2AAOA

Regulatory apparatus of calcium dependent protein kinase from arabidopsis thaliana
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
155
structure length
147
Chain Sequence
MNKFKKMALRVIAESLSEEEIAGLKEMFNMIDADKSGQITFEELKAGLKRVGANLKESEILDLMQAADVDNSGTIDYKEFIAATLHLNKIEREDHLFAAFTYFDKDGSGYITPDELQQACEEEELMRDVDQDNDGRIDYNEFVAMMQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calcium-dependent protein kinase, isoform AK1
publication title Structure of the regulatory apparatus of a calcium-dependent protein kinase (CDPK): a novel mode of calmodulin-target recognition.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
total genus 49
structure length 147
sequence length 155
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2005-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2aaoA00
4JPZB 1NCYA 2QPTA 4DS7A 1G33A 1EH2A 2LVIA 2KFGA 1M39A 5KU1A 1MWNA 1SY9A 3D0YA 1L7ZA 3PSRA 2TN4A 4MZKA 5AANA 2K7BA 2CTNA 5CPVA 1CM4A 1B7TZ 2F3ZA 2I18A 2AUCA 2E6WA 2LLSA 2BBMA 3PFVA 3OHMB 2RGIA 1B8LA 2DOQA 2M0RA 2L5XB 2E30A 2G2BA 4HRHA 5IBWA 3EK8A 3ICBA 1FW4A 1SMGA 1TNWA 5DKQA 2LAPA 2WORA 2CXJA 5BPJA 2HF5A 1DJWA 2QACA 1CB1A 1MF8B 2ISDA 3PM8A 4I5KA 2FOTA 1G4YR 1CTRA 1NWDA 1RWYA 3PN7C 1RJVA 2EC6C 4L9MA 3CS1A 3TS5C 1SR6C 1S3PA 5AEQA 1QIVA 2O5GA 3I5IC 2JOJA 2HQWA 2M49B 1UHHA 2OS8C 2WNDA 4DRWA 1B47A 1B8CA 4QJ5B 2ZKMX 3IQOA 1MXLC 4YGAA 4WRIA 3SJSA 3BUNB 4GBAA 3NXAA 1J1EA 2BCXA 3I5FC 5JJGA 1QS7A 1SRAA 3TDUA 2D8NA 2M1UA 4A4BA 2MA2A 1IG5A 1RECA 3DVMA 1OZSA 1BR4B 3AKBA 3VRQA 4I5LB 4MEWA 1YUUA 2KBIA 2Y1NA 4NDCA 2ZRSA 4GFTA 1TNXA 5AFPA 1AJ4A 1WDCB 1XYDA 4ORCB 3KO0A 5CSIA 1CFPA 1QASA 2KSPA 4MSPA 1H4BA 1DTLA 4HREE 1QTXA 5HYDA 1TCFA 4OR9B 2LCPA 3I5GB 4CPVA 1VRKA 3A8RA 1CKKA 1Q80A 1BLQA 1YR5A 1J55A 5DKNA 4A4CA 1IGVA 3K21A 1A75B 2BECA 2OPOA 3EVVA 1YUSA 4N1GA 4AQIA 1MUXA 1JFKA 1IRJA 3BYAA 1CDNA 5AERA 1CLMA 3SIAA 3PLFB 5I8NA 3LCPC 1S5GZ 2KGRA 4JQ0D 1OMVA 2BE6A 3EVRA 2JTTA 4YGCB 1Y1XA 5CSNA 3SG6A 2KQYA 1CMGA 2F2OA 1OZOA 4I5JA 1X02A 4DCKA 1PSBA 1ALVA 3FS7A 1K9UA 5JOLA 5B8IB 1K9KA 1NSHA 2FCDA 1FI6A 4GPLB 4C0KA 1U5IA 4MZJA 1WRKA 3EK7A 2JPTA 2Q91A 1BF5A 1FI5A 1KK8B 3I5GC 2JTZA 2KI4B 2HQ8A 4AQJA 3VRRA 1OOJA 1K94A 1YVHA 4USLA 1ALWA 4GNKB 3JVTB 2LMUA 4JWQA 1DJZA 1KWOC 2M29A 2K61A 1DF0B 1R6PA 3DVEA 1J7RA 1JBAA 2A4JA 1DJHA 2WCEA 1K96A 1D1OA 1H8BA 1B1GA 1QV0A 3DF0B 2H61C 2CCMA 2PSRA 1G8IA 1SKTA 1SYMA 2LVKA 1QX7A 1OQPA 1XK4C 1U5IB 2MRDA 2OTGC 1ZFSA 1TCOB 4MRYA 1JF2A 1RTP1 3IQQA 1GGZA 1Y0VH 1UP5A 1XFZO 4YI8A 3QRXA 2AAOA 1GJYA 1S6CA 1S26D 2V53A 2ZN8A 1WRLA 1IQ3A 3SIBA 2KQ6A 3TUYB 2B1UA 1UUSA 1SCMB 1M31A 4PHJA 1EL4A 2MLFC 3KPXA 2KI6D 2K7DA 2JT0A 2SASA 4YRUA 1CDPA 2GV5A 1UHNA 3O2PA 3OP0A 5ER5A 2JC2A 3JVTC 2KAVA 3EKJA 1EXRA 1S36A 5J3XA 1SPYA 1JUOA 2F3YA 3NSLA 1IJ5A 3PATA 3OX5A 3WNXB 1S1EA 1CLLA 2KYFA 4YBHB 3NSOA 2NXQA 4DUQA 5D69A 2GGMA 3OX6A 2ZN9A 1MHOA 2PRUA 2JNXA 3O4YA 2Y5IA 2KBMA 2O60A 4OKHA 1JSAA 4DIRA 4N5XA 4P5OE 4ZCUA 1ZMZA 2WCBA 2JQ6A 1XFWO 3BUXB 1J7PA 1SNLA 3EK4A 1DJXA 1LA3A 2HPSA 2MAZA 4XJKB 3BOWA 4XYNA 5D7FA 3TUYC 1SL8A 1K93D 1SCMC 1F71A 4YGDB 4M2QA 2LLUA 4MLWA 3DVKA 2KOTA 1NX1A 1JF0A 1K90D 1TNPA 5HKYA 1A75A 1F8HA 1V1FA 3PALA 1KQMB 5CSFA 4M2PA 3GK2A 3NSIA 2L4IA 2H61A 3FIAA 1C7WA 2L98A 4PALA 2M7NA 1PALA 5DKRA 1CFFA 1KK7Z 5PALA 1KFXS 1EG4A 2CT9A 1XK4A 1N2DA 5KTYA 1XFVO 2K2FA 2JRFA 2NZ0A 1V1GA 3CWGA 3BOWB 1JC2A 2WC8A 4YGBB 2LHIA 1HT9A 1QJTA 1BOCA 1UHIA 1J7QA 2KDHA 2M3WA 3CR2A 2CNPA 1K9PA 1NCXA 1K8UA 1TN4A 5AXIA 4OVNF 4M2OA 2NCPA 3MSEB 1E8AA 1NPQA 3I5HB 1F54A 2LP2A 3OB1B 3IF7A 4CLNA 3TDZA 1YRTB 4OV2A 1TNQA 1PK0D 1A4PA 4GAOA 1WLZA 1KQMC 2BCAA 1PSRA 2L51A 2LMTA 1DF0A 2JZIA 1IJ6A 1CFCA 2LC5A 4YI9A 1MR8A 3GOFA 3DF0A 2L0PA 1K2HA 1IWQA 3SG4A 2M8UA 2KYCA 1KFUL 1F4QA 4Q04A 3AAJA 1WDCC 1Y1AA 4YGEB 1WLMA 2L4HA 2F33A 1MXEA 1QLSA 1DGUA 2JXCA 1BJFA 2M7LA 1NP8A 4PHKA 1DJIA 1B9AA 2K2AA 3SG2A 1W7IB 1NIWA 3RM1A 1CDLA 3OB2B 3ZWHA 2JT3A 4IL1A 2CBLA 1DT7B 1JWDA 4ETOA 1DJGA 1S6JA 1N0YA 3I5HC 4PDZA 2FJUB 4GGFC 1BODA 3SG3A 5I2QA 2BBNA 2JWWA 2LV7A 5HKZA 1AP4A 3SG7A 1B7TY 2AMIA 2ZNDA 1RK9A 1TTXA 2SCPA 1MQ1A 4MBEA 2K0JA 1OSAA 3KEVA 2KAYA 1LINA 1EG3A 1FBVA 1RFJA 1F70A 4D1EA 2LP3A 3VGOA 2LUCA 2MLEC 3D10A 1UHKA 3NSKA 2MBXA 2L2EA 1BMOA 4N1FA 1KK8C 1HQVA 1GQMA 1SL9A 2FCEA 2PMYA 2ZNEA 1PVAA 1ZUZA 2F2PA 1L2OB 1QVIZ 2H2KA 2KI4C 3BQ3A 3CTNA 4MZLA 4NQGA 3DD4A 3E3RA 3RLZA 1SL7A 4XJKA 1A2XA 2EGDA 5F6TA 4I5NB 3GK4X 1M46A 1CMFA 4OCIA 1IQ5A 1YURA 3C1VA 4UPGA 1UHJA 4FTGA 1GGWA 2LVVA 2LLTA 2LANA 1XFYO 5ER4X 1SCVA 1WY9A 2M97A 1PRWA 4ZCVA 1QIWA 3BUMB 4HSZA 2OS8B 1F55A 3DVJA 2BE4A 1A03A 2K7CA 3CGAA 1NYAA 3LL8B 4NDDA 4F0ZB 1DVIA 3TZ1A 2KGBC 4PE4A 2LM5A 3I5FB 1YRUB 2JULA 5G08A 1B4CA 1XFUO 2K7OA 2NCOA 1CM1A 3GK1A 4MN0A 1WRZA 1LVCD 5FYXA 1BT6A 2JT8A 3CR5X 2ZFDA 1SK6D 3EVUA 2KAXA 4CFRA 1L2OC 4C0JA 4FQOA 1CLBA 1M45A 1AK8A 1J1DA 4P2YB 2I2RE 2MJWB 4WQ3A 1ODBA 3M0WA 2K8MB 1ZACA 5HLOA 2JU0A 3HCMA 4GGFA 3VRNA 1DJYA 2Q4UA 3LK1A 1S5GY 4HRGA 5K89A 4NDBA 2LVJA 1M63B 1JFJA 1KSMA 2BKHB 3WHUB 3FWCA 1TIZA 1TOPA 1Y6WA 2LMVA 3CR4X 3H4SE 4QJ3B 3D0YB 2HETA 3FWBA 4TNCA 5I2OA 4C0LA 1CFDA 5TNCA 2LE9B 1BG1A 2PALA 4GUKA 3A4UB 2PVBA 2LHLA 4PHNA 3ZNIA 1OMDA 1QXPA 2KFHA 4R1EA 1FPWA 1KCYA 2ZRTA 3AAKA 4AOMA 2BL0B 3O78A 1QV1A 4GGNA 3LK0A 4PE7A 3HX4A 3BUOB 4PE0A 1KFXL 1DGVA 1R2UA 1NX3A 2Y1MA 2M9GA 1YTZC 2COLB 1RROA 1AJ5A 4PHMA 4PE1A 1YX7A 2G9BA 1QX5B 1LKJA 5CSJA 1K95A 1PULA 3VROA 1W7JB 5KSZA 1NCZA 1BU3A 3LLEA 1AUIB 4ORAB 4QJ4B 1S6IA 4BY5A 4CIDA 3CLNA 1C7VA 1XO5A 1XVJA 2EHBA 4WQ2A 1KFUS 1QLKA 2Y4QA 2WOSA 1UWOA 1A29A 1KWOB 1NUBA 3JTDB 1OMRA 1PVBA 1B8RA 1LA0A 5GQQC 5I2LA 3TDIA 1AHRA 3O6BA 2I7AA 2I94A 2JXLA 1QVIY 1UURA 2M1KB 2P6BB 2BKIB 2BL0C 1J7OA 2OTGB 1SW8A 3BUWB 2LNKA 2PASA 3SG5A 1F4OA 2GGZA 3WXAA 3VRPA 2KI6C 4ORBB 5HKWA 2VRGA 1N65A 2BCBA 2KNEA 1QX2A 4ICBA 2KHNA 1IH0A 2WCFA 1CDMA 2R2IA 3CZTX 3KHEA 4PCWA 2MHHA 2NLNA 4MVFA 4E68A 1C07A 4MRXA 1ZOTB 1XFXO 3F45A 2IS9A 3AKAA 1OE9B 3JTDC 1SBJA 1QATA 1YUTA 2KFFA 1NX2A 2LUXA 4CFQA 3EKHA 3WHTB 1BR1B 1CNPA 1Y1UA 1DMOA 1YX8A 1EJ3A 1TRFA 2F8PA 4BY4A 1AVSA 1KSOA 3PN7B 1NX0A 2EC6B 1KQVA 4U8DA 3TS5B 3KF9A 1SR6B 1FF1A 1YVLA 1LXFC 3I5IB 2L50A 3BXKA 1IKUA 2JNFA 1XA5A 1KK7Y 5HLVA
chains in the Genus database with same CATH superfamily
4JPZB 1NCYA 2QPTA 2WCMA 3PM2A 4DS7A 1G33A 1EH2A 2LVIA 2KFGA 1M39A 5KU1A 1MWNA 1SY9A 3D0YA 1L7ZA 3PSRA 2TN4A 4MZKA 5AANA 2K7BA 2CTNA 5CPVA 1CM4A 1B7TZ 2F3ZA 1SSEB 2AUCA 2E6WA 2I18A 2BBMA 2LLSA 3PFVA 3OHMB 2RGIA 1B8LA 2DOQA 2M0RA 2L5XB 2E30A 2G2BA 4HRHA 5IBWA 3EK8A 3ICBA 1FW4A 1SMGA 1TNWA 5DKQA 2LAPA 2WORA 3OGNA 2CXJA 4JD9A 2HF5A 5BPJA 1DJWA 2QACA 1CB1A 1MF8B 2ISDA 2QEOA 3PM8A 4I5KA 2FOTA 1G4YR 1CTRA 1NWDA 1RWYA 2QDIA 3VB1A 3PN7C 1RJVA 2EC6C 4L9MA 2BAPA 3CS1A 5FI2A 3TS5C 1SR6C 1Z4HA 1S3PA 5AEQA 1QIVA 2O5GA 3I5IC 2JOJA 2HQWA 2M49B 1UHHA 2OS8C 2WNDA 4DRWA 1B47A 1B8CA 4QJ5B 2ZKMX 5I94A 3IQOA 1MXLC 4YGAA 4WRIA 3SJSA 3BUNB 4GBAA 3NXAA 1J1EA 2BCXA 3I5FC 5JJGA 1QS7A 1SRAA 3O4XA 3FE6A 2D8NA 3TDUA 2M1UA 4A4BA 2MA2A 1IG5A 1RECA 3DVMA 1OZSA 1BR4B 3AKBA 3VRQA 4I5LB 4MEWA 1QWVA 1YUUA 2KBIA 2KLEA 2Y1NA 4NDCA 2ZRSA 3R1VA 1TNXA 4GFTA 5AFPA 5FI6A 1AJ4A 1WDCB 1XYDA 4ORCB 3KO0A 5CSIA 1CFPA 1QASA 2KSPA 4MSPA 1H4BA 1DTLA 4HREE 1QTXA 5HYDA 1TCFA 4OR9B 1GM0A 2LCPA 3I5GB 4CPVA 2L5YA 1VRKA 3A8RA 3BJHA 1CKKA 4F7FA 1Q80A 1BLQA 1YR5A 1J55A 5DKNA 4A4CA 1IGVA 3D78A 4KYNA 3K21A 1A75B 2BECA 2OPOA 3EVVA 1YUSA 4N1GA 4AQIA 4OZDA 1MUXA 1JFKA 1IRJA 3BYAA 1CDNA 5AERA 1CLMA 3SIAA 1OOGA 3PLFB 3LCPC 1S5GZ 5I8NA 2KGRA 4JQ0D 1OMVA 2BE6A 3EVRA 2JTTA 4YGCB 1Y1XA 5CSNA 3SG6A 2KQYA 1CMGA 2F2OA 1OZOA 4I5JA 1X02A 4DCKA 1PSBA 1ALVA 1T14A 3FS7A 1K9UA 5JOLA 5B8IB 1K9KA 1NSHA 2FCDA 1FI6A 4GPLB 4C0KA 1U5IA 4MZJA 1WRKA 3EK7A 2JPTA 2Q91A 1BF5A 1FI5A 3QMEA 1KK8B 3I5GC 2JTZA 2KI4B 4PT1A 2HQ8A 3CZ0A 4AQJA 3VRRA 1OOJA 1K94A 1YVHA 3SS5A 3R1OA 4USLA 1ALWA 4GNKB 3JVTB 2LMUA 4JWQA 1DJZA 3OBVA 1KWOC 2M29A 2K61A 1DF0B 1R6PA 2H8VA 3DVEA 1J7RA 3L4LA 2A4JA 5DICA 1DJHA 2WCEA 1JBAA 3Q8IA 1K96A 1D1OA 1H8BA 1B1GA 1QV0A 3DF0B 2H61C 2CCMA 2PSRA 1G8IA 1SKTA 1SYMA 2LVKA 1QX7A 1OQPA 1XK4C 1U5IB 1TUZA 2MRDA 2OTGC 1ZFSA 1TCOB 4MRYA 1JF2A 1RTP1 3IQQA 1GGZA 1Y0VH 1UP5A 1XFZO 4YI8A 3CDNA 2AAOA 3N7HA 3QRXA 1GJYA 1S6CA 1S26D 2V53A 2ZN8A 1WRLA 1IQ3A 3SIBA 1OOIX 2KQ6A 3TUYB 2B1UA 1UUSA 5HLVA 1SCMB 1DQEA 1M31A 1EL4A 2MLFC 3KPXA 4PHJA 2KI6D 2K7DA 2JT0A 2SASA 4YRUA 1CDPA 2GV5A 3DYEA 1UHNA 3O2PA 3OP0A 5ER5A 2JC2A 3JVTC 2KAVA 3EKJA 1EXRA 1S36A 2L2CA 1OOFA 5J3XA 1TUJA 1SPYA 2P70A 1JUOA 2F3YA 3NSLA 1IJ5A 3PATA 3OX5A 4INWA 3WNXB 1S1EA 1CLLA 3SS3A 2KYFA 3D75A 4YBHB 3NSOA 2NXQA 4DUQA 5D69A 2GGMA 3OX6A 2ZN9A 1MHOA 2PRUA 1LS8A 2JNXA 3O4YA 2Y5IA 2KBMA 2O60A 4OKHA 1JSAA 4DIRA 2KPHA 4N5XA 4P5OE 4ZCUA 1ZMZA 2KLDA 2WCBA 2JQ6A 2P71A 1XFWO 3BUXB 1J7PA 1SNLA 3EK4A 1DJXA 1LA3A 2HPSA 2MAZA 4XJKB 3BOWA 1DC1A 4XYNA 2K60A 5D7FA 3TUYC 1SL8A 1K93D 1SCMC 1F71A 4YGDB 4M2QA 2LLUA 4MLWA 3DVKA 2KOTA 1NX1A 1JF0A 1K90D 1TNPA 5HKYA 3DXLA 1A75A 1F8HA 1V1FA 3PALA 1KQMB 5CSFA 2WCKA 1XFRA 4M2PA 3GK2A 3NSIA 2L4IA 2H61A 3FIAA 1C7WA 2L98A 1W9ZA 2M7NA 4PALA 1PALA 5DKRA 1CFFA 1KK7Z 5PALA 1KFXS 1EG4A 2CT9A 1XK4A 1N2DA 5KTYA 1XFVO 2K2FA 2JRFA 2NZ0A 1V1GA 3CWGA 3BOWB 1JC2A 2WC8A 4YGBB 2LHIA 1HT9A 1QJTA 1BOCA 1UHIA 1J7QA 2KDHA 2M3WA 3CR2A 3CYZA 2CNPA 1K9PA 1NCXA 1K8UA 1TN4A 5AXIA 4OVNF 4M2OA 2NCPA 3MSEB 1E8AA 1NPQA 3I5HB 1F54A 2LP2A 3OB1B 3IF7A 4CLNA 3TDZA 1YRTB 4OV2A 1TNQA 3CZ2A 1PK0D 1A4PA 1P28A 1DEKA 4GAOA 2YGUA 1WLZA 3UNWA 1KQMC 2BCAA 1PSRA 2L51A 2LMTA 1DF0A 2JZIA 1IJ6A 1CFCA 2LC5A 4YI9A 3R1PA 1MR8A 3GOFA 3B86A 3DF0A 2L0PA 1K2HA 1IWQA 3SG4A 2M8UA 2KYCA 1KFUL 1F4QA 4Q04A 1DELA 3AAJA 1WDCC 1Y1AA 4YGEB 1WLMA 2L4HA 2F33A 1MXEA 1QLSA 1DGUA 2JXCA 1BJFA 2M7LA 1NP8A 4PHKA 1DJIA 1B9AA 2K2AA 3SG2A 3S0BA 1W7IB 1NIWA 3RM1A 1CDLA 4JKTA 3OB2B 3ZWHA 2JT3A 4IL1A 2CBLA 1DT7B 1JWDA 4ETOA 1DJGA 1S6JA 1N0YA 3I5HC 3D73A 4PDZA 2FJUB 4GGFC 1BODA 3SG3A 5I2QA 2BBNA 2JWWA 2LV7A 5HKZA 1AP4A 1Z2CB 3SG7A 1B7TY 2AMIA 2ZNDA 1RK9A 1TTXA 2SCPA 1MQ1A 4MBEA 2K0JA 3V2LA 1OSAA 3KEVA 2KAYA 1LINA 1EG3A 1FBVA 1RFJA 1F70A 3D76A 4D1EA 3B88A 2LP3A 4INXA 3VGOA 2LUCA 2MLEC 3D10A 1UHKA 3NSKA 1ORGA 2MBXA 2L2EA 1BMOA 4N1FA 1KK8C 1HQVA 1GQMA 1SL9A 2FCEA 2PMYA 2ZNEA 1PVAA 1ZUZA 2F2PA 1L2OB 1QVIZ 2H2KA 2KI4C 3BQ3A 3CTNA 4MZLA 4NQGA 3DD4A 3E3RA 5D3OA 3RLZA 1SL7A 4XJKA 1A2XA 2EGDA 5F6TA 4I5NB 3GK4X 1M46A 3D77A 1CMFA 4OCIA 1IQ5A 1YURA 3BFHA 3C1VA 4UPGA 1UHJA 4FTGA 1GGWA 3IVTA 2LVVA 1OW4A 2LLTA 2LANA 2WCJA 1XFYO 5ER4X 1SCVA 1WY9A 2GTEA 2JPOA 1PRWA 2M97A 4ZCVA 1QIWA 3BUMB 3R72A 4HSZA 2OS8B 3BFAA 1F55A 3DVJA 2BE4A 1A03A 2K7CA 3CGAA 1NYAA 3LL8B 4NDDA 4F0ZB 1DVIA 2WC6A 3TZ1A 2KGBC 4PE4A 2LM5A 3I5FB 1YRUB 2JULA 5G08A 1B4CA 1XFUO 2K7OA 2NCOA 1CM1A 3GK1A 4MN0A 2BNXA 1WRZA 3FE9A 1LVCD 5FYXA 1BT6A 2JT8A 3CR5X 2ZFDA 1SK6D 3EVUA 2KAXA 4CFRA 3S0GA 1L2OC 1IIOA 4C0JA 4FQOA 1CLBA 1M45A 1AK8A 1J1DA 3L4AA 3PJIA 4P2YB 2I2RE 2MJWB 4WQ3A 1ODBA 3M0WA 2K8MB 1ZACA 5HLOA 2JU0A 3HCMA 4GGFA 3VRNA 1DJYA 2Q4UA 3LK1A 1S5GY 4HRGA 5K89A 4NDBA 3B6XA 2LVJA 1M63B 5FI7A 1JFJA 1KSMA 2BKHB 3WHUB 3FWCA 1TIZA 4IJ7A 1TOPA 1Y6WA 2LMVA 1TWOA 3SS4A 3CR4X 3H4SE 4QJ3B 3D0YB 2HETA 3FWBA 4TNCA 5I2OA 4C0LA 1CFDA 5TNCA 2LE9B 1BG1A 2PALA 3NHTA 4GUKA 3A4UB 2PVBA 1C3YA 2LHLA 1OOHA 4PHNA 1OMDA 1QXPA 2KFHA 4R1EA 3ZNIA 1FPWA 1KCYA 2ZRTA 3AAKA 3B7AA 3S0DA 2BL0B 4AOMA 3O78A 1QV1A 4GGNA 3LK0A 4PE7A 3HX4A 3BUOB 4PE0A 1C3ZA 1DGVA 1KFXL 1R2UA 1NX3A 2Y1MA 3S0AA 2WCLA 2M9GA 1YTZC 2COLB 1RROA 1AJ5A 4PHMA 4PE1A 1YX7A 2G9BA 1QX5B 1LKJA 3UO9A 5CSJA 1K95A 1PULA 3VROA 1W7JB 2WCHA 5KSZA 1NCZA 1BU3A 3LLEA 1AUIB 4ORAB 3NHIA 4QJ4B 1S6IA 4BY5A 2PQLA 4CIDA 5HL1A 3K1EA 3CLNA 1C7VA 1XO5A 1XVJA 2EHBA 4WQ2A 1KFUS 1QLKA 2Y4QA 2WOSA 1UWOA 1A29A 1KWOB 1NUBA 3B87A 1OMRA 1PVBA 3JTDB 1B8RA 1LA0A 5GQQC 5I2LA 3TDIA 1AHRA 2ERBA 3O6BA 2I7AA 2I94A 2JXLA 1QVIY 1UURA 2M1KB 2P6BB 2BKIB 2WC5A 4FQTA 2BL0C 3L47A 1J7OA 2OTGB 2QEVA 1SW8A 3BUWB 3NGVA 2LNKA 2PASA 3SG5A 1F4OA 3DZTA 2GGZA 3WXAA 3VRPA 2KI6C 2PYQA 3CABA 4ORBB 5HKWA 2VRGA 1N65A 2BCBA 2KNEA 3S0EA 1QX2A 4ICBA 2KHNA 1IH0A 2WCFA 1CDMA 2R2IA 3CZTX 3KHEA 4PCWA 2MHHA 2NLNA 4MVFA 4E68A 1C07A 4MRXA 1ZOTB 1XFXO 3F45A 2FJYA 2IS9A 3FE8A 3AKAA 1OE9B 3JTDC 1SBJA 1QATA 3CZ1A 2QEBA 1YUTA 2KFFA 1NX2A 2LUXA 4CFQA 3EKHA 3WHTB 1BR1B 1CNPA 1Y1UA 1DMOA 1YX8A 1EJ3A 3D74A 1TRFA 2F8PA 4BY4A 1AVSA 1KSOA 3PN7B 1NX0A 2EC6B 1KQVA 4U8DA 3TS5B 3KF9A 3RZSA 1SR6B 1FF1A 2QEHA 3EG5B 1YVLA 1LXFC 3I5IB 2L50A 3S0FA 3BXKA 1IKUA 5EL2A 3DY9A 2JNFA 1XA5A 1KK7Y 3BFBA
chains in the Genus database with same CATH topology
4JPZB 1NCYA 2QPTA 4DS7A 1G33A 1EH2A 2LVIA 2KFGA 1M39A 5KU1A 1MWNA 1SY9A 3D0YA 1L7ZA 3PSRA 2TN4A 4MZKA 5AANA 2K7BA 2CTNA 5CPVA 1CM4A 1B7TZ 2F3ZA 2I18A 2AUCA 2E6WA 2LLSA 2BBMA 3PFVA 3OHMB 2RGIA 1B8LA 2DOQA 2M0RA 2L5XB 2E30A 2G2BA 4HRHA 5IBWA 3EK8A 3ICBA 1FW4A 1SMGA 1TNWA 5DKQA 2LAPA 2WORA 2CXJA 5BPJA 2HF5A 1DJWA 2QACA 1CB1A 1MF8B 2ISDA 3PM8A 4I5KA 2FOTA 1G4YR 1CTRA 1NWDA 1RWYA 3PN7C 1RJVA 2EC6C 4L9MA 3CS1A 3TS5C 1SR6C 1S3PA 5AEQA 1QIVA 2O5GA 3I5IC 2JOJA 2HQWA 2M49B 1UHHA 2OS8C 2WNDA 4DRWA 1B47A 1B8CA 4QJ5B 2ZKMX 3IQOA 1MXLC 4YGAA 4WRIA 3SJSA 3BUNB 4GBAA 3NXAA 1J1EA 2BCXA 3I5FC 5JJGA 1QS7A 1SRAA 3TDUA 2D8NA 2M1UA 4A4BA 2MA2A 1IG5A 1RECA 3DVMA 1OZSA 1BR4B 3AKBA 3VRQA 4I5LB 4MEWA 1YUUA 2KBIA 2Y1NA 4NDCA 2ZRSA 4GFTA 1TNXA 5AFPA 1AJ4A 1WDCB 1XYDA 4ORCB 3KO0A 5CSIA 1CFPA 1QASA 2KSPA 4MSPA 1H4BA 1DTLA 4HREE 1QTXA 5HYDA 1TCFA 4OR9B 2LCPA 3I5GB 4CPVA 1VRKA 3A8RA 1CKKA 1Q80A 1BLQA 1YR5A 1J55A 5DKNA 4A4CA 1IGVA 3K21A 1A75B 2BECA 2OPOA 3EVVA 1YUSA 4N1GA 4AQIA 1MUXA 1JFKA 1IRJA 3BYAA 1CDNA 5AERA 1CLMA 3SIAA 3PLFB 5I8NA 3LCPC 1S5GZ 2KGRA 4JQ0D 1OMVA 2BE6A 3EVRA 2JTTA 4YGCB 1Y1XA 5CSNA 3SG6A 2KQYA 1CMGA 2F2OA 1OZOA 4I5JA 1X02A 4DCKA 1PSBA 1ALVA 3FS7A 1K9UA 5JOLA 5B8IB 1K9KA 1NSHA 2FCDA 1FI6A 4GPLB 4C0KA 1U5IA 4MZJA 1WRKA 3EK7A 2JPTA 2Q91A 1BF5A 1FI5A 1KK8B 3I5GC 2JTZA 2KI4B 2HQ8A 4AQJA 3VRRA 1OOJA 1K94A 1YVHA 4USLA 1ALWA 4GNKB 3JVTB 2LMUA 4JWQA 1DJZA 1KWOC 2M29A 2K61A 1DF0B 1R6PA 3DVEA 1J7RA 1JBAA 2A4JA 1DJHA 2WCEA 1K96A 1D1OA 1H8BA 1B1GA 1QV0A 3DF0B 2H61C 2CCMA 2PSRA 1G8IA 1SKTA 1SYMA 2LVKA 1QX7A 1OQPA 1XK4C 1U5IB 2MRDA 2OTGC 1ZFSA 1TCOB 4MRYA 1JF2A 1RTP1 3IQQA 1GGZA 1Y0VH 1UP5A 1XFZO 4YI8A 3QRXA 2AAOA 1GJYA 1S6CA 1S26D 2V53A 2ZN8A 1WRLA 1IQ3A 3SIBA 2KQ6A 3TUYB 2B1UA 1UUSA 1SCMB 1M31A 4PHJA 1EL4A 2MLFC 3KPXA 2KI6D 2K7DA 2JT0A 2SASA 4YRUA 1CDPA 2GV5A 1UHNA 3O2PA 3OP0A 5ER5A 2JC2A 3JVTC 2KAVA 3EKJA 1EXRA 1S36A 5J3XA 1SPYA 1JUOA 2F3YA 3NSLA 1IJ5A 3PATA 3OX5A 3WNXB 1S1EA 1CLLA 2KYFA 4YBHB 3NSOA 2NXQA 4DUQA 5D69A 2GGMA 3OX6A 2ZN9A 1MHOA 2PRUA 2JNXA 3O4YA 2Y5IA 2KBMA 2O60A 4OKHA 1JSAA 4DIRA 4N5XA 4P5OE 4ZCUA 1ZMZA 2WCBA 2JQ6A 1XFWO 3BUXB 1J7PA 1SNLA 3EK4A 1DJXA 1LA3A 2HPSA 2MAZA 4XJKB 3BOWA 4XYNA 5D7FA 3TUYC 1SL8A 1K93D 1SCMC 1F71A 4YGDB 4M2QA 2LLUA 4MLWA 3DVKA 2KOTA 1NX1A 1JF0A 1K90D 1TNPA 5HKYA 1A75A 1F8HA 1V1FA 3PALA 1KQMB 5CSFA 4M2PA 3GK2A 3NSIA 2L4IA 2H61A 3FIAA 1C7WA 2L98A 4PALA 2M7NA 1PALA 5DKRA 1CFFA 1KK7Z 5PALA 1KFXS 1EG4A 2CT9A 1XK4A 1N2DA 5KTYA 1XFVO 2K2FA 2JRFA 2NZ0A 1V1GA 3CWGA 3BOWB 1JC2A 2WC8A 4YGBB 2LHIA 1HT9A 1QJTA 1BOCA 1UHIA 1J7QA 2KDHA 2M3WA 3CR2A 2CNPA 1K9PA 1NCXA 1K8UA 1TN4A 5AXIA 4OVNF 4M2OA 2NCPA 3MSEB 1E8AA 1NPQA 3I5HB 1F54A 2LP2A 3OB1B 3IF7A 4CLNA 3TDZA 1YRTB 4OV2A 1TNQA 1PK0D 1A4PA 4GAOA 1WLZA 1KQMC 2BCAA 1PSRA 2L51A 2LMTA 1DF0A 2JZIA 1IJ6A 1CFCA 2LC5A 4YI9A 1MR8A 3GOFA 3DF0A 2L0PA 1K2HA 1IWQA 3SG4A 2M8UA 2KYCA 1KFUL 1F4QA 4Q04A 3AAJA 1WDCC 1Y1AA 4YGEB 1WLMA 2L4HA 2F33A 1MXEA 1QLSA 1DGUA 2JXCA 1BJFA 2M7LA 1NP8A 4PHKA 1DJIA 1B9AA 2K2AA 3SG2A 1W7IB 1NIWA 3RM1A 1CDLA 3OB2B 3ZWHA 2JT3A 4IL1A 2CBLA 1DT7B 1JWDA 4ETOA 1DJGA 1S6JA 1N0YA 3I5HC 4PDZA 2FJUB 4GGFC 1BODA 3SG3A 5I2QA 2BBNA 2JWWA 2LV7A 5HKZA 1AP4A 3SG7A 1B7TY 2AMIA 2ZNDA 1RK9A 1TTXA 2SCPA 1MQ1A 4MBEA 2K0JA 1OSAA 3KEVA 2KAYA 1LINA 1EG3A 1FBVA 1RFJA 1F70A 4D1EA 2LP3A 3VGOA 2LUCA 2MLEC 3D10A 1UHKA 3NSKA 2MBXA 2L2EA 1BMOA 4N1FA 1KK8C 1HQVA 1GQMA 1SL9A 2FCEA 2PMYA 2ZNEA 1PVAA 1ZUZA 2F2PA 1L2OB 1QVIZ 2H2KA 2KI4C 3BQ3A 3CTNA 4MZLA 4NQGA 3DD4A 3E3RA 3RLZA 1SL7A 4XJKA 1A2XA 2EGDA 5F6TA 4I5NB 3GK4X 1M46A 1CMFA 4OCIA 1IQ5A 1YURA 3C1VA 4UPGA 1UHJA 4FTGA 1GGWA 2LVVA 2LLTA 2LANA 1XFYO 5ER4X 1SCVA 1WY9A 2M97A 1PRWA 4ZCVA 1QIWA 3BUMB 4HSZA 2OS8B 1F55A 3DVJA 2BE4A 1A03A 2K7CA 3CGAA 1NYAA 3LL8B 4NDDA 4F0ZB 1DVIA 3TZ1A 2KGBC 4PE4A 2LM5A 3I5FB 1YRUB 2JULA 5G08A 1B4CA 1XFUO 2K7OA 2NCOA 1CM1A 3GK1A 4MN0A 1WRZA 1LVCD 5FYXA 1BT6A 2JT8A 3CR5X 2ZFDA 1SK6D 3EVUA 2KAXA 4CFRA 1L2OC 4C0JA 4FQOA 1CLBA 1M45A 1AK8A 1J1DA 4P2YB 2I2RE 2MJWB 4WQ3A 1ODBA 3M0WA 2K8MB 1ZACA 5HLOA 2JU0A 3HCMA 4GGFA 3VRNA 1DJYA 2Q4UA 3LK1A 1S5GY 4HRGA 5K89A 4NDBA 2LVJA 1M63B 1JFJA 1KSMA 2BKHB 3WHUB 3FWCA 1TIZA 1TOPA 1Y6WA 2LMVA 3CR4X 3H4SE 4QJ3B 3D0YB 2HETA 3FWBA 4TNCA 5I2OA 4C0LA 1CFDA 5TNCA 2LE9B 1BG1A 2PALA 4GUKA 3A4UB 2PVBA 2LHLA 4PHNA 3ZNIA 1OMDA 1QXPA 2KFHA 4R1EA 1FPWA 1KCYA 2ZRTA 3AAKA 4AOMA 2BL0B 3O78A 1QV1A 4GGNA 3LK0A 4PE7A 3HX4A 3BUOB 4PE0A 1KFXL 1DGVA 1R2UA 1NX3A 2Y1MA 2M9GA 1YTZC 2COLB 1RROA 1AJ5A 4PHMA 4PE1A 1YX7A 2G9BA 1QX5B 1LKJA 5CSJA 1K95A 1PULA 3VROA 1W7JB 5KSZA 1NCZA 1BU3A 3LLEA 1AUIB 4ORAB 4QJ4B 1S6IA 4BY5A 4CIDA 3CLNA 1C7VA 1XO5A 1XVJA 2EHBA 4WQ2A 1KFUS 1QLKA 2Y4QA 2WOSA 1UWOA 1A29A 1KWOB 1NUBA 3JTDB 1OMRA 1PVBA 1B8RA 1LA0A 5GQQC 5I2LA 3TDIA 1AHRA 3O6BA 2I7AA 2I94A 2JXLA 1QVIY 1UURA 2M1KB 2P6BB 2BKIB 2BL0C 1J7OA 2OTGB 1SW8A 3BUWB 2LNKA 2PASA 3SG5A 1F4OA 2GGZA 3WXAA 3VRPA 2KI6C 4ORBB 5HKWA 2VRGA 1N65A 2BCBA 2KNEA 1QX2A 4ICBA 2KHNA 1IH0A 2WCFA 1CDMA 2R2IA 3CZTX 3KHEA 4PCWA 2MHHA 2NLNA 4MVFA 4E68A 1C07A 4MRXA 1ZOTB 1XFXO 3F45A 2IS9A 3AKAA 1OE9B 3JTDC 1SBJA 1QATA 1YUTA 2KFFA 1NX2A 2LUXA 4CFQA 3EKHA 3WHTB 1BR1B 1CNPA 1Y1UA 1DMOA 1YX8A 1EJ3A 1TRFA 2F8PA 4BY4A 1AVSA 1KSOA 3PN7B 1NX0A 2EC6B 1KQVA 4U8DA 3TS5B 3KF9A 1SR6B 1FF1A 1YVLA 1LXFC 3I5IB 2L50A 3BXKA 1IKUA 2JNFA 1XA5A 1KK7Y 5HLVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JPZ B;  1NCY A;  2QPT A;  4DS7 A;  1G33 A;  1EH2 A;  2LVI A;  2KFG A;  1M39 A;  5KU1 A;  1MWN A;  1SY9 A;  3D0Y A;  1L7Z A;  3PSR A;  2TN4 A;  4MZK A;  5AAN A;  2K7B A;  2CTN A;  5CPV A;  1CM4 A;  1B7T Z;  2F3Z A;  2I18 A;  2AUC A;  2E6W A;  2LLS A;  2BBM A;  3PFV A;  3OHM B;  2RGI A;  1B8L A;  2DOQ A;  2M0R A;  2L5X B;  2E30 A;  2G2B A;  4HRH A;  5IBW A;  3EK8 A;  3ICB A;  1FW4 A;  1SMG A;  1TNW A;  5DKQ A;  2LAP A;  2WOR A;  2CXJ A;  5BPJ A;  2HF5 A;  1DJW A;  2QAC A;  1CB1 A;  1MF8 B;  2ISD A;  3PM8 A;  4I5K A;  2FOT A;  1G4Y R;  1CTR A;  1NWD A;  1RWY A;  3PN7 C;  1RJV A;  2EC6 C;  4L9M A;  3CS1 A;  3TS5 C;  1SR6 C;  1S3P A;  5AEQ A;  1QIV A;  2O5G A;  3I5I C;  2JOJ A;  2HQW A;  2M49 B;  1UHH A;  2OS8 C;  2WND A;  4DRW A;  1B47 A;  1B8C A;  4QJ5 B;  2ZKM X;  3IQO A;  1MXL C;  4YGA A;  4WRI A;  3SJS A;  3BUN B;  4GBA A;  3NXA A;  1J1E A;  2BCX A;  3I5F C;  5JJG A;  1QS7 A;  1SRA A;  3TDU A;  2D8N A;  2M1U A;  4A4B A;  2MA2 A;  1IG5 A;  1REC A;  3DVM A;  1OZS A;  1BR4 B;  3AKB A;  3VRQ A;  4I5L B;  4MEW A;  1YUU A;  2KBI A;  2Y1N A;  4NDC A;  2ZRS A;  4GFT A;  1TNX A;  5AFP A;  1AJ4 A;  1WDC B;  1XYD A;  4ORC B;  3KO0 A;  5CSI A;  1CFP A;  1QAS A;  2KSP A;  4MSP A;  1H4B A;  1DTL A;  4HRE E;  1QTX A;  5HYD A;  1TCF A;  4OR9 B;  2LCP A;  3I5G B;  4CPV A;  1VRK A;  3A8R A;  1CKK A;  1Q80 A;  1BLQ A;  1YR5 A;  1J55 A;  5DKN A;  4A4C A;  1IGV A;  3K21 A;  1A75 B;  2BEC A;  2OPO A;  3EVV A;  1YUS A;  4N1G A;  4AQI A;  1MUX A;  1JFK A;  1IRJ A;  3BYA A;  1CDN A;  5AER A;  1CLM A;  3SIA A;  3PLF B;  5I8N A;  3LCP C;  1S5G Z;  2KGR A;  4JQ0 D;  1OMV A;  2BE6 A;  3EVR A;  2JTT A;  4YGC B;  1Y1X A;  5CSN A;  3SG6 A;  2KQY A;  1CMG A;  2F2O A;  1OZO A;  4I5J A;  1X02 A;  4DCK A;  1PSB A;  1ALV A;  3FS7 A;  1K9U A;  5JOL A;  5B8I B;  1K9K A;  1NSH A;  2FCD A;  1FI6 A;  4GPL B;  4C0K A;  1U5I A;  4MZJ A;  1WRK A;  3EK7 A;  2JPT A;  2Q91 A;  1BF5 A;  1FI5 A;  1KK8 B;  3I5G C;  2JTZ A;  2KI4 B;  2HQ8 A;  4AQJ A;  3VRR A;  1OOJ A;  1K94 A;  1YVH A;  4USL A;  1ALW A;  4GNK B;  3JVT B;  2LMU A;  4JWQ A;  1DJZ A;  1KWO C;  2M29 A;  2K61 A;  1DF0 B;  1R6P A;  3DVE A;  1J7R A;  1JBA A;  2A4J A;  1DJH A;  2WCE A;  1K96 A;  1D1O A;  1H8B A;  1B1G A;  1QV0 A;  3DF0 B;  2H61 C;  2CCM A;  2PSR A;  1G8I A;  1SKT A;  1SYM A;  2LVK A;  1QX7 A;  1OQP A;  1XK4 C;  1U5I B;  2MRD A;  2OTG C;  1ZFS A;  1TCO B;  4MRY A;  1JF2 A;  1RTP 1;  3IQQ A;  1GGZ A;  1Y0V H;  1UP5 A;  1XFZ O;  4YI8 A;  3QRX A;  2AAO A;  1GJY A;  1S6C A;  1S26 D;  2V53 A;  2ZN8 A;  1WRL A;  1IQ3 A;  3SIB A;  2KQ6 A;  3TUY B;  2B1U A;  1UUS A;  1SCM B;  1M31 A;  4PHJ A;  1EL4 A;  2MLF C;  3KPX A;  2KI6 D;  2K7D A;  2JT0 A;  2SAS A;  4YRU A;  1CDP A;  2GV5 A;  1UHN A;  3O2P A;  3OP0 A;  5ER5 A;  2JC2 A;  3JVT C;  2KAV A;  3EKJ A;  1EXR A;  1S36 A;  5J3X A;  1SPY A;  1JUO A;  2F3Y A;  3NSL A;  1IJ5 A;  3PAT A;  3OX5 A;  3WNX B;  1S1E A;  1CLL A;  2KYF A;  4YBH B;  3NSO A;  2NXQ A;  4DUQ A;  5D69 A;  2GGM A;  3OX6 A;  2ZN9 A;  1MHO A;  2PRU A;  2JNX A;  3O4Y A;  2Y5I A;  2KBM A;  2O60 A;  4OKH A;  1JSA A;  4DIR A;  4N5X A;  4P5O E;  4ZCU A;  1ZMZ A;  2WCB A;  2JQ6 A;  1XFW O;  3BUX B;  1J7P A;  1SNL A;  3EK4 A;  1DJX A;  1LA3 A;  2HPS A;  2MAZ A;  4XJK B;  3BOW A;  4XYN A;  5D7F A;  3TUY C;  1SL8 A;  1K93 D;  1SCM C;  1F71 A;  4YGD B;  4M2Q A;  2LLU A;  4MLW A;  3DVK A;  2KOT A;  1NX1 A;  1JF0 A;  1K90 D;  1TNP A;  5HKY A;  1A75 A;  1F8H A;  1V1F A;  3PAL A;  1KQM B;  5CSF A;  4M2P A;  3GK2 A;  3NSI A;  2L4I A;  2H61 A;  3FIA A;  1C7W A;  2L98 A;  4PAL A;  2M7N A;  1PAL A;  5DKR A;  1CFF A;  1KK7 Z;  5PAL A;  1KFX S;  1EG4 A;  2CT9 A;  1XK4 A;  1N2D A;  5KTY A;  1XFV O;  2K2F A;  2JRF A;  2NZ0 A;  1V1G A;  3CWG A;  3BOW B;  1JC2 A;  2WC8 A;  4YGB B;  2LHI A;  1HT9 A;  1QJT A;  1BOC A;  1UHI A;  1J7Q A;  2KDH A;  2M3W A;  3CR2 A;  2CNP A;  1K9P A;  1NCX A;  1K8U A;  1TN4 A;  5AXI A;  4OVN F;  4M2O A;  2NCP A;  3MSE B;  1E8A A;  1NPQ A;  3I5H B;  1F54 A;  2LP2 A;  3OB1 B;  3IF7 A;  4CLN A;  3TDZ A;  1YRT B;  4OV2 A;  1TNQ A;  1PK0 D;  1A4P A;  4GAO A;  1WLZ A;  1KQM C;  2BCA A;  1PSR A;  2L51 A;  2LMT A;  1DF0 A;  2JZI A;  1IJ6 A;  1CFC A;  2LC5 A;  4YI9 A;  1MR8 A;  3GOF A;  3DF0 A;  2L0P A;  1K2H A;  1IWQ A;  3SG4 A;  2M8U A;  2KYC A;  1KFU L;  1F4Q A;  4Q04 A;  3AAJ A;  1WDC C;  1Y1A A;  4YGE B;  1WLM A;  2L4H A;  2F33 A;  1MXE A;  1QLS A;  1DGU A;  2JXC A;  1BJF A;  2M7L A;  1NP8 A;  4PHK A;  1DJI A;  1B9A A;  2K2A A;  3SG2 A;  1W7I B;  1NIW A;  3RM1 A;  1CDL A;  3OB2 B;  3ZWH A;  2JT3 A;  4IL1 A;  2CBL A;  1DT7 B;  1JWD A;  4ETO A;  1DJG A;  1S6J A;  1N0Y A;  3I5H C;  4PDZ A;  2FJU B;  4GGF C;  1BOD A;  3SG3 A;  5I2Q A;  2BBN A;  2JWW A;  2LV7 A;  5HKZ A;  1AP4 A;  3SG7 A;  1B7T Y;  2AMI A;  2ZND A;  1RK9 A;  1TTX A;  2SCP A;  1MQ1 A;  4MBE A;  2K0J A;  1OSA A;  3KEV A;  2KAY A;  1LIN A;  1EG3 A;  1FBV A;  1RFJ A;  1F70 A;  4D1E A;  2LP3 A;  3VGO A;  2LUC A;  2MLE C;  3D10 A;  1UHK A;  3NSK A;  2MBX A;  2L2E A;  1BMO A;  4N1F A;  1KK8 C;  1HQV A;  1GQM A;  1SL9 A;  2FCE A;  2PMY A;  2ZNE A;  1PVA A;  1ZUZ A;  2F2P A;  1L2O B;  1QVI Z;  2H2K A;  2KI4 C;  3BQ3 A;  3CTN A;  4MZL A;  4NQG A;  3DD4 A;  3E3R A;  3RLZ A;  1SL7 A;  4XJK A;  1A2X A;  2EGD A;  5F6T A;  4I5N B;  3GK4 X;  1M46 A;  1CMF A;  4OCI A;  1IQ5 A;  1YUR A;  3C1V A;  4UPG A;  1UHJ A;  4FTG A;  1GGW A;  2LVV A;  2LLT A;  2LAN A;  1XFY O;  5ER4 X;  1SCV A;  1WY9 A;  2M97 A;  1PRW A;  4ZCV A;  1QIW A;  3BUM B;  4HSZ A;  2OS8 B;  1F55 A;  3DVJ A;  2BE4 A;  1A03 A;  2K7C A;  3CGA A;  1NYA A;  3LL8 B;  4NDD A;  4F0Z B;  1DVI A;  3TZ1 A;  2KGB C;  4PE4 A;  2LM5 A;  3I5F B;  1YRU B;  2JUL A;  5G08 A;  1B4C A;  1XFU O;  2K7O A;  2NCO A;  1CM1 A;  3GK1 A;  4MN0 A;  1WRZ A;  1LVC D;  5FYX A;  1BT6 A;  2JT8 A;  3CR5 X;  2ZFD A;  1SK6 D;  3EVU A;  2KAX A;  4CFR A;  1L2O C;  4C0J A;  4FQO A;  1CLB A;  1M45 A;  1AK8 A;  1J1D A;  4P2Y B;  2I2R E;  2MJW B;  4WQ3 A;  1ODB A;  3M0W A;  2K8M B;  1ZAC A;  5HLO A;  2JU0 A;  3HCM A;  4GGF A;  3VRN A;  1DJY A;  2Q4U A;  3LK1 A;  1S5G Y;  4HRG A;  5K89 A;  4NDB A;  2LVJ A;  1M63 B;  1JFJ A;  1KSM A;  2BKH B;  3WHU B;  3FWC A;  1TIZ A;  1TOP A;  1Y6W A;  2LMV A;  3CR4 X;  3H4S E;  4QJ3 B;  3D0Y B;  2HET A;  3FWB A;  4TNC A;  5I2O A;  4C0L A;  1CFD A;  5TNC A;  2LE9 B;  1BG1 A;  2PAL A;  4GUK A;  3A4U B;  2PVB A;  2LHL A;  4PHN A;  3ZNI A;  1OMD A;  1QXP A;  2KFH A;  4R1E A;  1FPW A;  1KCY A;  2ZRT A;  3AAK A;  4AOM A;  2BL0 B;  3O78 A;  1QV1 A;  4GGN A;  3LK0 A;  4PE7 A;  3HX4 A;  3BUO B;  4PE0 A;  1KFX L;  1DGV A;  1R2U A;  1NX3 A;  2Y1M A;  2M9G A;  1YTZ C;  2COL B;  1RRO A;  1AJ5 A;  4PHM A;  4PE1 A;  1YX7 A;  2G9B A;  1QX5 B;  1LKJ A;  5CSJ A;  1K95 A;  1PUL A;  3VRO A;  1W7J B;  5KSZ A;  1NCZ A;  1BU3 A;  3LLE A;  1AUI B;  4ORA B;  4QJ4 B;  1S6I A;  4BY5 A;  4CID A;  3CLN A;  1C7V A;  1XO5 A;  1XVJ A;  2EHB A;  4WQ2 A;  1KFU S;  1QLK A;  2Y4Q A;  2WOS A;  1UWO A;  1A29 A;  1KWO B;  1NUB A;  3JTD B;  1OMR A;  1PVB A;  1B8R A;  1LA0 A;  5GQQ C;  5I2L A;  3TDI A;  1AHR A;  3O6B A;  2I7A A;  2I94 A;  2JXL A;  1QVI Y;  1UUR A;  2M1K B;  2P6B B;  2BKI B;  2BL0 C;  1J7O A;  2OTG B;  1SW8 A;  3BUW B;  2LNK A;  2PAS A;  3SG5 A;  1F4O A;  2GGZ A;  3WXA A;  3VRP A;  2KI6 C;  4ORB B;  5HKW A;  2VRG A;  1N65 A;  2BCB A;  2KNE A;  1QX2 A;  4ICB A;  2KHN A;  1IH0 A;  2WCF A;  1CDM A;  2R2I A;  3CZT X;  3KHE A;  4PCW A;  2MHH A;  2NLN A;  4MVF A;  4E68 A;  1C07 A;  4MRX A;  1ZOT B;  1XFX O;  3F45 A;  2IS9 A;  3AKA A;  1OE9 B;  3JTD C;  1SBJ A;  1QAT A;  1YUT A;  2KFF A;  1NX2 A;  2LUX A;  4CFQ A;  3EKH A;  3WHT B;  1BR1 B;  1CNP A;  1Y1U A;  1DMO A;  1YX8 A;  1EJ3 A;  1TRF A;  2F8P A;  4BY4 A;  1AVS A;  1KSO A;  3PN7 B;  1NX0 A;  2EC6 B;  1KQV A;  4U8D A;  3TS5 B;  3KF9 A;  1SR6 B;  1FF1 A;  1YVL A;  1LXF C;  3I5I B;  2L50 A;  3BXK A;  1IKU A;  2JNF A;  1XA5 A;  1KK7 Y;  5HLV A; 
#chains in the Genus database with same CATH topology
 4JPZ B;  1NCY A;  2QPT A;  2WCM A;  3PM2 A;  4DS7 A;  1G33 A;  1EH2 A;  2LVI A;  2KFG A;  1M39 A;  5KU1 A;  1MWN A;  1SY9 A;  3D0Y A;  1L7Z A;  3PSR A;  2TN4 A;  4MZK A;  5AAN A;  2K7B A;  2CTN A;  5CPV A;  1CM4 A;  1B7T Z;  2F3Z A;  1SSE B;  2AUC A;  2E6W A;  2I18 A;  2BBM A;  2LLS A;  3PFV A;  3OHM B;  2RGI A;  1B8L A;  2DOQ A;  2M0R A;  2L5X B;  2E30 A;  2G2B A;  4HRH A;  5IBW A;  3EK8 A;  3ICB A;  1FW4 A;  1SMG A;  1TNW A;  5DKQ A;  2LAP A;  2WOR A;  3OGN A;  2CXJ A;  4JD9 A;  2HF5 A;  5BPJ A;  1DJW A;  2QAC A;  1CB1 A;  1MF8 B;  2ISD A;  2QEO A;  3PM8 A;  4I5K A;  2FOT A;  1G4Y R;  1CTR A;  1NWD A;  1RWY A;  2QDI A;  3VB1 A;  3PN7 C;  1RJV A;  2EC6 C;  4L9M A;  2BAP A;  3CS1 A;  5FI2 A;  3TS5 C;  1SR6 C;  1Z4H A;  1S3P A;  5AEQ A;  1QIV A;  2O5G A;  3I5I C;  2JOJ A;  2HQW A;  2M49 B;  1UHH A;  2OS8 C;  2WND A;  4DRW A;  1B47 A;  1B8C A;  4QJ5 B;  2ZKM X;  5I94 A;  3IQO A;  1MXL C;  4YGA A;  4WRI A;  3SJS A;  3BUN B;  4GBA A;  3NXA A;  1J1E A;  2BCX A;  3I5F C;  5JJG A;  1QS7 A;  1SRA A;  3O4X A;  3FE6 A;  2D8N A;  3TDU A;  2M1U A;  4A4B A;  2MA2 A;  1IG5 A;  1REC A;  3DVM A;  1OZS A;  1BR4 B;  3AKB A;  3VRQ A;  4I5L B;  4MEW A;  1QWV A;  1YUU A;  2KBI A;  2KLE A;  2Y1N A;  4NDC A;  2ZRS A;  3R1V A;  1TNX A;  4GFT A;  5AFP A;  5FI6 A;  1AJ4 A;  1WDC B;  1XYD A;  4ORC B;  3KO0 A;  5CSI A;  1CFP A;  1QAS A;  2KSP A;  4MSP A;  1H4B A;  1DTL A;  4HRE E;  1QTX A;  5HYD A;  1TCF A;  4OR9 B;  1GM0 A;  2LCP A;  3I5G B;  4CPV A;  2L5Y A;  1VRK A;  3A8R A;  3BJH A;  1CKK A;  4F7F A;  1Q80 A;  1BLQ A;  1YR5 A;  1J55 A;  5DKN A;  4A4C A;  1IGV A;  3D78 A;  4KYN A;  3K21 A;  1A75 B;  2BEC A;  2OPO A;  3EVV A;  1YUS A;  4N1G A;  4AQI A;  4OZD A;  1MUX A;  1JFK A;  1IRJ A;  3BYA A;  1CDN A;  5AER A;  1CLM A;  3SIA A;  1OOG A;  3PLF B;  3LCP C;  1S5G Z;  5I8N A;  2KGR A;  4JQ0 D;  1OMV A;  2BE6 A;  3EVR A;  2JTT A;  4YGC B;  1Y1X A;  5CSN A;  3SG6 A;  2KQY A;  1CMG A;  2F2O A;  1OZO A;  4I5J A;  1X02 A;  4DCK A;  1PSB A;  1ALV A;  1T14 A;  3FS7 A;  1K9U A;  5JOL A;  5B8I B;  1K9K A;  1NSH A;  2FCD A;  1FI6 A;  4GPL B;  4C0K A;  1U5I A;  4MZJ A;  1WRK A;  3EK7 A;  2JPT A;  2Q91 A;  1BF5 A;  1FI5 A;  3QME A;  1KK8 B;  3I5G C;  2JTZ A;  2KI4 B;  4PT1 A;  2HQ8 A;  3CZ0 A;  4AQJ A;  3VRR A;  1OOJ A;  1K94 A;  1YVH A;  3SS5 A;  3R1O A;  4USL A;  1ALW A;  4GNK B;  3JVT B;  2LMU A;  4JWQ A;  1DJZ A;  3OBV A;  1KWO C;  2M29 A;  2K61 A;  1DF0 B;  1R6P A;  2H8V A;  3DVE A;  1J7R A;  3L4L A;  2A4J A;  5DIC A;  1DJH A;  2WCE A;  1JBA A;  3Q8I A;  1K96 A;  1D1O A;  1H8B A;  1B1G A;  1QV0 A;  3DF0 B;  2H61 C;  2CCM A;  2PSR A;  1G8I A;  1SKT A;  1SYM A;  2LVK A;  1QX7 A;  1OQP A;  1XK4 C;  1U5I B;  1TUZ A;  2MRD A;  2OTG C;  1ZFS A;  1TCO B;  4MRY A;  1JF2 A;  1RTP 1;  3IQQ A;  1GGZ A;  1Y0V H;  1UP5 A;  1XFZ O;  4YI8 A;  3CDN A;  2AAO A;  3N7H A;  3QRX A;  1GJY A;  1S6C A;  1S26 D;  2V53 A;  2ZN8 A;  1WRL A;  1IQ3 A;  3SIB A;  1OOI X;  2KQ6 A;  3TUY B;  2B1U A;  1UUS A;  5HLV A;  1SCM B;  1DQE A;  1M31 A;  1EL4 A;  2MLF C;  3KPX A;  4PHJ A;  2KI6 D;  2K7D A;  2JT0 A;  2SAS A;  4YRU A;  1CDP A;  2GV5 A;  3DYE A;  1UHN A;  3O2P A;  3OP0 A;  5ER5 A;  2JC2 A;  3JVT C;  2KAV A;  3EKJ A;  1EXR A;  1S36 A;  2L2C A;  1OOF A;  5J3X A;  1TUJ A;  1SPY A;  2P70 A;  1JUO A;  2F3Y A;  3NSL A;  1IJ5 A;  3PAT A;  3OX5 A;  4INW A;  3WNX B;  1S1E A;  1CLL A;  3SS3 A;  2KYF A;  3D75 A;  4YBH B;  3NSO A;  2NXQ A;  4DUQ A;  5D69 A;  2GGM A;  3OX6 A;  2ZN9 A;  1MHO A;  2PRU A;  1LS8 A;  2JNX A;  3O4Y A;  2Y5I A;  2KBM A;  2O60 A;  4OKH A;  1JSA A;  4DIR A;  2KPH A;  4N5X A;  4P5O E;  4ZCU A;  1ZMZ A;  2KLD A;  2WCB A;  2JQ6 A;  2P71 A;  1XFW O;  3BUX B;  1J7P A;  1SNL A;  3EK4 A;  1DJX A;  1LA3 A;  2HPS A;  2MAZ A;  4XJK B;  3BOW A;  1DC1 A;  4XYN A;  2K60 A;  5D7F A;  3TUY C;  1SL8 A;  1K93 D;  1SCM C;  1F71 A;  4YGD B;  4M2Q A;  2LLU A;  4MLW A;  3DVK A;  2KOT A;  1NX1 A;  1JF0 A;  1K90 D;  1TNP A;  5HKY A;  3DXL A;  1A75 A;  1F8H A;  1V1F A;  3PAL A;  1KQM B;  5CSF A;  2WCK A;  1XFR A;  4M2P A;  3GK2 A;  3NSI A;  2L4I A;  2H61 A;  3FIA A;  1C7W A;  2L98 A;  1W9Z A;  2M7N A;  4PAL A;  1PAL A;  5DKR A;  1CFF A;  1KK7 Z;  5PAL A;  1KFX S;  1EG4 A;  2CT9 A;  1XK4 A;  1N2D A;  5KTY A;  1XFV O;  2K2F A;  2JRF A;  2NZ0 A;  1V1G A;  3CWG A;  3BOW B;  1JC2 A;  2WC8 A;  4YGB B;  2LHI A;  1HT9 A;  1QJT A;  1BOC A;  1UHI A;  1J7Q A;  2KDH A;  2M3W A;  3CR2 A;  3CYZ A;  2CNP A;  1K9P A;  1NCX A;  1K8U A;  1TN4 A;  5AXI A;  4OVN F;  4M2O A;  2NCP A;  3MSE B;  1E8A A;  1NPQ A;  3I5H B;  1F54 A;  2LP2 A;  3OB1 B;  3IF7 A;  4CLN A;  3TDZ A;  1YRT B;  4OV2 A;  1TNQ A;  3CZ2 A;  1PK0 D;  1A4P A;  1P28 A;  1DEK A;  4GAO A;  2YGU A;  1WLZ A;  3UNW A;  1KQM C;  2BCA A;  1PSR A;  2L51 A;  2LMT A;  1DF0 A;  2JZI A;  1IJ6 A;  1CFC A;  2LC5 A;  4YI9 A;  3R1P A;  1MR8 A;  3GOF A;  3B86 A;  3DF0 A;  2L0P A;  1K2H A;  1IWQ A;  3SG4 A;  2M8U A;  2KYC A;  1KFU L;  1F4Q A;  4Q04 A;  1DEL A;  3AAJ A;  1WDC C;  1Y1A A;  4YGE B;  1WLM A;  2L4H A;  2F33 A;  1MXE A;  1QLS A;  1DGU A;  2JXC A;  1BJF A;  2M7L A;  1NP8 A;  4PHK A;  1DJI A;  1B9A A;  2K2A A;  3SG2 A;  3S0B A;  1W7I B;  1NIW A;  3RM1 A;  1CDL A;  4JKT A;  3OB2 B;  3ZWH A;  2JT3 A;  4IL1 A;  2CBL A;  1DT7 B;  1JWD A;  4ETO A;  1DJG A;  1S6J A;  1N0Y A;  3I5H C;  3D73 A;  4PDZ A;  2FJU B;  4GGF C;  1BOD A;  3SG3 A;  5I2Q A;  2BBN A;  2JWW A;  2LV7 A;  5HKZ A;  1AP4 A;  1Z2C B;  3SG7 A;  1B7T Y;  2AMI A;  2ZND A;  1RK9 A;  1TTX A;  2SCP A;  1MQ1 A;  4MBE A;  2K0J A;  3V2L A;  1OSA A;  3KEV A;  2KAY A;  1LIN A;  1EG3 A;  1FBV A;  1RFJ A;  1F70 A;  3D76 A;  4D1E A;  3B88 A;  2LP3 A;  4INX A;  3VGO A;  2LUC A;  2MLE C;  3D10 A;  1UHK A;  3NSK A;  1ORG A;  2MBX A;  2L2E A;  1BMO A;  4N1F A;  1KK8 C;  1HQV A;  1GQM A;  1SL9 A;  2FCE A;  2PMY A;  2ZNE A;  1PVA A;  1ZUZ A;  2F2P A;  1L2O B;  1QVI Z;  2H2K A;  2KI4 C;  3BQ3 A;  3CTN A;  4MZL A;  4NQG A;  3DD4 A;  3E3R A;  5D3O A;  3RLZ A;  1SL7 A;  4XJK A;  1A2X A;  2EGD A;  5F6T A;  4I5N B;  3GK4 X;  1M46 A;  3D77 A;  1CMF A;  4OCI A;  1IQ5 A;  1YUR A;  3BFH A;  3C1V A;  4UPG A;  1UHJ A;  4FTG A;  1GGW A;  3IVT A;  2LVV A;  1OW4 A;  2LLT A;  2LAN A;  2WCJ A;  1XFY O;  5ER4 X;  1SCV A;  1WY9 A;  2GTE A;  2JPO A;  1PRW A;  2M97 A;  4ZCV A;  1QIW A;  3BUM B;  3R72 A;  4HSZ A;  2OS8 B;  3BFA A;  1F55 A;  3DVJ A;  2BE4 A;  1A03 A;  2K7C A;  3CGA A;  1NYA A;  3LL8 B;  4NDD A;  4F0Z B;  1DVI A;  2WC6 A;  3TZ1 A;  2KGB C;  4PE4 A;  2LM5 A;  3I5F B;  1YRU B;  2JUL A;  5G08 A;  1B4C A;  1XFU O;  2K7O A;  2NCO A;  1CM1 A;  3GK1 A;  4MN0 A;  2BNX A;  1WRZ A;  3FE9 A;  1LVC D;  5FYX A;  1BT6 A;  2JT8 A;  3CR5 X;  2ZFD A;  1SK6 D;  3EVU A;  2KAX A;  4CFR A;  3S0G A;  1L2O C;  1IIO A;  4C0J A;  4FQO A;  1CLB A;  1M45 A;  1AK8 A;  1J1D A;  3L4A A;  3PJI A;  4P2Y B;  2I2R E;  2MJW B;  4WQ3 A;  1ODB A;  3M0W A;  2K8M B;  1ZAC A;  5HLO A;  2JU0 A;  3HCM A;  4GGF A;  3VRN A;  1DJY A;  2Q4U A;  3LK1 A;  1S5G Y;  4HRG A;  5K89 A;  4NDB A;  3B6X A;  2LVJ A;  1M63 B;  5FI7 A;  1JFJ A;  1KSM A;  2BKH B;  3WHU B;  3FWC A;  1TIZ A;  4IJ7 A;  1TOP A;  1Y6W A;  2LMV A;  1TWO A;  3SS4 A;  3CR4 X;  3H4S E;  4QJ3 B;  3D0Y B;  2HET A;  3FWB A;  4TNC A;  5I2O A;  4C0L A;  1CFD A;  5TNC A;  2LE9 B;  1BG1 A;  2PAL A;  3NHT A;  4GUK A;  3A4U B;  2PVB A;  1C3Y A;  2LHL A;  1OOH A;  4PHN A;  1OMD A;  1QXP A;  2KFH A;  4R1E A;  3ZNI A;  1FPW A;  1KCY A;  2ZRT A;  3AAK A;  3B7A A;  3S0D A;  2BL0 B;  4AOM A;  3O78 A;  1QV1 A;  4GGN A;  3LK0 A;  4PE7 A;  3HX4 A;  3BUO B;  4PE0 A;  1C3Z A;  1DGV A;  1KFX L;  1R2U A;  1NX3 A;  2Y1M A;  3S0A A;  2WCL A;  2M9G A;  1YTZ C;  2COL B;  1RRO A;  1AJ5 A;  4PHM A;  4PE1 A;  1YX7 A;  2G9B A;  1QX5 B;  1LKJ A;  3UO9 A;  5CSJ A;  1K95 A;  1PUL A;  3VRO A;  1W7J B;  2WCH A;  5KSZ A;  1NCZ A;  1BU3 A;  3LLE A;  1AUI B;  4ORA B;  3NHI A;  4QJ4 B;  1S6I A;  4BY5 A;  2PQL A;  4CID A;  5HL1 A;  3K1E A;  3CLN A;  1C7V A;  1XO5 A;  1XVJ A;  2EHB A;  4WQ2 A;  1KFU S;  1QLK A;  2Y4Q A;  2WOS A;  1UWO A;  1A29 A;  1KWO B;  1NUB A;  3B87 A;  1OMR A;  1PVB A;  3JTD B;  1B8R A;  1LA0 A;  5GQQ C;  5I2L A;  3TDI A;  1AHR A;  2ERB A;  3O6B A;  2I7A A;  2I94 A;  2JXL A;  1QVI Y;  1UUR A;  2M1K B;  2P6B B;  2BKI B;  2WC5 A;  4FQT A;  2BL0 C;  3L47 A;  1J7O A;  2OTG B;  2QEV A;  1SW8 A;  3BUW B;  3NGV A;  2LNK A;  2PAS A;  3SG5 A;  1F4O A;  3DZT A;  2GGZ A;  3WXA A;  3VRP A;  2KI6 C;  2PYQ A;  3CAB A;  4ORB B;  5HKW A;  2VRG A;  1N65 A;  2BCB A;  2KNE A;  3S0E A;  1QX2 A;  4ICB A;  2KHN A;  1IH0 A;  2WCF A;  1CDM A;  2R2I A;  3CZT X;  3KHE A;  4PCW A;  2MHH A;  2NLN A;  4MVF A;  4E68 A;  1C07 A;  4MRX A;  1ZOT B;  1XFX O;  3F45 A;  2FJY A;  2IS9 A;  3FE8 A;  3AKA A;  1OE9 B;  3JTD C;  1SBJ A;  1QAT A;  3CZ1 A;  2QEB A;  1YUT A;  2KFF A;  1NX2 A;  2LUX A;  4CFQ A;  3EKH A;  3WHT B;  1BR1 B;  1CNP A;  1Y1U A;  1DMO A;  1YX8 A;  1EJ3 A;  3D74 A;  1TRF A;  2F8P A;  4BY4 A;  1AVS A;  1KSO A;  3PN7 B;  1NX0 A;  2EC6 B;  1KQV A;  4U8D A;  3TS5 B;  3KF9 A;  3RZS A;  1SR6 B;  1FF1 A;  2QEH A;  3EG5 B;  1YVL A;  1LXF C;  3I5I B;  2L50 A;  3S0F A;  3BXK A;  1IKU A;  5EL2 A;  3DY9 A;  2JNF A;  1XA5 A;  1KK7 Y;  3BFB A; 
#chains in the Genus database with same CATH homology
 4JPZ B;  1NCY A;  2QPT A;  4DS7 A;  1G33 A;  1EH2 A;  2LVI A;  2KFG A;  1M39 A;  5KU1 A;  1MWN A;  1SY9 A;  3D0Y A;  1L7Z A;  3PSR A;  2TN4 A;  4MZK A;  5AAN A;  2K7B A;  2CTN A;  5CPV A;  1CM4 A;  1B7T Z;  2F3Z A;  2I18 A;  2AUC A;  2E6W A;  2LLS A;  2BBM A;  3PFV A;  3OHM B;  2RGI A;  1B8L A;  2DOQ A;  2M0R A;  2L5X B;  2E30 A;  2G2B A;  4HRH A;  5IBW A;  3EK8 A;  3ICB A;  1FW4 A;  1SMG A;  1TNW A;  5DKQ A;  2LAP A;  2WOR A;  2CXJ A;  5BPJ A;  2HF5 A;  1DJW A;  2QAC A;  1CB1 A;  1MF8 B;  2ISD A;  3PM8 A;  4I5K A;  2FOT A;  1G4Y R;  1CTR A;  1NWD A;  1RWY A;  3PN7 C;  1RJV A;  2EC6 C;  4L9M A;  3CS1 A;  3TS5 C;  1SR6 C;  1S3P A;  5AEQ A;  1QIV A;  2O5G A;  3I5I C;  2JOJ A;  2HQW A;  2M49 B;  1UHH A;  2OS8 C;  2WND A;  4DRW A;  1B47 A;  1B8C A;  4QJ5 B;  2ZKM X;  3IQO A;  1MXL C;  4YGA A;  4WRI A;  3SJS A;  3BUN B;  4GBA A;  3NXA A;  1J1E A;  2BCX A;  3I5F C;  5JJG A;  1QS7 A;  1SRA A;  3TDU A;  2D8N A;  2M1U A;  4A4B A;  2MA2 A;  1IG5 A;  1REC A;  3DVM A;  1OZS A;  1BR4 B;  3AKB A;  3VRQ A;  4I5L B;  4MEW A;  1YUU A;  2KBI A;  2Y1N A;  4NDC A;  2ZRS A;  4GFT A;  1TNX A;  5AFP A;  1AJ4 A;  1WDC B;  1XYD A;  4ORC B;  3KO0 A;  5CSI A;  1CFP A;  1QAS A;  2KSP A;  4MSP A;  1H4B A;  1DTL A;  4HRE E;  1QTX A;  5HYD A;  1TCF A;  4OR9 B;  2LCP A;  3I5G B;  4CPV A;  1VRK A;  3A8R A;  1CKK A;  1Q80 A;  1BLQ A;  1YR5 A;  1J55 A;  5DKN A;  4A4C A;  1IGV A;  3K21 A;  1A75 B;  2BEC A;  2OPO A;  3EVV A;  1YUS A;  4N1G A;  4AQI A;  1MUX A;  1JFK A;  1IRJ A;  3BYA A;  1CDN A;  5AER A;  1CLM A;  3SIA A;  3PLF B;  5I8N A;  3LCP C;  1S5G Z;  2KGR A;  4JQ0 D;  1OMV A;  2BE6 A;  3EVR A;  2JTT A;  4YGC B;  1Y1X A;  5CSN A;  3SG6 A;  2KQY A;  1CMG A;  2F2O A;  1OZO A;  4I5J A;  1X02 A;  4DCK A;  1PSB A;  1ALV A;  3FS7 A;  1K9U A;  5JOL A;  5B8I B;  1K9K A;  1NSH A;  2FCD A;  1FI6 A;  4GPL B;  4C0K A;  1U5I A;  4MZJ A;  1WRK A;  3EK7 A;  2JPT A;  2Q91 A;  1BF5 A;  1FI5 A;  1KK8 B;  3I5G C;  2JTZ A;  2KI4 B;  2HQ8 A;  4AQJ A;  3VRR A;  1OOJ A;  1K94 A;  1YVH A;  4USL A;  1ALW A;  4GNK B;  3JVT B;  2LMU A;  4JWQ A;  1DJZ A;  1KWO C;  2M29 A;  2K61 A;  1DF0 B;  1R6P A;  3DVE A;  1J7R A;  1JBA A;  2A4J A;  1DJH A;  2WCE A;  1K96 A;  1D1O A;  1H8B A;  1B1G A;  1QV0 A;  3DF0 B;  2H61 C;  2CCM A;  2PSR A;  1G8I A;  1SKT A;  1SYM A;  2LVK A;  1QX7 A;  1OQP A;  1XK4 C;  1U5I B;  2MRD A;  2OTG C;  1ZFS A;  1TCO B;  4MRY A;  1JF2 A;  1RTP 1;  3IQQ A;  1GGZ A;  1Y0V H;  1UP5 A;  1XFZ O;  4YI8 A;  3QRX A;  2AAO A;  1GJY A;  1S6C A;  1S26 D;  2V53 A;  2ZN8 A;  1WRL A;  1IQ3 A;  3SIB A;  2KQ6 A;  3TUY B;  2B1U A;  1UUS A;  1SCM B;  1M31 A;  4PHJ A;  1EL4 A;  2MLF C;  3KPX A;  2KI6 D;  2K7D A;  2JT0 A;  2SAS A;  4YRU A;  1CDP A;  2GV5 A;  1UHN A;  3O2P A;  3OP0 A;  5ER5 A;  2JC2 A;  3JVT C;  2KAV A;  3EKJ A;  1EXR A;  1S36 A;  5J3X A;  1SPY A;  1JUO A;  2F3Y A;  3NSL A;  1IJ5 A;  3PAT A;  3OX5 A;  3WNX B;  1S1E A;  1CLL A;  2KYF A;  4YBH B;  3NSO A;  2NXQ A;  4DUQ A;  5D69 A;  2GGM A;  3OX6 A;  2ZN9 A;  1MHO A;  2PRU A;  2JNX A;  3O4Y A;  2Y5I A;  2KBM A;  2O60 A;  4OKH A;  1JSA A;  4DIR A;  4N5X A;  4P5O E;  4ZCU A;  1ZMZ A;  2WCB A;  2JQ6 A;  1XFW O;  3BUX B;  1J7P A;  1SNL A;  3EK4 A;  1DJX A;  1LA3 A;  2HPS A;  2MAZ A;  4XJK B;  3BOW A;  4XYN A;  5D7F A;  3TUY C;  1SL8 A;  1K93 D;  1SCM C;  1F71 A;  4YGD B;  4M2Q A;  2LLU A;  4MLW A;  3DVK A;  2KOT A;  1NX1 A;  1JF0 A;  1K90 D;  1TNP A;  5HKY A;  1A75 A;  1F8H A;  1V1F A;  3PAL A;  1KQM B;  5CSF A;  4M2P A;  3GK2 A;  3NSI A;  2L4I A;  2H61 A;  3FIA A;  1C7W A;  2L98 A;  4PAL A;  2M7N A;  1PAL A;  5DKR A;  1CFF A;  1KK7 Z;  5PAL A;  1KFX S;  1EG4 A;  2CT9 A;  1XK4 A;  1N2D A;  5KTY A;  1XFV O;  2K2F A;  2JRF A;  2NZ0 A;  1V1G A;  3CWG A;  3BOW B;  1JC2 A;  2WC8 A;  4YGB B;  2LHI A;  1HT9 A;  1QJT A;  1BOC A;  1UHI A;  1J7Q A;  2KDH A;  2M3W A;  3CR2 A;  2CNP A;  1K9P A;  1NCX A;  1K8U A;  1TN4 A;  5AXI A;  4OVN F;  4M2O A;  2NCP A;  3MSE B;  1E8A A;  1NPQ A;  3I5H B;  1F54 A;  2LP2 A;  3OB1 B;  3IF7 A;  4CLN A;  3TDZ A;  1YRT B;  4OV2 A;  1TNQ A;  1PK0 D;  1A4P A;  4GAO A;  1WLZ A;  1KQM C;  2BCA A;  1PSR A;  2L51 A;  2LMT A;  1DF0 A;  2JZI A;  1IJ6 A;  1CFC A;  2LC5 A;  4YI9 A;  1MR8 A;  3GOF A;  3DF0 A;  2L0P A;  1K2H A;  1IWQ A;  3SG4 A;  2M8U A;  2KYC A;  1KFU L;  1F4Q A;  4Q04 A;  3AAJ A;  1WDC C;  1Y1A A;  4YGE B;  1WLM A;  2L4H A;  2F33 A;  1MXE A;  1QLS A;  1DGU A;  2JXC A;  1BJF A;  2M7L A;  1NP8 A;  4PHK A;  1DJI A;  1B9A A;  2K2A A;  3SG2 A;  1W7I B;  1NIW A;  3RM1 A;  1CDL A;  3OB2 B;  3ZWH A;  2JT3 A;  4IL1 A;  2CBL A;  1DT7 B;  1JWD A;  4ETO A;  1DJG A;  1S6J A;  1N0Y A;  3I5H C;  4PDZ A;  2FJU B;  4GGF C;  1BOD A;  3SG3 A;  5I2Q A;  2BBN A;  2JWW A;  2LV7 A;  5HKZ A;  1AP4 A;  3SG7 A;  1B7T Y;  2AMI A;  2ZND A;  1RK9 A;  1TTX A;  2SCP A;  1MQ1 A;  4MBE A;  2K0J A;  1OSA A;  3KEV A;  2KAY A;  1LIN A;  1EG3 A;  1FBV A;  1RFJ A;  1F70 A;  4D1E A;  2LP3 A;  3VGO A;  2LUC A;  2MLE C;  3D10 A;  1UHK A;  3NSK A;  2MBX A;  2L2E A;  1BMO A;  4N1F A;  1KK8 C;  1HQV A;  1GQM A;  1SL9 A;  2FCE A;  2PMY A;  2ZNE A;  1PVA A;  1ZUZ A;  2F2P A;  1L2O B;  1QVI Z;  2H2K A;  2KI4 C;  3BQ3 A;  3CTN A;  4MZL A;  4NQG A;  3DD4 A;  3E3R A;  3RLZ A;  1SL7 A;  4XJK A;  1A2X A;  2EGD A;  5F6T A;  4I5N B;  3GK4 X;  1M46 A;  1CMF A;  4OCI A;  1IQ5 A;  1YUR A;  3C1V A;  4UPG A;  1UHJ A;  4FTG A;  1GGW A;  2LVV A;  2LLT A;  2LAN A;  1XFY O;  5ER4 X;  1SCV A;  1WY9 A;  2M97 A;  1PRW A;  4ZCV A;  1QIW A;  3BUM B;  4HSZ A;  2OS8 B;  1F55 A;  3DVJ A;  2BE4 A;  1A03 A;  2K7C A;  3CGA A;  1NYA A;  3LL8 B;  4NDD A;  4F0Z B;  1DVI A;  3TZ1 A;  2KGB C;  4PE4 A;  2LM5 A;  3I5F B;  1YRU B;  2JUL A;  5G08 A;  1B4C A;  1XFU O;  2K7O A;  2NCO A;  1CM1 A;  3GK1 A;  4MN0 A;  1WRZ A;  1LVC D;  5FYX A;  1BT6 A;  2JT8 A;  3CR5 X;  2ZFD A;  1SK6 D;  3EVU A;  2KAX A;  4CFR A;  1L2O C;  4C0J A;  4FQO A;  1CLB A;  1M45 A;  1AK8 A;  1J1D A;  4P2Y B;  2I2R E;  2MJW B;  4WQ3 A;  1ODB A;  3M0W A;  2K8M B;  1ZAC A;  5HLO A;  2JU0 A;  3HCM A;  4GGF A;  3VRN A;  1DJY A;  2Q4U A;  3LK1 A;  1S5G Y;  4HRG A;  5K89 A;  4NDB A;  2LVJ A;  1M63 B;  1JFJ A;  1KSM A;  2BKH B;  3WHU B;  3FWC A;  1TIZ A;  1TOP A;  1Y6W A;  2LMV A;  3CR4 X;  3H4S E;  4QJ3 B;  3D0Y B;  2HET A;  3FWB A;  4TNC A;  5I2O A;  4C0L A;  1CFD A;  5TNC A;  2LE9 B;  1BG1 A;  2PAL A;  4GUK A;  3A4U B;  2PVB A;  2LHL A;  4PHN A;  3ZNI A;  1OMD A;  1QXP A;  2KFH A;  4R1E A;  1FPW A;  1KCY A;  2ZRT A;  3AAK A;  4AOM A;  2BL0 B;  3O78 A;  1QV1 A;  4GGN A;  3LK0 A;  4PE7 A;  3HX4 A;  3BUO B;  4PE0 A;  1KFX L;  1DGV A;  1R2U A;  1NX3 A;  2Y1M A;  2M9G A;  1YTZ C;  2COL B;  1RRO A;  1AJ5 A;  4PHM A;  4PE1 A;  1YX7 A;  2G9B A;  1QX5 B;  1LKJ A;  5CSJ A;  1K95 A;  1PUL A;  3VRO A;  1W7J B;  5KSZ A;  1NCZ A;  1BU3 A;  3LLE A;  1AUI B;  4ORA B;  4QJ4 B;  1S6I A;  4BY5 A;  4CID A;  3CLN A;  1C7V A;  1XO5 A;  1XVJ A;  2EHB A;  4WQ2 A;  1KFU S;  1QLK A;  2Y4Q A;  2WOS A;  1UWO A;  1A29 A;  1KWO B;  1NUB A;  3JTD B;  1OMR A;  1PVB A;  1B8R A;  1LA0 A;  5GQQ C;  5I2L A;  3TDI A;  1AHR A;  3O6B A;  2I7A A;  2I94 A;  2JXL A;  1QVI Y;  1UUR A;  2M1K B;  2P6B B;  2BKI B;  2BL0 C;  1J7O A;  2OTG B;  1SW8 A;  3BUW B;  2LNK A;  2PAS A;  3SG5 A;  1F4O A;  2GGZ A;  3WXA A;  3VRP A;  2KI6 C;  4ORB B;  5HKW A;  2VRG A;  1N65 A;  2BCB A;  2KNE A;  1QX2 A;  4ICB A;  2KHN A;  1IH0 A;  2WCF A;  1CDM A;  2R2I A;  3CZT X;  3KHE A;  4PCW A;  2MHH A;  2NLN A;  4MVF A;  4E68 A;  1C07 A;  4MRX A;  1ZOT B;  1XFX O;  3F45 A;  2IS9 A;  3AKA A;  1OE9 B;  3JTD C;  1SBJ A;  1QAT A;  1YUT A;  2KFF A;  1NX2 A;  2LUX A;  4CFQ A;  3EKH A;  3WHT B;  1BR1 B;  1CNP A;  1Y1U A;  1DMO A;  1YX8 A;  1EJ3 A;  1TRF A;  2F8P A;  4BY4 A;  1AVS A;  1KSO A;  3PN7 B;  1NX0 A;  2EC6 B;  1KQV A;  4U8D A;  3TS5 B;  3KF9 A;  1SR6 B;  1FF1 A;  1YVL A;  1LXF C;  3I5I B;  2L50 A;  3BXK A;  1IKU A;  2JNF A;  1XA5 A;  1KK7 Y;  5HLV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...