 A;  2M3W A;  1CDL A;  1W7J B;  1WDC C;  1MXE A;  1SCM C;  5CPV A;  1F55 A;  3GOF A;  3O6B A;  5CSI A;  1UUS A;  1Y1U A;  3DVE A;  1AHR A;  4C0K A;  5IBW A;  1TNX A;  4MRY A;  1EH2 A;  2LLT A;  4GAO A;  1XFY O;  2LUC A;  3TUY B;  3PAL A;  3BYA A;  1NWD A;  1RRO A;  2FOT A;  3A4U B;  1KFX S;  1SCV A;  1AP4 A;  4M2O A;  2LAN A;  1QIW A;  2FJU B;  1B47 A;  1TOP A;  1BOC A;  4WQ3 A;  3PN7 C;  1MQ1 A;  1GQM A;  4P5O E;  1FI5 A;  1IG5 A;  5ER5 A;  2KI6 D;  1KK8 C;  4WRI A;  2JOJ A;  3KEV A;  1U5I B;  2KAV A;  2L0P A;  4A4C A;  1UHI A;  2L98 A;  2RGI A;  2O5G A;  1TIZ A;  3TS5 B;  1LKJ A;  4ZCV A;  1SR6 B;  2LAP A;  5AER A;  2F3Y A;  2JT8 A;  1KCY A;  1PSB A;  3SG5 A;  3O2P A;  4N5X A;  4I5J A;  1EG3 A;  1A2X A;  1JFK A;  1K94 A;  3I5G C;  3VGO A;  2M7N A;  3AAK A;  4CFR A;  2LP3 A;  5JOL A;  1S6C A;  1J1D A;  4ZCU A;  2K61 A;  4PE1 A;  1SPY A;  2ZFD A;  2BL0 B;  4MLW A;  1RFJ A;  1K95 A;  2CBL A;  2EC6 C;  4AOM A;  1KK7 Z;  1J7O A;  2KAX A;  1F4Q A;  2JXC A;  1QX5 B;  2LLU A;  3BOW A;  5F6T A;  1B9A A;  3HCM A;  1YVH A;  1DF0 A;  1TNP A;  2LVJ A;  5HLV A;  3CGA A;  5HKY A;  4YGA A;  1S36 A;  1UHH A;  2Q4U A;  3TDZ A;  1LVC D;  2M97 A;  1NX2 A;  2KI4 B;  1ALV A;  2FCE A;  1EJ3 A;  1L2O B;  1B8L A;  1LA3 A;  4CPV A;  2JPT A;  5I2L A;  3TZ1 A;  4XJK A;  4E68 A;  1XK4 A;  2H2K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...