2M0RA

Solution structure and dynamics of human s100a14
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
104
structure length
104
Chain Sequence
MGQCRSANAEDAQEFSDVERAIETLIKNFHQYSVEGGKETLTPSELRDLVTQQLPHLMPSNCGLEEKIANLGSCNDSKLEFRSFWELIGEAAKSVKLERPVRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Protein S100-A14
publication title Solution structure and dynamics of human S100A14.
pubmed doi rcsb
source organism Homo sapiens
total genus 23
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2m0rA00
5KTYA 3PN7C 1C7WA 1YTZC 4DUQA 4A4BA 4PHKA 2M49B 2JT0A 2LLSA 2F2OA 3SG6A 4ORBB 1J7PA 4NQGA 2M1KB 4TNCA 1V1FA 2JRFA 4I5JA 1JUOA 2ZFDA 1C7VA 1S1EA 1YRTB 4Q04A 4A4CA 2KNEA 1GQMA 1MXLC 4QJ3B 2JTZA 1IQ3A 3QRXA 2CBLA 4L9MA 3VRPA 1BLQA 3BYAA 1B8RA 1RJVA 3I5FB 1EXRA 1UUSA 3I5GC 5HLVA 4HSZA 3EKHA 2K2FA 4GBAA 3FIAA 4MZJA 5ER4X 1HT9A 3NSOA 1SY9A 4PALA 1DF0A 2KI4C 4PCWA 1RK9A 1IJ6A 2L0PA 1IH0A 1BT6A 1B4CA 1DJZA 2EC6C 4MN0A 5BPJA 4YRUA 1KQVA 2JXLA 4MSPA 3VRRA 5I2OA 2NXQA 2QPTA 1MF8B 3JTDB 2JQ6A 2LHLA 1SKTA 1NSHA 2MRDA 2WNDA 4N1FA 4NDDA 1ALVA 1M31A 2D8NA 1YVLA 2JT8A 4ORAB 1WRKA 1OZOA 4CIDA 2WCBA 2K7BA 2KGBC 3ICBA 4YI8A 1F4QA 1TNPA 4FTGA 2GGMA 5J3XA 2LUCA 1FPWA 4GPLB 1SL8A 2MAZA 3EK7A 1SR6B 1XYDA 2CCMA 2KFHA 4U8DA 5DKNA 1CDNA 2LP3A 1K2HA 1LA0A 2MBXA 1N2DA 2LMTA 1QIWA 2HETA 5HKWA 1NCXA 1NP8A 2L4HA 4PE0A 1SBJA 1CM4A 2AUCA 1K8UA 5I8NA 1YX7A 2BBMA 2KAXA 2BCAA 4GNKB 1WRLA 2KBIA 1XVJA 1J1EA 1J7QA 1IRJA 2WCEA 1DGUA 2OTGB 1XA5A 2BL0C 1QVIZ 2LV7A 2OPOA 2WORA 1ZMZA 1CDPA 3WHTB 1OZSA 2M1UA 5AEQA 1EG4A 3SIAA 1UHHA 3FWCA 5FYXA 3SG7A 1OMVA 1PULA 1RWYA 1W7IB 1OE9B 2PSRA 2TN4A 3NSKA 3I5FC 2LANA 1EG3A 2GV5A 2JULA 3OX5A 1PVBA 1G8IA 2HQ8A 2B1UA 4DIRA 4XJKB 3BUWB 2L5XB 3PALA 2LLUA 2F33A 3OX6A 3TS5C 3TZ1A 3VROA 1CFCA 4YGAA 2AMIA 3PFVA 2KSPA 2ZNEA 3TDUA 1SL9A 1KK7Z 5HLOA 2Y1MA 1M63B 5HYDA 3GK4X 1NWDA 1BF5A 1A2XA 2WCFA 4PHMA 3NSIA 4WQ2A 4ZCVA 2HPSA 2JOJA 2KAYA 2KHNA 1CB1A 1M39A 1JC2A 3AAJA 3JTDC 3CR5X 3KHEA 1FI5A 4HRHA 2JZIA 1AHRA 1S6IA 2M29A 4OVNF 3BUOB 1TRFA 3TDZA 4PHNA 2IS9A 2BE4A 2F8PA 1DJYA 4P2YB 1A4PA 2M8UA 1K96A 1BR1B 1YURA 2Q91A 1BG1A 1F55A 1ZUZA 1F70A 2CNPA 1D1OA 2KQ6A 1Y6WA 2QACA 2HF5A 3OP0A 1B9AA 1CM1A 1SR6C 3TDIA 1KFUS 1KK8B 2K2AA 3LK0A 2MLEC 2PALA 4PE4A 2K7OA 4OKHA 1KSOA 1OSAA 1WDCB 2K7CA 2FJUB 3A4UB 3CWGA 1MHOA 1TTXA 4MVFA 2FCDA 3DVMA 1AVSA 1UP5A 3I5HC 4PDZA 1U5IB 3O4YA 1FI6A 1KWOB 2I7AA 1QASA 1S26D 2NLNA 5B8IB 1J1DA 4I5NB 3HCMA 2BE6A 2OTGC 2BCBA 4IL1A 2M97A 1QX5B 1YRUB 1TNWA 4MZKA 1QVIY 3RLZA 3D0YB 1UHKA 1OMDA 1S5GZ 3BUMB 3BUNB 4XJKA 1UHIA 1YX8A 1E8AA 2FCEA 4FQOA 1PVAA 3IQOA 5AXIA 1JBAA 3VRNA 1QXPA 1IQ5A 1EJ3A 1B47A 2MLFC 5CPVA 4HREE 1GGWA 1R6PA 3GK1A 4C0LA 2JPTA 1NPQA 4NDBA 2RGIA 1DT7B 1KFXL 4R1EA 1LA3A 4OCIA 5KSZA 3LLEA 1ZFSA 3GK2A 1CFDA 1R2UA 4N1GA 1YUUA 3KF9A 4QJ5B 4MRXA 5I2LA 1H8BA 2LM5A 3RM1A 1KK7Y 2JNFA 1L7ZA 4UPGA 3OB2B 4I5KA 1SW8A 2OS8C 1TCOB 4BY4A 5PALA 3AKBA 1RFJA 1YVHA 4AQIA 1V1GA 1CFPA 1JF2A 4F0ZB 1DJGA 2LUXA 1H4BA 4E68A 2WC8A 3SG5A 2K61A 4CFRA 1AK8A 1BU3A 1IKUA 5G08A 1YUTA 4MBEA 3GOFA 2O60A 3TUYB 5JOLA 1JWDA 1LVCD 2JXCA 1WLZA 1QJTA 2M9GA 3AAKA 3NSLA 1U5IA 1KK8C 1K95A 2K8MB 1M46A 1S6CA 1XFYO 1BODA 1G33A 1WDCC 1ALWA 2EHBA 4C0KA 4GUKA 4WRIA 2K7DA 1DJHA 3NXAA 2LE9B 5K89A 1FBVA 4MEWA 1KWOC 3O78A 3JVTB 1F4OA 2G9BA 1NIWA 3D0YA 1CLBA 4AOMA 1XFZO 3IQQA 1WY9A 1ZACA 3AKAA 3PN7B 2ZKMX 3CGAA 2KYCA 1XK4A 2Y4QA 2ZRTA 2Q4UA 1FF1A 5GQQC 2E30A 1DJWA 2LVJA 1S5GY 2ISDA 2JT3A 1NYAA 2ZNDA 5CSFA 3M0WA 1XK4C 2NCPA 1BMOA 3F45A 1LINA 2CT9A 1NCZA 2M3WA 1IG5A 3BQ3A 3LL8B 5ER5A 1EL4A 2R2IA 2O5GA 3I5IB 2KFFA 1QLSA 4XYNA 1SRAA 5CSJA 4QJ4B 3DVJA 4DCKA 2KOTA 4GGFA 3WXAA 1SNLA 4ZCUA 1F54A 4D1EA 3CS1A 4JPZB 1PSRA 1CNPA 4MRYA 1K9UA 2HQWA 2K0JA 4YBHB 1LXFC 1B7TZ 2LHIA 1K90D 1B1GA 2MA2A 4AQJA 1AUIB 2KI4B 3A8RA 1Y1XA 4GGFC 3OB1B 5AANA 5DKRA 1HQVA 2LLTA 4YGEB 2KYFA 3VRQA 3O2PA 1GJYA 1NX1A 1PSBA 1K9KA 5D69A 5HKYA 3CR2A 2PVBA 5AERA 1TNQA 4GGNA 1J7RA 2ZN9A 4ICBA 5I2QA 1OQPA 1WRZA 3PSRA 1UWOA 5HKZA 3TUYC 1PALA 2LVVA 1JSAA 1G4YR 2BECA 1CLLA 4PE1A 2BKHB 2KQYA 1GGZA 4CPVA 1MR8A 3HX4A 1DMOA 1SCMB 2AAOA 1PK0D 1XFVO 1C07A 3O6BA 3SG2A 2MJWB 1XO5A 3WHUB 2F3YA 3JVTC 5F6TA 1MQ1A 1QTXA 4BY5A 3CTNA 1ODBA 4I5LB 2JWWA 1NUBA 2LC5A 5AFPA 1MWNA 1FW4A 3KO0A 2PMYA 2L51A 3CZTX 4OR9B 2H61A 1DVIA 2LCPA 3KPXA 1ZOTB 5D7FA 3IF7A 2ZRSA 1AJ5A 3FS7A 2G2BA 2BL0B 2VRGA 2COLB 2H61C 3K21A 1A03A 1WLMA 1KSMA 1BOCA 1TNXA 2JNXA 1YR5A 1QX7A 2KAVA 2GGZA 3I5IC 3BXKA 3OHMB 4PHJA 2LVIA 3EK8A 1L2OB 1JF0A 2P6BB 1UHNA 1OOJA 3EVRA 5KU1A 3LCPC 3LK1A 1N0YA 1RTP1 3DD4A 4YGBB 1J55A 4M2PA 3PLFB 3SG4A 1NX0A 4YI9A 1QATA 1UHJA 2LP2A 3TS5B 5DKQA 1IJ5A 4N5XA 1B7TY 2L2EA 1Y1AA 1Y1UA 1Y0VH 2E6WA 2L4IA 1M45A 2SCPA 4ORCB 3C1VA 1QS7A 1S3PA 3CLNA 1SPYA 1DJXA 1K94A 1QIVA 1MUXA 1IGVA 1KFUL 1VRKA 2A4JA 1CDLA 3DF0B 1SMGA 3BOWB 1XFWO 3ZNIA 2CTNA 2LMVA 5CSIA 3SG3A 3EVVA 1RECA 3SIBA 2SASA 2L98A 1F71A 1BR4B 1AJ4A 2JTTA 2LAPA 1X02A 2ZN8A 1CKKA 1KQMB 1TIZA 3D10A 4GAOA 1SCMC 2KI6C 1TOPA 1A75B 1XFUO 2LMUA 1NX2A 2NZ0A 2KI6D 2KGRA 2Y1NA 1PRWA 1S6JA 1N65A 1SK6D 5TNCA 2KFGA 1SYMA 1NX3A 4GFTA 1AP4A 2BCXA 2DOQA 1DTLA 4DRWA 1MXEA 1K93D 1JFJA 2KDHA 3I5HB 2MHHA 1A29A 2BBNA 2PRUA 1QLKA 1W7JB 2EGDA 4MZLA 2I2RE 3KEVA 2JU0A 2LVKA 4JWQA 3EKJA 3VGOA 2NCOA 1KCYA 1YUSA 1Q80A 1S36A 3ZWHA 4USLA 1CMGA 2JC2A 3I5GB 2M0RA 4YGDB 3H4SE 3WNXB 1L2OC 2PASA 4DS7A 3MSEB 2WOSA 4CLNA 1DGVA 3DVKA 1UURA 1QV1A 1B8LA 1SL7A 2BKIB 4MLWA 4M2QA 1J7OA 2EC6B 2H2KA 2L50A 1RROA 2V53A 1JFKA 4NDCA 2FOTA 5CSNA 2I94A 5JJGA 3BUXB 4YGCB 2I18A 1K9PA 3DF0A 4OV2A 2M7NA 3SJSA 3CR4X 1CDMA 1LKJA 4JQ0D 3BOWA 1DF0B 1KFXS 5IBWA 3EVUA 3PATA 3E3RA 2F2PA 4PE7A 1XFXO 4C0JA 2OS8B 4HRGA 2LNKA 3FWBA 1CTRA 1OMRA 1CFFA 1BJFA 1QV0A 1SCVA 4P5OE 2Y5IA 1TN4A 2KBMA 1A75A 4WQ3A 2M7LA 1CLMA 3EK4A 1CMFA 1NCYA 3DVEA 3PM8A 1DJIA 2CXJA 1KQMC 1IWQA 1EH2A 1B8CA 1TCFA 4M2OA 1F8HA 4ETOA 4CFQA 1QX2A 2F3ZA
chains in the Genus database with same CATH superfamily
5KTYA 2QEOA 3PN7C 1C7WA 1YTZC 4DUQA 4A4BA 4PHKA 3CZ0A 2M49B 2JT0A 2LLSA 1OOIX 2F2OA 2BNXA 3SG6A 4ORBB 1J7PA 4NQGA 2M1KB 4TNCA 1V1FA 2JRFA 4I5JA 1JUOA 2ZFDA 1C7VA 1S1EA 1YRTB 4Q04A 4A4CA 2KNEA 1GQMA 1MXLC 4QJ3B 2JTZA 1IQ3A 3QRXA 2CBLA 4L9MA 3VRPA 1BLQA 3BYAA 1B8RA 1RJVA 3I5FB 1EXRA 4INWA 1UUSA 3I5GC 3PM2A 5HLVA 4HSZA 3EKHA 2K2FA 4GBAA 3UO9A 3FIAA 4MZJA 5ER4X 4IJ7A 1HT9A 3NSOA 3RZSA 1SY9A 2FJYA 3DY9A 4KYNA 3V2LA 4PALA 3BFBA 1DF0A 2KI4C 4PCWA 1RK9A 1IJ6A 2L0PA 1IH0A 1BT6A 1B4CA 1DJZA 2EC6C 4MN0A 3B87A 5BPJA 4YRUA 1KQVA 2JXLA 4MSPA 1TUJA 3S0AA 2WCHA 3VRRA 5I2OA 2NXQA 2QPTA 1MF8B 3JTDB 1XFRA 2JQ6A 1SKTA 1NSHA 2LHLA 2MRDA 2WNDA 3NHTA 1ALVA 4N1FA 1M31A 4NDDA 2D8NA 1YVLA 2JT8A 4ORAB 1WRKA 1OZOA 4CIDA 2WCBA 2K7BA 2KGBC 3ICBA 4YI8A 1F4QA 1TNPA 4FTGA 2GGMA 3NGVA 5J3XA 2LUCA 1FPWA 4GPLB 1SL8A 2MAZA 3EK7A 1SR6B 1XYDA 2CCMA 2KFHA 4U8DA 5DKNA 1CDNA 2LP3A 1K2HA 1LA0A 3L4AA 2MBXA 1N2DA 3L4LA 2LMTA 1QIWA 2HETA 5HKWA 1NCXA 1DC1A 1NP8A 2L4HA 4PE0A 2PYQA 1SBJA 1CM4A 2AUCA 1K8UA 5I8NA 1YX7A 2BBMA 2KAXA 2BCAA 3IVTA 4GNKB 1WRLA 2KBIA 1XVJA 1J1EA 1J7QA 1IRJA 2WCEA 1DGUA 2OTGB 1XA5A 2BL0C 1QVIZ 2LV7A 2OPOA 2WORA 1ZMZA 1CDPA 3WHTB 1OZSA 2M1UA 5AEQA 1EG4A 3SIAA 1UHHA 3FWCA 5FYXA 3S0FA 1DQEA 3SG7A 1OMVA 1PULA 1RWYA 1W7IB 3D77A 1OE9B 2PSRA 2TN4A 3NSKA 3I5FC 2LANA 5FI6A 1EG3A 2GV5A 2JULA 3OX5A 1PVBA 1G8IA 3NHIA 2HQ8A 2B1UA 3O4XA 4DIRA 4XJKB 3BUWB 2L5XB 3PALA 2LLUA 2F33A 3OX6A 3TS5C 3TZ1A 3VROA 1CFCA 4YGAA 2AMIA 3PFVA 2KSPA 2ZNEA 3TDUA 1SL9A 1KK7Z 5HLOA 2Y1MA 1M63B 5HYDA 3GK4X 1NWDA 1BF5A 1A2XA 2WCFA 4PHMA 3CZ2A 3NSIA 4WQ2A 4ZCVA 4FQTA 2HPSA 2JOJA 2KAYA 2KHNA 1CB1A 1M39A 5D3OA 1JC2A 3AAJA 3JTDC 3CR5X 3KHEA 1FI5A 4HRHA 2JZIA 1AHRA 1S6IA 2M29A 4OVNF 3BUOB 1TRFA 3TDZA 4PHNA 4JD9A 2IS9A 2BE4A 2F8PA 1DJYA 3K1EA 1A4PA 4INXA 4P2YB 2M8UA 1K96A 1BR1B 1YURA 2Q91A 1BG1A 1F55A 1ZUZA 1F70A 2CNPA 1D1OA 2KQ6A 1Y6WA 2QACA 2HF5A 3OP0A 1B9AA 1CM1A 1QWVA 1SR6C 1T14A 3TDIA 3EG5B 1KFUS 1KK8B 2K2AA 3LK0A 2MLEC 2PALA 4PE4A 3Q8IA 2K7OA 4OKHA 1KSOA 1OSAA 1WDCB 2K7CA 2FJUB 3A4UB 3CWGA 1MHOA 1TTXA 2K60A 4MVFA 1TWOA 2FCDA 3DVMA 1AVSA 1UP5A 3I5HC 4PDZA 1U5IB 3O4YA 1FI6A 1KWOB 2I7AA 1QASA 1S26D 2NLNA 5B8IB 1J1DA 4I5NB 3HCMA 5I94A 2BE6A 2OTGC 2BCBA 2P71A 2WCKA 4IL1A 2M97A 1QX5B 1YRUB 1DELA 1TNWA 4MZKA 1Z4HA 1QVIY 3RLZA 3D0YB 3FE8A 1UHKA 1OMDA 1S5GZ 3BUMB 3BUNB 4XJKA 1UHIA 1YX8A 1E8AA 2FCEA 4FQOA 1PVAA 3IQOA 5AXIA 1JBAA 3VRNA 1QXPA 1IQ5A 1EJ3A 1B47A 2MLFC 5CPVA 4HREE 1GGWA 1R6PA 3GK1A 4C0LA 2JPTA 1NPQA 4NDBA 2WC6A 2RGIA 1DT7B 1KFXL 4R1EA 1LA3A 4OCIA 5KSZA 3LLEA 1ZFSA 3GK2A 1CFDA 1R2UA 4N1GA 1YUUA 3KF9A 4QJ5B 4MRXA 5I2LA 1H8BA 2LM5A 3RM1A 1KK7Y 2JNFA 1L7ZA 4UPGA 3OB2B 1W9ZA 4I5KA 1SW8A 2OS8C 1TCOB 4BY4A 5PALA 3AKBA 1RFJA 3CDNA 1YVHA 4AQIA 1V1GA 1CFPA 3BFHA 1JF2A 4F0ZB 1DJGA 3R72A 2LUXA 1H4BA 4E68A 2WC8A 3SG5A 2K61A 4CFRA 1AK8A 1BU3A 1IKUA 3B86A 1YUTA 3B88A 4MBEA 5G08A 3GOFA 2O60A 3TUYB 5JOLA 1JWDA 1LVCD 2JXCA 1WLZA 1QJTA 2M9GA 3AAKA 3NSLA 1U5IA 1KK8C 4PT1A 1K95A 1P28A 2K8MB 5EL2A 1M46A 1S6CA 1XFYO 1BODA 1G33A 1WDCC 1ALWA 2EHBA 4C0KA 4GUKA 4WRIA 1IIOA 2K7DA 1DJHA 3NXAA 2LE9B 5K89A 2JPOA 1FBVA 4MEWA 1KWOC 3O78A 4OZDA 3JVTB 1F4OA 2G9BA 1NIWA 3D0YA 1CLBA 4AOMA 1GM0A 1XFZO 3IQQA 1WY9A 1ZACA 3AKAA 3PN7B 2ZKMX 3CGAA 2KYCA 1XK4A 2Y4QA 2ZRTA 2Q4UA 1OOHA 1FF1A 5GQQC 2E30A 1DJWA 2LVJA 1S5GY 2ISDA 1C3ZA 2JT3A 1NYAA 2ZNDA 5CSFA 1DEKA 3M0WA 1XK4C 2NCPA 1SSEB 1BMOA 3F45A 1LINA 2CT9A 1NCZA 2M3WA 1IG5A 3BQ3A 3LL8B 5ER5A 1EL4A 2R2IA 2O5GA 3I5IB 3L47A 2KFFA 1QLSA 4XYNA 1SRAA 5CSJA 4QJ4B 3DVJA 2KPHA 4DCKA 2KOTA 2PQLA 4GGFA 1SNLA 3WXAA 3D74A 4ZCUA 1F54A 3DYEA 4D1EA 3CS1A 4JPZB 1PSRA 1CNPA 2WCMA 4MRYA 4F7FA 1K9UA 2HQWA 2K0JA 4YBHB 1LXFC 1B7TZ 2LHIA 1K90D 1B1GA 2MA2A 4AQJA 1AUIB 2KI4B 3A8RA 1Y1XA 4GGFC 3OB1B 1OOFA 1TUZA 5AANA 3CABA 5DKRA 1HQVA 2LLTA 2QEVA 4YGEB 2KYFA 3VRQA 3O2PA 1GJYA 1NX1A 1PSBA 1K9KA 3D73A 5D69A 5HKYA 3CR2A 2PVBA 5AERA 2KLDA 1TNQA 4GGNA 3R1PA 2QDIA 3S0BA 1J7RA 2ZN9A 4ICBA 3VB1A 5I2QA 1OQPA 1WRZA 3PSRA 1UWOA 5HKZA 3TUYC 1PALA 2YGUA 2LVVA 1JSAA 1G4YR 2BECA 1CLLA 3DZTA 4PE1A 3SS3A 2BKHB 2KQYA 1GGZA 4CPVA 1MR8A 3HX4A 3OGNA 1DMOA 1ORGA 1OOGA 1SCMB 2AAOA 1PK0D 1XFVO 1C07A 3SS5A 3O6BA 3SG2A 2MJWB 1XO5A 3WHUB 2F3YA 3JVTC 5F6TA 1MQ1A 1QTXA 4BY5A 3CTNA 2L5YA 1ODBA 4I5LB 2JWWA 3DXLA 1NUBA 2LC5A 2WCJA 1MWNA 5AFPA 1FW4A 2H8VA 3KO0A 3PJIA 2PMYA 2L51A 3CZTX 4OR9B 2H61A 1DVIA 2LCPA 2QEHA 3KPXA 1ZOTB 5FI7A 5D7FA 3IF7A 3FE6A 2ZRSA 1AJ5A 3D75A 3FS7A 2G2BA 2BL0B 2VRGA 2WCLA 2COLB 2H61C 3K21A 1A03A 1WLMA 1KSMA 3FE9A 1BOCA 3S0GA 1TNXA 2JNXA 1YR5A 1QX7A 1Z2CB 2KAVA 2GGZA 3I5IC 3BXKA 3OHMB 4PHJA 2LVIA 3EK8A 1L2OB 3S0EA 1JF0A 2P6BB 1UHNA 1OOJA 3D78A 3EVRA 5KU1A 2L2CA 3LCPC 3LK1A 1N0YA 1RTP1 3DD4A 4YGBB 1J55A 4M2PA 3PLFB 3SG4A 1NX0A 4YI9A 1QATA 1UHJA 2LP2A 3TS5B 5DKQA 1IJ5A 4N5XA 1B7TY 2L2EA 3R1OA 1Y1AA 1Y1UA 1Y0VH 2E6WA 2L4IA 5HL1A 1M45A 5FI2A 2SCPA 4ORCB 3C1VA 1QS7A 1S3PA 3CLNA 3R1VA 1SPYA 4JKTA 3BFAA 1DJXA 1K94A 3CZ1A 1QIVA 1MUXA 2ERBA 1IGVA 1KFUL 1VRKA 2A4JA 1CDLA 3DF0B 1SMGA 3BOWB 1XFWO 3ZNIA 2CTNA 2LMVA 5CSIA 3SG3A 3EVVA 2KLEA 1RECA 3SIBA 2SASA 2L98A 1F71A 1BR4B 1AJ4A 2JTTA 2LAPA 1X02A 2ZN8A 3B7AA 1C3YA 1KQMB 1TIZA 2QEBA 3D10A 3D76A 1CKKA 4GAOA 1SCMC 5DICA 2KI6C 1TOPA 1A75B 1XFUO 2LMUA 1NX2A 2NZ0A 2KI6D 2KGRA 2Y1NA 1PRWA 1S6JA 1N65A 1SK6D 5TNCA 3CYZA 2KFGA 1SYMA 1NX3A 4GFTA 1AP4A 2BCXA 2DOQA 1DTLA 4DRWA 1MXEA 1K93D 1JFJA 2KDHA 3I5HB 2MHHA 1A29A 2BBNA 2PRUA 3QMEA 1QLKA 1W7JB 2EGDA 4MZLA 2I2RE 2P70A 2JU0A 3KEVA 2LVKA 4JWQA 3EKJA 3VGOA 2NCOA 1KCYA 1YUSA 1Q80A 1S36A 3ZWHA 2GTEA 4USLA 1CMGA 3B6XA 2JC2A 3I5GB 2M0RA 4YGDB 3H4SE 3WNXB 1L2OC 2PASA 2WC5A 4DS7A 3MSEB 2WOSA 4CLNA 1DGVA 3DVKA 1UURA 1QV1A 1B8LA 1SL7A 2BKIB 3SS4A 3UNWA 4MLWA 3OBVA 4M2QA 1J7OA 2EC6B 2BAPA 2H2KA 2L50A 1RROA 2V53A 1JFKA 4NDCA 2FOTA 5CSNA 2I94A 5JJGA 3BUXB 4YGCB 2I18A 1K9PA 3DF0A 4OV2A 2M7NA 3SJSA 3CR4X 1CDMA 1LKJA 4JQ0D 3BOWA 1DF0B 1KFXS 5IBWA 3EVUA 3PATA 3E3RA 2F2PA 4PE7A 1XFXO 4C0JA 2OS8B 3N7HA 2LNKA 3FWBA 1CTRA 4HRGA 1OMRA 1OW4A 1CFFA 1BJFA 1QV0A 1SCVA 4P5OE 2Y5IA 1TN4A 2KBMA 1A75A 4WQ3A 2M7LA 1CLMA 3EK4A 3S0DA 1CMFA 1NCYA 3DVEA 3PM8A 1DJIA 2CXJA 1KQMC 1LS8A 1IWQA 1EH2A 1B8CA 1TCFA 3BJHA 4M2OA 4ETOA 1F8HA 4CFQA 1QX2A 2F3ZA
chains in the Genus database with same CATH topology
5KTYA 3PN7C 1C7WA 1YTZC 4DUQA 4A4BA 4PHKA 2M49B 2JT0A 2LLSA 2F2OA 3SG6A 4ORBB 1J7PA 4NQGA 2M1KB 4TNCA 1V1FA 2JRFA 4I5JA 1JUOA 2ZFDA 1C7VA 1S1EA 1YRTB 4Q04A 4A4CA 2KNEA 1GQMA 1MXLC 4QJ3B 2JTZA 1IQ3A 3QRXA 2CBLA 4L9MA 3VRPA 1BLQA 3BYAA 1B8RA 1RJVA 3I5FB 1EXRA 1UUSA 3I5GC 5HLVA 4HSZA 3EKHA 2K2FA 4GBAA 3FIAA 4MZJA 5ER4X 1HT9A 3NSOA 1SY9A 4PALA 1DF0A 2KI4C 4PCWA 1RK9A 1IJ6A 2L0PA 1IH0A 1BT6A 1B4CA 1DJZA 2EC6C 4MN0A 5BPJA 4YRUA 1KQVA 2JXLA 4MSPA 3VRRA 5I2OA 2NXQA 2QPTA 1MF8B 3JTDB 2JQ6A 2LHLA 1SKTA 1NSHA 2MRDA 2WNDA 4N1FA 4NDDA 1ALVA 1M31A 2D8NA 1YVLA 2JT8A 4ORAB 1WRKA 1OZOA 4CIDA 2WCBA 2K7BA 2KGBC 3ICBA 4YI8A 1F4QA 1TNPA 4FTGA 2GGMA 5J3XA 2LUCA 1FPWA 4GPLB 1SL8A 2MAZA 3EK7A 1SR6B 1XYDA 2CCMA 2KFHA 4U8DA 5DKNA 1CDNA 2LP3A 1K2HA 1LA0A 2MBXA 1N2DA 2LMTA 1QIWA 2HETA 5HKWA 1NCXA 1NP8A 2L4HA 4PE0A 1SBJA 1CM4A 2AUCA 1K8UA 5I8NA 1YX7A 2BBMA 2KAXA 2BCAA 4GNKB 1WRLA 2KBIA 1XVJA 1J1EA 1J7QA 1IRJA 2WCEA 1DGUA 2OTGB 1XA5A 2BL0C 1QVIZ 2LV7A 2OPOA 2WORA 1ZMZA 1CDPA 3WHTB 1OZSA 2M1UA 5AEQA 1EG4A 3SIAA 1UHHA 3FWCA 5FYXA 3SG7A 1OMVA 1PULA 1RWYA 1W7IB 1OE9B 2PSRA 2TN4A 3NSKA 3I5FC 2LANA 1EG3A 2GV5A 2JULA 3OX5A 1PVBA 1G8IA 2HQ8A 2B1UA 4DIRA 4XJKB 3BUWB 2L5XB 3PALA 2LLUA 2F33A 3OX6A 3TS5C 3TZ1A 3VROA 1CFCA 4YGAA 2AMIA 3PFVA 2KSPA 2ZNEA 3TDUA 1SL9A 1KK7Z 5HLOA 2Y1MA 1M63B 5HYDA 3GK4X 1NWDA 1BF5A 1A2XA 2WCFA 4PHMA 3NSIA 4WQ2A 4ZCVA 2HPSA 2JOJA 2KAYA 2KHNA 1CB1A 1M39A 1JC2A 3AAJA 3JTDC 3CR5X 3KHEA 1FI5A 4HRHA 2JZIA 1AHRA 1S6IA 2M29A 4OVNF 3BUOB 1TRFA 3TDZA 4PHNA 2IS9A 2BE4A 2F8PA 1DJYA 4P2YB 1A4PA 2M8UA 1K96A 1BR1B 1YURA 2Q91A 1BG1A 1F55A 1ZUZA 1F70A 2CNPA 1D1OA 2KQ6A 1Y6WA 2QACA 2HF5A 3OP0A 1B9AA 1CM1A 1SR6C 3TDIA 1KFUS 1KK8B 2K2AA 3LK0A 2MLEC 2PALA 4PE4A 2K7OA 4OKHA 1KSOA 1OSAA 1WDCB 2K7CA 2FJUB 3A4UB 3CWGA 1MHOA 1TTXA 4MVFA 2FCDA 3DVMA 1AVSA 1UP5A 3I5HC 4PDZA 1U5IB 3O4YA 1FI6A 1KWOB 2I7AA 1QASA 1S26D 2NLNA 5B8IB 1J1DA 4I5NB 3HCMA 2BE6A 2OTGC 2BCBA 4IL1A 2M97A 1QX5B 1YRUB 1TNWA 4MZKA 1QVIY 3RLZA 3D0YB 1UHKA 1OMDA 1S5GZ 3BUMB 3BUNB 4XJKA 1UHIA 1YX8A 1E8AA 2FCEA 4FQOA 1PVAA 3IQOA 5AXIA 1JBAA 3VRNA 1QXPA 1IQ5A 1EJ3A 1B47A 2MLFC 5CPVA 4HREE 1GGWA 1R6PA 3GK1A 4C0LA 2JPTA 1NPQA 4NDBA 2RGIA 1DT7B 1KFXL 4R1EA 1LA3A 4OCIA 5KSZA 3LLEA 1ZFSA 3GK2A 1CFDA 1R2UA 4N1GA 1YUUA 3KF9A 4QJ5B 4MRXA 5I2LA 1H8BA 2LM5A 3RM1A 1KK7Y 2JNFA 1L7ZA 4UPGA 3OB2B 4I5KA 1SW8A 2OS8C 1TCOB 4BY4A 5PALA 3AKBA 1RFJA 1YVHA 4AQIA 1V1GA 1CFPA 1JF2A 4F0ZB 1DJGA 2LUXA 1H4BA 4E68A 2WC8A 3SG5A 2K61A 4CFRA 1AK8A 1BU3A 1IKUA 5G08A 1YUTA 4MBEA 3GOFA 2O60A 3TUYB 5JOLA 1JWDA 1LVCD 2JXCA 1WLZA 1QJTA 2M9GA 3AAKA 3NSLA 1U5IA 1KK8C 1K95A 2K8MB 1M46A 1S6CA 1XFYO 1BODA 1G33A 1WDCC 1ALWA 2EHBA 4C0KA 4GUKA 4WRIA 2K7DA 1DJHA 3NXAA 2LE9B 5K89A 1FBVA 4MEWA 1KWOC 3O78A 3JVTB 1F4OA 2G9BA 1NIWA 3D0YA 1CLBA 4AOMA 1XFZO 3IQQA 1WY9A 1ZACA 3AKAA 3PN7B 2ZKMX 3CGAA 2KYCA 1XK4A 2Y4QA 2ZRTA 2Q4UA 1FF1A 5GQQC 2E30A 1DJWA 2LVJA 1S5GY 2ISDA 2JT3A 1NYAA 2ZNDA 5CSFA 3M0WA 1XK4C 2NCPA 1BMOA 3F45A 1LINA 2CT9A 1NCZA 2M3WA 1IG5A 3BQ3A 3LL8B 5ER5A 1EL4A 2R2IA 2O5GA 3I5IB 2KFFA 1QLSA 4XYNA 1SRAA 5CSJA 4QJ4B 3DVJA 4DCKA 2KOTA 4GGFA 3WXAA 1SNLA 4ZCUA 1F54A 4D1EA 3CS1A 4JPZB 1PSRA 1CNPA 4MRYA 1K9UA 2HQWA 2K0JA 4YBHB 1LXFC 1B7TZ 2LHIA 1K90D 1B1GA 2MA2A 4AQJA 1AUIB 2KI4B 3A8RA 1Y1XA 4GGFC 3OB1B 5AANA 5DKRA 1HQVA 2LLTA 4YGEB 2KYFA 3VRQA 3O2PA 1GJYA 1NX1A 1PSBA 1K9KA 5D69A 5HKYA 3CR2A 2PVBA 5AERA 1TNQA 4GGNA 1J7RA 2ZN9A 4ICBA 5I2QA 1OQPA 1WRZA 3PSRA 1UWOA 5HKZA 3TUYC 1PALA 2LVVA 1JSAA 1G4YR 2BECA 1CLLA 4PE1A 2BKHB 2KQYA 1GGZA 4CPVA 1MR8A 3HX4A 1DMOA 1SCMB 2AAOA 1PK0D 1XFVO 1C07A 3O6BA 3SG2A 2MJWB 1XO5A 3WHUB 2F3YA 3JVTC 5F6TA 1MQ1A 1QTXA 4BY5A 3CTNA 1ODBA 4I5LB 2JWWA 1NUBA 2LC5A 5AFPA 1MWNA 1FW4A 3KO0A 2PMYA 2L51A 3CZTX 4OR9B 2H61A 1DVIA 2LCPA 3KPXA 1ZOTB 5D7FA 3IF7A 2ZRSA 1AJ5A 3FS7A 2G2BA 2BL0B 2VRGA 2COLB 2H61C 3K21A 1A03A 1WLMA 1KSMA 1BOCA 1TNXA 2JNXA 1YR5A 1QX7A 2KAVA 2GGZA 3I5IC 3BXKA 3OHMB 4PHJA 2LVIA 3EK8A 1L2OB 1JF0A 2P6BB 1UHNA 1OOJA 3EVRA 5KU1A 3LCPC 3LK1A 1N0YA 1RTP1 3DD4A 4YGBB 1J55A 4M2PA 3PLFB 3SG4A 1NX0A 4YI9A 1QATA 1UHJA 2LP2A 3TS5B 5DKQA 1IJ5A 4N5XA 1B7TY 2L2EA 1Y1AA 1Y1UA 1Y0VH 2E6WA 2L4IA 1M45A 2SCPA 4ORCB 3C1VA 1QS7A 1S3PA 3CLNA 1SPYA 1DJXA 1K94A 1QIVA 1MUXA 1IGVA 1KFUL 1VRKA 2A4JA 1CDLA 3DF0B 1SMGA 3BOWB 1XFWO 3ZNIA 2CTNA 2LMVA 5CSIA 3SG3A 3EVVA 1RECA 3SIBA 2SASA 2L98A 1F71A 1BR4B 1AJ4A 2JTTA 2LAPA 1X02A 2ZN8A 1CKKA 1KQMB 1TIZA 3D10A 4GAOA 1SCMC 2KI6C 1TOPA 1A75B 1XFUO 2LMUA 1NX2A 2NZ0A 2KI6D 2KGRA 2Y1NA 1PRWA 1S6JA 1N65A 1SK6D 5TNCA 2KFGA 1SYMA 1NX3A 4GFTA 1AP4A 2BCXA 2DOQA 1DTLA 4DRWA 1MXEA 1K93D 1JFJA 2KDHA 3I5HB 2MHHA 1A29A 2BBNA 2PRUA 1QLKA 1W7JB 2EGDA 4MZLA 2I2RE 3KEVA 2JU0A 2LVKA 4JWQA 3EKJA 3VGOA 2NCOA 1KCYA 1YUSA 1Q80A 1S36A 3ZWHA 4USLA 1CMGA 2JC2A 3I5GB 2M0RA 4YGDB 3H4SE 3WNXB 1L2OC 2PASA 4DS7A 3MSEB 2WOSA 4CLNA 1DGVA 3DVKA 1UURA 1QV1A 1B8LA 1SL7A 2BKIB 4MLWA 4M2QA 1J7OA 2EC6B 2H2KA 2L50A 1RROA 2V53A 1JFKA 4NDCA 2FOTA 5CSNA 2I94A 5JJGA 3BUXB 4YGCB 2I18A 1K9PA 3DF0A 4OV2A 2M7NA 3SJSA 3CR4X 1CDMA 1LKJA 4JQ0D 3BOWA 1DF0B 1KFXS 5IBWA 3EVUA 3PATA 3E3RA 2F2PA 4PE7A 1XFXO 4C0JA 2OS8B 4HRGA 2LNKA 3FWBA 1CTRA 1OMRA 1CFFA 1BJFA 1QV0A 1SCVA 4P5OE 2Y5IA 1TN4A 2KBMA 1A75A 4WQ3A 2M7LA 1CLMA 3EK4A 1CMFA 1NCYA 3DVEA 3PM8A 1DJIA 2CXJA 1KQMC 1IWQA 1EH2A 1B8CA 1TCFA 4M2OA 1F8HA 4ETOA 4CFQA 1QX2A 2F3ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KTY A;  3PN7 C;  1C7W A;  1YTZ C;  4DUQ A;  4A4B A;  4PHK A;  2M49 B;  2JT0 A;  2LLS A;  2F2O A;  3SG6 A;  4ORB B;  1J7P A;  4NQG A;  2M1K B;  4TNC A;  1V1F A;  2JRF A;  4I5J A;  1JUO A;  2ZFD A;  1C7V A;  1S1E A;  1YRT B;  4Q04 A;  4A4C A;  2KNE A;  1GQM A;  1MXL C;  4QJ3 B;  2JTZ A;  1IQ3 A;  3QRX A;  2CBL A;  4L9M A;  3VRP A;  1BLQ A;  3BYA A;  1B8R A;  1RJV A;  3I5F B;  1EXR A;  1UUS A;  3I5G C;  5HLV A;  4HSZ A;  3EKH A;  2K2F A;  4GBA A;  3FIA A;  4MZJ A;  5ER4 X;  1HT9 A;  3NSO A;  1SY9 A;  4PAL A;  1DF0 A;  2KI4 C;  4PCW A;  1RK9 A;  1IJ6 A;  2L0P A;  1IH0 A;  1BT6 A;  1B4C A;  1DJZ A;  2EC6 C;  4MN0 A;  5BPJ A;  4YRU A;  1KQV A;  2JXL A;  4MSP A;  3VRR A;  5I2O A;  2NXQ A;  2QPT A;  1MF8 B;  3JTD B;  2JQ6 A;  2LHL A;  1SKT A;  1NSH A;  2MRD A;  2WND A;  4N1F A;  4NDD A;  1ALV A;  1M31 A;  2D8N A;  1YVL A;  2JT8 A;  4ORA B;  1WRK A;  1OZO A;  4CID A;  2WCB A;  2K7B A;  2KGB C;  3ICB A;  4YI8 A;  1F4Q A;  1TNP A;  4FTG A;  2GGM A;  5J3X A;  2LUC A;  1FPW A;  4GPL B;  1SL8 A;  2MAZ A;  3EK7 A;  1SR6 B;  1XYD A;  2CCM A;  2KFH A;  4U8D A;  5DKN A;  1CDN A;  2LP3 A;  1K2H A;  1LA0 A;  2MBX A;  1N2D A;  2LMT A;  1QIW A;  2HET A;  5HKW A;  1NCX A;  1NP8 A;  2L4H A;  4PE0 A;  1SBJ A;  1CM4 A;  2AUC A;  1K8U A;  5I8N A;  1YX7 A;  2BBM A;  2KAX A;  2BCA A;  4GNK B;  1WRL A;  2KBI A;  1XVJ A;  1J1E A;  1J7Q A;  1IRJ A;  2WCE A;  1DGU A;  2OTG B;  1XA5 A;  2BL0 C;  1QVI Z;  2LV7 A;  2OPO A;  2WOR A;  1ZMZ A;  1CDP A;  3WHT B;  1OZS A;  2M1U A;  5AEQ A;  1EG4 A;  3SIA A;  1UHH A;  3FWC A;  5FYX A;  3SG7 A;  1OMV A;  1PUL A;  1RWY A;  1W7I B;  1OE9 B;  2PSR A;  2TN4 A;  3NSK A;  3I5F C;  2LAN A;  1EG3 A;  2GV5 A;  2JUL A;  3OX5 A;  1PVB A;  1G8I A;  2HQ8 A;  2B1U A;  4DIR A;  4XJK B;  3BUW B;  2L5X B;  3PAL A;  2LLU A;  2F33 A;  3OX6 A;  3TS5 C;  3TZ1 A;  3VRO A;  1CFC A;  4YGA A;  2AMI A;  3PFV A;  2KSP A;  2ZNE A;  3TDU A;  1SL9 A;  1KK7 Z;  5HLO A;  2Y1M A;  1M63 B;  5HYD A;  3GK4 X;  1NWD A;  1BF5 A;  1A2X A;  2WCF A;  4PHM A;  3NSI A;  4WQ2 A;  4ZCV A;  2HPS A;  2JOJ A;  2KAY A;  2KHN A;  1CB1 A;  1M39 A;  1JC2 A;  3AAJ A;  3JTD C;  3CR5 X;  3KHE A;  1FI5 A;  4HRH A;  2JZI A;  1AHR A;  1S6I A;  2M29 A;  4OVN F;  3BUO B;  1TRF A;  3TDZ A;  4PHN A;  2IS9 A;  2BE4 A;  2F8P A;  1DJY A;  4P2Y B;  1A4P A;  2M8U A;  1K96 A;  1BR1 B;  1YUR A;  2Q91 A;  1BG1 A;  1F55 A;  1ZUZ A;  1F70 A;  2CNP A;  1D1O A;  2KQ6 A;  1Y6W A;  2QAC A;  2HF5 A;  3OP0 A;  1B9A A;  1CM1 A;  1SR6 C;  3TDI A;  1KFU S;  1KK8 B;  2K2A A;  3LK0 A;  2MLE C;  2PAL A;  4PE4 A;  2K7O A;  4OKH A;  1KSO A;  1OSA A;  1WDC B;  2K7C A;  2FJU B;  3A4U B;  3CWG A;  1MHO A;  1TTX A;  4MVF A;  2FCD A;  3DVM A;  1AVS A;  1UP5 A;  3I5H C;  4PDZ A;  1U5I B;  3O4Y A;  1FI6 A;  1KWO B;  2I7A A;  1QAS A;  1S26 D;  2NLN A;  5B8I B;  1J1D A;  4I5N B;  3HCM A;  2BE6 A;  2OTG C;  2BCB A;  4IL1 A;  2M97 A;  1QX5 B;  1YRU B;  1TNW A;  4MZK A;  1QVI Y;  3RLZ A;  3D0Y B;  1UHK A;  1OMD A;  1S5G Z;  3BUM B;  3BUN B;  4XJK A;  1UHI A;  1YX8 A;  1E8A A;  2FCE A;  4FQO A;  1PVA A;  3IQO A;  5AXI A;  1JBA A;  3VRN A;  1QXP A;  1IQ5 A;  1EJ3 A;  1B47 A;  2MLF C;  5CPV A;  4HRE E;  1GGW A;  1R6P A;  3GK1 A;  4C0L A;  2JPT A;  1NPQ A;  4NDB A;  2RGI A;  1DT7 B;  1KFX L;  4R1E A;  1LA3 A;  4OCI A;  5KSZ A;  3LLE A;  1ZFS A;  3GK2 A;  1CFD A;  1R2U A;  4N1G A;  1YUU A;  3KF9 A;  4QJ5 B;  4MRX A;  5I2L A;  1H8B A;  2LM5 A;  3RM1 A;  1KK7 Y;  2JNF A;  1L7Z A;  4UPG A;  3OB2 B;  4I5K A;  1SW8 A;  2OS8 C;  1TCO B;  4BY4 A;  5PAL A;  3AKB A;  1RFJ A;  1YVH A;  4AQI A;  1V1G A;  1CFP A;  1JF2 A;  4F0Z B;  1DJG A;  2LUX A;  1H4B A;  4E68 A;  2WC8 A;  3SG5 A;  2K61 A;  4CFR A;  1AK8 A;  1BU3 A;  1IKU A;  5G08 A;  1YUT A;  4MBE A;  3GOF A;  2O60 A;  3TUY B;  5JOL A;  1JWD A;  1LVC D;  2JXC A;  1WLZ A;  1QJT A;  2M9G A;  3AAK A;  3NSL A;  1U5I A;  1KK8 C;  1K95 A;  2K8M B;  1M46 A;  1S6C A;  1XFY O;  1BOD A;  1G33 A;  1WDC C;  1ALW A;  2EHB A;  4C0K A;  4GUK A;  4WRI A;  2K7D A;  1DJH A;  3NXA A;  2LE9 B;  5K89 A;  1FBV A;  4MEW A;  1KWO C;  3O78 A;  3JVT B;  1F4O A;  2G9B A;  1NIW A;  3D0Y A;  1CLB A;  4AOM A;  1XFZ O;  3IQQ A;  1WY9 A;  1ZAC A;  3AKA A;  3PN7 B;  2ZKM X;  3CGA A;  2KYC A;  1XK4 A;  2Y4Q A;  2ZRT A;  2Q4U A;  1FF1 A;  5GQQ C;  2E30 A;  1DJW A;  2LVJ A;  1S5G Y;  2ISD A;  2JT3 A;  1NYA A;  2ZND A;  5CSF A;  3M0W A;  1XK4 C;  2NCP A;  1BMO A;  3F45 A;  1LIN A;  2CT9 A;  1NCZ A;  2M3W A;  1IG5 A;  3BQ3 A;  3LL8 B;  5ER5 A;  1EL4 A;  2R2I A;  2O5G A;  3I5I B;  2KFF A;  1QLS A;  4XYN A;  1SRA A;  5CSJ A;  4QJ4 B;  3DVJ A;  4DCK A;  2KOT A;  4GGF A;  3WXA A;  1SNL A;  4ZCU A;  1F54 A;  4D1E A;  3CS1 A;  4JPZ B;  1PSR A;  1CNP A;  4MRY A;  1K9U A;  2HQW A;  2K0J A;  4YBH B;  1LXF C;  1B7T Z;  2LHI A;  1K90 D;  1B1G A;  2MA2 A;  4AQJ A;  1AUI B;  2KI4 B;  3A8R A;  1Y1X A;  4GGF C;  3OB1 B;  5AAN A;  5DKR A;  1HQV A;  2LLT A;  4YGE B;  2KYF A;  3VRQ A;  3O2P A;  1GJY A;  1NX1 A;  1PSB A;  1K9K A;  5D69 A;  5HKY A;  3CR2 A;  2PVB A;  5AER A;  1TNQ A;  4GGN A;  1J7R A;  2ZN9 A;  4ICB A;  5I2Q A;  1OQP A;  1WRZ A;  3PSR A;  1UWO A;  5HKZ A;  3TUY C;  1PAL A;  2LVV A;  1JSA A;  1G4Y R;  2BEC A;  1CLL A;  4PE1 A;  2BKH B;  2KQY A;  1GGZ A;  4CPV A;  1MR8 A;  3HX4 A;  1DMO A;  1SCM B;  2AAO A;  1PK0 D;  1XFV O;  1C07 A;  3O6B A;  3SG2 A;  2MJW B;  1XO5 A;  3WHU B;  2F3Y A;  3JVT C;  5F6T A;  1MQ1 A;  1QTX A;  4BY5 A;  3CTN A;  1ODB A;  4I5L B;  2JWW A;  1NUB A;  2LC5 A;  5AFP A;  1MWN A;  1FW4 A;  3KO0 A;  2PMY A;  2L51 A;  3CZT X;  4OR9 B;  2H61 A;  1DVI A;  2LCP A;  3KPX A;  1ZOT B;  5D7F A;  3IF7 A;  2ZRS A;  1AJ5 A;  3FS7 A;  2G2B A;  2BL0 B;  2VRG A;  2COL B;  2H61 C;  3K21 A;  1A03 A;  1WLM A;  1KSM A;  1BOC A;  1TNX A;  2JNX A;  1YR5 A;  1QX7 A;  2KAV A;  2GGZ A;  3I5I C;  3BXK A;  3OHM B;  4PHJ A;  2LVI A;  3EK8 A;  1L2O B;  1JF0 A;  2P6B B;  1UHN A;  1OOJ A;  3EVR A;  5KU1 A;  3LCP C;  3LK1 A;  1N0Y A;  1RTP 1;  3DD4 A;  4YGB B;  1J55 A;  4M2P A;  3PLF B;  3SG4 A;  1NX0 A;  4YI9 A;  1QAT A;  1UHJ A;  2LP2 A;  3TS5 B;  5DKQ A;  1IJ5 A;  4N5X A;  1B7T Y;  2L2E A;  1Y1A A;  1Y1U A;  1Y0V H;  2E6W A;  2L4I A;  1M45 A;  2SCP A;  4ORC B;  3C1V A;  1QS7 A;  1S3P A;  3CLN A;  1SPY A;  1DJX A;  1K94 A;  1QIV A;  1MUX A;  1IGV A;  1KFU L;  1VRK A;  2A4J A;  1CDL A;  3DF0 B;  1SMG A;  3BOW B;  1XFW O;  3ZNI A;  2CTN A;  2LMV A;  5CSI A;  3SG3 A;  3EVV A;  1REC A;  3SIB A;  2SAS A;  2L98 A;  1F71 A;  1BR4 B;  1AJ4 A;  2JTT A;  2LAP A;  1X02 A;  2ZN8 A;  1CKK A;  1KQM B;  1TIZ A;  3D10 A;  4GAO A;  1SCM C;  2KI6 C;  1TOP A;  1A75 B;  1XFU O;  2LMU A;  1NX2 A;  2NZ0 A;  2KI6 D;  2KGR A;  2Y1N A;  1PRW A;  1S6J A;  1N65 A;  1SK6 D;  5TNC A;  2KFG A;  1SYM A;  1NX3 A;  4GFT A;  1AP4 A;  2BCX A;  2DOQ A;  1DTL A;  4DRW A;  1MXE A;  1K93 D;  1JFJ A;  2KDH A;  3I5H B;  2MHH A;  1A29 A;  2BBN A;  2PRU A;  1QLK A;  1W7J B;  2EGD A;  4MZL A;  2I2R E;  3KEV A;  2JU0 A;  2LVK A;  4JWQ A;  3EKJ A;  3VGO A;  2NCO A;  1KCY A;  1YUS A;  1Q80 A;  1S36 A;  3ZWH A;  4USL A;  1CMG A;  2JC2 A;  3I5G B;  2M0R A;  4YGD B;  3H4S E;  3WNX B;  1L2O C;  2PAS A;  4DS7 A;  3MSE B;  2WOS A;  4CLN A;  1DGV A;  3DVK A;  1UUR A;  1QV1 A;  1B8L A;  1SL7 A;  2BKI B;  4MLW A;  4M2Q A;  1J7O A;  2EC6 B;  2H2K A;  2L50 A;  1RRO A;  2V53 A;  1JFK A;  4NDC A;  2FOT A;  5CSN A;  2I94 A;  5JJG A;  3BUX B;  4YGC B;  2I18 A;  1K9P A;  3DF0 A;  4OV2 A;  2M7N A;  3SJS A;  3CR4 X;  1CDM A;  1LKJ A;  4JQ0 D;  3BOW A;  1DF0 B;  1KFX S;  5IBW A;  3EVU A;  3PAT A;  3E3R A;  2F2P A;  4PE7 A;  1XFX O;  4C0J A;  2OS8 B;  4HRG A;  2LNK A;  3FWB A;  1CTR A;  1OMR A;  1CFF A;  1BJF A;  1QV0 A;  1SCV A;  4P5O E;  2Y5I A;  1TN4 A;  2KBM A;  1A75 A;  4WQ3 A;  2M7L A;  1CLM A;  3EK4 A;  1CMF A;  1NCY A;  3DVE A;  3PM8 A;  1DJI A;  2CXJ A;  1KQM C;  1IWQ A;  1EH2 A;  1B8C A;  1TCF A;  4M2O A;  1F8H A;  4ETO A;  4CFQ A;  1QX2 A;  2F3Z A; 
#chains in the Genus database with same CATH topology
 5KTY A;  2QEO A;  3PN7 C;  1C7W A;  1YTZ C;  4DUQ A;  4A4B A;  4PHK A;  3CZ0 A;  2M49 B;  2JT0 A;  2LLS A;  1OOI X;  2F2O A;  2BNX A;  3SG6 A;  4ORB B;  1J7P A;  4NQG A;  2M1K B;  4TNC A;  1V1F A;  2JRF A;  4I5J A;  1JUO A;  2ZFD A;  1C7V A;  1S1E A;  1YRT B;  4Q04 A;  4A4C A;  2KNE A;  1GQM A;  1MXL C;  4QJ3 B;  2JTZ A;  1IQ3 A;  3QRX A;  2CBL A;  4L9M A;  3VRP A;  1BLQ A;  3BYA A;  1B8R A;  1RJV A;  3I5F B;  1EXR A;  4INW A;  1UUS A;  3I5G C;  3PM2 A;  5HLV A;  4HSZ A;  3EKH A;  2K2F A;  4GBA A;  3UO9 A;  3FIA A;  4MZJ A;  5ER4 X;  4IJ7 A;  1HT9 A;  3NSO A;  3RZS A;  1SY9 A;  2FJY A;  3DY9 A;  4KYN A;  3V2L A;  4PAL A;  3BFB A;  1DF0 A;  2KI4 C;  4PCW A;  1RK9 A;  1IJ6 A;  2L0P A;  1IH0 A;  1BT6 A;  1B4C A;  1DJZ A;  2EC6 C;  4MN0 A;  3B87 A;  5BPJ A;  4YRU A;  1KQV A;  2JXL A;  4MSP A;  1TUJ A;  3S0A A;  2WCH A;  3VRR A;  5I2O A;  2NXQ A;  2QPT A;  1MF8 B;  3JTD B;  1XFR A;  2JQ6 A;  1SKT A;  1NSH A;  2LHL A;  2MRD A;  2WND A;  3NHT A;  1ALV A;  4N1F A;  1M31 A;  4NDD A;  2D8N A;  1YVL A;  2JT8 A;  4ORA B;  1WRK A;  1OZO A;  4CID A;  2WCB A;  2K7B A;  2KGB C;  3ICB A;  4YI8 A;  1F4Q A;  1TNP A;  4FTG A;  2GGM A;  3NGV A;  5J3X A;  2LUC A;  1FPW A;  4GPL B;  1SL8 A;  2MAZ A;  3EK7 A;  1SR6 B;  1XYD A;  2CCM A;  2KFH A;  4U8D A;  5DKN A;  1CDN A;  2LP3 A;  1K2H A;  1LA0 A;  3L4A A;  2MBX A;  1N2D A;  3L4L A;  2LMT A;  1QIW A;  2HET A;  5HKW A;  1NCX A;  1DC1 A;  1NP8 A;  2L4H A;  4PE0 A;  2PYQ A;  1SBJ A;  1CM4 A;  2AUC A;  1K8U A;  5I8N A;  1YX7 A;  2BBM A;  2KAX A;  2BCA A;  3IVT A;  4GNK B;  1WRL A;  2KBI A;  1XVJ A;  1J1E A;  1J7Q A;  1IRJ A;  2WCE A;  1DGU A;  2OTG B;  1XA5 A;  2BL0 C;  1QVI Z;  2LV7 A;  2OPO A;  2WOR A;  1ZMZ A;  1CDP A;  3WHT B;  1OZS A;  2M1U A;  5AEQ A;  1EG4 A;  3SIA A;  1UHH A;  3FWC A;  5FYX A;  3S0F A;  1DQE A;  3SG7 A;  1OMV A;  1PUL A;  1RWY A;  1W7I B;  3D77 A;  1OE9 B;  2PSR A;  2TN4 A;  3NSK A;  3I5F C;  2LAN A;  5FI6 A;  1EG3 A;  2GV5 A;  2JUL A;  3OX5 A;  1PVB A;  1G8I A;  3NHI A;  2HQ8 A;  2B1U A;  3O4X A;  4DIR A;  4XJK B;  3BUW B;  2L5X B;  3PAL A;  2LLU A;  2F33 A;  3OX6 A;  3TS5 C;  3TZ1 A;  3VRO A;  1CFC A;  4YGA A;  2AMI A;  3PFV A;  2KSP A;  2ZNE A;  3TDU A;  1SL9 A;  1KK7 Z;  5HLO A;  2Y1M A;  1M63 B;  5HYD A;  3GK4 X;  1NWD A;  1BF5 A;  1A2X A;  2WCF A;  4PHM A;  3CZ2 A;  3NSI A;  4WQ2 A;  4ZCV A;  4FQT A;  2HPS A;  2JOJ A;  2KAY A;  2KHN A;  1CB1 A;  1M39 A;  5D3O A;  1JC2 A;  3AAJ A;  3JTD C;  3CR5 X;  3KHE A;  1FI5 A;  4HRH A;  2JZI A;  1AHR A;  1S6I A;  2M29 A;  4OVN F;  3BUO B;  1TRF A;  3TDZ A;  4PHN A;  4JD9 A;  2IS9 A;  2BE4 A;  2F8P A;  1DJY A;  3K1E A;  1A4P A;  4INX A;  4P2Y B;  2M8U A;  1K96 A;  1BR1 B;  1YUR A;  2Q91 A;  1BG1 A;  1F55 A;  1ZUZ A;  1F70 A;  2CNP A;  1D1O A;  2KQ6 A;  1Y6W A;  2QAC A;  2HF5 A;  3OP0 A;  1B9A A;  1CM1 A;  1QWV A;  1SR6 C;  1T14 A;  3TDI A;  3EG5 B;  1KFU S;  1KK8 B;  2K2A A;  3LK0 A;  2MLE C;  2PAL A;  4PE4 A;  3Q8I A;  2K7O A;  4OKH A;  1KSO A;  1OSA A;  1WDC B;  2K7C A;  2FJU B;  3A4U B;  3CWG A;  1MHO A;  1TTX A;  2K60 A;  4MVF A;  1TWO A;  2FCD A;  3DVM A;  1AVS A;  1UP5 A;  3I5H C;  4PDZ A;  1U5I B;  3O4Y A;  1FI6 A;  1KWO B;  2I7A A;  1QAS A;  1S26 D;  2NLN A;  5B8I B;  1J1D A;  4I5N B;  3HCM A;  5I94 A;  2BE6 A;  2OTG C;  2BCB A;  2P71 A;  2WCK A;  4IL1 A;  2M97 A;  1QX5 B;  1YRU B;  1DEL A;  1TNW A;  4MZK A;  1Z4H A;  1QVI Y;  3RLZ A;  3D0Y B;  3FE8 A;  1UHK A;  1OMD A;  1S5G Z;  3BUM B;  3BUN B;  4XJK A;  1UHI A;  1YX8 A;  1E8A A;  2FCE A;  4FQO A;  1PVA A;  3IQO A;  5AXI A;  1JBA A;  3VRN A;  1QXP A;  1IQ5 A;  1EJ3 A;  1B47 A;  2MLF C;  5CPV A;  4HRE E;  1GGW A;  1R6P A;  3GK1 A;  4C0L A;  2JPT A;  1NPQ A;  4NDB A;  2WC6 A;  2RGI A;  1DT7 B;  1KFX L;  4R1E A;  1LA3 A;  4OCI A;  5KSZ A;  3LLE A;  1ZFS A;  3GK2 A;  1CFD A;  1R2U A;  4N1G A;  1YUU A;  3KF9 A;  4QJ5 B;  4MRX A;  5I2L A;  1H8B A;  2LM5 A;  3RM1 A;  1KK7 Y;  2JNF A;  1L7Z A;  4UPG A;  3OB2 B;  1W9Z A;  4I5K A;  1SW8 A;  2OS8 C;  1TCO B;  4BY4 A;  5PAL A;  3AKB A;  1RFJ A;  3CDN A;  1YVH A;  4AQI A;  1V1G A;  1CFP A;  3BFH A;  1JF2 A;  4F0Z B;  1DJG A;  3R72 A;  2LUX A;  1H4B A;  4E68 A;  2WC8 A;  3SG5 A;  2K61 A;  4CFR A;  1AK8 A;  1BU3 A;  1IKU A;  3B86 A;  1YUT A;  3B88 A;  4MBE A;  5G08 A;  3GOF A;  2O60 A;  3TUY B;  5JOL A;  1JWD A;  1LVC D;  2JXC A;  1WLZ A;  1QJT A;  2M9G A;  3AAK A;  3NSL A;  1U5I A;  1KK8 C;  4PT1 A;  1K95 A;  1P28 A;  2K8M B;  5EL2 A;  1M46 A;  1S6C A;  1XFY O;  1BOD A;  1G33 A;  1WDC C;  1ALW A;  2EHB A;  4C0K A;  4GUK A;  4WRI A;  1IIO A;  2K7D A;  1DJH A;  3NXA A;  2LE9 B;  5K89 A;  2JPO A;  1FBV A;  4MEW A;  1KWO C;  3O78 A;  4OZD A;  3JVT B;  1F4O A;  2G9B A;  1NIW A;  3D0Y A;  1CLB A;  4AOM A;  1GM0 A;  1XFZ O;  3IQQ A;  1WY9 A;  1ZAC A;  3AKA A;  3PN7 B;  2ZKM X;  3CGA A;  2KYC A;  1XK4 A;  2Y4Q A;  2ZRT A;  2Q4U A;  1OOH A;  1FF1 A;  5GQQ C;  2E30 A;  1DJW A;  2LVJ A;  1S5G Y;  2ISD A;  1C3Z A;  2JT3 A;  1NYA A;  2ZND A;  5CSF A;  1DEK A;  3M0W A;  1XK4 C;  2NCP A;  1SSE B;  1BMO A;  3F45 A;  1LIN A;  2CT9 A;  1NCZ A;  2M3W A;  1IG5 A;  3BQ3 A;  3LL8 B;  5ER5 A;  1EL4 A;  2R2I A;  2O5G A;  3I5I B;  3L47 A;  2KFF A;  1QLS A;  4XYN A;  1SRA A;  5CSJ A;  4QJ4 B;  3DVJ A;  2KPH A;  4DCK A;  2KOT A;  2PQL A;  4GGF A;  1SNL A;  3WXA A;  3D74 A;  4ZCU A;  1F54 A;  3DYE A;  4D1E A;  3CS1 A;  4JPZ B;  1PSR A;  1CNP A;  2WCM A;  4MRY A;  4F7F A;  1K9U A;  2HQW A;  2K0J A;  4YBH B;  1LXF C;  1B7T Z;  2LHI A;  1K90 D;  1B1G A;  2MA2 A;  4AQJ A;  1AUI B;  2KI4 B;  3A8R A;  1Y1X A;  4GGF C;  3OB1 B;  1OOF A;  1TUZ A;  5AAN A;  3CAB A;  5DKR A;  1HQV A;  2LLT A;  2QEV A;  4YGE B;  2KYF A;  3VRQ A;  3O2P A;  1GJY A;  1NX1 A;  1PSB A;  1K9K A;  3D73 A;  5D69 A;  5HKY A;  3CR2 A;  2PVB A;  5AER A;  2KLD A;  1TNQ A;  4GGN A;  3R1P A;  2QDI A;  3S0B A;  1J7R A;  2ZN9 A;  4ICB A;  3VB1 A;  5I2Q A;  1OQP A;  1WRZ A;  3PSR A;  1UWO A;  5HKZ A;  3TUY C;  1PAL A;  2YGU A;  2LVV A;  1JSA A;  1G4Y R;  2BEC A;  1CLL A;  3DZT A;  4PE1 A;  3SS3 A;  2BKH B;  2KQY A;  1GGZ A;  4CPV A;  1MR8 A;  3HX4 A;  3OGN A;  1DMO A;  1ORG A;  1OOG A;  1SCM B;  2AAO A;  1PK0 D;  1XFV O;  1C07 A;  3SS5 A;  3O6B A;  3SG2 A;  2MJW B;  1XO5 A;  3WHU B;  2F3Y A;  3JVT C;  5F6T A;  1MQ1 A;  1QTX A;  4BY5 A;  3CTN A;  2L5Y A;  1ODB A;  4I5L B;  2JWW A;  3DXL A;  1NUB A;  2LC5 A;  2WCJ A;  1MWN A;  5AFP A;  1FW4 A;  2H8V A;  3KO0 A;  3PJI A;  2PMY A;  2L51 A;  3CZT X;  4OR9 B;  2H61 A;  1DVI A;  2LCP A;  2QEH A;  3KPX A;  1ZOT B;  5FI7 A;  5D7F A;  3IF7 A;  3FE6 A;  2ZRS A;  1AJ5 A;  3D75 A;  3FS7 A;  2G2B A;  2BL0 B;  2VRG A;  2WCL A;  2COL B;  2H61 C;  3K21 A;  1A03 A;  1WLM A;  1KSM A;  3FE9 A;  1BOC A;  3S0G A;  1TNX A;  2JNX A;  1YR5 A;  1QX7 A;  1Z2C B;  2KAV A;  2GGZ A;  3I5I C;  3BXK A;  3OHM B;  4PHJ A;  2LVI A;  3EK8 A;  1L2O B;  3S0E A;  1JF0 A;  2P6B B;  1UHN A;  1OOJ A;  3D78 A;  3EVR A;  5KU1 A;  2L2C A;  3LCP C;  3LK1 A;  1N0Y A;  1RTP 1;  3DD4 A;  4YGB B;  1J55 A;  4M2P A;  3PLF B;  3SG4 A;  1NX0 A;  4YI9 A;  1QAT A;  1UHJ A;  2LP2 A;  3TS5 B;  5DKQ A;  1IJ5 A;  4N5X A;  1B7T Y;  2L2E A;  3R1O A;  1Y1A A;  1Y1U A;  1Y0V H;  2E6W A;  2L4I A;  5HL1 A;  1M45 A;  5FI2 A;  2SCP A;  4ORC B;  3C1V A;  1QS7 A;  1S3P A;  3CLN A;  3R1V A;  1SPY A;  4JKT A;  3BFA A;  1DJX A;  1K94 A;  3CZ1 A;  1QIV A;  1MUX A;  2ERB A;  1IGV A;  1KFU L;  1VRK A;  2A4J A;  1CDL A;  3DF0 B;  1SMG A;  3BOW B;  1XFW O;  3ZNI A;  2CTN A;  2LMV A;  5CSI A;  3SG3 A;  3EVV A;  2KLE A;  1REC A;  3SIB A;  2SAS A;  2L98 A;  1F71 A;  1BR4 B;  1AJ4 A;  2JTT A;  2LAP A;  1X02 A;  2ZN8 A;  3B7A A;  1C3Y A;  1KQM B;  1TIZ A;  2QEB A;  3D10 A;  3D76 A;  1CKK A;  4GAO A;  1SCM C;  5DIC A;  2KI6 C;  1TOP A;  1A75 B;  1XFU O;  2LMU A;  1NX2 A;  2NZ0 A;  2KI6 D;  2KGR A;  2Y1N A;  1PRW A;  1S6J A;  1N65 A;  1SK6 D;  5TNC A;  3CYZ A;  2KFG A;  1SYM A;  1NX3 A;  4GFT A;  1AP4 A;  2BCX A;  2DOQ A;  1DTL A;  4DRW A;  1MXE A;  1K93 D;  1JFJ A;  2KDH A;  3I5H B;  2MHH A;  1A29 A;  2BBN A;  2PRU A;  3QME A;  1QLK A;  1W7J B;  2EGD A;  4MZL A;  2I2R E;  2P70 A;  2JU0 A;  3KEV A;  2LVK A;  4JWQ A;  3EKJ A;  3VGO A;  2NCO A;  1KCY A;  1YUS A;  1Q80 A;  1S36 A;  3ZWH A;  2GTE A;  4USL A;  1CMG A;  3B6X A;  2JC2 A;  3I5G B;  2M0R A;  4YGD B;  3H4S E;  3WNX B;  1L2O C;  2PAS A;  2WC5 A;  4DS7 A;  3MSE B;  2WOS A;  4CLN A;  1DGV A;  3DVK A;  1UUR A;  1QV1 A;  1B8L A;  1SL7 A;  2BKI B;  3SS4 A;  3UNW A;  4MLW A;  3OBV A;  4M2Q A;  1J7O A;  2EC6 B;  2BAP A;  2H2K A;  2L50 A;  1RRO A;  2V53 A;  1JFK A;  4NDC A;  2FOT A;  5CSN A;  2I94 A;  5JJG A;  3BUX B;  4YGC B;  2I18 A;  1K9P A;  3DF0 A;  4OV2 A;  2M7N A;  3SJS A;  3CR4 X;  1CDM A;  1LKJ A;  4JQ0 D;  3BOW A;  1DF0 B;  1KFX S;  5IBW A;  3EVU A;  3PAT A;  3E3R A;  2F2P A;  4PE7 A;  1XFX O;  4C0J A;  2OS8 B;  3N7H A;  2LNK A;  3FWB A;  1CTR A;  4HRG A;  1OMR A;  1OW4 A;  1CFF A;  1BJF A;  1QV0 A;  1SCV A;  4P5O E;  2Y5I A;  1TN4 A;  2KBM A;  1A75 A;  4WQ3 A;  2M7L A;  1CLM A;  3EK4 A;  3S0D A;  1CMF A;  1NCY A;  3DVE A;  3PM8 A;  1DJI A;  2CXJ A;  1KQM C;  1LS8 A;  1IWQ A;  1EH2 A;  1B8C A;  1TCF A;  3BJH A;  4M2O A;  4ETO A;  1F8H A;  4CFQ A;  1QX2 A;  2F3Z A; 
#chains in the Genus database with same CATH homology
 5KTY A;  3PN7 C;  1C7W A;  1YTZ C;  4DUQ A;  4A4B A;  4PHK A;  2M49 B;  2JT0 A;  2LLS A;  2F2O A;  3SG6 A;  4ORB B;  1J7P A;  4NQG A;  2M1K B;  4TNC A;  1V1F A;  2JRF A;  4I5J A;  1JUO A;  2ZFD A;  1C7V A;  1S1E A;  1YRT B;  4Q04 A;  4A4C A;  2KNE A;  1GQM A;  1MXL C;  4QJ3 B;  2JTZ A;  1IQ3 A;  3QRX A;  2CBL A;  4L9M A;  3VRP A;  1BLQ A;  3BYA A;  1B8R A;  1RJV A;  3I5F B;  1EXR A;  1UUS A;  3I5G C;  5HLV A;  4HSZ A;  3EKH A;  2K2F A;  4GBA A;  3FIA A;  4MZJ A;  5ER4 X;  1HT9 A;  3NSO A;  1SY9 A;  4PAL A;  1DF0 A;  2KI4 C;  4PCW A;  1RK9 A;  1IJ6 A;  2L0P A;  1IH0 A;  1BT6 A;  1B4C A;  1DJZ A;  2EC6 C;  4MN0 A;  5BPJ A;  4YRU A;  1KQV A;  2JXL A;  4MSP A;  3VRR A;  5I2O A;  2NXQ A;  2QPT A;  1MF8 B;  3JTD B;  2JQ6 A;  2LHL A;  1SKT A;  1NSH A;  2MRD A;  2WND A;  4N1F A;  4NDD A;  1ALV A;  1M31 A;  2D8N A;  1YVL A;  2JT8 A;  4ORA B;  1WRK A;  1OZO A;  4CID A;  2WCB A;  2K7B A;  2KGB C;  3ICB A;  4YI8 A;  1F4Q A;  1TNP A;  4FTG A;  2GGM A;  5J3X A;  2LUC A;  1FPW A;  4GPL B;  1SL8 A;  2MAZ A;  3EK7 A;  1SR6 B;  1XYD A;  2CCM A;  2KFH A;  4U8D A;  5DKN A;  1CDN A;  2LP3 A;  1K2H A;  1LA0 A;  2MBX A;  1N2D A;  2LMT A;  1QIW A;  2HET A;  5HKW A;  1NCX A;  1NP8 A;  2L4H A;  4PE0 A;  1SBJ A;  1CM4 A;  2AUC A;  1K8U A;  5I8N A;  1YX7 A;  2BBM A;  2KAX A;  2BCA A;  4GNK B;  1WRL A;  2KBI A;  1XVJ A;  1J1E A;  1J7Q A;  1IRJ A;  2WCE A;  1DGU A;  2OTG B;  1XA5 A;  2BL0 C;  1QVI Z;  2LV7 A;  2OPO A;  2WOR A;  1ZMZ A;  1CDP A;  3WHT B;  1OZS A;  2M1U A;  5AEQ A;  1EG4 A;  3SIA A;  1UHH A;  3FWC A;  5FYX A;  3SG7 A;  1OMV A;  1PUL A;  1RWY A;  1W7I B;  1OE9 B;  2PSR A;  2TN4 A;  3NSK A;  3I5F C;  2LAN A;  1EG3 A;  2GV5 A;  2JUL A;  3OX5 A;  1PVB A;  1G8I A;  2HQ8 A;  2B1U A;  4DIR A;  4XJK B;  3BUW B;  2L5X B;  3PAL A;  2LLU A;  2F33 A;  3OX6 A;  3TS5 C;  3TZ1 A;  3VRO A;  1CFC A;  4YGA A;  2AMI A;  3PFV A;  2KSP A;  2ZNE A;  3TDU A;  1SL9 A;  1KK7 Z;  5HLO A;  2Y1M A;  1M63 B;  5HYD A;  3GK4 X;  1NWD A;  1BF5 A;  1A2X A;  2WCF A;  4PHM A;  3NSI A;  4WQ2 A;  4ZCV A;  2HPS A;  2JOJ A;  2KAY A;  2KHN A;  1CB1 A;  1M39 A;  1JC2 A;  3AAJ A;  3JTD C;  3CR5 X;  3KHE A;  1FI5 A;  4HRH A;  2JZI A;  1AHR A;  1S6I A;  2M29 A;  4OVN F;  3BUO B;  1TRF A;  3TDZ A;  4PHN A;  2IS9 A;  2BE4 A;  2F8P A;  1DJY A;  4P2Y B;  1A4P A;  2M8U A;  1K96 A;  1BR1 B;  1YUR A;  2Q91 A;  1BG1 A;  1F55 A;  1ZUZ A;  1F70 A;  2CNP A;  1D1O A;  2KQ6 A;  1Y6W A;  2QAC A;  2HF5 A;  3OP0 A;  1B9A A;  1CM1 A;  1SR6 C;  3TDI A;  1KFU S;  1KK8 B;  2K2A A;  3LK0 A;  2MLE C;  2PAL A;  4PE4 A;  2K7O A;  4OKH A;  1KSO A;  1OSA A;  1WDC B;  2K7C A;  2FJU B;  3A4U B;  3CWG A;  1MHO A;  1TTX A;  4MVF A;  2FCD A;  3DVM A;  1AVS A;  1UP5 A;  3I5H C;  4PDZ A;  1U5I B;  3O4Y A;  1FI6 A;  1KWO B;  2I7A A;  1QAS A;  1S26 D;  2NLN A;  5B8I B;  1J1D A;  4I5N B;  3HCM A;  2BE6 A;  2OTG C;  2BCB A;  4IL1 A;  2M97 A;  1QX5 B;  1YRU B;  1TNW A;  4MZK A;  1QVI Y;  3RLZ A;  3D0Y B;  1UHK A;  1OMD A;  1S5G Z;  3BUM B;  3BUN B;  4XJK A;  1UHI A;  1YX8 A;  1E8A A;  2FCE A;  4FQO A;  1PVA A;  3IQO A;  5AXI A;  1JBA A;  3VRN A;  1QXP A;  1IQ5 A;  1EJ3 A;  1B47 A;  2MLF C;  5CPV A;  4HRE E;  1GGW A;  1R6P A;  3GK1 A;  4C0L A;  2JPT A;  1NPQ A;  4NDB A;  2RGI A;  1DT7 B;  1KFX L;  4R1E A;  1LA3 A;  4OCI A;  5KSZ A;  3LLE A;  1ZFS A;  3GK2 A;  1CFD A;  1R2U A;  4N1G A;  1YUU A;  3KF9 A;  4QJ5 B;  4MRX A;  5I2L A;  1H8B A;  2LM5 A;  3RM1 A;  1KK7 Y;  2JNF A;  1L7Z A;  4UPG A;  3OB2 B;  4I5K A;  1SW8 A;  2OS8 C;  1TCO B;  4BY4 A;  5PAL A;  3AKB A;  1RFJ A;  1YVH A;  4AQI A;  1V1G A;  1CFP A;  1JF2 A;  4F0Z B;  1DJG A;  2LUX A;  1H4B A;  4E68 A;  2WC8 A;  3SG5 A;  2K61 A;  4CFR A;  1AK8 A;  1BU3 A;  1IKU A;  5G08 A;  1YUT A;  4MBE A;  3GOF A;  2O60 A;  3TUY B;  5JOL A;  1JWD A;  1LVC D;  2JXC A;  1WLZ A;  1QJT A;  2M9G A;  3AAK A;  3NSL A;  1U5I A;  1KK8 C;  1K95 A;  2K8M B;  1M46 A;  1S6C A;  1XFY O;  1BOD A;  1G33 A;  1WDC C;  1ALW A;  2EHB A;  4C0K A;  4GUK A;  4WRI A;  2K7D A;  1DJH A;  3NXA A;  2LE9 B;  5K89 A;  1FBV A;  4MEW A;  1KWO C;  3O78 A;  3JVT B;  1F4O A;  2G9B A;  1NIW A;  3D0Y A;  1CLB A;  4AOM A;  1XFZ O;  3IQQ A;  1WY9 A;  1ZAC A;  3AKA A;  3PN7 B;  2ZKM X;  3CGA A;  2KYC A;  1XK4 A;  2Y4Q A;  2ZRT A;  2Q4U A;  1FF1 A;  5GQQ C;  2E30 A;  1DJW A;  2LVJ A;  1S5G Y;  2ISD A;  2JT3 A;  1NYA A;  2ZND A;  5CSF A;  3M0W A;  1XK4 C;  2NCP A;  1BMO A;  3F45 A;  1LIN A;  2CT9 A;  1NCZ A;  2M3W A;  1IG5 A;  3BQ3 A;  3LL8 B;  5ER5 A;  1EL4 A;  2R2I A;  2O5G A;  3I5I B;  2KFF A;  1QLS A;  4XYN A;  1SRA A;  5CSJ A;  4QJ4 B;  3DVJ A;  4DCK A;  2KOT A;  4GGF A;  3WXA A;  1SNL A;  4ZCU A;  1F54 A;  4D1E A;  3CS1 A;  4JPZ B;  1PSR A;  1CNP A;  4MRY A;  1K9U A;  2HQW A;  2K0J A;  4YBH B;  1LXF C;  1B7T Z;  2LHI A;  1K90 D;  1B1G A;  2MA2 A;  4AQJ A;  1AUI B;  2KI4 B;  3A8R A;  1Y1X A;  4GGF C;  3OB1 B;  5AAN A;  5DKR A;  1HQV A;  2LLT A;  4YGE B;  2KYF A;  3VRQ A;  3O2P A;  1GJY A;  1NX1 A;  1PSB A;  1K9K A;  5D69 A;  5HKY A;  3CR2 A;  2PVB A;  5AER A;  1TNQ A;  4GGN A;  1J7R A;  2ZN9 A;  4ICB A;  5I2Q A;  1OQP A;  1WRZ A;  3PSR A;  1UWO A;  5HKZ A;  3TUY C;  1PAL A;  2LVV A;  1JSA A;  1G4Y R;  2BEC A;  1CLL A;  4PE1 A;  2BKH B;  2KQY A;  1GGZ A;  4CPV A;  1MR8 A;  3HX4 A;  1DMO A;  1SCM B;  2AAO A;  1PK0 D;  1XFV O;  1C07 A;  3O6B A;  3SG2 A;  2MJW B;  1XO5 A;  3WHU B;  2F3Y A;  3JVT C;  5F6T A;  1MQ1 A;  1QTX A;  4BY5 A;  3CTN A;  1ODB A;  4I5L B;  2JWW A;  1NUB A;  2LC5 A;  5AFP A;  1MWN A;  1FW4 A;  3KO0 A;  2PMY A;  2L51 A;  3CZT X;  4OR9 B;  2H61 A;  1DVI A;  2LCP A;  3KPX A;  1ZOT B;  5D7F A;  3IF7 A;  2ZRS A;  1AJ5 A;  3FS7 A;  2G2B A;  2BL0 B;  2VRG A;  2COL B;  2H61 C;  3K21 A;  1A03 A;  1WLM A;  1KSM A;  1BOC A;  1TNX A;  2JNX A;  1YR5 A;  1QX7 A;  2KAV A;  2GGZ A;  3I5I C;  3BXK A;  3OHM B;  4PHJ A;  2LVI A;  3EK8 A;  1L2O B;  1JF0 A;  2P6B B;  1UHN A;  1OOJ A;  3EVR A;  5KU1 A;  3LCP C;  3LK1 A;  1N0Y A;  1RTP 1;  3DD4 A;  4YGB B;  1J55 A;  4M2P A;  3PLF B;  3SG4 A;  1NX0 A;  4YI9 A;  1QAT A;  1UHJ A;  2LP2 A;  3TS5 B;  5DKQ A;  1IJ5 A;  4N5X A;  1B7T Y;  2L2E A;  1Y1A A;  1Y1U A;  1Y0V H;  2E6W A;  2L4I A;  1M45 A;  2SCP A;  4ORC B;  3C1V A;  1QS7 A;  1S3P A;  3CLN A;  1SPY A;  1DJX A;  1K94 A;  1QIV A;  1MUX A;  1IGV A;  1KFU L;  1VRK A;  2A4J A;  1CDL A;  3DF0 B;  1SMG A;  3BOW B;  1XFW O;  3ZNI A;  2CTN A;  2LMV A;  5CSI A;  3SG3 A;  3EVV A;  1REC A;  3SIB A;  2SAS A;  2L98 A;  1F71 A;  1BR4 B;  1AJ4 A;  2JTT A;  2LAP A;  1X02 A;  2ZN8 A;  1CKK A;  1KQM B;  1TIZ A;  3D10 A;  4GAO A;  1SCM C;  2KI6 C;  1TOP A;  1A75 B;  1XFU O;  2LMU A;  1NX2 A;  2NZ0 A;  2KI6 D;  2KGR A;  2Y1N A;  1PRW A;  1S6J A;  1N65 A;  1SK6 D;  5TNC A;  2KFG A;  1SYM A;  1NX3 A;  4GFT A;  1AP4 A;  2BCX A;  2DOQ A;  1DTL A;  4DRW A;  1MXE A;  1K93 D;  1JFJ A;  2KDH A;  3I5H B;  2MHH A;  1A29 A;  2BBN A;  2PRU A;  1QLK A;  1W7J B;  2EGD A;  4MZL A;  2I2R E;  3KEV A;  2JU0 A;  2LVK A;  4JWQ A;  3EKJ A;  3VGO A;  2NCO A;  1KCY A;  1YUS A;  1Q80 A;  1S36 A;  3ZWH A;  4USL A;  1CMG A;  2JC2 A;  3I5G B;  2M0R A;  4YGD B;  3H4S E;  3WNX B;  1L2O C;  2PAS A;  4DS7 A;  3MSE B;  2WOS A;  4CLN A;  1DGV A;  3DVK A;  1UUR A;  1QV1 A;  1B8L A;  1SL7 A;  2BKI B;  4MLW A;  4M2Q A;  1J7O A;  2EC6 B;  2H2K A;  2L50 A;  1RRO A;  2V53 A;  1JFK A;  4NDC A;  2FOT A;  5CSN A;  2I94 A;  5JJG A;  3BUX B;  4YGC B;  2I18 A;  1K9P A;  3DF0 A;  4OV2 A;  2M7N A;  3SJS A;  3CR4 X;  1CDM A;  1LKJ A;  4JQ0 D;  3BOW A;  1DF0 B;  1KFX S;  5IBW A;  3EVU A;  3PAT A;  3E3R A;  2F2P A;  4PE7 A;  1XFX O;  4C0J A;  2OS8 B;  4HRG A;  2LNK A;  3FWB A;  1CTR A;  1OMR A;  1CFF A;  1BJF A;  1QV0 A;  1SCV A;  4P5O E;  2Y5I A;  1TN4 A;  2KBM A;  1A75 A;  4WQ3 A;  2M7L A;  1CLM A;  3EK4 A;  1CMF A;  1NCY A;  3DVE A;  3PM8 A;  1DJI A;  2CXJ A;  1KQM C;  1IWQ A;  1EH2 A;  1B8C A;  1TCF A;  4M2O A;  1F8H A;  4ETO A;  4CFQ A;  1QX2 A;  2F3Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...