2M0RA

Solution structure and dynamics of human s100a14
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
104
structure length
104
Chain Sequence
MGQCRSANAEDAQEFSDVERAIETLIKNFHQYSVEGGKETLTPSELRDLVTQQLPHLMPSNCGLEEKIANLGSCNDSKLEFRSFWELIGEAAKSVKLERPVRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure and dynamics of human S100A14.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords Protein S100-A14
total genus 23
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2m0rA00
2SCPA 2LP2A 1TNQA 1U5IA 1XYDA 1K9UA 1C7VA 2CT9A 1EL4A 1A29A 4I5JA 4DUQA 2LAPA 2F33A 1CFFA 5AERA 2E6WA 4I5NB 1K93D 1BMOA 1JFKA 1EJ3A 1NCYA 2ZNDA 3DVEA 5CSNA 2BCXA 1F4OA 2NLNA 1ALWA 1QIWA 2WORA 3DVJA 3DVMA 1KK7Z 4YI8A 1XFWO 3CZTX 4D1EA 1S6CA 3WHTB 4JWQA 1SL9A 1FF1A 1SK6D 1NWDA 1J7OA 3BXKA 5FYXA 2M1UA 1CKKA 1LKJA 1JF0A 1UHIA 2Y5IA 1QLSA 3KO0A 1CM1A 2IS9A 3SIAA 4GUKA 1XFYO 1WRZA 2H61C 1YURA 4GGNA 2O60A 3OB2B 3I5FC 1S6JA 2Q91A 2M97A 2E30A 1R2UA 3RM1A 2KI6D 4A4BA 4MVFA 1SY9A 1U5IB 1H4BA 2JU0A 1KK8B 1EG4A 2LE9B 4ZCVA 1FI6A 4I5LB 1S6IA 3LK0A 2ZN9A 5KU1A 1XFZO 5AFPA 1W7JB 4PHMA 5JJGA 3CR5X 4PHJA 1IJ5A 5HKZA 3GK2A 3GK4X 4DS7A 2AMIA 4FQOA 3SG7A 2OTGB 4DIRA 1SR6C 3EK8A 2GV5A 1IQ3A 3DF0B 2ZKMX 1B8RA 2FCDA 1XFVO 2JNXA 1TNXA 4GBAA 3BUOB 1K8UA 1KK8C 1F55A 2KNEA 1J7PA 1IGVA 2K0JA 4BY5A 4R1EA 3TUYC 4OKHA 4USLA 1JBAA 4PHKA 1EH2A 1KSMA 3D0YB 3SIBA 4NDCA 1N65A 1K96A 1BJFA 2WCBA 5CSJA 2AUCA 4PDZA 3TZ1A 3CR4X 2KGRA 1CNPA 1S3PA 1MXLC 1RJVA 1C07A 3DVKA 1B1GA 1M31A 3A4UB 4L9MA 1DF0A 1NSHA 1LXFC 1WRKA 2LANA 5I2QA 1F71A 2PSRA 4GFTA 3EVRA 1QASA 4E68A 2CCMA 1SCVA 1CTRA 1B7TZ 4M2QA 1UHNA 1A2XA 5KSZA 3OX6A 1SR6B 3BQ3A 4XJKB 1QX7A 1QATA 1TCOB 2KSPA 1DJYA 1JWDA 2Y1MA 3TUYB 2MBXA 4WQ3A 1NIWA 4CFRA 1B8CA 4M2OA 3NXAA 5J3XA 1UWOA 1CB1A 2WNDA 4MBEA 4NDDA 4AQJA 2SASA 1E8AA 4YBHB 1PULA 2NCOA 4OR9B 1A4PA 2M1KB 1Y1AA 3D0YA 2LVIA 5IBWA 1ZUZA 1NCZA 1SCMB 2F3ZA 1DJGA 1DTLA 3VGOA 1TNWA 3PM8A 3A8RA 1F70A 1SW8A 4ETOA 1F54A 3MSEB 2L0PA 5F6TA 2BE6A 3OHMB 1HQVA 1YUUA 3SG6A 1FW4A 1M63B 1MWNA 4ORCB 1YVLA 3JVTB 3VRNA 3SG4A 2LVJA 2KFFA 1LA0A 2Y1NA 1QLKA 5AXIA 3RLZA 1ALVA 1YTZC 2KOTA 1CLBA 1RROA 1UUSA 1QS7A 1AUIB 2CBLA 4GGFA 1SRAA 3IQOA 2L5XB 5CSFA 1KQVA 2HETA 1WY9A 4DCKA 3NSKA 3BOWA 3GOFA 1CFDA 4N1FA 2HPSA 1NX1A 2GGMA 3BUNB 1LINA 1XO5A 1NX3A 2KAVA 1K9KA 4MZLA 2LMTA 2PMYA 2HQWA 3LK1A 3WHUB 1B9AA 1S36A 1IH0A 1RFJA 1J7RA 3JTDC 3LL8B 4MN0A 2I2RE 1G4YR 1ZOTB 2JRFA 3FS7A 2M29A 2OTGC 1QJTA 1G8IA 1QVIZ 1S5GZ 3EVVA 3TS5C 1GJYA 1DJWA 3H4SE 2M7LA 1PSBA 1QV0A 1M39A 5G08A 3HX4A 5AANA 1YX7A 2KI4C 3LLEA 1F4QA 2I94A 4MZKA 1MUXA 1SL8A 2JT3A 1K2HA 1BT6A 2LUCA 1AP4A 3BUXB 4MLWA 3CWGA 1AJ4A 1OZSA 1H8BA 4MZJA 1DVIA 4GNKB 2ZRSA 2ZFDA 3CS1A 1DT7B 3K21A 1KFUS 2KYFA 1X02A 2BBNA 2NXQA 5I8NA 1TRFA 1UHKA 2QPTA 3O78A 2JTTA 2LHLA 1XVJA 3I5HB 2JXLA 3FIAA 2I7AA 1KFUL 4ZCUA 1R6PA 1Y6WA 1TCFA 3EKHA 2BECA 3PSRA 2L51A 4NQGA 1V1FA 3KEVA 1SNLA 2D8NA 5ER5A 2R2IA 1KCYA 2JPTA 5TNCA 5BPJA 1J55A 4CPVA 2LLTA 2M7NA 2K2AA 1L2OC 1DJZA 1SPYA 1TN4A 2KBIA 2MAZA 5GQQC 2HQ8A 1IG5A 3NSIA 1OMVA 4CIDA 1IQ5A 4HRGA 4QJ5B 5PALA 3NSLA 3SG5A 1ZACA 2MLFC 3ZWHA 3EK4A 3DF0A 3KF9A 1SKTA 3FWCA 2I18A 4IL1A 1JUOA 1BR4B 1DJIA 4P2YB 1KK7Y 5CSIA 1WDCC 2H61A 2BCBA 1YX8A 1CDLA 1QV1A 1B47A 1OMDA 1SL7A 4I5KA 4C0JA 3WXAA 1BODA 2KDHA 3KPXA 4A4CA 1A75A 2AAOA 1UURA 5HKWA 2JT8A 2TN4A 4PCWA 1M46A 1RECA 1BG1A 1J7QA 1SCMC 2GGZA 1DGUA 2A4JA 5HLOA 1CMGA 1Y1XA 4PE4A 4GPLB 2M3WA 2M49B 4HSZA 1SBJA 3AAJA 3HCMA 1L7ZA 2BKIB 1PK0D 1YR5A 2LUXA 4NDBA 1CFCA 4MEWA 3SG2A 3VROA 2ZN8A 1SYMA 3VRRA 1TTXA 1PRWA 1BU3A 3OB1B 2M9GA 4PE7A 3WNXB 4CLNA 1IKUA 2LVKA 1N2DA 1QIVA 1TOPA 1Y0VH 2BBMA 5D7FA 1CMFA 5K89A 3E3RA 1WLZA 1A03A 1C7WA 5DKNA 4WQ2A 2MJWB 4MRYA 2KBMA 3PATA 1YRTB 3PFVA 5DKQA 5KTYA 2Q4UA 1NX2A 4ICBA 4AQIA 1A75B 5HKYA 1WLMA 2KQ6A 3M0WA 4MSPA 1TNPA 3JTDB 3I5FB 5DKRA 4MRXA 5D69A 2K7OA 1AHRA 1AK8A 1XK4C 2LNKA 1K95A 2COLB 2H2KA 2OPOA 1GGWA 1J1DA 1S26D 2LLSA 4YGCB 4UPGA 2JXCA 1QXPA 3PN7B 2F8PA 1DF0B 2KFHA 1OE9B 3I5GB 4TNCA 4PHNA 2K2FA 1BF5A 4PALA 2ZRTA 1NX0A 2V53A 2K61A 3DD4A 2PASA 2M0RA 2B1UA 2PVBA 1KWOC 2L4HA 1NP8A 2MHHA 2K8MB 4XJKA 4OVNF 4YGEB 4OV2A 1JSAA 1QX5B 2M8UA 1UHJA 1FPWA 2MRDA 1XFXO 3BUMB 1KQMB 2BL0C 4C0LA 2WC8A 1BOCA 2L98A 4YI9A 1KFXS 3CTNA 2KI6C 2O5GA 1CLLA 1YUTA 4P5OE 1XK4A 2ISDA 1K90D 5I2OA 1EXRA 1G33A 1L2OB 2F2OA 2KFGA 3AKAA 1KFXL 2KAYA 2OS8B 4GGFC 3TDZA 1NCXA 2JQ6A 4OCIA 1NYAA 3O2PA 3PALA 1EG3A 2G2BA 2JZIA 2LLUA 1OOJA 2RGIA 2JULA 2MLEC 1M45A 2CTNA 2K7DA 1PSRA 3EK7A 3EVUA 3TS5B 1QTXA 4YRUA 2KGBC 1KWOB 1MF8B 4N1GA 1MR8A 1LVCD 4JQ0D 2PALA 4M2PA 2QACA 3O6BA 1AVSA 4YGDB 1DJHA 4ORAB 3AAKA 3C1VA 3SJSA 2F2PA 2LC5A 3VRPA 1CLMA 1IJ6A 3I5GC 3NSOA 1IRJA 4YGAA 1QX2A 2Y4QA 1CDNA 3QRXA 4JPZB 5CPVA 1JC2A 2L50A 4WRIA 1RTP1 3TDUA 4QJ3B 3PLFB 2EC6B 3ZNIA 1BLQA 2LHIA 3D10A 1QVIY 2LVVA 2F3YA 3CLNA 1OSAA 1Y1UA 1FI5A 4XYNA 1VRKA 4GAOA 2P6BB 1AJ5A 2JNFA 1S5GY 4Q04A 1ZMZA 1B4CA 1HT9A 1OZOA 2KQYA 1IWQA 2KAXA 2VRGA 1UP5A 1FBVA 5AEQA 1B8LA 3CGAA 3OP0A 2G9BA 2NCPA 1GQMA 1YRUB 1B7TY 1K9PA 2JTZA 2LCPA 1OMRA 3LCPC 4DRWA 1J1EA 5I2LA 2ZNEA 2WCFA 4N5XA 2LP3A 1CFPA 2BKHB 2BE4A 2K7BA 3F45A 4F0ZB 1GGZA 2EC6C 5B8IB 2FJUB 3I5IB 1UHHA 4FTGA 1DMOA 3O4YA 1DJXA 2HF5A 1MHOA 3CR2A 1XFUO 1BR1B 2CXJA 1N0YA 1OQPA 1WDCB 5HYDA 4U8DA 1ZFSA 2JOJA 4ORBB 1CM4A 2EHBA 1MQ1A 2FOTA 1CDMA 2FCEA 1WRLA 1CDPA 2LMVA 2LMUA 2L2EA 2LM5A 3EKJA 3IF7A 1DGVA 3I5IC 3JVTC 4C0KA 2WOSA 3BUWB 5JOLA 1XA5A 1ODBA 1V1GA 1LA3A 1PALA 3OX5A 4PE1A 2JT0A 3PN7C 3AKBA 2KYCA 1YVHA 2DOQA 4PE0A 1KSOA 1F8HA 2WCEA 3TDIA 1S1EA 5HLVA 3FWBA 1W7IB 2KI4B 1JFJA 2OS8C 1PVAA 4YGBB 1YUSA 2JWWA 2KHNA 3VRQA 4CFQA 1MXEA 1JF2A 5ER4X 3IQQA 2EGDA 2LV7A 2JC2A 1KQMC 1NPQA 2BL0B 2BCAA 2PRUA 4QJ4B 1RWYA 2NZ0A 4HREE 1TIZA 3GK1A 2CNPA 4AOMA 1D1OA 3BOWB 1K94A 2L4IA 2K7CA 3SG3A 3BYAA 2MA2A 1Q80A 3KHEA 4HRHA 4BY4A 3I5HC 3ICBA 1PVBA 1NUBA 1SMGA 1RK9A
chains in the Genus database with same CATH superfamily
2SCPA 2LP2A 1TNQA 1U5IA 1XYDA 3L4LA 1K9UA 1C7VA 2CT9A 1EL4A 2KLDA 1A29A 4I5JA 3UNWA 4DUQA 2LAPA 2F33A 1CFFA 5AERA 2E6WA 4I5NB 1K93D 1BMOA 1JFKA 1EJ3A 1NCYA 2ZNDA 3DVEA 5CSNA 2BCXA 1F4OA 2NLNA 1ALWA 1QIWA 2WORA 3DVJA 3DVMA 1KK7Z 4YI8A 1XFWO 3B6XA 3CZTX 3S0DA 4D1EA 1S6CA 3WHTB 4JWQA 1SL9A 1FF1A 1SK6D 1NWDA 1J7OA 3BXKA 5FYXA 2M1UA 1CKKA 1LKJA 1JF0A 1UHIA 2Y5IA 1QLSA 3KO0A 1CM1A 2IS9A 3SIAA 3VB1A 4GUKA 1XFYO 1WRZA 2H61C 1YURA 1GM0A 4GGNA 3D75A 2O60A 3OB2B 3I5FC 1S6JA 2Q91A 2M97A 3B7AA 2E30A 1R2UA 3RM1A 2KI6D 4A4BA 2WCMA 3N7HA 4MVFA 1SY9A 1U5IB 1H4BA 2JU0A 1KK8B 1EG4A 2LE9B 3R1OA 4ZCVA 1FI6A 4I5LB 1S6IA 3LK0A 2ZN9A 5KU1A 1XFZO 5AFPA 1W7JB 4PHMA 5JJGA 4PT1A 3CR5X 4PHJA 1IJ5A 5HKZA 3GK2A 3GK4X 4DS7A 2AMIA 4FQOA 3SG7A 4INXA 2OTGB 4DIRA 1SR6C 3EK8A 2GV5A 1IQ3A 3DF0B 2ZKMX 1B8RA 2FCDA 1XFVO 2JNXA 1TNXA 4GBAA 3BUOB 1K8UA 1KK8C 1F55A 2KNEA 3B87A 1IGVA 2K0JA 4BY5A 4R1EA 3TUYC 1J7PA 4OKHA 4USLA 1JBAA 4PHKA 1EH2A 1KSMA 3D0YB 3SIBA 3B86A 1TWOA 4NDCA 1N65A 1K96A 1BJFA 2WCBA 5CSJA 2AUCA 4PDZA 3TZ1A 3CR4X 2KGRA 1CNPA 1S3PA 1MXLC 1RJVA 1C07A 3DVKA 1B1GA 1M31A 3A4UB 4L9MA 1DF0A 1NSHA 1DQEA 1LXFC 1WRKA 2LANA 3DXLA 5I2QA 2PSRA 1F71A 4GFTA 3EVRA 1QASA 4E68A 2CCMA 1SCVA 1CTRA 1B7TZ 2WCJA 4M2QA 1UHNA 1A2XA 5KSZA 3OX6A 1SR6B 3BQ3A 4XJKB 1QX7A 1TUJA 1QATA 1TCOB 2KSPA 1DJYA 1JWDA 3BFHA 2Y1MA 3TUYB 2MBXA 4WQ3A 2FJYA 1NIWA 4CFRA 1B8CA 4M2OA 3NXAA 5J3XA 1UWOA 1CB1A 2WNDA 4MBEA 4NDDA 4AQJA 2SASA 1E8AA 4YBHB 1PULA 2NCOA 4OR9B 1A4PA 2M1KB 3CYZA 1Y1AA 3S0GA 3D0YA 2LVIA 3BJHA 2JPOA 5IBWA 1ZUZA 1NCZA 1SCMB 2F3ZA 3CZ1A 1DJGA 1DTLA 2PQLA 1TNWA 3PM8A 3VGOA 3A8RA 1F70A 1SW8A 4ETOA 1F54A 3UO9A 3L47A 5HL1A 4FQTA 3B88A 3MSEB 2L0PA 3R1VA 5F6TA 2BE6A 3OHMB 2L5YA 1HQVA 1YUUA 3SG6A 1FW4A 1M63B 1MWNA 4ORCB 5DICA 1YVLA 3JVTB 3VRNA 3SG4A 2LVJA 2KFFA 1LA0A 2Y1NA 1QLKA 5AXIA 3RLZA 1ALVA 1YTZC 2KOTA 1CLBA 1RROA 1UUSA 1QS7A 1AUIB 1T14A 2CBLA 4GGFA 1SRAA 3IQOA 2L5XB 5CSFA 1KQVA 2HETA 3CZ2A 1WY9A 4DCKA 3NSKA 3BOWA 3GOFA 1CFDA 4N1FA 2HPSA 1NX1A 2GGMA 3BUNB 3S0BA 1LINA 1XO5A 1NX3A 2KAVA 1K9KA 1P28A 4MZLA 2LMTA 2PMYA 2HQWA 3LK1A 3WHUB 1B9AA 1S36A 1IH0A 1RFJA 1J7RA 3JTDC 3LL8B 4MN0A 2I2RE 1G4YR 4INWA 1ZOTB 2JRFA 3FS7A 2M29A 2OTGC 1QJTA 1G8IA 1QVIZ 1S5GZ 3EVVA 3TS5C 1GJYA 1QWVA 1DJWA 3H4SE 2M7LA 1PSBA 2QEOA 1QV0A 1M39A 5G08A 3HX4A 5AANA 1DEKA 1YX7A 2KI4C 3LLEA 4JKTA 1F4QA 2I94A 4KYNA 4MZKA 3OBVA 1MUXA 1SL8A 2JT3A 1K2HA 1BT6A 2LUCA 2P70A 1AP4A 3BUXB 4MLWA 3CWGA 1AJ4A 1OZSA 3SS4A 1H8BA 4MZJA 1DVIA 4GNKB 2ZRSA 2ZFDA 3CS1A 1DT7B 3K21A 1KFUS 2KYFA 1X02A 2BBNA 2NXQA 5I8NA 1TRFA 2WC5A 1UHKA 1TUZA 2QPTA 3O78A 3CZ0A 2JTTA 2LHLA 1XVJA 3I5HB 2JXLA 1Z4HA 3FIAA 2I7AA 1KFUL 5FI7A 1R6PA 4ZCUA 1Y6WA 1TCFA 3EKHA 2BECA 3PSRA 2L51A 5I94A 4NQGA 1V1FA 3KEVA 1SNLA 2D8NA 5ER5A 2R2IA 1KCYA 2JPTA 5TNCA 5BPJA 1J55A 3DYEA 2LLTA 4CPVA 3NHIA 2M7NA 2K2AA 1L2OC 1DJZA 1SPYA 1TN4A 2KBIA 2MAZA 5GQQC 2HQ8A 1IG5A 3NSIA 1OMVA 4CIDA 1IQ5A 4HRGA 3CABA 3D77A 4QJ5B 5PALA 3NSLA 3SG5A 1ZACA 2MLFC 3ZWHA 3EK4A 3DF0A 3KF9A 1SKTA 3FWCA 2I18A 1IIOA 4IL1A 1JUOA 1BR4B 1DJIA 4P2YB 1KK7Y 5CSIA 1WDCC 1CDLA 2BCBA 1YX8A 1QV1A 1B47A 1OMDA 2H61A 1SL7A 4I5KA 4C0JA 3WXAA 1BODA 2KDHA 3KPXA 4A4CA 1A75A 2AAOA 1UURA 5HKWA 2JT8A 2TN4A 4PCWA 1M46A 1RECA 2PYQA 1BG1A 1J7QA 1SCMC 2ERBA 1DGUA 2A4JA 2GGZA 5HLOA 1CMGA 1Y1XA 4PE4A 3FE8A 4GPLB 2M3WA 2M49B 4HSZA 1SBJA 3AAJA 3HCMA 1L7ZA 2BKIB 1PK0D 1YR5A 1Z2CB 2LUXA 4NDBA 1CFCA 4MEWA 3SG2A 3VROA 2ZN8A 3K1EA 3IVTA 1OOHA 1SYMA 3VRRA 1TTXA 1ORGA 3S0AA 1PRWA 1BU3A 3OB1B 2M9GA 4PE7A 3WNXB 4CLNA 1IKUA 3OGNA 1LS8A 2LVKA 1N2DA 1QIVA 1TOPA 1Y0VH 2BBMA 5D7FA 1CMFA 5K89A 3E3RA 1WLZA 1A03A 5FI2A 1C7WA 5DKNA 4WQ2A 2MJWB 3NGVA 4MRYA 2KBMA 3PATA 1YRTB 3Q8IA 3PFVA 3CDNA 5DKQA 5KTYA 2Q4UA 1NX2A 4ICBA 4AQIA 1A75B 1OW4A 5EL2A 5HKYA 1WLMA 2KQ6A 3M0WA 4MSPA 1TNPA 3JTDB 3I5FB 5DKRA 4MRXA 5D69A 2K7OA 1AHRA 1AK8A 1XK4C 2LNKA 1C3ZA 1K95A 2COLB 2H2KA 2OPOA 1GGWA 1J1DA 1S26D 2LLSA 4YGCB 4UPGA 2JXCA 1QXPA 3PN7B 2P71A 2F8PA 1DF0B 2KFHA 1OE9B 3I5GB 4TNCA 4PHNA 2K2FA 1BF5A 4PALA 1OOFA 3DY9A 2ZRTA 3QMEA 1NX0A 2V53A 2K61A 5D3OA 4OZDA 3DD4A 2PASA 3RZSA 3FE6A 2M0RA 2B1UA 2H8VA 2PVBA 1KWOC 2L4HA 1NP8A 2MHHA 2K8MB 4XJKA 4OVNF 4YGEB 4OV2A 3D78A 1JSAA 1QX5B 2M8UA 1UHJA 1FPWA 2MRDA 1XFXO 3BUMB 1KQMB 2BL0C 4C0LA 2WC8A 1BOCA 4IJ7A 2L98A 4YI9A 3D74A 1KFXS 3CTNA 2KI6C 2O5GA 1CLLA 1YUTA 4P5OE 1XK4A 2ISDA 3R72A 1K90D 5I2OA 1EXRA 1G33A 1L2OB 2F2OA 2KFGA 3AKAA 3FE9A 1KFXL 2WC6A 3SS3A 2KAYA 2OS8B 2KPHA 4GGFC 3TDZA 1NCXA 2JQ6A 4OCIA 1NYAA 3O2PA 3D76A 3PALA 1EG3A 2G2BA 2JZIA 2LLUA 1OOJA 2RGIA 2JULA 2MLEC 1M45A 2CTNA 2K7DA 1PSRA 1XFRA 3EK7A 3EVUA 3TS5B 1QTXA 4YRUA 2KGBC 1KWOB 3S0FA 1MF8B 4N1GA 1MR8A 1LVCD 4JQ0D 2PALA 4M2PA 2QACA 3O6BA 1AVSA 4YGDB 1DJHA 1DC1A 4ORAB 3AAKA 3C1VA 1W9ZA 3SJSA 2F2PA 2LC5A 5FI6A 3VRPA 1CLMA 1IJ6A 3I5GC 3NSOA 1IRJA 4YGAA 2YGUA 1QX2A 2Y4QA 1CDNA 2K60A 3QRXA 4JPZB 5CPVA 1JC2A 2L50A 4WRIA 2KLEA 1RTP1 3BFBA 3TDUA 4QJ3B 3PLFB 3R1PA 2EC6B 3ZNIA 3V2LA 2LHIA 3D10A 1BLQA 1QVIY 2LVVA 2F3YA 3SS5A 3CLNA 1OSAA 1Y1UA 1FI5A 4XYNA 1VRKA 2BAPA 2QDIA 2WCKA 2P6BB 4GAOA 1AJ5A 2JNFA 1S5GY 4Q04A 1ZMZA 1B4CA 1HT9A 1OZOA 2KQYA 4JD9A 1IWQA 2KAXA 2VRGA 1UP5A 1FBVA 5AEQA 1B8LA 3CGAA 3OP0A 2G9BA 2NCPA 1GQMA 1YRUB 1B7TY 1OOIX 1K9PA 2JTZA 2LCPA 1OMRA 3LCPC 4DRWA 1J1EA 5I2LA 2ZNEA 2WCFA 4N5XA 2LP3A 2L2CA 1CFPA 2BKHB 2BE4A 2K7BA 3F45A 4F0ZB 1GGZA 2EC6C 5B8IB 2FJUB 1OOGA 3I5IB 1UHHA 4FTGA 1DMOA 3O4YA 1DJXA 2HF5A 1MHOA 3CR2A 1XFUO 1BR1B 2CXJA 1N0YA 1OQPA 1WDCB 5HYDA 4U8DA 1ZFSA 2JOJA 4ORBB 1CM4A 2EHBA 2QEHA 1MQ1A 2FOTA 3PM2A 2QEVA 1CDMA 2FCEA 1WRLA 1CDPA 2LMVA 2LMUA 3BFAA 2L2EA 2LM5A 3EKJA 3IF7A 1DGVA 3I5IC 3JVTC 4C0KA 2WOSA 3BUWB 5JOLA 1XA5A 1SSEB 3DZTA 3O4XA 1ODBA 1V1GA 1LA3A 1PALA 3L4AA 3OX5A 1DELA 4PE1A 2JT0A 3PJIA 3PN7C 3AKBA 2KYCA 1YVHA 2GTEA 2DOQA 3S0EA 4PE0A 3EG5B 1KSOA 2WCHA 1F8HA 2WCEA 3TDIA 1S1EA 2BNXA 3FWBA 5HLVA 4F7FA 1W7IB 2KI4B 1JFJA 2OS8C 1C3YA 1PVAA 4YGBB 1YUSA 2JWWA 2KHNA 3VRQA 4CFQA 1MXEA 2WCLA 1JF2A 5ER4X 3IQQA 2EGDA 2LV7A 2JC2A 1KQMC 1NPQA 2BL0B 2BCAA 2PRUA 2QEBA 1RWYA 2NZ0A 4QJ4B 4HREE 1TIZA 3GK1A 2CNPA 3NHTA 4AOMA 1D1OA 3BOWB 1K94A 2L4IA 2K7CA 3SG3A 3BYAA 2MA2A 1Q80A 3KHEA 4HRHA 4BY4A 3I5HC 3ICBA 1PVBA 1NUBA 1SMGA 3D73A 1RK9A
chains in the Genus database with same CATH topology
2SCPA 2LP2A 1TNQA 1U5IA 1XYDA 1K9UA 1C7VA 2CT9A 1EL4A 1A29A 4I5JA 4DUQA 2LAPA 2F33A 1CFFA 5AERA 2E6WA 4I5NB 1K93D 1BMOA 1JFKA 1EJ3A 1NCYA 2ZNDA 3DVEA 5CSNA 2BCXA 1F4OA 2NLNA 1ALWA 1QIWA 2WORA 3DVJA 3DVMA 1KK7Z 4YI8A 1XFWO 3CZTX 4D1EA 1S6CA 3WHTB 4JWQA 1SL9A 1FF1A 1SK6D 1NWDA 1J7OA 3BXKA 5FYXA 2M1UA 1CKKA 1LKJA 1JF0A 1UHIA 2Y5IA 1QLSA 3KO0A 1CM1A 2IS9A 3SIAA 4GUKA 1XFYO 1WRZA 2H61C 1YURA 4GGNA 2O60A 3OB2B 3I5FC 1S6JA 2Q91A 2M97A 2E30A 1R2UA 3RM1A 2KI6D 4A4BA 4MVFA 1SY9A 1U5IB 1H4BA 2JU0A 1KK8B 1EG4A 2LE9B 4ZCVA 1FI6A 4I5LB 1S6IA 3LK0A 2ZN9A 5KU1A 1XFZO 5AFPA 1W7JB 4PHMA 5JJGA 3CR5X 4PHJA 1IJ5A 5HKZA 3GK2A 3GK4X 4DS7A 2AMIA 4FQOA 3SG7A 2OTGB 4DIRA 1SR6C 3EK8A 2GV5A 1IQ3A 3DF0B 2ZKMX 1B8RA 2FCDA 1XFVO 2JNXA 1TNXA 4GBAA 3BUOB 1K8UA 1KK8C 1F55A 2KNEA 1J7PA 1IGVA 2K0JA 4BY5A 4R1EA 3TUYC 4OKHA 4USLA 1JBAA 4PHKA 1EH2A 1KSMA 3D0YB 3SIBA 4NDCA 1N65A 1K96A 1BJFA 2WCBA 5CSJA 2AUCA 4PDZA 3TZ1A 3CR4X 2KGRA 1CNPA 1S3PA 1MXLC 1RJVA 1C07A 3DVKA 1B1GA 1M31A 3A4UB 4L9MA 1DF0A 1NSHA 1LXFC 1WRKA 2LANA 5I2QA 1F71A 2PSRA 4GFTA 3EVRA 1QASA 4E68A 2CCMA 1SCVA 1CTRA 1B7TZ 4M2QA 1UHNA 1A2XA 5KSZA 3OX6A 1SR6B 3BQ3A 4XJKB 1QX7A 1QATA 1TCOB 2KSPA 1DJYA 1JWDA 2Y1MA 3TUYB 2MBXA 4WQ3A 1NIWA 4CFRA 1B8CA 4M2OA 3NXAA 5J3XA 1UWOA 1CB1A 2WNDA 4MBEA 4NDDA 4AQJA 2SASA 1E8AA 4YBHB 1PULA 2NCOA 4OR9B 1A4PA 2M1KB 1Y1AA 3D0YA 2LVIA 5IBWA 1ZUZA 1NCZA 1SCMB 2F3ZA 1DJGA 1DTLA 3VGOA 1TNWA 3PM8A 3A8RA 1F70A 1SW8A 4ETOA 1F54A 3MSEB 2L0PA 5F6TA 2BE6A 3OHMB 1HQVA 1YUUA 3SG6A 1FW4A 1M63B 1MWNA 4ORCB 1YVLA 3JVTB 3VRNA 3SG4A 2LVJA 2KFFA 1LA0A 2Y1NA 1QLKA 5AXIA 3RLZA 1ALVA 1YTZC 2KOTA 1CLBA 1RROA 1UUSA 1QS7A 1AUIB 2CBLA 4GGFA 1SRAA 3IQOA 2L5XB 5CSFA 1KQVA 2HETA 1WY9A 4DCKA 3NSKA 3BOWA 3GOFA 1CFDA 4N1FA 2HPSA 1NX1A 2GGMA 3BUNB 1LINA 1XO5A 1NX3A 2KAVA 1K9KA 4MZLA 2LMTA 2PMYA 2HQWA 3LK1A 3WHUB 1B9AA 1S36A 1IH0A 1RFJA 1J7RA 3JTDC 3LL8B 4MN0A 2I2RE 1G4YR 1ZOTB 2JRFA 3FS7A 2M29A 2OTGC 1QJTA 1G8IA 1QVIZ 1S5GZ 3EVVA 3TS5C 1GJYA 1DJWA 3H4SE 2M7LA 1PSBA 1QV0A 1M39A 5G08A 3HX4A 5AANA 1YX7A 2KI4C 3LLEA 1F4QA 2I94A 4MZKA 1MUXA 1SL8A 2JT3A 1K2HA 1BT6A 2LUCA 1AP4A 3BUXB 4MLWA 3CWGA 1AJ4A 1OZSA 1H8BA 4MZJA 1DVIA 4GNKB 2ZRSA 2ZFDA 3CS1A 1DT7B 3K21A 1KFUS 2KYFA 1X02A 2BBNA 2NXQA 5I8NA 1TRFA 1UHKA 2QPTA 3O78A 2JTTA 2LHLA 1XVJA 3I5HB 2JXLA 3FIAA 2I7AA 1KFUL 4ZCUA 1R6PA 1Y6WA 1TCFA 3EKHA 2BECA 3PSRA 2L51A 4NQGA 1V1FA 3KEVA 1SNLA 2D8NA 5ER5A 2R2IA 1KCYA 2JPTA 5TNCA 5BPJA 1J55A 4CPVA 2LLTA 2M7NA 2K2AA 1L2OC 1DJZA 1SPYA 1TN4A 2KBIA 2MAZA 5GQQC 2HQ8A 1IG5A 3NSIA 1OMVA 4CIDA 1IQ5A 4HRGA 4QJ5B 5PALA 3NSLA 3SG5A 1ZACA 2MLFC 3ZWHA 3EK4A 3DF0A 3KF9A 1SKTA 3FWCA 2I18A 4IL1A 1JUOA 1BR4B 1DJIA 4P2YB 1KK7Y 5CSIA 1WDCC 2H61A 2BCBA 1YX8A 1CDLA 1QV1A 1B47A 1OMDA 1SL7A 4I5KA 4C0JA 3WXAA 1BODA 2KDHA 3KPXA 4A4CA 1A75A 2AAOA 1UURA 5HKWA 2JT8A 2TN4A 4PCWA 1M46A 1RECA 1BG1A 1J7QA 1SCMC 2GGZA 1DGUA 2A4JA 5HLOA 1CMGA 1Y1XA 4PE4A 4GPLB 2M3WA 2M49B 4HSZA 1SBJA 3AAJA 3HCMA 1L7ZA 2BKIB 1PK0D 1YR5A 2LUXA 4NDBA 1CFCA 4MEWA 3SG2A 3VROA 2ZN8A 1SYMA 3VRRA 1TTXA 1PRWA 1BU3A 3OB1B 2M9GA 4PE7A 3WNXB 4CLNA 1IKUA 2LVKA 1N2DA 1QIVA 1TOPA 1Y0VH 2BBMA 5D7FA 1CMFA 5K89A 3E3RA 1WLZA 1A03A 1C7WA 5DKNA 4WQ2A 2MJWB 4MRYA 2KBMA 3PATA 1YRTB 3PFVA 5DKQA 5KTYA 2Q4UA 1NX2A 4ICBA 4AQIA 1A75B 5HKYA 1WLMA 2KQ6A 3M0WA 4MSPA 1TNPA 3JTDB 3I5FB 5DKRA 4MRXA 5D69A 2K7OA 1AHRA 1AK8A 1XK4C 2LNKA 1K95A 2COLB 2H2KA 2OPOA 1GGWA 1J1DA 1S26D 2LLSA 4YGCB 4UPGA 2JXCA 1QXPA 3PN7B 2F8PA 1DF0B 2KFHA 1OE9B 3I5GB 4TNCA 4PHNA 2K2FA 1BF5A 4PALA 2ZRTA 1NX0A 2V53A 2K61A 3DD4A 2PASA 2M0RA 2B1UA 2PVBA 1KWOC 2L4HA 1NP8A 2MHHA 2K8MB 4XJKA 4OVNF 4YGEB 4OV2A 1JSAA 1QX5B 2M8UA 1UHJA 1FPWA 2MRDA 1XFXO 3BUMB 1KQMB 2BL0C 4C0LA 2WC8A 1BOCA 2L98A 4YI9A 1KFXS 3CTNA 2KI6C 2O5GA 1CLLA 1YUTA 4P5OE 1XK4A 2ISDA 1K90D 5I2OA 1EXRA 1G33A 1L2OB 2F2OA 2KFGA 3AKAA 1KFXL 2KAYA 2OS8B 4GGFC 3TDZA 1NCXA 2JQ6A 4OCIA 1NYAA 3O2PA 3PALA 1EG3A 2G2BA 2JZIA 2LLUA 1OOJA 2RGIA 2JULA 2MLEC 1M45A 2CTNA 2K7DA 1PSRA 3EK7A 3EVUA 3TS5B 1QTXA 4YRUA 2KGBC 1KWOB 1MF8B 4N1GA 1MR8A 1LVCD 4JQ0D 2PALA 4M2PA 2QACA 3O6BA 1AVSA 4YGDB 1DJHA 4ORAB 3AAKA 3C1VA 3SJSA 2F2PA 2LC5A 3VRPA 1CLMA 1IJ6A 3I5GC 3NSOA 1IRJA 4YGAA 1QX2A 2Y4QA 1CDNA 3QRXA 4JPZB 5CPVA 1JC2A 2L50A 4WRIA 1RTP1 3TDUA 4QJ3B 3PLFB 2EC6B 3ZNIA 1BLQA 2LHIA 3D10A 1QVIY 2LVVA 2F3YA 3CLNA 1OSAA 1Y1UA 1FI5A 4XYNA 1VRKA 4GAOA 2P6BB 1AJ5A 2JNFA 1S5GY 4Q04A 1ZMZA 1B4CA 1HT9A 1OZOA 2KQYA 1IWQA 2KAXA 2VRGA 1UP5A 1FBVA 5AEQA 1B8LA 3CGAA 3OP0A 2G9BA 2NCPA 1GQMA 1YRUB 1B7TY 1K9PA 2JTZA 2LCPA 1OMRA 3LCPC 4DRWA 1J1EA 5I2LA 2ZNEA 2WCFA 4N5XA 2LP3A 1CFPA 2BKHB 2BE4A 2K7BA 3F45A 4F0ZB 1GGZA 2EC6C 5B8IB 2FJUB 3I5IB 1UHHA 4FTGA 1DMOA 3O4YA 1DJXA 2HF5A 1MHOA 3CR2A 1XFUO 1BR1B 2CXJA 1N0YA 1OQPA 1WDCB 5HYDA 4U8DA 1ZFSA 2JOJA 4ORBB 1CM4A 2EHBA 1MQ1A 2FOTA 1CDMA 2FCEA 1WRLA 1CDPA 2LMVA 2LMUA 2L2EA 2LM5A 3EKJA 3IF7A 1DGVA 3I5IC 3JVTC 4C0KA 2WOSA 3BUWB 5JOLA 1XA5A 1ODBA 1V1GA 1LA3A 1PALA 3OX5A 4PE1A 2JT0A 3PN7C 3AKBA 2KYCA 1YVHA 2DOQA 4PE0A 1KSOA 1F8HA 2WCEA 3TDIA 1S1EA 5HLVA 3FWBA 1W7IB 2KI4B 1JFJA 2OS8C 1PVAA 4YGBB 1YUSA 2JWWA 2KHNA 3VRQA 4CFQA 1MXEA 1JF2A 5ER4X 3IQQA 2EGDA 2LV7A 2JC2A 1KQMC 1NPQA 2BL0B 2BCAA 2PRUA 4QJ4B 1RWYA 2NZ0A 4HREE 1TIZA 3GK1A 2CNPA 4AOMA 1D1OA 3BOWB 1K94A 2L4IA 2K7CA 3SG3A 3BYAA 2MA2A 1Q80A 3KHEA 4HRHA 4BY4A 3I5HC 3ICBA 1PVBA 1NUBA 1SMGA 1RK9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2SCP A;  2LP2 A;  1TNQ A;  1U5I A;  1XYD A;  1K9U A;  1C7V A;  2CT9 A;  1EL4 A;  1A29 A;  4I5J A;  4DUQ A;  2LAP A;  2F33 A;  1CFF A;  5AER A;  2E6W A;  4I5N B;  1K93 D;  1BMO A;  1JFK A;  1EJ3 A;  1NCY A;  2ZND A;  3DVE A;  5CSN A;  2BCX A;  1F4O A;  2NLN A;  1ALW A;  1QIW A;  2WOR A;  3DVJ A;  3DVM A;  1KK7 Z;  4YI8 A;  1XFW O;  3CZT X;  4D1E A;  1S6C A;  3WHT B;  4JWQ A;  1SL9 A;  1FF1 A;  1SK6 D;  1NWD A;  1J7O A;  3BXK A;  5FYX A;  2M1U A;  1CKK A;  1LKJ A;  1JF0 A;  1UHI A;  2Y5I A;  1QLS A;  3KO0 A;  1CM1 A;  2IS9 A;  3SIA A;  4GUK A;  1XFY O;  1WRZ A;  2H61 C;  1YUR A;  4GGN A;  2O60 A;  3OB2 B;  3I5F C;  1S6J A;  2Q91 A;  2M97 A;  2E30 A;  1R2U A;  3RM1 A;  2KI6 D;  4A4B A;  4MVF A;  1SY9 A;  1U5I B;  1H4B A;  2JU0 A;  1KK8 B;  1EG4 A;  2LE9 B;  4ZCV A;  1FI6 A;  4I5L B;  1S6I A;  3LK0 A;  2ZN9 A;  5KU1 A;  1XFZ O;  5AFP A;  1W7J B;  4PHM A;  5JJG A;  3CR5 X;  4PHJ A;  1IJ5 A;  5HKZ A;  3GK2 A;  3GK4 X;  4DS7 A;  2AMI A;  4FQO A;  3SG7 A;  2OTG B;  4DIR A;  1SR6 C;  3EK8 A;  2GV5 A;  1IQ3 A;  3DF0 B;  2ZKM X;  1B8R A;  2FCD A;  1XFV O;  2JNX A;  1TNX A;  4GBA A;  3BUO B;  1K8U A;  1KK8 C;  1F55 A;  2KNE A;  1J7P A;  1IGV A;  2K0J A;  4BY5 A;  4R1E A;  3TUY C;  4OKH A;  4USL A;  1JBA A;  4PHK A;  1EH2 A;  1KSM A;  3D0Y B;  3SIB A;  4NDC A;  1N65 A;  1K96 A;  1BJF A;  2WCB A;  5CSJ A;  2AUC A;  4PDZ A;  3TZ1 A;  3CR4 X;  2KGR A;  1CNP A;  1S3P A;  1MXL C;  1RJV A;  1C07 A;  3DVK A;  1B1G A;  1M31 A;  3A4U B;  4L9M A;  1DF0 A;  1NSH A;  1LXF C;  1WRK A;  2LAN A;  5I2Q A;  1F71 A;  2PSR A;  4GFT A;  3EVR A;  1QAS A;  4E68 A;  2CCM A;  1SCV A;  1CTR A;  1B7T Z;  4M2Q A;  1UHN A;  1A2X A;  5KSZ A;  3OX6 A;  1SR6 B;  3BQ3 A;  4XJK B;  1QX7 A;  1QAT A;  1TCO B;  2KSP A;  1DJY A;  1JWD A;  2Y1M A;  3TUY B;  2MBX A;  4WQ3 A;  1NIW A;  4CFR A;  1B8C A;  4M2O A;  3NXA A;  5J3X A;  1UWO A;  1CB1 A;  2WND A;  4MBE A;  4NDD A;  4AQJ A;  2SAS A;  1E8A A;  4YBH B;  1PUL A;  2NCO A;  4OR9 B;  1A4P A;  2M1K B;  1Y1A A;  3D0Y A;  2LVI A;  5IBW A;  1ZUZ A;  1NCZ A;  1SCM B;  2F3Z A;  1DJG A;  1DTL A;  3VGO A;  1TNW A;  3PM8 A;  3A8R A;  1F70 A;  1SW8 A;  4ETO A;  1F54 A;  3MSE B;  2L0P A;  5F6T A;  2BE6 A;  3OHM B;  1HQV A;  1YUU A;  3SG6 A;  1FW4 A;  1M63 B;  1MWN A;  4ORC B;  1YVL A;  3JVT B;  3VRN A;  3SG4 A;  2LVJ A;  2KFF A;  1LA0 A;  2Y1N A;  1QLK A;  5AXI A;  3RLZ A;  1ALV A;  1YTZ C;  2KOT A;  1CLB A;  1RRO A;  1UUS A;  1QS7 A;  1AUI B;  2CBL A;  4GGF A;  1SRA A;  3IQO A;  2L5X B;  5CSF A;  1KQV A;  2HET A;  1WY9 A;  4DCK A;  3NSK A;  3BOW A;  3GOF A;  1CFD A;  4N1F A;  2HPS A;  1NX1 A;  2GGM A;  3BUN B;  1LIN A;  1XO5 A;  1NX3 A;  2KAV A;  1K9K A;  4MZL A;  2LMT A;  2PMY A;  2HQW A;  3LK1 A;  3WHU B;  1B9A A;  1S36 A;  1IH0 A;  1RFJ A;  1J7R A;  3JTD C;  3LL8 B;  4MN0 A;  2I2R E;  1G4Y R;  1ZOT B;  2JRF A;  3FS7 A;  2M29 A;  2OTG C;  1QJT A;  1G8I A;  1QVI Z;  1S5G Z;  3EVV A;  3TS5 C;  1GJY A;  1DJW A;  3H4S E;  2M7L A;  1PSB A;  1QV0 A;  1M39 A;  5G08 A;  3HX4 A;  5AAN A;  1YX7 A;  2KI4 C;  3LLE A;  1F4Q A;  2I94 A;  4MZK A;  1MUX A;  1SL8 A;  2JT3 A;  1K2H A;  1BT6 A;  2LUC A;  1AP4 A;  3BUX B;  4MLW A;  3CWG A;  1AJ4 A;  1OZS A;  1H8B A;  4MZJ A;  1DVI A;  4GNK B;  2ZRS A;  2ZFD A;  3CS1 A;  1DT7 B;  3K21 A;  1KFU S;  2KYF A;  1X02 A;  2BBN A;  2NXQ A;  5I8N A;  1TRF A;  1UHK A;  2QPT A;  3O78 A;  2JTT A;  2LHL A;  1XVJ A;  3I5H B;  2JXL A;  3FIA A;  2I7A A;  1KFU L;  4ZCU A;  1R6P A;  1Y6W A;  1TCF A;  3EKH A;  2BEC A;  3PSR A;  2L51 A;  4NQG A;  1V1F A;  3KEV A;  1SNL A;  2D8N A;  5ER5 A;  2R2I A;  1KCY A;  2JPT A;  5TNC A;  5BPJ A;  1J55 A;  4CPV A;  2LLT A;  2M7N A;  2K2A A;  1L2O C;  1DJZ A;  1SPY A;  1TN4 A;  2KBI A;  2MAZ A;  5GQQ C;  2HQ8 A;  1IG5 A;  3NSI A;  1OMV A;  4CID A;  1IQ5 A;  4HRG A;  4QJ5 B;  5PAL A;  3NSL A;  3SG5 A;  1ZAC A;  2MLF C;  3ZWH A;  3EK4 A;  3DF0 A;  3KF9 A;  1SKT A;  3FWC A;  2I18 A;  4IL1 A;  1JUO A;  1BR4 B;  1DJI A;  4P2Y B;  1KK7 Y;  5CSI A;  1WDC C;  2H61 A;  2BCB A;  1YX8 A;  1CDL A;  1QV1 A;  1B47 A;  1OMD A;  1SL7 A;  4I5K A;  4C0J A;  3WXA A;  1BOD A;  2KDH A;  3KPX A;  4A4C A;  1A75 A;  2AAO A;  1UUR A;  5HKW A;  2JT8 A;  2TN4 A;  4PCW A;  1M46 A;  1REC A;  1BG1 A;  1J7Q A;  1SCM C;  2GGZ A;  1DGU A;  2A4J A;  5HLO A;  1CMG A;  1Y1X A;  4PE4 A;  4GPL B;  2M3W A;  2M49 B;  4HSZ A;  1SBJ A;  3AAJ A;  3HCM A;  1L7Z A;  2BKI B;  1PK0 D;  1YR5 A;  2LUX A;  4NDB A;  1CFC A;  4MEW A;  3SG2 A;  3VRO A;  2ZN8 A;  1SYM A;  3VRR A;  1TTX A;  1PRW A;  1BU3 A;  3OB1 B;  2M9G A;  4PE7 A;  3WNX B;  4CLN A;  1IKU A;  2LVK A;  1N2D A;  1QIV A;  1TOP A;  1Y0V H;  2BBM A;  5D7F A;  1CMF A;  5K89 A;  3E3R A;  1WLZ A;  1A03 A;  1C7W A;  5DKN A;  4WQ2 A;  2MJW B;  4MRY A;  2KBM A;  3PAT A;  1YRT B;  3PFV A;  5DKQ A;  5KTY A;  2Q4U A;  1NX2 A;  4ICB A;  4AQI A;  1A75 B;  5HKY A;  1WLM A;  2KQ6 A;  3M0W A;  4MSP A;  1TNP A;  3JTD B;  3I5F B;  5DKR A;  4MRX A;  5D69 A;  2K7O A;  1AHR A;  1AK8 A;  1XK4 C;  2LNK A;  1K95 A;  2COL B;  2H2K A;  2OPO A;  1GGW A;  1J1D A;  1S26 D;  2LLS A;  4YGC B;  4UPG A;  2JXC A;  1QXP A;  3PN7 B;  2F8P A;  1DF0 B;  2KFH A;  1OE9 B;  3I5G B;  4TNC A;  4PHN A;  2K2F A;  1BF5 A;  4PAL A;  2ZRT A;  1NX0 A;  2V53 A;  2K61 A;  3DD4 A;  2PAS A;  2M0R A;  2B1U A;  2PVB A;  1KWO C;  2L4H A;  1NP8 A;  2MHH A;  2K8M B;  4XJK A;  4OVN F;  4YGE B;  4OV2 A;  1JSA A;  1QX5 B;  2M8U A;  1UHJ A;  1FPW A;  2MRD A;  1XFX O;  3BUM B;  1KQM B;  2BL0 C;  4C0L A;  2WC8 A;  1BOC A;  2L98 A;  4YI9 A;  1KFX S;  3CTN A;  2KI6 C;  2O5G A;  1CLL A;  1YUT A;  4P5O E;  1XK4 A;  2ISD A;  1K90 D;  5I2O A;  1EXR A;  1G33 A;  1L2O B;  2F2O A;  2KFG A;  3AKA A;  1KFX L;  2KAY A;  2OS8 B;  4GGF C;  3TDZ A;  1NCX A;  2JQ6 A;  4OCI A;  1NYA A;  3O2P A;  3PAL A;  1EG3 A;  2G2B A;  2JZI A;  2LLU A;  1OOJ A;  2RGI A;  2JUL A;  2MLE C;  1M45 A;  2CTN A;  2K7D A;  1PSR A;  3EK7 A;  3EVU A;  3TS5 B;  1QTX A;  4YRU A;  2KGB C;  1KWO B;  1MF8 B;  4N1G A;  1MR8 A;  1LVC D;  4JQ0 D;  2PAL A;  4M2P A;  2QAC A;  3O6B A;  1AVS A;  4YGD B;  1DJH A;  4ORA B;  3AAK A;  3C1V A;  3SJS A;  2F2P A;  2LC5 A;  3VRP A;  1CLM A;  1IJ6 A;  3I5G C;  3NSO A;  1IRJ A;  4YGA A;  1QX2 A;  2Y4Q A;  1CDN A;  3QRX A;  4JPZ B;  5CPV A;  1JC2 A;  2L50 A;  4WRI A;  1RTP 1;  3TDU A;  4QJ3 B;  3PLF B;  2EC6 B;  3ZNI A;  1BLQ A;  2LHI A;  3D10 A;  1QVI Y;  2LVV A;  2F3Y A;  3CLN A;  1OSA A;  1Y1U A;  1FI5 A;  4XYN A;  1VRK A;  4GAO A;  2P6B B;  1AJ5 A;  2JNF A;  1S5G Y;  4Q04 A;  1ZMZ A;  1B4C A;  1HT9 A;  1OZO A;  2KQY A;  1IWQ A;  2KAX A;  2VRG A;  1UP5 A;  1FBV A;  5AEQ A;  1B8L A;  3CGA A;  3OP0 A;  2G9B A;  2NCP A;  1GQM A;  1YRU B;  1B7T Y;  1K9P A;  2JTZ A;  2LCP A;  1OMR A;  3LCP C;  4DRW A;  1J1E A;  5I2L A;  2ZNE A;  2WCF A;  4N5X A;  2LP3 A;  1CFP A;  2BKH B;  2BE4 A;  2K7B A;  3F45 A;  4F0Z B;  1GGZ A;  2EC6 C;  5B8I B;  2FJU B;  3I5I B;  1UHH A;  4FTG A;  1DMO A;  3O4Y A;  1DJX A;  2HF5 A;  1MHO A;  3CR2 A;  1XFU O;  1BR1 B;  2CXJ A;  1N0Y A;  1OQP A;  1WDC B;  5HYD A;  4U8D A;  1ZFS A;  2JOJ A;  4ORB B;  1CM4 A;  2EHB A;  1MQ1 A;  2FOT A;  1CDM A;  2FCE A;  1WRL A;  1CDP A;  2LMV A;  2LMU A;  2L2E A;  2LM5 A;  3EKJ A;  3IF7 A;  1DGV A;  3I5I C;  3JVT C;  4C0K A;  2WOS A;  3BUW B;  5JOL A;  1XA5 A;  1ODB A;  1V1G A;  1LA3 A;  1PAL A;  3OX5 A;  4PE1 A;  2JT0 A;  3PN7 C;  3AKB A;  2KYC A;  1YVH A;  2DOQ A;  4PE0 A;  1KSO A;  1F8H A;  2WCE A;  3TDI A;  1S1E A;  5HLV A;  3FWB A;  1W7I B;  2KI4 B;  1JFJ A;  2OS8 C;  1PVA A;  4YGB B;  1YUS A;  2JWW A;  2KHN A;  3VRQ A;  4CFQ A;  1MXE A;  1JF2 A;  5ER4 X;  3IQQ A;  2EGD A;  2LV7 A;  2JC2 A;  1KQM C;  1NPQ A;  2BL0 B;  2BCA A;  2PRU A;  4QJ4 B;  1RWY A;  2NZ0 A;  4HRE E;  1TIZ A;  3GK1 A;  2CNP A;  4AOM A;  1D1O A;  3BOW B;  1K94 A;  2L4I A;  2K7C A;  3SG3 A;  3BYA A;  2MA2 A;  1Q80 A;  3KHE A;  4HRH A;  4BY4 A;  3I5H C;  3ICB A;  1PVB A;  1NUB A;  1SMG A;  1RK9 A; 
#chains in the Genus database with same CATH topology
 2SCP A;  2LP2 A;  1TNQ A;  1U5I A;  1XYD A;  3L4L A;  1K9U A;  1C7V A;  2CT9 A;  1EL4 A;  2KLD A;  1A29 A;  4I5J A;  3UNW A;  4DUQ A;  2LAP A;  2F33 A;  1CFF A;  5AER A;  2E6W A;  4I5N B;  1K93 D;  1BMO A;  1JFK A;  1EJ3 A;  1NCY A;  2ZND A;  3DVE A;  5CSN A;  2BCX A;  1F4O A;  2NLN A;  1ALW A;  1QIW A;  2WOR A;  3DVJ A;  3DVM A;  1KK7 Z;  4YI8 A;  1XFW O;  3B6X A;  3CZT X;  3S0D A;  4D1E A;  1S6C A;  3WHT B;  4JWQ A;  1SL9 A;  1FF1 A;  1SK6 D;  1NWD A;  1J7O A;  3BXK A;  5FYX A;  2M1U A;  1CKK A;  1LKJ A;  1JF0 A;  1UHI A;  2Y5I A;  1QLS A;  3KO0 A;  1CM1 A;  2IS9 A;  3SIA A;  3VB1 A;  4GUK A;  1XFY O;  1WRZ A;  2H61 C;  1YUR A;  1GM0 A;  4GGN A;  3D75 A;  2O60 A;  3OB2 B;  3I5F C;  1S6J A;  2Q91 A;  2M97 A;  3B7A A;  2E30 A;  1R2U A;  3RM1 A;  2KI6 D;  4A4B A;  2WCM A;  3N7H A;  4MVF A;  1SY9 A;  1U5I B;  1H4B A;  2JU0 A;  1KK8 B;  1EG4 A;  2LE9 B;  3R1O A;  4ZCV A;  1FI6 A;  4I5L B;  1S6I A;  3LK0 A;  2ZN9 A;  5KU1 A;  1XFZ O;  5AFP A;  1W7J B;  4PHM A;  5JJG A;  4PT1 A;  3CR5 X;  4PHJ A;  1IJ5 A;  5HKZ A;  3GK2 A;  3GK4 X;  4DS7 A;  2AMI A;  4FQO A;  3SG7 A;  4INX A;  2OTG B;  4DIR A;  1SR6 C;  3EK8 A;  2GV5 A;  1IQ3 A;  3DF0 B;  2ZKM X;  1B8R A;  2FCD A;  1XFV O;  2JNX A;  1TNX A;  4GBA A;  3BUO B;  1K8U A;  1KK8 C;  1F55 A;  2KNE A;  3B87 A;  1IGV A;  2K0J A;  4BY5 A;  4R1E A;  3TUY C;  1J7P A;  4OKH A;  4USL A;  1JBA A;  4PHK A;  1EH2 A;  1KSM A;  3D0Y B;  3SIB A;  3B86 A;  1TWO A;  4NDC A;  1N65 A;  1K96 A;  1BJF A;  2WCB A;  5CSJ A;  2AUC A;  4PDZ A;  3TZ1 A;  3CR4 X;  2KGR A;  1CNP A;  1S3P A;  1MXL C;  1RJV A;  1C07 A;  3DVK A;  1B1G A;  1M31 A;  3A4U B;  4L9M A;  1DF0 A;  1NSH A;  1DQE A;  1LXF C;  1WRK A;  2LAN A;  3DXL A;  5I2Q A;  2PSR A;  1F71 A;  4GFT A;  3EVR A;  1QAS A;  4E68 A;  2CCM A;  1SCV A;  1CTR A;  1B7T Z;  2WCJ A;  4M2Q A;  1UHN A;  1A2X A;  5KSZ A;  3OX6 A;  1SR6 B;  3BQ3 A;  4XJK B;  1QX7 A;  1TUJ A;  1QAT A;  1TCO B;  2KSP A;  1DJY A;  1JWD A;  3BFH A;  2Y1M A;  3TUY B;  2MBX A;  4WQ3 A;  2FJY A;  1NIW A;  4CFR A;  1B8C A;  4M2O A;  3NXA A;  5J3X A;  1UWO A;  1CB1 A;  2WND A;  4MBE A;  4NDD A;  4AQJ A;  2SAS A;  1E8A A;  4YBH B;  1PUL A;  2NCO A;  4OR9 B;  1A4P A;  2M1K B;  3CYZ A;  1Y1A A;  3S0G A;  3D0Y A;  2LVI A;  3BJH A;  2JPO A;  5IBW A;  1ZUZ A;  1NCZ A;  1SCM B;  2F3Z A;  3CZ1 A;  1DJG A;  1DTL A;  2PQL A;  1TNW A;  3PM8 A;  3VGO A;  3A8R A;  1F70 A;  1SW8 A;  4ETO A;  1F54 A;  3UO9 A;  3L47 A;  5HL1 A;  4FQT A;  3B88 A;  3MSE B;  2L0P A;  3R1V A;  5F6T A;  2BE6 A;  3OHM B;  2L5Y A;  1HQV A;  1YUU A;  3SG6 A;  1FW4 A;  1M63 B;  1MWN A;  4ORC B;  5DIC A;  1YVL A;  3JVT B;  3VRN A;  3SG4 A;  2LVJ A;  2KFF A;  1LA0 A;  2Y1N A;  1QLK A;  5AXI A;  3RLZ A;  1ALV A;  1YTZ C;  2KOT A;  1CLB A;  1RRO A;  1UUS A;  1QS7 A;  1AUI B;  1T14 A;  2CBL A;  4GGF A;  1SRA A;  3IQO A;  2L5X B;  5CSF A;  1KQV A;  2HET A;  3CZ2 A;  1WY9 A;  4DCK A;  3NSK A;  3BOW A;  3GOF A;  1CFD A;  4N1F A;  2HPS A;  1NX1 A;  2GGM A;  3BUN B;  3S0B A;  1LIN A;  1XO5 A;  1NX3 A;  2KAV A;  1K9K A;  1P28 A;  4MZL A;  2LMT A;  2PMY A;  2HQW A;  3LK1 A;  3WHU B;  1B9A A;  1S36 A;  1IH0 A;  1RFJ A;  1J7R A;  3JTD C;  3LL8 B;  4MN0 A;  2I2R E;  1G4Y R;  4INW A;  1ZOT B;  2JRF A;  3FS7 A;  2M29 A;  2OTG C;  1QJT A;  1G8I A;  1QVI Z;  1S5G Z;  3EVV A;  3TS5 C;  1GJY A;  1QWV A;  1DJW A;  3H4S E;  2M7L A;  1PSB A;  2QEO A;  1QV0 A;  1M39 A;  5G08 A;  3HX4 A;  5AAN A;  1DEK A;  1YX7 A;  2KI4 C;  3LLE A;  4JKT A;  1F4Q A;  2I94 A;  4KYN A;  4MZK A;  3OBV A;  1MUX A;  1SL8 A;  2JT3 A;  1K2H A;  1BT6 A;  2LUC A;  2P70 A;  1AP4 A;  3BUX B;  4MLW A;  3CWG A;  1AJ4 A;  1OZS A;  3SS4 A;  1H8B A;  4MZJ A;  1DVI A;  4GNK B;  2ZRS A;  2ZFD A;  3CS1 A;  1DT7 B;  3K21 A;  1KFU S;  2KYF A;  1X02 A;  2BBN A;  2NXQ A;  5I8N A;  1TRF A;  2WC5 A;  1UHK A;  1TUZ A;  2QPT A;  3O78 A;  3CZ0 A;  2JTT A;  2LHL A;  1XVJ A;  3I5H B;  2JXL A;  1Z4H A;  3FIA A;  2I7A A;  1KFU L;  5FI7 A;  1R6P A;  4ZCU A;  1Y6W A;  1TCF A;  3EKH A;  2BEC A;  3PSR A;  2L51 A;  5I94 A;  4NQG A;  1V1F A;  3KEV A;  1SNL A;  2D8N A;  5ER5 A;  2R2I A;  1KCY A;  2JPT A;  5TNC A;  5BPJ A;  1J55 A;  3DYE A;  2LLT A;  4CPV A;  3NHI A;  2M7N A;  2K2A A;  1L2O C;  1DJZ A;  1SPY A;  1TN4 A;  2KBI A;  2MAZ A;  5GQQ C;  2HQ8 A;  1IG5 A;  3NSI A;  1OMV A;  4CID A;  1IQ5 A;  4HRG A;  3CAB A;  3D77 A;  4QJ5 B;  5PAL A;  3NSL A;  3SG5 A;  1ZAC A;  2MLF C;  3ZWH A;  3EK4 A;  3DF0 A;  3KF9 A;  1SKT A;  3FWC A;  2I18 A;  1IIO A;  4IL1 A;  1JUO A;  1BR4 B;  1DJI A;  4P2Y B;  1KK7 Y;  5CSI A;  1WDC C;  1CDL A;  2BCB A;  1YX8 A;  1QV1 A;  1B47 A;  1OMD A;  2H61 A;  1SL7 A;  4I5K A;  4C0J A;  3WXA A;  1BOD A;  2KDH A;  3KPX A;  4A4C A;  1A75 A;  2AAO A;  1UUR A;  5HKW A;  2JT8 A;  2TN4 A;  4PCW A;  1M46 A;  1REC A;  2PYQ A;  1BG1 A;  1J7Q A;  1SCM C;  2ERB A;  1DGU A;  2A4J A;  2GGZ A;  5HLO A;  1CMG A;  1Y1X A;  4PE4 A;  3FE8 A;  4GPL B;  2M3W A;  2M49 B;  4HSZ A;  1SBJ A;  3AAJ A;  3HCM A;  1L7Z A;  2BKI B;  1PK0 D;  1YR5 A;  1Z2C B;  2LUX A;  4NDB A;  1CFC A;  4MEW A;  3SG2 A;  3VRO A;  2ZN8 A;  3K1E A;  3IVT A;  1OOH A;  1SYM A;  3VRR A;  1TTX A;  1ORG A;  3S0A A;  1PRW A;  1BU3 A;  3OB1 B;  2M9G A;  4PE7 A;  3WNX B;  4CLN A;  1IKU A;  3OGN A;  1LS8 A;  2LVK A;  1N2D A;  1QIV A;  1TOP A;  1Y0V H;  2BBM A;  5D7F A;  1CMF A;  5K89 A;  3E3R A;  1WLZ A;  1A03 A;  5FI2 A;  1C7W A;  5DKN A;  4WQ2 A;  2MJW B;  3NGV A;  4MRY A;  2KBM A;  3PAT A;  1YRT B;  3Q8I A;  3PFV A;  3CDN A;  5DKQ A;  5KTY A;  2Q4U A;  1NX2 A;  4ICB A;  4AQI A;  1A75 B;  1OW4 A;  5EL2 A;  5HKY A;  1WLM A;  2KQ6 A;  3M0W A;  4MSP A;  1TNP A;  3JTD B;  3I5F B;  5DKR A;  4MRX A;  5D69 A;  2K7O A;  1AHR A;  1AK8 A;  1XK4 C;  2LNK A;  1C3Z A;  1K95 A;  2COL B;  2H2K A;  2OPO A;  1GGW A;  1J1D A;  1S26 D;  2LLS A;  4YGC B;  4UPG A;  2JXC A;  1QXP A;  3PN7 B;  2P71 A;  2F8P A;  1DF0 B;  2KFH A;  1OE9 B;  3I5G B;  4TNC A;  4PHN A;  2K2F A;  1BF5 A;  4PAL A;  1OOF A;  3DY9 A;  2ZRT A;  3QME A;  1NX0 A;  2V53 A;  2K61 A;  5D3O A;  4OZD A;  3DD4 A;  2PAS A;  3RZS A;  3FE6 A;  2M0R A;  2B1U A;  2H8V A;  2PVB A;  1KWO C;  2L4H A;  1NP8 A;  2MHH A;  2K8M B;  4XJK A;  4OVN F;  4YGE B;  4OV2 A;  3D78 A;  1JSA A;  1QX5 B;  2M8U A;  1UHJ A;  1FPW A;  2MRD A;  1XFX O;  3BUM B;  1KQM B;  2BL0 C;  4C0L A;  2WC8 A;  1BOC A;  4IJ7 A;  2L98 A;  4YI9 A;  3D74 A;  1KFX S;  3CTN A;  2KI6 C;  2O5G A;  1CLL A;  1YUT A;  4P5O E;  1XK4 A;  2ISD A;  3R72 A;  1K90 D;  5I2O A;  1EXR A;  1G33 A;  1L2O B;  2F2O A;  2KFG A;  3AKA A;  3FE9 A;  1KFX L;  2WC6 A;  3SS3 A;  2KAY A;  2OS8 B;  2KPH A;  4GGF C;  3TDZ A;  1NCX A;  2JQ6 A;  4OCI A;  1NYA A;  3O2P A;  3D76 A;  3PAL A;  1EG3 A;  2G2B A;  2JZI A;  2LLU A;  1OOJ A;  2RGI A;  2JUL A;  2MLE C;  1M45 A;  2CTN A;  2K7D A;  1PSR A;  1XFR A;  3EK7 A;  3EVU A;  3TS5 B;  1QTX A;  4YRU A;  2KGB C;  1KWO B;  3S0F A;  1MF8 B;  4N1G A;  1MR8 A;  1LVC D;  4JQ0 D;  2PAL A;  4M2P A;  2QAC A;  3O6B A;  1AVS A;  4YGD B;  1DJH A;  1DC1 A;  4ORA B;  3AAK A;  3C1V A;  1W9Z A;  3SJS A;  2F2P A;  2LC5 A;  5FI6 A;  3VRP A;  1CLM A;  1IJ6 A;  3I5G C;  3NSO A;  1IRJ A;  4YGA A;  2YGU A;  1QX2 A;  2Y4Q A;  1CDN A;  2K60 A;  3QRX A;  4JPZ B;  5CPV A;  1JC2 A;  2L50 A;  4WRI A;  2KLE A;  1RTP 1;  3BFB A;  3TDU A;  4QJ3 B;  3PLF B;  3R1P A;  2EC6 B;  3ZNI A;  3V2L A;  2LHI A;  3D10 A;  1BLQ A;  1QVI Y;  2LVV A;  2F3Y A;  3SS5 A;  3CLN A;  1OSA A;  1Y1U A;  1FI5 A;  4XYN A;  1VRK A;  2BAP A;  2QDI A;  2WCK A;  2P6B B;  4GAO A;  1AJ5 A;  2JNF A;  1S5G Y;  4Q04 A;  1ZMZ A;  1B4C A;  1HT9 A;  1OZO A;  2KQY A;  4JD9 A;  1IWQ A;  2KAX A;  2VRG A;  1UP5 A;  1FBV A;  5AEQ A;  1B8L A;  3CGA A;  3OP0 A;  2G9B A;  2NCP A;  1GQM A;  1YRU B;  1B7T Y;  1OOI X;  1K9P A;  2JTZ A;  2LCP A;  1OMR A;  3LCP C;  4DRW A;  1J1E A;  5I2L A;  2ZNE A;  2WCF A;  4N5X A;  2LP3 A;  2L2C A;  1CFP A;  2BKH B;  2BE4 A;  2K7B A;  3F45 A;  4F0Z B;  1GGZ A;  2EC6 C;  5B8I B;  2FJU B;  1OOG A;  3I5I B;  1UHH A;  4FTG A;  1DMO A;  3O4Y A;  1DJX A;  2HF5 A;  1MHO A;  3CR2 A;  1XFU O;  1BR1 B;  2CXJ A;  1N0Y A;  1OQP A;  1WDC B;  5HYD A;  4U8D A;  1ZFS A;  2JOJ A;  4ORB B;  1CM4 A;  2EHB A;  2QEH A;  1MQ1 A;  2FOT A;  3PM2 A;  2QEV A;  1CDM A;  2FCE A;  1WRL A;  1CDP A;  2LMV A;  2LMU A;  3BFA A;  2L2E A;  2LM5 A;  3EKJ A;  3IF7 A;  1DGV A;  3I5I C;  3JVT C;  4C0K A;  2WOS A;  3BUW B;  5JOL A;  1XA5 A;  1SSE B;  3DZT A;  3O4X A;  1ODB A;  1V1G A;  1LA3 A;  1PAL A;  3L4A A;  3OX5 A;  1DEL A;  4PE1 A;  2JT0 A;  3PJI A;  3PN7 C;  3AKB A;  2KYC A;  1YVH A;  2GTE A;  2DOQ A;  3S0E A;  4PE0 A;  3EG5 B;  1KSO A;  2WCH A;  1F8H A;  2WCE A;  3TDI A;  1S1E A;  2BNX A;  3FWB A;  5HLV A;  4F7F A;  1W7I B;  2KI4 B;  1JFJ A;  2OS8 C;  1C3Y A;  1PVA A;  4YGB B;  1YUS A;  2JWW A;  2KHN A;  3VRQ A;  4CFQ A;  1MXE A;  2WCL A;  1JF2 A;  5ER4 X;  3IQQ A;  2EGD A;  2LV7 A;  2JC2 A;  1KQM C;  1NPQ A;  2BL0 B;  2BCA A;  2PRU A;  2QEB A;  1RWY A;  2NZ0 A;  4QJ4 B;  4HRE E;  1TIZ A;  3GK1 A;  2CNP A;  3NHT A;  4AOM A;  1D1O A;  3BOW B;  1K94 A;  2L4I A;  2K7C A;  3SG3 A;  3BYA A;  2MA2 A;  1Q80 A;  3KHE A;  4HRH A;  4BY4 A;  3I5H C;  3ICB A;  1PVB A;  1NUB A;  1SMG A;  3D73 A;  1RK9 A; 
#chains in the Genus database with same CATH homology
 2SCP A;  2LP2 A;  1TNQ A;  1U5I A;  1XYD A;  1K9U A;  1C7V A;  2CT9 A;  1EL4 A;  1A29 A;  4I5J A;  4DUQ A;  2LAP A;  2F33 A;  1CFF A;  5AER A;  2E6W A;  4I5N B;  1K93 D;  1BMO A;  1JFK A;  1EJ3 A;  1NCY A;  2ZND A;  3DVE A;  5CSN A;  2BCX A;  1F4O A;  2NLN A;  1ALW A;  1QIW A;  2WOR A;  3DVJ A;  3DVM A;  1KK7 Z;  4YI8 A;  1XFW O;  3CZT X;  4D1E A;  1S6C A;  3WHT B;  4JWQ A;  1SL9 A;  1FF1 A;  1SK6 D;  1NWD A;  1J7O A;  3BXK A;  5FYX A;  2M1U A;  1CKK A;  1LKJ A;  1JF0 A;  1UHI A;  2Y5I A;  1QLS A;  3KO0 A;  1CM1 A;  2IS9 A;  3SIA A;  4GUK A;  1XFY O;  1WRZ A;  2H61 C;  1YUR A;  4GGN A;  2O60 A;  3OB2 B;  3I5F C;  1S6J A;  2Q91 A;  2M97 A;  2E30 A;  1R2U A;  3RM1 A;  2KI6 D;  4A4B A;  4MVF A;  1SY9 A;  1U5I B;  1H4B A;  2JU0 A;  1KK8 B;  1EG4 A;  2LE9 B;  4ZCV A;  1FI6 A;  4I5L B;  1S6I A;  3LK0 A;  2ZN9 A;  5KU1 A;  1XFZ O;  5AFP A;  1W7J B;  4PHM A;  5JJG A;  3CR5 X;  4PHJ A;  1IJ5 A;  5HKZ A;  3GK2 A;  3GK4 X;  4DS7 A;  2AMI A;  4FQO A;  3SG7 A;  2OTG B;  4DIR A;  1SR6 C;  3EK8 A;  2GV5 A;  1IQ3 A;  3DF0 B;  2ZKM X;  1B8R A;  2FCD A;  1XFV O;  2JNX A;  1TNX A;  4GBA A;  3BUO B;  1K8U A;  1KK8 C;  1F55 A;  2KNE A;  1J7P A;  1IGV A;  2K0J A;  4BY5 A;  4R1E A;  3TUY C;  4OKH A;  4USL A;  1JBA A;  4PHK A;  1EH2 A;  1KSM A;  3D0Y B;  3SIB A;  4NDC A;  1N65 A;  1K96 A;  1BJF A;  2WCB A;  5CSJ A;  2AUC A;  4PDZ A;  3TZ1 A;  3CR4 X;  2KGR A;  1CNP A;  1S3P A;  1MXL C;  1RJV A;  1C07 A;  3DVK A;  1B1G A;  1M31 A;  3A4U B;  4L9M A;  1DF0 A;  1NSH A;  1LXF C;  1WRK A;  2LAN A;  5I2Q A;  1F71 A;  2PSR A;  4GFT A;  3EVR A;  1QAS A;  4E68 A;  2CCM A;  1SCV A;  1CTR A;  1B7T Z;  4M2Q A;  1UHN A;  1A2X A;  5KSZ A;  3OX6 A;  1SR6 B;  3BQ3 A;  4XJK B;  1QX7 A;  1QAT A;  1TCO B;  2KSP A;  1DJY A;  1JWD A;  2Y1M A;  3TUY B;  2MBX A;  4WQ3 A;  1NIW A;  4CFR A;  1B8C A;  4M2O A;  3NXA A;  5J3X A;  1UWO A;  1CB1 A;  2WND A;  4MBE A;  4NDD A;  4AQJ A;  2SAS A;  1E8A A;  4YBH B;  1PUL A;  2NCO A;  4OR9 B;  1A4P A;  2M1K B;  1Y1A A;  3D0Y A;  2LVI A;  5IBW A;  1ZUZ A;  1NCZ A;  1SCM B;  2F3Z A;  1DJG A;  1DTL A;  3VGO A;  1TNW A;  3PM8 A;  3A8R A;  1F70 A;  1SW8 A;  4ETO A;  1F54 A;  3MSE B;  2L0P A;  5F6T A;  2BE6 A;  3OHM B;  1HQV A;  1YUU A;  3SG6 A;  1FW4 A;  1M63 B;  1MWN A;  4ORC B;  1YVL A;  3JVT B;  3VRN A;  3SG4 A;  2LVJ A;  2KFF A;  1LA0 A;  2Y1N A;  1QLK A;  5AXI A;  3RLZ A;  1ALV A;  1YTZ C;  2KOT A;  1CLB A;  1RRO A;  1UUS A;  1QS7 A;  1AUI B;  2CBL A;  4GGF A;  1SRA A;  3IQO A;  2L5X B;  5CSF A;  1KQV A;  2HET A;  1WY9 A;  4DCK A;  3NSK A;  3BOW A;  3GOF A;  1CFD A;  4N1F A;  2HPS A;  1NX1 A;  2GGM A;  3BUN B;  1LIN A;  1XO5 A;  1NX3 A;  2KAV A;  1K9K A;  4MZL A;  2LMT A;  2PMY A;  2HQW A;  3LK1 A;  3WHU B;  1B9A A;  1S36 A;  1IH0 A;  1RFJ A;  1J7R A;  3JTD C;  3LL8 B;  4MN0 A;  2I2R E;  1G4Y R;  1ZOT B;  2JRF A;  3FS7 A;  2M29 A;  2OTG C;  1QJT A;  1G8I A;  1QVI Z;  1S5G Z;  3EVV A;  3TS5 C;  1GJY A;  1DJW A;  3H4S E;  2M7L A;  1PSB A;  1QV0 A;  1M39 A;  5G08 A;  3HX4 A;  5AAN A;  1YX7 A;  2KI4 C;  3LLE A;  1F4Q A;  2I94 A;  4MZK A;  1MUX A;  1SL8 A;  2JT3 A;  1K2H A;  1BT6 A;  2LUC A;  1AP4 A;  3BUX B;  4MLW A;  3CWG A;  1AJ4 A;  1OZS A;  1H8B A;  4MZJ A;  1DVI A;  4GNK B;  2ZRS A;  2ZFD A;  3CS1 A;  1DT7 B;  3K21 A;  1KFU S;  2KYF A;  1X02 A;  2BBN A;  2NXQ A;  5I8N A;  1TRF A;  1UHK A;  2QPT A;  3O78 A;  2JTT A;  2LHL A;  1XVJ A;  3I5H B;  2JXL A;  3FIA A;  2I7A A;  1KFU L;  4ZCU A;  1R6P A;  1Y6W A;  1TCF A;  3EKH A;  2BEC A;  3PSR A;  2L51 A;  4NQG A;  1V1F A;  3KEV A;  1SNL A;  2D8N A;  5ER5 A;  2R2I A;  1KCY A;  2JPT A;  5TNC A;  5BPJ A;  1J55 A;  4CPV A;  2LLT A;  2M7N A;  2K2A A;  1L2O C;  1DJZ A;  1SPY A;  1TN4 A;  2KBI A;  2MAZ A;  5GQQ C;  2HQ8 A;  1IG5 A;  3NSI A;  1OMV A;  4CID A;  1IQ5 A;  4HRG A;  4QJ5 B;  5PAL A;  3NSL A;  3SG5 A;  1ZAC A;  2MLF C;  3ZWH A;  3EK4 A;  3DF0 A;  3KF9 A;  1SKT A;  3FWC A;  2I18 A;  4IL1 A;  1JUO A;  1BR4 B;  1DJI A;  4P2Y B;  1KK7 Y;  5CSI A;  1WDC C;  2H61 A;  2BCB A;  1YX8 A;  1CDL A;  1QV1 A;  1B47 A;  1OMD A;  1SL7 A;  4I5K A;  4C0J A;  3WXA A;  1BOD A;  2KDH A;  3KPX A;  4A4C A;  1A75 A;  2AAO A;  1UUR A;  5HKW A;  2JT8 A;  2TN4 A;  4PCW A;  1M46 A;  1REC A;  1BG1 A;  1J7Q A;  1SCM C;  2GGZ A;  1DGU A;  2A4J A;  5HLO A;  1CMG A;  1Y1X A;  4PE4 A;  4GPL B;  2M3W A;  2M49 B;  4HSZ A;  1SBJ A;  3AAJ A;  3HCM A;  1L7Z A;  2BKI B;  1PK0 D;  1YR5 A;  2LUX A;  4NDB A;  1CFC A;  4MEW A;  3SG2 A;  3VRO A;  2ZN8 A;  1SYM A;  3VRR A;  1TTX A;  1PRW A;  1BU3 A;  3OB1 B;  2M9G A;  4PE7 A;  3WNX B;  4CLN A;  1IKU A;  2LVK A;  1N2D A;  1QIV A;  1TOP A;  1Y0V H;  2BBM A;  5D7F A;  1CMF A;  5K89 A;  3E3R A;  1WLZ A;  1A03 A;  1C7W A;  5DKN A;  4WQ2 A;  2MJW B;  4MRY A;  2KBM A;  3PAT A;  1YRT B;  3PFV A;  5DKQ A;  5KTY A;  2Q4U A;  1NX2 A;  4ICB A;  4AQI A;  1A75 B;  5HKY A;  1WLM A;  2KQ6 A;  3M0W A;  4MSP A;  1TNP A;  3JTD B;  3I5F B;  5DKR A;  4MRX A;  5D69 A;  2K7O A;  1AHR A;  1AK8 A;  1XK4 C;  2LNK A;  1K95 A;  2COL B;  2H2K A;  2OPO A;  1GGW A;  1J1D A;  1S26 D;  2LLS A;  4YGC B;  4UPG A;  2JXC A;  1QXP A;  3PN7 B;  2F8P A;  1DF0 B;  2KFH A;  1OE9 B;  3I5G B;  4TNC A;  4PHN A;  2K2F A;  1BF5 A;  4PAL A;  2ZRT A;  1NX0 A;  2V53 A;  2K61 A;  3DD4 A;  2PAS A;  2M0R A;  2B1U A;  2PVB A;  1KWO C;  2L4H A;  1NP8 A;  2MHH A;  2K8M B;  4XJK A;  4OVN F;  4YGE B;  4OV2 A;  1JSA A;  1QX5 B;  2M8U A;  1UHJ A;  1FPW A;  2MRD A;  1XFX O;  3BUM B;  1KQM B;  2BL0 C;  4C0L A;  2WC8 A;  1BOC A;  2L98 A;  4YI9 A;  1KFX S;  3CTN A;  2KI6 C;  2O5G A;  1CLL A;  1YUT A;  4P5O E;  1XK4 A;  2ISD A;  1K90 D;  5I2O A;  1EXR A;  1G33 A;  1L2O B;  2F2O A;  2KFG A;  3AKA A;  1KFX L;  2KAY A;  2OS8 B;  4GGF C;  3TDZ A;  1NCX A;  2JQ6 A;  4OCI A;  1NYA A;  3O2P A;  3PAL A;  1EG3 A;  2G2B A;  2JZI A;  2LLU A;  1OOJ A;  2RGI A;  2JUL A;  2MLE C;  1M45 A;  2CTN A;  2K7D A;  1PSR A;  3EK7 A;  3EVU A;  3TS5 B;  1QTX A;  4YRU A;  2KGB C;  1KWO B;  1MF8 B;  4N1G A;  1MR8 A;  1LVC D;  4JQ0 D;  2PAL A;  4M2P A;  2QAC A;  3O6B A;  1AVS A;  4YGD B;  1DJH A;  4ORA B;  3AAK A;  3C1V A;  3SJS A;  2F2P A;  2LC5 A;  3VRP A;  1CLM A;  1IJ6 A;  3I5G C;  3NSO A;  1IRJ A;  4YGA A;  1QX2 A;  2Y4Q A;  1CDN A;  3QRX A;  4JPZ B;  5CPV A;  1JC2 A;  2L50 A;  4WRI A;  1RTP 1;  3TDU A;  4QJ3 B;  3PLF B;  2EC6 B;  3ZNI A;  1BLQ A;  2LHI A;  3D10 A;  1QVI Y;  2LVV A;  2F3Y A;  3CLN A;  1OSA A;  1Y1U A;  1FI5 A;  4XYN A;  1VRK A;  4GAO A;  2P6B B;  1AJ5 A;  2JNF A;  1S5G Y;  4Q04 A;  1ZMZ A;  1B4C A;  1HT9 A;  1OZO A;  2KQY A;  1IWQ A;  2KAX A;  2VRG A;  1UP5 A;  1FBV A;  5AEQ A;  1B8L A;  3CGA A;  3OP0 A;  2G9B A;  2NCP A;  1GQM A;  1YRU B;  1B7T Y;  1K9P A;  2JTZ A;  2LCP A;  1OMR A;  3LCP C;  4DRW A;  1J1E A;  5I2L A;  2ZNE A;  2WCF A;  4N5X A;  2LP3 A;  1CFP A;  2BKH B;  2BE4 A;  2K7B A;  3F45 A;  4F0Z B;  1GGZ A;  2EC6 C;  5B8I B;  2FJU B;  3I5I B;  1UHH A;  4FTG A;  1DMO A;  3O4Y A;  1DJX A;  2HF5 A;  1MHO A;  3CR2 A;  1XFU O;  1BR1 B;  2CXJ A;  1N0Y A;  1OQP A;  1WDC B;  5HYD A;  4U8D A;  1ZFS A;  2JOJ A;  4ORB B;  1CM4 A;  2EHB A;  1MQ1 A;  2FOT A;  1CDM A;  2FCE A;  1WRL A;  1CDP A;  2LMV A;  2LMU A;  2L2E A;  2LM5 A;  3EKJ A;  3IF7 A;  1DGV A;  3I5I C;  3JVT C;  4C0K A;  2WOS A;  3BUW B;  5JOL A;  1XA5 A;  1ODB A;  1V1G A;  1LA3 A;  1PAL A;  3OX5 A;  4PE1 A;  2JT0 A;  3PN7 C;  3AKB A;  2KYC A;  1YVH A;  2DOQ A;  4PE0 A;  1KSO A;  1F8H A;  2WCE A;  3TDI A;  1S1E A;  5HLV A;  3FWB A;  1W7I B;  2KI4 B;  1JFJ A;  2OS8 C;  1PVA A;  4YGB B;  1YUS A;  2JWW A;  2KHN A;  3VRQ A;  4CFQ A;  1MXE A;  1JF2 A;  5ER4 X;  3IQQ A;  2EGD A;  2LV7 A;  2JC2 A;  1KQM C;  1NPQ A;  2BL0 B;  2BCA A;  2PRU A;  4QJ4 B;  1RWY A;  2NZ0 A;  4HRE E;  1TIZ A;  3GK1 A;  2CNP A;  4AOM A;  1D1O A;  3BOW B;  1K94 A;  2L4I A;  2K7C A;  3SG3 A;  3BYA A;  2MA2 A;  1Q80 A;  3KHE A;  4HRH A;  4BY4 A;  3I5H C;  3ICB A;  1PVB A;  1NUB A;  1SMG A;  1RK9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...