2M0RA

Solution structure and dynamics of human s100a14
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
104
structure length
104
Chain Sequence
MGQCRSANAEDAQEFSDVERAIETLIKNFHQYSVEGGKETLTPSELRDLVTQQLPHLMPSNCGLEEKIANLGSCNDSKLEFRSFWELIGEAAKSVKLERPVRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-A14
publication title Solution structure and dynamics of human S100A14.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 23
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2m0rA00
4ORBB 3SG5A 2KYCA 2LLTA 2CTNA 1WRKA 2O5GA 2PSRA 3TDUA 3PLFB 4GAOA 1MXLC 1QX7A 1FI5A 5ER5A 1V1GA 4I5LB 4CIDA 1BF5A 2ZFDA 2KGBC 1LXFC 1B47A 1CLMA 1RK9A 1QATA 2JT3A 3KPXA 4WRIA 2K7CA 1QV0A 3BUMB 3I5IB 2G2BA 5TNCA 2TN4A 2LVKA 3O2PA 2COLB 1SL7A 4MSPA 2NLNA 4N1FA 2JWWA 1XFUO 2GGMA 2ZKMX 2MRDA 4GPLB 4GBAA 1F8HA 1KQVA 4PHJA 4C0JA 1F71A 4I5KA 2E6WA 4AOMA 1XK4A 1KCYA 1J55A 4AQIA 1KFUL 4CPVA 4MZKA 1NX2A 1SRAA 1OOJA 5I2OA 2F3YA 2EGDA 4OR9B 3BOWA 2LVJA 3CGAA 1YUTA 4GGFC 1KK8C 1EL4A 2NXQA 4HRGA 2M9GA 2H61A 4BY5A 1KQMC 1B8LA 4A4CA 3HCMA 4DIRA 1CKKA 3EK7A 2M7LA 5I2QA 1JC2A 1DF0A 1WY9A 3I5GB 3JVTC 2LHIA 2V53A 3PSRA 1KFXL 1SL9A 1UHNA 1YRTB 3FWBA 2M97A 3EKHA 1UHHA 3AKAA 2ZRSA 3OB2B 1A75B 1CFFA 2LHLA 5DKNA 1E8AA 2BL0C 1K9KA 2NCPA 2WCBA 1C07A 1B1GA 1SYMA 1CDPA 4XYNA 2F8PA 1LINA 1EH2A 1JWDA 3WNXB 3NSOA 1UURA 5CSJA 2L5XB 2Y4QA 2MAZA 3TS5C 1BOCA 2F2OA 4YGDB 3DVJA 2CBLA 1XFYO 3SG4A 1AJ5A 1G33A 2G9BA 2LUCA 3BYAA 3D0YA 4AQJA 3GK1A 1IQ5A 4NDCA 3HX4A 5HYDA 2PASA 3I5HB 4MN0A 4M2PA 3PN7C 2JZIA 3OX6A 4NQGA 4C0KA 1M31A 2KDHA 2BE4A 4PE0A 2M1KB 1IRJA 1DGUA 1JF2A 2FCDA 1KK7Y 1SL8A 1L7ZA 1OSAA 1S1EA 1SNLA 2KNEA 3WXAA 1TN4A 3EK8A 1BR1B 4MEWA 1NP8A 3EVVA 1XFVO 2Q91A 1XA5A 1KQMB 4QJ4B 4IL1A 1H4BA 5F6TA 1HQVA 1SK6D 1M63B 4N1GA 3EVRA 4XJKB 4P2YB 1AUIB 1OQPA 3BQ3A 1MR8A 1XFZO 2LNKA 4CFRA 4UPGA 1IKUA 3CTNA 1BU3A 2I2RE 2JC2A 2JPTA 2LLSA 4MZJA 1QLKA 5HKZA 2BCBA 1A29A 1PRWA 2PVBA 2L50A 2BBNA 2K7DA 2WNDA 2ZN8A 5HLOA 1EG4A 4ETOA 1AK8A 4MVFA 1DMOA 1Y0VH 3IQQA 1JUOA 2HQWA 1OMDA 2VRGA 3JTDB 1C7VA 4D1EA 1V1FA 1VRKA 4HRHA 2KYFA 2K7OA 5K89A 3TS5B 3O6BA 4PE7A 3F45A 2L51A 4PE4A 2QPTA 4FTGA 2FJUB 2MJWB 1XVJA 4YGAA 1BODA 3WHUB 1CB1A 1FPWA 3TZ1A 1EJ3A 4TNCA 3SIAA 1SW8A 2PMYA 3I5GC 2L0PA 4ZCUA 1MF8B 1QIWA 3PN7B 5J3XA 5AXIA 3DVMA 4WQ2A 1G4YR 3BUWB 2BE6A 2WCFA 3LK0A 1TCFA 2K8MB 1CNPA 1B9AA 1J7PA 1DVIA 2JRFA 1ZOTB 2Q4UA 2WORA 1PSRA 2JTZA 3K21A 3OX5A 1B7TY 3PALA 5DKRA 2JOJA 2LP3A 4F0ZB 4PHKA 2JXLA 1K93D 3TUYC 4P5OE 3NSKA 2E30A 3NXAA 4I5JA 4CFQA 4NDDA 2JXCA 1S26D 1B8CA 1S5GZ 3CR4X 4OVNF 2H61C 3I5HC 1SMGA 1FBVA 1Q80A 3PM8A 2NZ0A 3VGOA 1RECA 3ZWHA 4HREE 4M2OA 1YVLA 1IG5A 3KEVA 3TDZA 4DS7A 4R1EA 1NPQA 3EKJA 1MUXA 1HT9A 1R6PA 1CM1A 2L4IA 1X02A 1KWOB 4MLWA 1F54A 2KFHA 1OZOA 2ZNDA 4MRYA 2KAXA 1Y1XA 2NCOA 2BKIB 1J7RA 2P6BB 1UP5A 1LVCD 1TNQA 1L2OB 1QVIY 1U5IA 2M7NA 2LVIA 1TTXA 1GGWA 2MA2A 1NSHA 1A03A 1DJZA 1XFXO 1UWOA 3JTDC 3KHEA 5PALA 3CS1A 1MQ1A 1PK0D 3SJSA 1LKJA 3TUYB 3SG7A 1OE9B 1S36A 3AAJA 1TOPA 4CLNA 1AVSA 4GGFA 1TIZA 3QRXA 1NX0A 3BOWB 5CSNA 5KSZA 3DF0A 1SKTA 2FOTA 1IH0A 1WRLA 1K96A 3ICBA 1S6JA 1QX5B 1NCYA 3VRNA 1RWYA 1CDLA 3DVKA 3CZTX 2CT9A 2I94A 1G8IA 2JT8A 4QJ3B 1F70A 1DF0B 4U8DA 1CMGA 1XO5A 4ORCB 4MBEA 1SCVA 4PCWA 1SR6C 2KFFA 2JT0A 2L98A 1CLLA 2KSPA 1PVAA 1DJHA 3PFVA 2LVVA 1ODBA 2KFGA 1M45A 2O60A 2PRUA 1SY9A 5DKQA 5ER4X 2MLFC 4ZCVA 2KI6D 1BR4B 3BUNB 2MBXA 3VRQA 2CCMA 1ALWA 3LL8B 3RM1A 4GNKB 3AKBA 2LLUA 3VRPA 4OCIA 3IF7A 1IWQA 5B8IB 2LMTA 1WRZA 2KQYA 1J1EA 2OPOA 2Y1MA 5FYXA 3KO0A 1AHRA 2GV5A 5D69A 1QJTA 1MHOA 2LANA 3D0YB 1Y1UA 1K90D 1BMOA 1KK7Z 1QX2A 2KGRA 4GGNA 4L9MA 2LAPA 1QLSA 1UHKA 2BKHB 1DTLA 2JTTA 1QASA 1ZFSA 2B1UA 4JWQA 2I18A 2IS9A 1K2HA 3CR5X 3I5FB 1N2DA 1KWOC 4HSZA 2KI4C 1JBAA 2BCXA 2OS8B 3CWGA 1W7IB 4OV2A 1UHIA 4Q04A 3NSLA 3SG6A 1AJ4A 4C0LA 2WCEA 2Y1NA 3GK4X 1RJVA 1L2OC 2KOTA 2SASA 2K2FA 1KFUS 4PHNA 1RFJA 5IBWA 2KBMA 1SR6B 5BPJA 4PDZA 1K9PA 2BECA 4YBHB 4BY4A 1UHJA 3M0WA 3LK1A 1NWDA 1BG1A 3CLNA 1XK4C 2KQ6A 1CDMA 1SBJA 2ZN9A 3DVEA 4DCKA 1NIWA 3BUXB 4YI9A 1C7WA 1GGZA 1EG3A 2F33A 1BJFA 1ZMZA 1OMRA 2JQ6A 1OMVA 3GOFA 4PE1A 3FWCA 4MRXA 1LA0A 1MXEA 1XFWO 1BT6A 1KFXS 5AFPA 3D10A 1FI6A 2M49B 2WOSA 1QIVA 1TCOB 2CXJA 2LC5A 3AAKA 1S3PA 1NCZA 3H4SE 1QV1A 5KU1A 1B7TZ 2M8UA 5JJGA 3LCPC 1J7QA 1CMFA 3TDIA 1A75A 2I7AA 1B8RA 2JULA 2M3WA 1W7JB 4N5XA 2KI4B 1YR5A 2JNXA 3NSIA 1M46A 1WLZA 3RLZA 4QJ5B 4ORAB 1NUBA 4E68A 3C1VA 5CSFA 5D7FA 3SG3A 2KHNA 4MZLA 3BUOB 1NCXA 1KSOA 2OTGB 4PALA 1J7OA 2LE9B 2EHBA 3CR2A 4YGEB 2K2AA 2M0RA 1QS7A 2KAVA 1XYDA 1NX1A 5GQQC 1F4OA 1TNXA 1IQ3A 1OZSA 2KI6C 1UUSA 2LP2A 2KBIA 1A2XA 1FF1A 3FIAA 2ZRTA 1K9UA 1B4CA 2F2PA 2Y5IA 4YI8A 5AANA 1WDCC 1CM4A 2LUXA 1YUSA 1PALA 2CNPA 2HPSA 2EC6B 1ZUZA 1LA3A 3MSEB 4YGCB 1NYAA 1CDNA 1SPYA 2AAOA 1DGVA 1J1DA 3SG2A 1CTRA 1BLQA 3I5FC 2BCAA 2ZNEA 4GFTA 1DJWA 2OS8C 4GUKA 2D8NA 1S6CA 1WLMA 5KTYA 4XJKA 1EXRA 1YTZC 1QVIZ 3ZNIA 1JFJA 4ICBA 1TNPA 2R2IA 3VROA 2M29A 4A4BA 1A4PA 1D1OA 1YX7A 1SCMC 1M39A 2K7BA 2LMUA 1YRUB 2PALA 2SCPA 3PATA 1KSMA 1TNWA 1U5IB 1AP4A 4YRUA 3E3RA 4FQOA 2LM5A 1ZACA 1FW4A 2L2EA 2LMVA 2QACA 3EK4A 1F4QA 2H2KA 3A8RA 1YVHA 2LCPA 1GQMA 1PULA 5G08A 3WHTB 3OHMB 3FS7A 3O4YA 1R2UA 1YX8A 3IQOA 1Y1AA 1CLBA 1DJYA 3LLEA 4NDBA 4OKHA 3OB1B 1QTXA 5HKYA 4DRWA 3KF9A 1CFDA 1KK8B 2HETA 4YGBB 3EVUA 3DF0B 2MLEC 4USLA 1DT7B 1N65A 1QXPA 1CFPA 3SIBA 1N0YA 1F55A 1WDCB 5HKWA 3I5IC 1IJ6A 2K61A 2BBMA 3GK2A 4PHMA 3JVTB 1IGVA 1DJGA 2DOQA 2LV7A 2KAYA 1JF0A 2F3ZA 2MHHA 1S6IA 5CSIA 2AUCA 4I5NB 3A4UB 2BL0B 1DJXA 1K94A 2JNFA 2FCEA 2OTGC 1IJ5A 1CFCA 1ALVA 1NX3A 2HQ8A 3DD4A 3O78A 1SCMB 5I8NA 1GJYA 4WQ3A 1RROA 2ISDA 5AEQA 1H8BA 5I2LA 2K0JA 5AERA 1K95A 1DJIA 1MWNA 1Y6WA 3VRRA 1PSBA 2JU0A 5HLVA 2RGIA 1K8UA 2HF5A 1PVBA 2A4JA 2AMIA 1TRFA 4M2QA 2EC6C 3OP0A 4JPZB 1S5GY 2GGZA 1JFKA 2L4HA 2M1UA 1RTP1 3BXKA 1YUUA 5JOLA 4DUQA 2WC8A 4JQ0D 5CPVA 1JSAA 1YURA
chains in the Genus database with same CATH superfamily
4ORBB 2WCMA 3SG5A 2KYCA 2LLTA 2CTNA 4OZDA 1WRKA 3D77A 2O5GA 2PSRA 3TDUA 3PLFB 4GAOA 1MXLC 1QX7A 2ERBA 1FI5A 5ER5A 1V1GA 4I5LB 4CIDA 1BF5A 2ZFDA 3K1EA 2KGBC 1LXFC 1B47A 1CLMA 1RK9A 1QATA 2JT3A 3B7AA 3KPXA 4WRIA 2K7CA 1QV0A 3BUMB 3I5IB 2G2BA 5TNCA 2TN4A 2LVKA 3O2PA 2COLB 1ORGA 1SL7A 2NLNA 4JKTA 4MSPA 1QWVA 4N1FA 2JWWA 1XFUO 2GGMA 2ZKMX 2MRDA 4GPLB 4GBAA 1F8HA 1KQVA 4PHJA 2PYQA 4C0JA 4I5KA 1F71A 2E6WA 4AOMA 1XK4A 1KCYA 1J55A 5EL2A 4AQIA 1KFUL 4CPVA 4MZKA 1NX2A 1SRAA 1OOJA 5I2OA 2F3YA 2EGDA 4OR9B 5FI7A 3BOWA 2LVJA 3CGAA 1YUTA 3N7HA 4GGFC 1C3YA 1KK8C 2WCKA 1EL4A 2NXQA 4HRGA 2M9GA 2H61A 4BY5A 1KQMC 1B8LA 4A4CA 3HCMA 4DIRA 2KPHA 1CKKA 3EK7A 2M7LA 5I2QA 1JC2A 3BFBA 1DF0A 1WY9A 3I5GB 3JVTC 2LHIA 2V53A 3PSRA 1KFXL 1SL9A 1UHNA 1YRTB 3FWBA 2M97A 3IVTA 3EKHA 3R1OA 1UHHA 3AKAA 2ZRSA 3OB2B 1A75B 1CFFA 2LHLA 5DKNA 1E8AA 2BL0C 1K9KA 2NCPA 1OOFA 3O4XA 2WCBA 1C07A 1B1GA 1SYMA 1CDPA 4XYNA 2F8PA 1LINA 1EH2A 1JWDA 3WNXB 3NSOA 1UURA 5CSJA 2L5XB 2Y4QA 2MAZA 2KLEA 3TS5C 1BOCA 2F2OA 2L2CA 4YGDB 3DVJA 2CBLA 1XFYO 3SG4A 1AJ5A 1G33A 2G9BA 2LUCA 3S0FA 3BYAA 3D0YA 4AQJA 3GK1A 1IQ5A 4NDCA 3HX4A 5HYDA 2PASA 3I5HB 4MN0A 4M2PA 3PN7C 2JZIA 3OX6A 4NQGA 4C0KA 1M31A 2KDHA 3DXLA 2BE4A 4PE0A 2M1KB 1IRJA 1DGUA 1JF2A 2FCDA 1KK7Y 1SL8A 1L7ZA 1OSAA 1S1EA 1SNLA 2KNEA 3WXAA 1TN4A 3EK8A 1BR1B 4MEWA 1NP8A 3EVVA 1XFVO 2Q91A 2FJYA 1XA5A 1KQMB 4QJ4B 4IL1A 1H4BA 5F6TA 1HQVA 1SK6D 1M63B 4N1GA 3EVRA 4XJKB 3V2LA 4P2YB 1AUIB 1OQPA 3BQ3A 1MR8A 1XFZO 2LNKA 4CFRA 4UPGA 1IKUA 3CTNA 1BU3A 2I2RE 2JC2A 2JPTA 2LLSA 4MZJA 3FE8A 3DZTA 1IIOA 1DELA 1QLKA 1TWOA 5HKZA 2BCBA 1A29A 2WCJA 3S0BA 1PRWA 2PVBA 2L50A 2BBNA 2K7DA 2WNDA 2ZN8A 5HLOA 1EG4A 4ETOA 1AK8A 4FQTA 4MVFA 1DMOA 1Y0VH 3IQQA 1JUOA 2HQWA 1OMDA 2VRGA 2L5YA 3JTDB 1C7VA 4D1EA 1V1FA 1VRKA 4HRHA 2KYFA 2K7OA 5K89A 3TS5B 3O6BA 4PE7A 3F45A 2L51A 4PE4A 2QPTA 4FTGA 2FJUB 2MJWB 1XVJA 4YGAA 2KLDA 3CZ2A 3WHUB 1BODA 1FPWA 3OBVA 3TZ1A 1EJ3A 4TNCA 3SS5A 3SIAA 1SW8A 2PMYA 1OOHA 1W9ZA 3I5GC 4INWA 2L0PA 3R1PA 4ZCUA 1MF8B 1QIWA 3PN7B 5J3XA 5AXIA 3DVMA 4WQ2A 1G4YR 3Q8IA 3BUWB 2BE6A 2WCFA 3LK0A 1TCFA 2K8MB 1CNPA 3SS3A 1B9AA 1J7PA 1DVIA 2JRFA 1ZOTB 2Q4UA 2WORA 3OGNA 1PSRA 2JTZA 3D78A 3K21A 3OX5A 1B7TY 3PALA 5DKRA 2JOJA 2LP3A 4F0ZB 4PHKA 2JXLA 1K93D 3TUYC 4P5OE 3NSKA 2E30A 3NXAA 4I5JA 4CFQA 3CZ0A 2JPOA 4NDDA 3FE9A 2JXCA 1S26D 1B8CA 1S5GZ 3CR4X 1LS8A 2BNXA 4OVNF 2H61C 3I5HC 3B88A 1SMGA 1FBVA 1Z2CB 3NGVA 1Q80A 1T14A 3R72A 3PM8A 2NZ0A 3PJIA 3VGOA 1RECA 3ZWHA 2PQLA 4HREE 1YVLA 4M2OA 1OOGA 1IG5A 3KEVA 3L4AA 3TDZA 4DS7A 4R1EA 1NPQA 3EKJA 1MUXA 1HT9A 1R6PA 1CM1A 2L4IA 1X02A 1KWOB 4MLWA 1F54A 2KFHA 1OZOA 2ZNDA 4MRYA 2KAXA 1Y1XA 2NCOA 2BKIB 1J7RA 2P6BB 1UP5A 1LVCD 1TNQA 1L2OB 1QVIY 1U5IA 2M7NA 2LVIA 1TTXA 1GGWA 2MA2A 2QEOA 1NSHA 1A03A 1DJZA 1XFXO 1UWOA 3JTDC 3KHEA 5PALA 3CS1A 1MQ1A 1PK0D 3SJSA 1LKJA 3TUYB 3SG7A 1OE9B 1S36A 3AAJA 1TOPA 4CLNA 1AVSA 4GGFA 2WC6A 1TIZA 3QRXA 1NX0A 3BOWB 2WC5A 5CSNA 5KSZA 3DF0A 1SKTA 2FOTA 1IH0A 1WRLA 1K96A 3ICBA 1S6JA 1QX5B 1NCYA 3VRNA 1RWYA 1CDLA 3DVKA 3CZTX 2CT9A 2I94A 1G8IA 2JT8A 4QJ3B 1F70A 1DF0B 4U8DA 1CMGA 3RZSA 1XO5A 4ORCB 4MBEA 1SCVA 4PCWA 1SR6C 3CABA 2KFFA 3R1VA 2JT0A 2L98A 1CLLA 2KSPA 1PVAA 3S0AA 1DJHA 3PFVA 2LVVA 1ODBA 2KFGA 1M45A 2O60A 2PRUA 1SY9A 5DKQA 5ER4X 3PM2A 2MLFC 4ZCVA 2KI6D 1BR4B 3BUNB 2MBXA 3VRQA 5D3OA 2CCMA 1ALWA 3LL8B 3RM1A 4GNKB 3AKBA 2LLUA 3VRPA 4OCIA 3CDNA 3IF7A 5DICA 1IWQA 5B8IB 2LMTA 1DQEA 1SSEB 1J1EA 1WRZA 2KQYA 2OPOA 2Y1MA 3D76A 5FYXA 3KO0A 1AHRA 2GV5A 5D69A 1QJTA 1MHOA 2LANA 3D0YB 1Y1UA 1K90D 1BMOA 1KK7Z 1QX2A 2KGRA 4GGNA 4L9MA 2LAPA 1QLSA 1UHKA 2BKHB 1DTLA 2JTTA 1QASA 1ZFSA 2B1UA 4JWQA 2I18A 2IS9A 1K2HA 3EG5B 4KYNA 3CR5X 3I5FB 4JD9A 1N2DA 1KWOC 3S0DA 3CYZA 2KI4C 4HSZA 1JBAA 2BCXA 2OS8B 3CWGA 1W7IB 3D75A 3SS4A 4OV2A 1UHIA 4Q04A 3NSLA 3QMEA 1AJ4A 3SG6A 4C0LA 1P28A 2WCEA 2Y1NA 3GK4X 1RJVA 1L2OC 2KOTA 2SASA 2K2FA 1KFUS 4PHNA 2GTEA 3B6XA 1RFJA 2QEBA 5IBWA 3B86A 2KBMA 1SR6B 5BPJA 4PDZA 1K9PA 2BECA 4YBHB 3VB1A 4BY4A 1UHJA 3M0WA 3LK1A 1NWDA 1BG1A 4INXA 3CLNA 1XK4C 3DYEA 2KQ6A 1CDMA 1SBJA 2ZN9A 3CZ1A 3DVEA 4DCKA 1NIWA 3BUXB 4YI9A 2K60A 1C7WA 1GGZA 1EG3A 2F33A 1BJFA 1ZMZA 1OMRA 2JQ6A 1OMVA 3GOFA 4PE1A 3FWCA 4MRXA 1LA0A 1DEKA 1MXEA 3NHIA 1XFWO 3NHTA 1BT6A 1C3ZA 1KFXS 5AFPA 3D10A 1FI6A 2M49B 2WOSA 1QIVA 1TCOB 2H8VA 2CXJA 2LC5A 3L4LA 3L47A 3AAKA 1S3PA 1NCZA 3H4SE 1QV1A 5KU1A 1B7TZ 2M8UA 5JJGA 3LCPC 1J7QA 1CMFA 3TDIA 1A75A 2I7AA 1B8RA 2JULA 2M3WA 1W7JB 4N5XA 2KI4B 1YR5A 2JNXA 3NSIA 1M46A 1WLZA 2P70A 3RLZA 3UNWA 4QJ5B 4ORAB 1NUBA 4E68A 3C1VA 5CSFA 1XFRA 5D7FA 3SG3A 2KHNA 4MZLA 3BUOB 1NCXA 1KSOA 3S0GA 2OTGB 4PALA 5HL1A 2LE9B 1J7OA 2EHBA 3CR2A 4YGEB 2K2AA 2M0RA 1QS7A 2KAVA 1XYDA 1NX1A 5GQQC 1F4OA 1TNXA 2QDIA 1IQ3A 1CB1A 1OZSA 2KI6C 1UUSA 2LP2A 2QEHA 2KBIA 1A2XA 1FF1A 3FIAA 3S0EA 2ZRTA 1K9UA 3BFAA 1B4CA 2F2PA 2Y5IA 4YI8A 5AANA 1WDCC 1CM4A 2LUXA 1YUSA 1PALA 2CNPA 2HPSA 2EC6B 1ZUZA 1LA3A 3MSEB 4YGCB 1NYAA 1CDNA 1SPYA 2AAOA 1DGVA 1J1DA 4IJ7A 3SG2A 1CTRA 1BLQA 3I5FC 2BCAA 2ZNEA 4GFTA 1GM0A 1DJWA 2OS8C 4GUKA 2D8NA 1S6CA 1WLMA 5KTYA 1Z4HA 4F7FA 4XJKA 1EXRA 1YTZC 1QVIZ 3ZNIA 1JFJA 5FI6A 4ICBA 1TNPA 2R2IA 3VROA 2M29A 4A4BA 1A4PA 3FE6A 1D1OA 1YX7A 1SCMC 1M39A 2K7BA 2LMUA 1YRUB 2PALA 2WCHA 2SCPA 3PATA 1KSMA 1OOIX 1TNWA 2P71A 1U5IB 1AP4A 4YRUA 3E3RA 4FQOA 2LM5A 1ZACA 1FW4A 2L2EA 2LMVA 2QACA 2YGUA 1F4QA 1TUJA 3EK4A 2H2KA 3A8RA 1YVHA 2LCPA 5I94A 1OW4A 1GQMA 1PULA 5G08A 3WHTB 3OHMB 3FS7A 3D74A 3O4YA 1R2UA 1YX8A 2BAPA 1Y1AA 3IQOA 1CLBA 1DJYA 3LLEA 4NDBA 4OKHA 3OB1B 1QTXA 5HKYA 4DRWA 3KF9A 1CFDA 1KK8B 2HETA 4YGBB 3EVUA 3DF0B 2MLEC 3DY9A 4USLA 1DT7B 1N65A 1QXPA 4PT1A 3UO9A 1CFPA 3SIBA 1N0YA 1F55A 1WDCB 5HKWA 3I5IC 1TUZA 1IJ6A 2K61A 2BBMA 3GK2A 4PHMA 3JVTB 1IGVA 1DJGA 2DOQA 5FI2A 2LV7A 2KAYA 1JF0A 2F3ZA 2MHHA 1S6IA 5CSIA 2AUCA 4I5NB 3A4UB 2BL0B 1DJXA 1K94A 2JNFA 2FCEA 2QEVA 2WCLA 2OTGC 1IJ5A 1CFCA 1ALVA 1NX3A 2HQ8A 3DD4A 3O78A 1SCMB 5I8NA 1GJYA 4WQ3A 1RROA 2ISDA 5AEQA 1H8BA 5I2LA 2K0JA 5AERA 1K95A 1DJIA 1MWNA 1Y6WA 3VRRA 1PSBA 3BJHA 2JU0A 5HLVA 3B87A 3BFHA 2RGIA 1K8UA 2HF5A 1PVBA 2A4JA 2AMIA 1TRFA 4M2QA 1DC1A 3D73A 2EC6C 3OP0A 4JPZB 1S5GY 2GGZA 1JFKA 2L4HA 2M1UA 1RTP1 3BXKA 1YUUA 5JOLA 4DUQA 2WC8A 4JQ0D 5CPVA 1JSAA 1YURA
chains in the Genus database with same CATH topology
4ORBB 3SG5A 2KYCA 2LLTA 2CTNA 1WRKA 2O5GA 2PSRA 3TDUA 3PLFB 4GAOA 1MXLC 1QX7A 1FI5A 5ER5A 1V1GA 4I5LB 4CIDA 1BF5A 2ZFDA 2KGBC 1LXFC 1B47A 1CLMA 1RK9A 1QATA 2JT3A 3KPXA 4WRIA 2K7CA 1QV0A 3BUMB 3I5IB 2G2BA 5TNCA 2TN4A 2LVKA 3O2PA 2COLB 1SL7A 4MSPA 2NLNA 4N1FA 2JWWA 1XFUO 2GGMA 2ZKMX 2MRDA 4GPLB 4GBAA 1F8HA 1KQVA 4PHJA 4C0JA 1F71A 4I5KA 2E6WA 4AOMA 1XK4A 1KCYA 1J55A 4AQIA 1KFUL 4CPVA 4MZKA 1NX2A 1SRAA 1OOJA 5I2OA 2F3YA 2EGDA 4OR9B 3BOWA 2LVJA 3CGAA 1YUTA 4GGFC 1KK8C 1EL4A 2NXQA 4HRGA 2M9GA 2H61A 4BY5A 1KQMC 1B8LA 4A4CA 3HCMA 4DIRA 1CKKA 3EK7A 2M7LA 5I2QA 1JC2A 1DF0A 1WY9A 3I5GB 3JVTC 2LHIA 2V53A 3PSRA 1KFXL 1SL9A 1UHNA 1YRTB 3FWBA 2M97A 3EKHA 1UHHA 3AKAA 2ZRSA 3OB2B 1A75B 1CFFA 2LHLA 5DKNA 1E8AA 2BL0C 1K9KA 2NCPA 2WCBA 1C07A 1B1GA 1SYMA 1CDPA 4XYNA 2F8PA 1LINA 1EH2A 1JWDA 3WNXB 3NSOA 1UURA 5CSJA 2L5XB 2Y4QA 2MAZA 3TS5C 1BOCA 2F2OA 4YGDB 3DVJA 2CBLA 1XFYO 3SG4A 1AJ5A 1G33A 2G9BA 2LUCA 3BYAA 3D0YA 4AQJA 3GK1A 1IQ5A 4NDCA 3HX4A 5HYDA 2PASA 3I5HB 4MN0A 4M2PA 3PN7C 2JZIA 3OX6A 4NQGA 4C0KA 1M31A 2KDHA 2BE4A 4PE0A 2M1KB 1IRJA 1DGUA 1JF2A 2FCDA 1KK7Y 1SL8A 1L7ZA 1OSAA 1S1EA 1SNLA 2KNEA 3WXAA 1TN4A 3EK8A 1BR1B 4MEWA 1NP8A 3EVVA 1XFVO 2Q91A 1XA5A 1KQMB 4QJ4B 4IL1A 1H4BA 5F6TA 1HQVA 1SK6D 1M63B 4N1GA 3EVRA 4XJKB 4P2YB 1AUIB 1OQPA 3BQ3A 1MR8A 1XFZO 2LNKA 4CFRA 4UPGA 1IKUA 3CTNA 1BU3A 2I2RE 2JC2A 2JPTA 2LLSA 4MZJA 1QLKA 5HKZA 2BCBA 1A29A 1PRWA 2PVBA 2L50A 2BBNA 2K7DA 2WNDA 2ZN8A 5HLOA 1EG4A 4ETOA 1AK8A 4MVFA 1DMOA 1Y0VH 3IQQA 1JUOA 2HQWA 1OMDA 2VRGA 3JTDB 1C7VA 4D1EA 1V1FA 1VRKA 4HRHA 2KYFA 2K7OA 5K89A 3TS5B 3O6BA 4PE7A 3F45A 2L51A 4PE4A 2QPTA 4FTGA 2FJUB 2MJWB 1XVJA 4YGAA 1BODA 3WHUB 1CB1A 1FPWA 3TZ1A 1EJ3A 4TNCA 3SIAA 1SW8A 2PMYA 3I5GC 2L0PA 4ZCUA 1MF8B 1QIWA 3PN7B 5J3XA 5AXIA 3DVMA 4WQ2A 1G4YR 3BUWB 2BE6A 2WCFA 3LK0A 1TCFA 2K8MB 1CNPA 1B9AA 1J7PA 1DVIA 2JRFA 1ZOTB 2Q4UA 2WORA 1PSRA 2JTZA 3K21A 3OX5A 1B7TY 3PALA 5DKRA 2JOJA 2LP3A 4F0ZB 4PHKA 2JXLA 1K93D 3TUYC 4P5OE 3NSKA 2E30A 3NXAA 4I5JA 4CFQA 4NDDA 2JXCA 1S26D 1B8CA 1S5GZ 3CR4X 4OVNF 2H61C 3I5HC 1SMGA 1FBVA 1Q80A 3PM8A 2NZ0A 3VGOA 1RECA 3ZWHA 4HREE 4M2OA 1YVLA 1IG5A 3KEVA 3TDZA 4DS7A 4R1EA 1NPQA 3EKJA 1MUXA 1HT9A 1R6PA 1CM1A 2L4IA 1X02A 1KWOB 4MLWA 1F54A 2KFHA 1OZOA 2ZNDA 4MRYA 2KAXA 1Y1XA 2NCOA 2BKIB 1J7RA 2P6BB 1UP5A 1LVCD 1TNQA 1L2OB 1QVIY 1U5IA 2M7NA 2LVIA 1TTXA 1GGWA 2MA2A 1NSHA 1A03A 1DJZA 1XFXO 1UWOA 3JTDC 3KHEA 5PALA 3CS1A 1MQ1A 1PK0D 3SJSA 1LKJA 3TUYB 3SG7A 1OE9B 1S36A 3AAJA 1TOPA 4CLNA 1AVSA 4GGFA 1TIZA 3QRXA 1NX0A 3BOWB 5CSNA 5KSZA 3DF0A 1SKTA 2FOTA 1IH0A 1WRLA 1K96A 3ICBA 1S6JA 1QX5B 1NCYA 3VRNA 1RWYA 1CDLA 3DVKA 3CZTX 2CT9A 2I94A 1G8IA 2JT8A 4QJ3B 1F70A 1DF0B 4U8DA 1CMGA 1XO5A 4ORCB 4MBEA 1SCVA 4PCWA 1SR6C 2KFFA 2JT0A 2L98A 1CLLA 2KSPA 1PVAA 1DJHA 3PFVA 2LVVA 1ODBA 2KFGA 1M45A 2O60A 2PRUA 1SY9A 5DKQA 5ER4X 2MLFC 4ZCVA 2KI6D 1BR4B 3BUNB 2MBXA 3VRQA 2CCMA 1ALWA 3LL8B 3RM1A 4GNKB 3AKBA 2LLUA 3VRPA 4OCIA 3IF7A 1IWQA 5B8IB 2LMTA 1WRZA 2KQYA 1J1EA 2OPOA 2Y1MA 5FYXA 3KO0A 1AHRA 2GV5A 5D69A 1QJTA 1MHOA 2LANA 3D0YB 1Y1UA 1K90D 1BMOA 1KK7Z 1QX2A 2KGRA 4GGNA 4L9MA 2LAPA 1QLSA 1UHKA 2BKHB 1DTLA 2JTTA 1QASA 1ZFSA 2B1UA 4JWQA 2I18A 2IS9A 1K2HA 3CR5X 3I5FB 1N2DA 1KWOC 4HSZA 2KI4C 1JBAA 2BCXA 2OS8B 3CWGA 1W7IB 4OV2A 1UHIA 4Q04A 3NSLA 3SG6A 1AJ4A 4C0LA 2WCEA 2Y1NA 3GK4X 1RJVA 1L2OC 2KOTA 2SASA 2K2FA 1KFUS 4PHNA 1RFJA 5IBWA 2KBMA 1SR6B 5BPJA 4PDZA 1K9PA 2BECA 4YBHB 4BY4A 1UHJA 3M0WA 3LK1A 1NWDA 1BG1A 3CLNA 1XK4C 2KQ6A 1CDMA 1SBJA 2ZN9A 3DVEA 4DCKA 1NIWA 3BUXB 4YI9A 1C7WA 1GGZA 1EG3A 2F33A 1BJFA 1ZMZA 1OMRA 2JQ6A 1OMVA 3GOFA 4PE1A 3FWCA 4MRXA 1LA0A 1MXEA 1XFWO 1BT6A 1KFXS 5AFPA 3D10A 1FI6A 2M49B 2WOSA 1QIVA 1TCOB 2CXJA 2LC5A 3AAKA 1S3PA 1NCZA 3H4SE 1QV1A 5KU1A 1B7TZ 2M8UA 5JJGA 3LCPC 1J7QA 1CMFA 3TDIA 1A75A 2I7AA 1B8RA 2JULA 2M3WA 1W7JB 4N5XA 2KI4B 1YR5A 2JNXA 3NSIA 1M46A 1WLZA 3RLZA 4QJ5B 4ORAB 1NUBA 4E68A 3C1VA 5CSFA 5D7FA 3SG3A 2KHNA 4MZLA 3BUOB 1NCXA 1KSOA 2OTGB 4PALA 1J7OA 2LE9B 2EHBA 3CR2A 4YGEB 2K2AA 2M0RA 1QS7A 2KAVA 1XYDA 1NX1A 5GQQC 1F4OA 1TNXA 1IQ3A 1OZSA 2KI6C 1UUSA 2LP2A 2KBIA 1A2XA 1FF1A 3FIAA 2ZRTA 1K9UA 1B4CA 2F2PA 2Y5IA 4YI8A 5AANA 1WDCC 1CM4A 2LUXA 1YUSA 1PALA 2CNPA 2HPSA 2EC6B 1ZUZA 1LA3A 3MSEB 4YGCB 1NYAA 1CDNA 1SPYA 2AAOA 1DGVA 1J1DA 3SG2A 1CTRA 1BLQA 3I5FC 2BCAA 2ZNEA 4GFTA 1DJWA 2OS8C 4GUKA 2D8NA 1S6CA 1WLMA 5KTYA 4XJKA 1EXRA 1YTZC 1QVIZ 3ZNIA 1JFJA 4ICBA 1TNPA 2R2IA 3VROA 2M29A 4A4BA 1A4PA 1D1OA 1YX7A 1SCMC 1M39A 2K7BA 2LMUA 1YRUB 2PALA 2SCPA 3PATA 1KSMA 1TNWA 1U5IB 1AP4A 4YRUA 3E3RA 4FQOA 2LM5A 1ZACA 1FW4A 2L2EA 2LMVA 2QACA 3EK4A 1F4QA 2H2KA 3A8RA 1YVHA 2LCPA 1GQMA 1PULA 5G08A 3WHTB 3OHMB 3FS7A 3O4YA 1R2UA 1YX8A 3IQOA 1Y1AA 1CLBA 1DJYA 3LLEA 4NDBA 4OKHA 3OB1B 1QTXA 5HKYA 4DRWA 3KF9A 1CFDA 1KK8B 2HETA 4YGBB 3EVUA 3DF0B 2MLEC 4USLA 1DT7B 1N65A 1QXPA 1CFPA 3SIBA 1N0YA 1F55A 1WDCB 5HKWA 3I5IC 1IJ6A 2K61A 2BBMA 3GK2A 4PHMA 3JVTB 1IGVA 1DJGA 2DOQA 2LV7A 2KAYA 1JF0A 2F3ZA 2MHHA 1S6IA 5CSIA 2AUCA 4I5NB 3A4UB 2BL0B 1DJXA 1K94A 2JNFA 2FCEA 2OTGC 1IJ5A 1CFCA 1ALVA 1NX3A 2HQ8A 3DD4A 3O78A 1SCMB 5I8NA 1GJYA 4WQ3A 1RROA 2ISDA 5AEQA 1H8BA 5I2LA 2K0JA 5AERA 1K95A 1DJIA 1MWNA 1Y6WA 3VRRA 1PSBA 2JU0A 5HLVA 2RGIA 1K8UA 2HF5A 1PVBA 2A4JA 2AMIA 1TRFA 4M2QA 2EC6C 3OP0A 4JPZB 1S5GY 2GGZA 1JFKA 2L4HA 2M1UA 1RTP1 3BXKA 1YUUA 5JOLA 4DUQA 2WC8A 4JQ0D 5CPVA 1JSAA 1YURA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ORB B;  3SG5 A;  2KYC A;  2LLT A;  2CTN A;  1WRK A;  2O5G A;  2PSR A;  3TDU A;  3PLF B;  4GAO A;  1MXL C;  1QX7 A;  1FI5 A;  5ER5 A;  1V1G A;  4I5L B;  4CID A;  1BF5 A;  2ZFD A;  2KGB C;  1LXF C;  1B47 A;  1CLM A;  1RK9 A;  1QAT A;  2JT3 A;  3KPX A;  4WRI A;  2K7C A;  1QV0 A;  3BUM B;  3I5I B;  2G2B A;  5TNC A;  2TN4 A;  2LVK A;  3O2P A;  2COL B;  1SL7 A;  4MSP A;  2NLN A;  4N1F A;  2JWW A;  1XFU O;  2GGM A;  2ZKM X;  2MRD A;  4GPL B;  4GBA A;  1F8H A;  1KQV A;  4PHJ A;  4C0J A;  1F71 A;  4I5K A;  2E6W A;  4AOM A;  1XK4 A;  1KCY A;  1J55 A;  4AQI A;  1KFU L;  4CPV A;  4MZK A;  1NX2 A;  1SRA A;  1OOJ A;  5I2O A;  2F3Y A;  2EGD A;  4OR9 B;  3BOW A;  2LVJ A;  3CGA A;  1YUT A;  4GGF C;  1KK8 C;  1EL4 A;  2NXQ A;  4HRG A;  2M9G A;  2H61 A;  4BY5 A;  1KQM C;  1B8L A;  4A4C A;  3HCM A;  4DIR A;  1CKK A;  3EK7 A;  2M7L A;  5I2Q A;  1JC2 A;  1DF0 A;  1WY9 A;  3I5G B;  3JVT C;  2LHI A;  2V53 A;  3PSR A;  1KFX L;  1SL9 A;  1UHN A;  1YRT B;  3FWB A;  2M97 A;  3EKH A;  1UHH A;  3AKA A;  2ZRS A;  3OB2 B;  1A75 B;  1CFF A;  2LHL A;  5DKN A;  1E8A A;  2BL0 C;  1K9K A;  2NCP A;  2WCB A;  1C07 A;  1B1G A;  1SYM A;  1CDP A;  4XYN A;  2F8P A;  1LIN A;  1EH2 A;  1JWD A;  3WNX B;  3NSO A;  1UUR A;  5CSJ A;  2L5X B;  2Y4Q A;  2MAZ A;  3TS5 C;  1BOC A;  2F2O A;  4YGD B;  3DVJ A;  2CBL A;  1XFY O;  3SG4 A;  1AJ5 A;  1G33 A;  2G9B A;  2LUC A;  3BYA A;  3D0Y A;  4AQJ A;  3GK1 A;  1IQ5 A;  4NDC A;  3HX4 A;  5HYD A;  2PAS A;  3I5H B;  4MN0 A;  4M2P A;  3PN7 C;  2JZI A;  3OX6 A;  4NQG A;  4C0K A;  1M31 A;  2KDH A;  2BE4 A;  4PE0 A;  2M1K B;  1IRJ A;  1DGU A;  1JF2 A;  2FCD A;  1KK7 Y;  1SL8 A;  1L7Z A;  1OSA A;  1S1E A;  1SNL A;  2KNE A;  3WXA A;  1TN4 A;  3EK8 A;  1BR1 B;  4MEW A;  1NP8 A;  3EVV A;  1XFV O;  2Q91 A;  1XA5 A;  1KQM B;  4QJ4 B;  4IL1 A;  1H4B A;  5F6T A;  1HQV A;  1SK6 D;  1M63 B;  4N1G A;  3EVR A;  4XJK B;  4P2Y B;  1AUI B;  1OQP A;  3BQ3 A;  1MR8 A;  1XFZ O;  2LNK A;  4CFR A;  4UPG A;  1IKU A;  3CTN A;  1BU3 A;  2I2R E;  2JC2 A;  2JPT A;  2LLS A;  4MZJ A;  1QLK A;  5HKZ A;  2BCB A;  1A29 A;  1PRW A;  2PVB A;  2L50 A;  2BBN A;  2K7D A;  2WND A;  2ZN8 A;  5HLO A;  1EG4 A;  4ETO A;  1AK8 A;  4MVF A;  1DMO A;  1Y0V H;  3IQQ A;  1JUO A;  2HQW A;  1OMD A;  2VRG A;  3JTD B;  1C7V A;  4D1E A;  1V1F A;  1VRK A;  4HRH A;  2KYF A;  2K7O A;  5K89 A;  3TS5 B;  3O6B A;  4PE7 A;  3F45 A;  2L51 A;  4PE4 A;  2QPT A;  4FTG A;  2FJU B;  2MJW B;  1XVJ A;  4YGA A;  1BOD A;  3WHU B;  1CB1 A;  1FPW A;  3TZ1 A;  1EJ3 A;  4TNC A;  3SIA A;  1SW8 A;  2PMY A;  3I5G C;  2L0P A;  4ZCU A;  1MF8 B;  1QIW A;  3PN7 B;  5J3X A;  5AXI A;  3DVM A;  4WQ2 A;  1G4Y R;  3BUW B;  2BE6 A;  2WCF A;  3LK0 A;  1TCF A;  2K8M B;  1CNP A;  1B9A A;  1J7P A;  1DVI A;  2JRF A;  1ZOT B;  2Q4U A;  2WOR A;  1PSR A;  2JTZ A;  3K21 A;  3OX5 A;  1B7T Y;  3PAL A;  5DKR A;  2JOJ A;  2LP3 A;  4F0Z B;  4PHK A;  2JXL A;  1K93 D;  3TUY C;  4P5O E;  3NSK A;  2E30 A;  3NXA A;  4I5J A;  4CFQ A;  4NDD A;  2JXC A;  1S26 D;  1B8C A;  1S5G Z;  3CR4 X;  4OVN F;  2H61 C;  3I5H C;  1SMG A;  1FBV A;  1Q80 A;  3PM8 A;  2NZ0 A;  3VGO A;  1REC A;  3ZWH A;  4HRE E;  4M2O A;  1YVL A;  1IG5 A;  3KEV A;  3TDZ A;  4DS7 A;  4R1E A;  1NPQ A;  3EKJ A;  1MUX A;  1HT9 A;  1R6P A;  1CM1 A;  2L4I A;  1X02 A;  1KWO B;  4MLW A;  1F54 A;  2KFH A;  1OZO A;  2ZND A;  4MRY A;  2KAX A;  1Y1X A;  2NCO A;  2BKI B;  1J7R A;  2P6B B;  1UP5 A;  1LVC D;  1TNQ A;  1L2O B;  1QVI Y;  1U5I A;  2M7N A;  2LVI A;  1TTX A;  1GGW A;  2MA2 A;  1NSH A;  1A03 A;  1DJZ A;  1XFX O;  1UWO A;  3JTD C;  3KHE A;  5PAL A;  3CS1 A;  1MQ1 A;  1PK0 D;  3SJS A;  1LKJ A;  3TUY B;  3SG7 A;  1OE9 B;  1S36 A;  3AAJ A;  1TOP A;  4CLN A;  1AVS A;  4GGF A;  1TIZ A;  3QRX A;  1NX0 A;  3BOW B;  5CSN A;  5KSZ A;  3DF0 A;  1SKT A;  2FOT A;  1IH0 A;  1WRL A;  1K96 A;  3ICB A;  1S6J A;  1QX5 B;  1NCY A;  3VRN A;  1RWY A;  1CDL A;  3DVK A;  3CZT X;  2CT9 A;  2I94 A;  1G8I A;  2JT8 A;  4QJ3 B;  1F70 A;  1DF0 B;  4U8D A;  1CMG A;  1XO5 A;  4ORC B;  4MBE A;  1SCV A;  4PCW A;  1SR6 C;  2KFF A;  2JT0 A;  2L98 A;  1CLL A;  2KSP A;  1PVA A;  1DJH A;  3PFV A;  2LVV A;  1ODB A;  2KFG A;  1M45 A;  2O60 A;  2PRU A;  1SY9 A;  5DKQ A;  5ER4 X;  2MLF C;  4ZCV A;  2KI6 D;  1BR4 B;  3BUN B;  2MBX A;  3VRQ A;  2CCM A;  1ALW A;  3LL8 B;  3RM1 A;  4GNK B;  3AKB A;  2LLU A;  3VRP A;  4OCI A;  3IF7 A;  1IWQ A;  5B8I B;  2LMT A;  1WRZ A;  2KQY A;  1J1E A;  2OPO A;  2Y1M A;  5FYX A;  3KO0 A;  1AHR A;  2GV5 A;  5D69 A;  1QJT A;  1MHO A;  2LAN A;  3D0Y B;  1Y1U A;  1K90 D;  1BMO A;  1KK7 Z;  1QX2 A;  2KGR A;  4GGN A;  4L9M A;  2LAP A;  1QLS A;  1UHK A;  2BKH B;  1DTL A;  2JTT A;  1QAS A;  1ZFS A;  2B1U A;  4JWQ A;  2I18 A;  2IS9 A;  1K2H A;  3CR5 X;  3I5F B;  1N2D A;  1KWO C;  4HSZ A;  2KI4 C;  1JBA A;  2BCX A;  2OS8 B;  3CWG A;  1W7I B;  4OV2 A;  1UHI A;  4Q04 A;  3NSL A;  3SG6 A;  1AJ4 A;  4C0L A;  2WCE A;  2Y1N A;  3GK4 X;  1RJV A;  1L2O C;  2KOT A;  2SAS A;  2K2F A;  1KFU S;  4PHN A;  1RFJ A;  5IBW A;  2KBM A;  1SR6 B;  5BPJ A;  4PDZ A;  1K9P A;  2BEC A;  4YBH B;  4BY4 A;  1UHJ A;  3M0W A;  3LK1 A;  1NWD A;  1BG1 A;  3CLN A;  1XK4 C;  2KQ6 A;  1CDM A;  1SBJ A;  2ZN9 A;  3DVE A;  4DCK A;  1NIW A;  3BUX B;  4YI9 A;  1C7W A;  1GGZ A;  1EG3 A;  2F33 A;  1BJF A;  1ZMZ A;  1OMR A;  2JQ6 A;  1OMV A;  3GOF A;  4PE1 A;  3FWC A;  4MRX A;  1LA0 A;  1MXE A;  1XFW O;  1BT6 A;  1KFX S;  5AFP A;  3D10 A;  1FI6 A;  2M49 B;  2WOS A;  1QIV A;  1TCO B;  2CXJ A;  2LC5 A;  3AAK A;  1S3P A;  1NCZ A;  3H4S E;  1QV1 A;  5KU1 A;  1B7T Z;  2M8U A;  5JJG A;  3LCP C;  1J7Q A;  1CMF A;  3TDI A;  1A75 A;  2I7A A;  1B8R A;  2JUL A;  2M3W A;  1W7J B;  4N5X A;  2KI4 B;  1YR5 A;  2JNX A;  3NSI A;  1M46 A;  1WLZ A;  3RLZ A;  4QJ5 B;  4ORA B;  1NUB A;  4E68 A;  3C1V A;  5CSF A;  5D7F A;  3SG3 A;  2KHN A;  4MZL A;  3BUO B;  1NCX A;  1KSO A;  2OTG B;  4PAL A;  1J7O A;  2LE9 B;  2EHB A;  3CR2 A;  4YGE B;  2K2A A;  2M0R A;  1QS7 A;  2KAV A;  1XYD A;  1NX1 A;  5GQQ C;  1F4O A;  1TNX A;  1IQ3 A;  1OZS A;  2KI6 C;  1UUS A;  2LP2 A;  2KBI A;  1A2X A;  1FF1 A;  3FIA A;  2ZRT A;  1K9U A;  1B4C A;  2F2P A;  2Y5I A;  4YI8 A;  5AAN A;  1WDC C;  1CM4 A;  2LUX A;  1YUS A;  1PAL A;  2CNP A;  2HPS A;  2EC6 B;  1ZUZ A;  1LA3 A;  3MSE B;  4YGC B;  1NYA A;  1CDN A;  1SPY A;  2AAO A;  1DGV A;  1J1D A;  3SG2 A;  1CTR A;  1BLQ A;  3I5F C;  2BCA A;  2ZNE A;  4GFT A;  1DJW A;  2OS8 C;  4GUK A;  2D8N A;  1S6C A;  1WLM A;  5KTY A;  4XJK A;  1EXR A;  1YTZ C;  1QVI Z;  3ZNI A;  1JFJ A;  4ICB A;  1TNP A;  2R2I A;  3VRO A;  2M29 A;  4A4B A;  1A4P A;  1D1O A;  1YX7 A;  1SCM C;  1M39 A;  2K7B A;  2LMU A;  1YRU B;  2PAL A;  2SCP A;  3PAT A;  1KSM A;  1TNW A;  1U5I B;  1AP4 A;  4YRU A;  3E3R A;  4FQO A;  2LM5 A;  1ZAC A;  1FW4 A;  2L2E A;  2LMV A;  2QAC A;  3EK4 A;  1F4Q A;  2H2K A;  3A8R A;  1YVH A;  2LCP A;  1GQM A;  1PUL A;  5G08 A;  3WHT B;  3OHM B;  3FS7 A;  3O4Y A;  1R2U A;  1YX8 A;  3IQO A;  1Y1A A;  1CLB A;  1DJY A;  3LLE A;  4NDB A;  4OKH A;  3OB1 B;  1QTX A;  5HKY A;  4DRW A;  3KF9 A;  1CFD A;  1KK8 B;  2HET A;  4YGB B;  3EVU A;  3DF0 B;  2MLE C;  4USL A;  1DT7 B;  1N65 A;  1QXP A;  1CFP A;  3SIB A;  1N0Y A;  1F55 A;  1WDC B;  5HKW A;  3I5I C;  1IJ6 A;  2K61 A;  2BBM A;  3GK2 A;  4PHM A;  3JVT B;  1IGV A;  1DJG A;  2DOQ A;  2LV7 A;  2KAY A;  1JF0 A;  2F3Z A;  2MHH A;  1S6I A;  5CSI A;  2AUC A;  4I5N B;  3A4U B;  2BL0 B;  1DJX A;  1K94 A;  2JNF A;  2FCE A;  2OTG C;  1IJ5 A;  1CFC A;  1ALV A;  1NX3 A;  2HQ8 A;  3DD4 A;  3O78 A;  1SCM B;  5I8N A;  1GJY A;  4WQ3 A;  1RRO A;  2ISD A;  5AEQ A;  1H8B A;  5I2L A;  2K0J A;  5AER A;  1K95 A;  1DJI A;  1MWN A;  1Y6W A;  3VRR A;  1PSB A;  2JU0 A;  5HLV A;  2RGI A;  1K8U A;  2HF5 A;  1PVB A;  2A4J A;  2AMI A;  1TRF A;  4M2Q A;  2EC6 C;  3OP0 A;  4JPZ B;  1S5G Y;  2GGZ A;  1JFK A;  2L4H A;  2M1U A;  1RTP 1;  3BXK A;  1YUU A;  5JOL A;  4DUQ A;  2WC8 A;  4JQ0 D;  5CPV A;  1JSA A;  1YUR A; 
#chains in the Genus database with same CATH topology
 4ORB B;  2WCM A;  3SG5 A;  2KYC A;  2LLT A;  2CTN A;  4OZD A;  1WRK A;  3D77 A;  2O5G A;  2PSR A;  3TDU A;  3PLF B;  4GAO A;  1MXL C;  1QX7 A;  2ERB A;  1FI5 A;  5ER5 A;  1V1G A;  4I5L B;  4CID A;  1BF5 A;  2ZFD A;  3K1E A;  2KGB C;  1LXF C;  1B47 A;  1CLM A;  1RK9 A;  1QAT A;  2JT3 A;  3B7A A;  3KPX A;  4WRI A;  2K7C A;  1QV0 A;  3BUM B;  3I5I B;  2G2B A;  5TNC A;  2TN4 A;  2LVK A;  3O2P A;  2COL B;  1ORG A;  1SL7 A;  2NLN A;  4JKT A;  4MSP A;  1QWV A;  4N1F A;  2JWW A;  1XFU O;  2GGM A;  2ZKM X;  2MRD A;  4GPL B;  4GBA A;  1F8H A;  1KQV A;  4PHJ A;  2PYQ A;  4C0J A;  4I5K A;  1F71 A;  2E6W A;  4AOM A;  1XK4 A;  1KCY A;  1J55 A;  5EL2 A;  4AQI A;  1KFU L;  4CPV A;  4MZK A;  1NX2 A;  1SRA A;  1OOJ A;  5I2O A;  2F3Y A;  2EGD A;  4OR9 B;  5FI7 A;  3BOW A;  2LVJ A;  3CGA A;  1YUT A;  3N7H A;  4GGF C;  1C3Y A;  1KK8 C;  2WCK A;  1EL4 A;  2NXQ A;  4HRG A;  2M9G A;  2H61 A;  4BY5 A;  1KQM C;  1B8L A;  4A4C A;  3HCM A;  4DIR A;  2KPH A;  1CKK A;  3EK7 A;  2M7L A;  5I2Q A;  1JC2 A;  3BFB A;  1DF0 A;  1WY9 A;  3I5G B;  3JVT C;  2LHI A;  2V53 A;  3PSR A;  1KFX L;  1SL9 A;  1UHN A;  1YRT B;  3FWB A;  2M97 A;  3IVT A;  3EKH A;  3R1O A;  1UHH A;  3AKA A;  2ZRS A;  3OB2 B;  1A75 B;  1CFF A;  2LHL A;  5DKN A;  1E8A A;  2BL0 C;  1K9K A;  2NCP A;  1OOF A;  3O4X A;  2WCB A;  1C07 A;  1B1G A;  1SYM A;  1CDP A;  4XYN A;  2F8P A;  1LIN A;  1EH2 A;  1JWD A;  3WNX B;  3NSO A;  1UUR A;  5CSJ A;  2L5X B;  2Y4Q A;  2MAZ A;  2KLE A;  3TS5 C;  1BOC A;  2F2O A;  2L2C A;  4YGD B;  3DVJ A;  2CBL A;  1XFY O;  3SG4 A;  1AJ5 A;  1G33 A;  2G9B A;  2LUC A;  3S0F A;  3BYA A;  3D0Y A;  4AQJ A;  3GK1 A;  1IQ5 A;  4NDC A;  3HX4 A;  5HYD A;  2PAS A;  3I5H B;  4MN0 A;  4M2P A;  3PN7 C;  2JZI A;  3OX6 A;  4NQG A;  4C0K A;  1M31 A;  2KDH A;  3DXL A;  2BE4 A;  4PE0 A;  2M1K B;  1IRJ A;  1DGU A;  1JF2 A;  2FCD A;  1KK7 Y;  1SL8 A;  1L7Z A;  1OSA A;  1S1E A;  1SNL A;  2KNE A;  3WXA A;  1TN4 A;  3EK8 A;  1BR1 B;  4MEW A;  1NP8 A;  3EVV A;  1XFV O;  2Q91 A;  2FJY A;  1XA5 A;  1KQM B;  4QJ4 B;  4IL1 A;  1H4B A;  5F6T A;  1HQV A;  1SK6 D;  1M63 B;  4N1G A;  3EVR A;  4XJK B;  3V2L A;  4P2Y B;  1AUI B;  1OQP A;  3BQ3 A;  1MR8 A;  1XFZ O;  2LNK A;  4CFR A;  4UPG A;  1IKU A;  3CTN A;  1BU3 A;  2I2R E;  2JC2 A;  2JPT A;  2LLS A;  4MZJ A;  3FE8 A;  3DZT A;  1IIO A;  1DEL A;  1QLK A;  1TWO A;  5HKZ A;  2BCB A;  1A29 A;  2WCJ A;  3S0B A;  1PRW A;  2PVB A;  2L50 A;  2BBN A;  2K7D A;  2WND A;  2ZN8 A;  5HLO A;  1EG4 A;  4ETO A;  1AK8 A;  4FQT A;  4MVF A;  1DMO A;  1Y0V H;  3IQQ A;  1JUO A;  2HQW A;  1OMD A;  2VRG A;  2L5Y A;  3JTD B;  1C7V A;  4D1E A;  1V1F A;  1VRK A;  4HRH A;  2KYF A;  2K7O A;  5K89 A;  3TS5 B;  3O6B A;  4PE7 A;  3F45 A;  2L51 A;  4PE4 A;  2QPT A;  4FTG A;  2FJU B;  2MJW B;  1XVJ A;  4YGA A;  2KLD A;  3CZ2 A;  3WHU B;  1BOD A;  1FPW A;  3OBV A;  3TZ1 A;  1EJ3 A;  4TNC A;  3SS5 A;  3SIA A;  1SW8 A;  2PMY A;  1OOH A;  1W9Z A;  3I5G C;  4INW A;  2L0P A;  3R1P A;  4ZCU A;  1MF8 B;  1QIW A;  3PN7 B;  5J3X A;  5AXI A;  3DVM A;  4WQ2 A;  1G4Y R;  3Q8I A;  3BUW B;  2BE6 A;  2WCF A;  3LK0 A;  1TCF A;  2K8M B;  1CNP A;  3SS3 A;  1B9A A;  1J7P A;  1DVI A;  2JRF A;  1ZOT B;  2Q4U A;  2WOR A;  3OGN A;  1PSR A;  2JTZ A;  3D78 A;  3K21 A;  3OX5 A;  1B7T Y;  3PAL A;  5DKR A;  2JOJ A;  2LP3 A;  4F0Z B;  4PHK A;  2JXL A;  1K93 D;  3TUY C;  4P5O E;  3NSK A;  2E30 A;  3NXA A;  4I5J A;  4CFQ A;  3CZ0 A;  2JPO A;  4NDD A;  3FE9 A;  2JXC A;  1S26 D;  1B8C A;  1S5G Z;  3CR4 X;  1LS8 A;  2BNX A;  4OVN F;  2H61 C;  3I5H C;  3B88 A;  1SMG A;  1FBV A;  1Z2C B;  3NGV A;  1Q80 A;  1T14 A;  3R72 A;  3PM8 A;  2NZ0 A;  3PJI A;  3VGO A;  1REC A;  3ZWH A;  2PQL A;  4HRE E;  1YVL A;  4M2O A;  1OOG A;  1IG5 A;  3KEV A;  3L4A A;  3TDZ A;  4DS7 A;  4R1E A;  1NPQ A;  3EKJ A;  1MUX A;  1HT9 A;  1R6P A;  1CM1 A;  2L4I A;  1X02 A;  1KWO B;  4MLW A;  1F54 A;  2KFH A;  1OZO A;  2ZND A;  4MRY A;  2KAX A;  1Y1X A;  2NCO A;  2BKI B;  1J7R A;  2P6B B;  1UP5 A;  1LVC D;  1TNQ A;  1L2O B;  1QVI Y;  1U5I A;  2M7N A;  2LVI A;  1TTX A;  1GGW A;  2MA2 A;  2QEO A;  1NSH A;  1A03 A;  1DJZ A;  1XFX O;  1UWO A;  3JTD C;  3KHE A;  5PAL A;  3CS1 A;  1MQ1 A;  1PK0 D;  3SJS A;  1LKJ A;  3TUY B;  3SG7 A;  1OE9 B;  1S36 A;  3AAJ A;  1TOP A;  4CLN A;  1AVS A;  4GGF A;  2WC6 A;  1TIZ A;  3QRX A;  1NX0 A;  3BOW B;  2WC5 A;  5CSN A;  5KSZ A;  3DF0 A;  1SKT A;  2FOT A;  1IH0 A;  1WRL A;  1K96 A;  3ICB A;  1S6J A;  1QX5 B;  1NCY A;  3VRN A;  1RWY A;  1CDL A;  3DVK A;  3CZT X;  2CT9 A;  2I94 A;  1G8I A;  2JT8 A;  4QJ3 B;  1F70 A;  1DF0 B;  4U8D A;  1CMG A;  3RZS A;  1XO5 A;  4ORC B;  4MBE A;  1SCV A;  4PCW A;  1SR6 C;  3CAB A;  2KFF A;  3R1V A;  2JT0 A;  2L98 A;  1CLL A;  2KSP A;  1PVA A;  3S0A A;  1DJH A;  3PFV A;  2LVV A;  1ODB A;  2KFG A;  1M45 A;  2O60 A;  2PRU A;  1SY9 A;  5DKQ A;  5ER4 X;  3PM2 A;  2MLF C;  4ZCV A;  2KI6 D;  1BR4 B;  3BUN B;  2MBX A;  3VRQ A;  5D3O A;  2CCM A;  1ALW A;  3LL8 B;  3RM1 A;  4GNK B;  3AKB A;  2LLU A;  3VRP A;  4OCI A;  3CDN A;  3IF7 A;  5DIC A;  1IWQ A;  5B8I B;  2LMT A;  1DQE A;  1SSE B;  1J1E A;  1WRZ A;  2KQY A;  2OPO A;  2Y1M A;  3D76 A;  5FYX A;  3KO0 A;  1AHR A;  2GV5 A;  5D69 A;  1QJT A;  1MHO A;  2LAN A;  3D0Y B;  1Y1U A;  1K90 D;  1BMO A;  1KK7 Z;  1QX2 A;  2KGR A;  4GGN A;  4L9M A;  2LAP A;  1QLS A;  1UHK A;  2BKH B;  1DTL A;  2JTT A;  1QAS A;  1ZFS A;  2B1U A;  4JWQ A;  2I18 A;  2IS9 A;  1K2H A;  3EG5 B;  4KYN A;  3CR5 X;  3I5F B;  4JD9 A;  1N2D A;  1KWO C;  3S0D A;  3CYZ A;  2KI4 C;  4HSZ A;  1JBA A;  2BCX A;  2OS8 B;  3CWG A;  1W7I B;  3D75 A;  3SS4 A;  4OV2 A;  1UHI A;  4Q04 A;  3NSL A;  3QME A;  1AJ4 A;  3SG6 A;  4C0L A;  1P28 A;  2WCE A;  2Y1N A;  3GK4 X;  1RJV A;  1L2O C;  2KOT A;  2SAS A;  2K2F A;  1KFU S;  4PHN A;  2GTE A;  3B6X A;  1RFJ A;  2QEB A;  5IBW A;  3B86 A;  2KBM A;  1SR6 B;  5BPJ A;  4PDZ A;  1K9P A;  2BEC A;  4YBH B;  3VB1 A;  4BY4 A;  1UHJ A;  3M0W A;  3LK1 A;  1NWD A;  1BG1 A;  4INX A;  3CLN A;  1XK4 C;  3DYE A;  2KQ6 A;  1CDM A;  1SBJ A;  2ZN9 A;  3CZ1 A;  3DVE A;  4DCK A;  1NIW A;  3BUX B;  4YI9 A;  2K60 A;  1C7W A;  1GGZ A;  1EG3 A;  2F33 A;  1BJF A;  1ZMZ A;  1OMR A;  2JQ6 A;  1OMV A;  3GOF A;  4PE1 A;  3FWC A;  4MRX A;  1LA0 A;  1DEK A;  1MXE A;  3NHI A;  1XFW O;  3NHT A;  1BT6 A;  1C3Z A;  1KFX S;  5AFP A;  3D10 A;  1FI6 A;  2M49 B;  2WOS A;  1QIV A;  1TCO B;  2H8V A;  2CXJ A;  2LC5 A;  3L4L A;  3L47 A;  3AAK A;  1S3P A;  1NCZ A;  3H4S E;  1QV1 A;  5KU1 A;  1B7T Z;  2M8U A;  5JJG A;  3LCP C;  1J7Q A;  1CMF A;  3TDI A;  1A75 A;  2I7A A;  1B8R A;  2JUL A;  2M3W A;  1W7J B;  4N5X A;  2KI4 B;  1YR5 A;  2JNX A;  3NSI A;  1M46 A;  1WLZ A;  2P70 A;  3RLZ A;  3UNW A;  4QJ5 B;  4ORA B;  1NUB A;  4E68 A;  3C1V A;  5CSF A;  1XFR A;  5D7F A;  3SG3 A;  2KHN A;  4MZL A;  3BUO B;  1NCX A;  1KSO A;  3S0G A;  2OTG B;  4PAL A;  5HL1 A;  2LE9 B;  1J7O A;  2EHB A;  3CR2 A;  4YGE B;  2K2A A;  2M0R A;  1QS7 A;  2KAV A;  1XYD A;  1NX1 A;  5GQQ C;  1F4O A;  1TNX A;  2QDI A;  1IQ3 A;  1CB1 A;  1OZS A;  2KI6 C;  1UUS A;  2LP2 A;  2QEH A;  2KBI A;  1A2X A;  1FF1 A;  3FIA A;  3S0E A;  2ZRT A;  1K9U A;  3BFA A;  1B4C A;  2F2P A;  2Y5I A;  4YI8 A;  5AAN A;  1WDC C;  1CM4 A;  2LUX A;  1YUS A;  1PAL A;  2CNP A;  2HPS A;  2EC6 B;  1ZUZ A;  1LA3 A;  3MSE B;  4YGC B;  1NYA A;  1CDN A;  1SPY A;  2AAO A;  1DGV A;  1J1D A;  4IJ7 A;  3SG2 A;  1CTR A;  1BLQ A;  3I5F C;  2BCA A;  2ZNE A;  4GFT A;  1GM0 A;  1DJW A;  2OS8 C;  4GUK A;  2D8N A;  1S6C A;  1WLM A;  5KTY A;  1Z4H A;  4F7F A;  4XJK A;  1EXR A;  1YTZ C;  1QVI Z;  3ZNI A;  1JFJ A;  5FI6 A;  4ICB A;  1TNP A;  2R2I A;  3VRO A;  2M29 A;  4A4B A;  1A4P A;  3FE6 A;  1D1O A;  1YX7 A;  1SCM C;  1M39 A;  2K7B A;  2LMU A;  1YRU B;  2PAL A;  2WCH A;  2SCP A;  3PAT A;  1KSM A;  1OOI X;  1TNW A;  2P71 A;  1U5I B;  1AP4 A;  4YRU A;  3E3R A;  4FQO A;  2LM5 A;  1ZAC A;  1FW4 A;  2L2E A;  2LMV A;  2QAC A;  2YGU A;  1F4Q A;  1TUJ A;  3EK4 A;  2H2K A;  3A8R A;  1YVH A;  2LCP A;  5I94 A;  1OW4 A;  1GQM A;  1PUL A;  5G08 A;  3WHT B;  3OHM B;  3FS7 A;  3D74 A;  3O4Y A;  1R2U A;  1YX8 A;  2BAP A;  1Y1A A;  3IQO A;  1CLB A;  1DJY A;  3LLE A;  4NDB A;  4OKH A;  3OB1 B;  1QTX A;  5HKY A;  4DRW A;  3KF9 A;  1CFD A;  1KK8 B;  2HET A;  4YGB B;  3EVU A;  3DF0 B;  2MLE C;  3DY9 A;  4USL A;  1DT7 B;  1N65 A;  1QXP A;  4PT1 A;  3UO9 A;  1CFP A;  3SIB A;  1N0Y A;  1F55 A;  1WDC B;  5HKW A;  3I5I C;  1TUZ A;  1IJ6 A;  2K61 A;  2BBM A;  3GK2 A;  4PHM A;  3JVT B;  1IGV A;  1DJG A;  2DOQ A;  5FI2 A;  2LV7 A;  2KAY A;  1JF0 A;  2F3Z A;  2MHH A;  1S6I A;  5CSI A;  2AUC A;  4I5N B;  3A4U B;  2BL0 B;  1DJX A;  1K94 A;  2JNF A;  2FCE A;  2QEV A;  2WCL A;  2OTG C;  1IJ5 A;  1CFC A;  1ALV A;  1NX3 A;  2HQ8 A;  3DD4 A;  3O78 A;  1SCM B;  5I8N A;  1GJY A;  4WQ3 A;  1RRO A;  2ISD A;  5AEQ A;  1H8B A;  5I2L A;  2K0J A;  5AER A;  1K95 A;  1DJI A;  1MWN A;  1Y6W A;  3VRR A;  1PSB A;  3BJH A;  2JU0 A;  5HLV A;  3B87 A;  3BFH A;  2RGI A;  1K8U A;  2HF5 A;  1PVB A;  2A4J A;  2AMI A;  1TRF A;  4M2Q A;  1DC1 A;  3D73 A;  2EC6 C;  3OP0 A;  4JPZ B;  1S5G Y;  2GGZ A;  1JFK A;  2L4H A;  2M1U A;  1RTP 1;  3BXK A;  1YUU A;  5JOL A;  4DUQ A;  2WC8 A;  4JQ0 D;  5CPV A;  1JSA A;  1YUR A; 
#chains in the Genus database with same CATH homology
 4ORB B;  3SG5 A;  2KYC A;  2LLT A;  2CTN A;  1WRK A;  2O5G A;  2PSR A;  3TDU A;  3PLF B;  4GAO A;  1MXL C;  1QX7 A;  1FI5 A;  5ER5 A;  1V1G A;  4I5L B;  4CID A;  1BF5 A;  2ZFD A;  2KGB C;  1LXF C;  1B47 A;  1CLM A;  1RK9 A;  1QAT A;  2JT3 A;  3KPX A;  4WRI A;  2K7C A;  1QV0 A;  3BUM B;  3I5I B;  2G2B A;  5TNC A;  2TN4 A;  2LVK A;  3O2P A;  2COL B;  1SL7 A;  4MSP A;  2NLN A;  4N1F A;  2JWW A;  1XFU O;  2GGM A;  2ZKM X;  2MRD A;  4GPL B;  4GBA A;  1F8H A;  1KQV A;  4PHJ A;  4C0J A;  1F71 A;  4I5K A;  2E6W A;  4AOM A;  1XK4 A;  1KCY A;  1J55 A;  4AQI A;  1KFU L;  4CPV A;  4MZK A;  1NX2 A;  1SRA A;  1OOJ A;  5I2O A;  2F3Y A;  2EGD A;  4OR9 B;  3BOW A;  2LVJ A;  3CGA A;  1YUT A;  4GGF C;  1KK8 C;  1EL4 A;  2NXQ A;  4HRG A;  2M9G A;  2H61 A;  4BY5 A;  1KQM C;  1B8L A;  4A4C A;  3HCM A;  4DIR A;  1CKK A;  3EK7 A;  2M7L A;  5I2Q A;  1JC2 A;  1DF0 A;  1WY9 A;  3I5G B;  3JVT C;  2LHI A;  2V53 A;  3PSR A;  1KFX L;  1SL9 A;  1UHN A;  1YRT B;  3FWB A;  2M97 A;  3EKH A;  1UHH A;  3AKA A;  2ZRS A;  3OB2 B;  1A75 B;  1CFF A;  2LHL A;  5DKN A;  1E8A A;  2BL0 C;  1K9K A;  2NCP A;  2WCB A;  1C07 A;  1B1G A;  1SYM A;  1CDP A;  4XYN A;  2F8P A;  1LIN A;  1EH2 A;  1JWD A;  3WNX B;  3NSO A;  1UUR A;  5CSJ A;  2L5X B;  2Y4Q A;  2MAZ A;  3TS5 C;  1BOC A;  2F2O A;  4YGD B;  3DVJ A;  2CBL A;  1XFY O;  3SG4 A;  1AJ5 A;  1G33 A;  2G9B A;  2LUC A;  3BYA A;  3D0Y A;  4AQJ A;  3GK1 A;  1IQ5 A;  4NDC A;  3HX4 A;  5HYD A;  2PAS A;  3I5H B;  4MN0 A;  4M2P A;  3PN7 C;  2JZI A;  3OX6 A;  4NQG A;  4C0K A;  1M31 A;  2KDH A;  2BE4 A;  4PE0 A;  2M1K B;  1IRJ A;  1DGU A;  1JF2 A;  2FCD A;  1KK7 Y;  1SL8 A;  1L7Z A;  1OSA A;  1S1E A;  1SNL A;  2KNE A;  3WXA A;  1TN4 A;  3EK8 A;  1BR1 B;  4MEW A;  1NP8 A;  3EVV A;  1XFV O;  2Q91 A;  1XA5 A;  1KQM B;  4QJ4 B;  4IL1 A;  1H4B A;  5F6T A;  1HQV A;  1SK6 D;  1M63 B;  4N1G A;  3EVR A;  4XJK B;  4P2Y B;  1AUI B;  1OQP A;  3BQ3 A;  1MR8 A;  1XFZ O;  2LNK A;  4CFR A;  4UPG A;  1IKU A;  3CTN A;  1BU3 A;  2I2R E;  2JC2 A;  2JPT A;  2LLS A;  4MZJ A;  1QLK A;  5HKZ A;  2BCB A;  1A29 A;  1PRW A;  2PVB A;  2L50 A;  2BBN A;  2K7D A;  2WND A;  2ZN8 A;  5HLO A;  1EG4 A;  4ETO A;  1AK8 A;  4MVF A;  1DMO A;  1Y0V H;  3IQQ A;  1JUO A;  2HQW A;  1OMD A;  2VRG A;  3JTD B;  1C7V A;  4D1E A;  1V1F A;  1VRK A;  4HRH A;  2KYF A;  2K7O A;  5K89 A;  3TS5 B;  3O6B A;  4PE7 A;  3F45 A;  2L51 A;  4PE4 A;  2QPT A;  4FTG A;  2FJU B;  2MJW B;  1XVJ A;  4YGA A;  1BOD A;  3WHU B;  1CB1 A;  1FPW A;  3TZ1 A;  1EJ3 A;  4TNC A;  3SIA A;  1SW8 A;  2PMY A;  3I5G C;  2L0P A;  4ZCU A;  1MF8 B;  1QIW A;  3PN7 B;  5J3X A;  5AXI A;  3DVM A;  4WQ2 A;  1G4Y R;  3BUW B;  2BE6 A;  2WCF A;  3LK0 A;  1TCF A;  2K8M B;  1CNP A;  1B9A A;  1J7P A;  1DVI A;  2JRF A;  1ZOT B;  2Q4U A;  2WOR A;  1PSR A;  2JTZ A;  3K21 A;  3OX5 A;  1B7T Y;  3PAL A;  5DKR A;  2JOJ A;  2LP3 A;  4F0Z B;  4PHK A;  2JXL A;  1K93 D;  3TUY C;  4P5O E;  3NSK A;  2E30 A;  3NXA A;  4I5J A;  4CFQ A;  4NDD A;  2JXC A;  1S26 D;  1B8C A;  1S5G Z;  3CR4 X;  4OVN F;  2H61 C;  3I5H C;  1SMG A;  1FBV A;  1Q80 A;  3PM8 A;  2NZ0 A;  3VGO A;  1REC A;  3ZWH A;  4HRE E;  4M2O A;  1YVL A;  1IG5 A;  3KEV A;  3TDZ A;  4DS7 A;  4R1E A;  1NPQ A;  3EKJ A;  1MUX A;  1HT9 A;  1R6P A;  1CM1 A;  2L4I A;  1X02 A;  1KWO B;  4MLW A;  1F54 A;  2KFH A;  1OZO A;  2ZND A;  4MRY A;  2KAX A;  1Y1X A;  2NCO A;  2BKI B;  1J7R A;  2P6B B;  1UP5 A;  1LVC D;  1TNQ A;  1L2O B;  1QVI Y;  1U5I A;  2M7N A;  2LVI A;  1TTX A;  1GGW A;  2MA2 A;  1NSH A;  1A03 A;  1DJZ A;  1XFX O;  1UWO A;  3JTD C;  3KHE A;  5PAL A;  3CS1 A;  1MQ1 A;  1PK0 D;  3SJS A;  1LKJ A;  3TUY B;  3SG7 A;  1OE9 B;  1S36 A;  3AAJ A;  1TOP A;  4CLN A;  1AVS A;  4GGF A;  1TIZ A;  3QRX A;  1NX0 A;  3BOW B;  5CSN A;  5KSZ A;  3DF0 A;  1SKT A;  2FOT A;  1IH0 A;  1WRL A;  1K96 A;  3ICB A;  1S6J A;  1QX5 B;  1NCY A;  3VRN A;  1RWY A;  1CDL A;  3DVK A;  3CZT X;  2CT9 A;  2I94 A;  1G8I A;  2JT8 A;  4QJ3 B;  1F70 A;  1DF0 B;  4U8D A;  1CMG A;  1XO5 A;  4ORC B;  4MBE A;  1SCV A;  4PCW A;  1SR6 C;  2KFF A;  2JT0 A;  2L98 A;  1CLL A;  2KSP A;  1PVA A;  1DJH A;  3PFV A;  2LVV A;  1ODB A;  2KFG A;  1M45 A;  2O60 A;  2PRU A;  1SY9 A;  5DKQ A;  5ER4 X;  2MLF C;  4ZCV A;  2KI6 D;  1BR4 B;  3BUN B;  2MBX A;  3VRQ A;  2CCM A;  1ALW A;  3LL8 B;  3RM1 A;  4GNK B;  3AKB A;  2LLU A;  3VRP A;  4OCI A;  3IF7 A;  1IWQ A;  5B8I B;  2LMT A;  1WRZ A;  2KQY A;  1J1E A;  2OPO A;  2Y1M A;  5FYX A;  3KO0 A;  1AHR A;  2GV5 A;  5D69 A;  1QJT A;  1MHO A;  2LAN A;  3D0Y B;  1Y1U A;  1K90 D;  1BMO A;  1KK7 Z;  1QX2 A;  2KGR A;  4GGN A;  4L9M A;  2LAP A;  1QLS A;  1UHK A;  2BKH B;  1DTL A;  2JTT A;  1QAS A;  1ZFS A;  2B1U A;  4JWQ A;  2I18 A;  2IS9 A;  1K2H A;  3CR5 X;  3I5F B;  1N2D A;  1KWO C;  4HSZ A;  2KI4 C;  1JBA A;  2BCX A;  2OS8 B;  3CWG A;  1W7I B;  4OV2 A;  1UHI A;  4Q04 A;  3NSL A;  3SG6 A;  1AJ4 A;  4C0L A;  2WCE A;  2Y1N A;  3GK4 X;  1RJV A;  1L2O C;  2KOT A;  2SAS A;  2K2F A;  1KFU S;  4PHN A;  1RFJ A;  5IBW A;  2KBM A;  1SR6 B;  5BPJ A;  4PDZ A;  1K9P A;  2BEC A;  4YBH B;  4BY4 A;  1UHJ A;  3M0W A;  3LK1 A;  1NWD A;  1BG1 A;  3CLN A;  1XK4 C;  2KQ6 A;  1CDM A;  1SBJ A;  2ZN9 A;  3DVE A;  4DCK A;  1NIW A;  3BUX B;  4YI9 A;  1C7W A;  1GGZ A;  1EG3 A;  2F33 A;  1BJF A;  1ZMZ A;  1OMR A;  2JQ6 A;  1OMV A;  3GOF A;  4PE1 A;  3FWC A;  4MRX A;  1LA0 A;  1MXE A;  1XFW O;  1BT6 A;  1KFX S;  5AFP A;  3D10 A;  1FI6 A;  2M49 B;  2WOS A;  1QIV A;  1TCO B;  2CXJ A;  2LC5 A;  3AAK A;  1S3P A;  1NCZ A;  3H4S E;  1QV1 A;  5KU1 A;  1B7T Z;  2M8U A;  5JJG A;  3LCP C;  1J7Q A;  1CMF A;  3TDI A;  1A75 A;  2I7A A;  1B8R A;  2JUL A;  2M3W A;  1W7J B;  4N5X A;  2KI4 B;  1YR5 A;  2JNX A;  3NSI A;  1M46 A;  1WLZ A;  3RLZ A;  4QJ5 B;  4ORA B;  1NUB A;  4E68 A;  3C1V A;  5CSF A;  5D7F A;  3SG3 A;  2KHN A;  4MZL A;  3BUO B;  1NCX A;  1KSO A;  2OTG B;  4PAL A;  1J7O A;  2LE9 B;  2EHB A;  3CR2 A;  4YGE B;  2K2A A;  2M0R A;  1QS7 A;  2KAV A;  1XYD A;  1NX1 A;  5GQQ C;  1F4O A;  1TNX A;  1IQ3 A;  1OZS A;  2KI6 C;  1UUS A;  2LP2 A;  2KBI A;  1A2X A;  1FF1 A;  3FIA A;  2ZRT A;  1K9U A;  1B4C A;  2F2P A;  2Y5I A;  4YI8 A;  5AAN A;  1WDC C;  1CM4 A;  2LUX A;  1YUS A;  1PAL A;  2CNP A;  2HPS A;  2EC6 B;  1ZUZ A;  1LA3 A;  3MSE B;  4YGC B;  1NYA A;  1CDN A;  1SPY A;  2AAO A;  1DGV A;  1J1D A;  3SG2 A;  1CTR A;  1BLQ A;  3I5F C;  2BCA A;  2ZNE A;  4GFT A;  1DJW A;  2OS8 C;  4GUK A;  2D8N A;  1S6C A;  1WLM A;  5KTY A;  4XJK A;  1EXR A;  1YTZ C;  1QVI Z;  3ZNI A;  1JFJ A;  4ICB A;  1TNP A;  2R2I A;  3VRO A;  2M29 A;  4A4B A;  1A4P A;  1D1O A;  1YX7 A;  1SCM C;  1M39 A;  2K7B A;  2LMU A;  1YRU B;  2PAL A;  2SCP A;  3PAT A;  1KSM A;  1TNW A;  1U5I B;  1AP4 A;  4YRU A;  3E3R A;  4FQO A;  2LM5 A;  1ZAC A;  1FW4 A;  2L2E A;  2LMV A;  2QAC A;  3EK4 A;  1F4Q A;  2H2K A;  3A8R A;  1YVH A;  2LCP A;  1GQM A;  1PUL A;  5G08 A;  3WHT B;  3OHM B;  3FS7 A;  3O4Y A;  1R2U A;  1YX8 A;  3IQO A;  1Y1A A;  1CLB A;  1DJY A;  3LLE A;  4NDB A;  4OKH A;  3OB1 B;  1QTX A;  5HKY A;  4DRW A;  3KF9 A;  1CFD A;  1KK8 B;  2HET A;  4YGB B;  3EVU A;  3DF0 B;  2MLE C;  4USL A;  1DT7 B;  1N65 A;  1QXP A;  1CFP A;  3SIB A;  1N0Y A;  1F55 A;  1WDC B;  5HKW A;  3I5I C;  1IJ6 A;  2K61 A;  2BBM A;  3GK2 A;  4PHM A;  3JVT B;  1IGV A;  1DJG A;  2DOQ A;  2LV7 A;  2KAY A;  1JF0 A;  2F3Z A;  2MHH A;  1S6I A;  5CSI A;  2AUC A;  4I5N B;  3A4U B;  2BL0 B;  1DJX A;  1K94 A;  2JNF A;  2FCE A;  2OTG C;  1IJ5 A;  1CFC A;  1ALV A;  1NX3 A;  2HQ8 A;  3DD4 A;  3O78 A;  1SCM B;  5I8N A;  1GJY A;  4WQ3 A;  1RRO A;  2ISD A;  5AEQ A;  1H8B A;  5I2L A;  2K0J A;  5AER A;  1K95 A;  1DJI A;  1MWN A;  1Y6W A;  3VRR A;  1PSB A;  2JU0 A;  5HLV A;  2RGI A;  1K8U A;  2HF5 A;  1PVB A;  2A4J A;  2AMI A;  1TRF A;  4M2Q A;  2EC6 C;  3OP0 A;  4JPZ B;  1S5G Y;  2GGZ A;  1JFK A;  2L4H A;  2M1U A;  1RTP 1;  3BXK A;  1YUU A;  5JOL A;  4DUQ A;  2WC8 A;  4JQ0 D;  5CPV A;  1JSA A;  1YUR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...