2AAOA

Regulatory apparatus of calcium dependent protein kinase from arabidopsis thaliana
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
155
structure length
147
Chain Sequence
MNKFKKMALRVIAESLSEEEIAGLKEMFNMIDADKSGQITFEELKAGLKRVGANLKESEILDLMQAADVDNSGTIDYKEFIAATLHLNKIEREDHLFAAFTYFDKDGSGYITPDELQQACEEEELMRDVDQDNDGRIDYNEFVAMMQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calcium-dependent protein kinase, isoform AK1
publication title Structure of the regulatory apparatus of a calcium-dependent protein kinase (CDPK): a novel mode of calmodulin-target recognition.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
total genus 49
structure length 147
sequence length 155
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2005-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2aaoA00
1HT9A 2AAOA 4YGAA 1QLSA 1DJIA 3O78A 2CXJA 2M8UA 2M0RA 1J55A 1S26D 3KHEA 2GGZA 2ZNDA 2IS9A 1N2DA 3EKJA 1IKUA 1M45A 5HLOA 4WRIA 3WHTB 1QIVA 2BKIB 1M31A 2I18A 1TIZA 2BBMA 2R2IA 4GNKB 2KFGA 1C7WA 1QVIY 1SKTA 3IQQA 2MLFC 1F54A 4ORCB 5AXIA 1KK8C 4HRGA 3LLEA 2HQ8A 1G4YR 1R2UA 1K9UA 1KWOC 1BF5A 5K89A 3BUWB 3VRRA 5ER4X 1CLMA 4USLA 3AAJA 2L0PA 2CT9A 1ZACA 1CDNA 1KK8B 1SK6D 2ZRSA 3CZTX 1EJ3A 1QIWA 1WRZA 1KWOB 2L4HA 4DUQA 1F70A 1A29A 4MN0A 2LANA 1MQ1A 1KK7Y 2JZIA 3M0WA 1CFCA 1OMRA 4QJ4B 2E6WA 4GGFC 5HKZA 1UUSA 2BCBA 5CSFA 1XA5A 2Y5IA 2BECA 1S36A 3FIAA 3GK4X 5AFPA 5TNCA 2FCDA 1LXFC 4OKHA 1SCVA 2JT3A 1ZFSA 2F2PA 2CTNA 1SR6B 2KGRA 2LVKA 2M49B 1XK4A 1B7TY 1SPYA 3PN7C 1DF0B 1F4QA 5G08A 2LE9B 5AERA 5HYDA 1LKJA 1FW4A 2KI6D 2L51A 2LCPA 3OB2B 2MAZA 4C0KA 3GOFA 3PN7B 5ER5A 1AVSA 2JXLA 2LHIA 3D0YB 4C0LA 1NP8A 2KFFA 2JT0A 1K9PA 1Y1UA 4A4CA 2OS8C 3TUYC 3KO0A 1BT6A 1Q80A 2HETA 3F45A 1M63B 1YX7A 3TZ1A 1UHNA 4GUKA 1C07A 2EC6C 4IL1A 1H8BA 1MF8B 2LLTA 2OS8B 3TUYB 1JBAA 1QTXA 1D1OA 1KFXL 3VRPA 5HKYA 1NYAA 2BL0C 2G2BA 2QPTA 4WQ3A 4A4BA 3BYAA 2EC6B 1K9KA 2KAVA 3TDIA 1B47A 5BPJA 2K8MB 3VRNA 1A2XA 1YURA 2KOTA 1G8IA 2BL0B 1YRTB 2ZFDA 4XJKA 4AQJA 4QJ5B 1IJ5A 2WOSA 2JWWA 2NZ0A 3EVUA 2JNXA 3SG5A 4DIRA 1KSMA 3QRXA 1SY9A 2M1KB 4JWQA 1FI6A 1BMOA 2F8PA 5KSZA 1QASA 2KHNA 1CDLA 2JRFA 1U5IA 1BR1B 2LLSA 1XYDA 1RFJA 4MSPA 3BUOB 4ETOA 2LV7A 1M46A 2KI4C 2Y1NA 1PRWA 3CR2A 1CNPA 4Q04A 2EGDA 1KQVA 2LHLA 4QJ3B 3CR5X 5GQQC 2RGIA 1XFVO 3D0YA 4M2OA 1RECA 4YBHB 2M1UA 3PALA 1JWDA 2F33A 1MR8A 2F3ZA 2BCAA 2KI4B 1EH2A 3NXAA 1TTXA 2MRDA 2KAXA 1A4PA 2Q4UA 5J3XA 1EL4A 1JFKA 1OE9B 1R6PA 1Y0VH 2OTGC 1QV1A 5D7FA 1RROA 2K2AA 3WXAA 4OR9B 4CFQA 3I5IC 2VRGA 2EHBA 2LVVA 3DVMA 4U8DA 2HPSA 3OX6A 1AJ5A 1CM4A 1X02A 1BLQA 2LAPA 1DJZA 1N65A 2KI6C 3NSKA 1IGVA 2OTGB 3PATA 1DJHA 3TDUA 3SJSA 1CDMA 3I5IB 4HSZA 1MXLC 2H61C 3DVKA 3BOWA 1UHJA 1DGUA 1JF2A 1RJVA 2G9BA 3OB1B 1MXEA 1KCYA 3GK2A 2NCPA 1NX2A 1OZSA 3EK8A 4CFRA 4NQGA 1BG1A 5HLVA 5CSJA 1KFXS 2NCOA 2Q91A 1K94A 4F0ZB 3A8RA 1NX1A 3OP0A 1JC2A 1XVJA 4DS7A 4PCWA 4OV2A 4I5KA 1AJ4A 2MHHA 2F3YA 1HQVA 1NCYA 3A4UB 2MJWB 1J1EA 2PASA 3TS5C 1ZMZA 3DVJA 3PM8A 4MZJA 2I7AA 5I2OA 3BUXB 1B4CA 1GJYA 1SMGA 4ZCVA 1PK0D 1YUUA 2KQ6A 1S3PA 4PE0A 1DJGA 4PE1A 5HKWA 2LP2A 1SL9A 1ZOTB 2L4IA 4YGDB 3TS5B 1DT7B 2PVBA 2JXCA 3SG3A 2ZNEA 1FPWA 2Y1MA 4P5OE 4PE4A 2O5GA 1K90D 2ZN9A 1EG4A 1IJ6A 2WORA 2LM5A 1TN4A 3KEVA 1KK7Z 1S5GY 1F55A 3CWGA 5AANA 3BUNB 2JC2A 4DCKA 1JSAA 2Y4QA 1BJFA 3LK0A 1Y6WA 1B8CA 1Y1XA 1SCMC 2KGBC 4MZLA 1MHOA 1TNWA 1K2HA 2LMUA 1NCXA 2F2OA 2BE4A 1A75B 2KYFA 1LA0A 2E30A 3RLZA 1SL8A 3SG7A 1PALA 4I5NB 3LCPC 1W7IB 1YTZC 2WCFA 2M97A 1G33A 3JVTC 4JQ0D 3I5FC 1NSHA 1CFDA 1L7ZA 1N0YA 1CTRA 1J7PA 1YVHA 4P2YB 1DTLA 1EG3A 1SNLA 5I2QA 1AK8A 1SBJA 3DF0B 4XYNA 1CFPA 1JUOA 3JVTB 1XFUO 3I5FB 1PVAA 1EXRA 3O4YA 4R1EA 1BOCA 4GGFA 5IBWA 4L9MA 1DF0A 1UHIA 1YUTA 2KDHA 2MA2A 4N1GA 3ICBA 4N5XA 1ZUZA 2K7OA 1YRUB 2PRUA 2PALA 4GAOA 3E3RA 3EVRA 2WC8A 3WNXB 1LA3A 2K7CA 2NXQA 4NDDA 2JPTA 1FI5A 4UPGA 2KYCA 2L5XB 2JQ6A 2M3WA 3EVVA 1CB1A 4CIDA 3EKHA 1FBVA 1QS7A 2JT8A 1B1GA 2O60A 2D8NA 3FWBA 4MZKA 1GQMA 4BY4A 2BKHB 2KBMA 1QLKA 1OOJA 4PALA 4GGNA 3KPXA 1IQ5A 4OCIA 3JTDC 2JTZA 1OMVA 4HRHA 2JOJA 1BODA 3PLFB 2JULA 4PHNA 5FYXA 3C1VA 4CLNA 2KSPA 2NLNA 2AMIA 3NSOA 4PHKA 2L2EA 1MUXA 2V53A 2LLUA 1ALWA 5KU1A 1QATA 3EK7A 2LVJA 1LINA 3JTDB 1TNQA 4YI8A 1XFWO 2ZKMX 4M2QA 1XK4C 1BU3A 3O2PA 2LUCA 4M2PA 3TDZA 5B8IB 1PULA 1F4OA 1RK9A 3AKBA 1WRLA 3I5GC 4WQ2A 1AUIB 2SASA 3BXKA 1KFUL 3WHUB 4NDCA 2TN4A 3CS1A 1CKKA 3FWCA 2FJUB 4MLWA 2LC5A 3I5GB 4NDBA 3SG6A 3SG2A 4YGBB 3K21A 1RWYA 2K7BA 1YX8A 1XO5A 2L98A 3OHMB 4I5LB 5DKQA 2AUCA 1MWNA 1VRKA 2DOQA 5KTYA 2LVIA 1XFZO 3LL8B 1NX3A 1QX7A 2KQYA 1RTP1 1TRFA 4GFTA 2KNEA 3SIBA 2A4JA 1NWDA 4MRXA 4FTGA 4N1FA 2I94A 1CLBA 1QVIZ 3OX5A 1S6CA 1S6JA 1J1DA 4OVNF 2CCMA 4YGEB 1SL7A 1OMDA 1DJWA 3D10A 1XFYO 2COLB 4CPVA 3AAKA 1YR5A 5CSIA 1TNXA 2MLEC 4JPZB 3CR4X 1JFJA 4PHMA 1NIWA 5CPVA 3IQOA 2JTTA 1OZOA 1KQMC 1W7JB 4MBEA 5F6TA 2BE6A 5JJGA 5CSNA 1E8AA 1SYMA 1UP5A 3PSRA 4TNCA 1SR6C 1QX2A 1UHKA 2K0JA 1BR4B 1J7QA 4XJKB 4YI9A 2HQWA 1DVIA 1K95A 2PSRA 2M29A 5DKRA 1KQMB 1CM1A 2I2RE 1YVLA 2WCBA 3GK1A 2LNKA 1JF0A 1WDCC 1TOPA 3AKAA 4GPLB 4ORAB 1KSOA 1U5IB 2BCXA 2M7LA 4D1EA 2JU0A 3LK1A 5JOLA 3NSLA 2MBXA 1PSRA 2H61A 1A03A 5DKNA 2WCEA 1K96A 1QJTA 5I2LA 5AEQA 1DJYA 4MVFA 2FCEA 1F71A 4C0JA 1C7VA 1WDCB 3BUMB 1UWOA 1J7OA 1B7TZ 1GGWA 4FQOA 4MRYA 1SCMB 1LVCD 1YUSA 2LP3A 3BQ3A 1ODBA 1TNPA 4PE7A 4YGCB 1CLLA 1L2OC 5PALA 4ICBA 2CBLA 1ALVA 2M7NA 3I5HC 3CGAA 4MEWA 1K93D 3HX4A 3RM1A 2BBNA 1NPQA 1S6IA 1M39A 2K2FA 1S1EA 1S5GZ 3PFVA 4GBAA 1OQPA 1IG5A 3SG4A 1GGZA 1KFUS 1L2OB 4PDZA 2ZRTA 3ZWHA 1SRAA 3I5HB 1XFXO 1DGVA 5I8NA 1WLMA 4AOMA 4ORBB 4E68A 1QXPA 1UHHA 1WRKA 2SCPA 4DRWA 1QV0A 1NCZA 1SW8A 2QACA 4AQIA 2FOTA 2JNFA 2LMVA 2ZN8A 1B8RA 3KF9A 1CFFA 1CMFA 1Y1AA 4HREE 1B9AA 3ZNIA 1AP4A 3BOWB 2LUXA 2KBIA 2PMYA 1AHRA 2K7DA 1NUBA 1QX5B 3H4SE 3FS7A 3SIAA 1PVBA 1WLZA 2H2KA 1J7RA 1V1GA 1UURA 3MSEB 2WNDA 1FF1A 3NSIA 3VROA 2L50A 2HF5A 3IF7A 2CNPA 4BY5A 1CMGA 4YRUA 1A75A 1B8LA 3CTNA 3VRQA 1DMOA 4ZCUA 2GGMA 1CDPA 4PHJA 3CLNA 3DD4A 2M9GA 3O6BA 1DJXA 1WY9A 1OSAA 1TCOB 1F8HA 2K61A 1IRJA 2OPOA 3VGOA 2ISDA 3EK4A 3HCMA 5D69A 1IH0A 2GV5A 1V1FA 2B1UA 2P6BB 1IWQA 1K8UA 1TCFA 1PSBA 4I5JA 1NX0A 1H4BA 3DF0A 1IQ3A 2KFHA 2KAYA 2LMTA 3DVEA
chains in the Genus database with same CATH superfamily
1HT9A 2AAOA 4YGAA 1QLSA 1DJIA 3O78A 2GTEA 2CXJA 2M8UA 2M0RA 3DXLA 1J55A 3FE9A 1S26D 3KHEA 3N7HA 2GGZA 1Z2CB 2ZNDA 2IS9A 1N2DA 3EKJA 1IKUA 1M45A 5HLOA 3S0AA 4WRIA 3WHTB 1QIVA 2BKIB 1M31A 2I18A 1TIZA 2BBMA 2R2IA 4GNKB 2KFGA 2ERBA 1OW4A 1C7WA 1QVIY 1SKTA 1Z4HA 3IQQA 2MLFC 1F54A 4ORCB 5AXIA 1KK8C 4HRGA 3LLEA 2HQ8A 1G4YR 1R2UA 1K9UA 1KWOC 1BF5A 5K89A 3BUWB 3S0EA 3VRRA 5ER4X 1CLMA 4USLA 3AAJA 2L0PA 2CT9A 3CDNA 1ZACA 1CDNA 1KK8B 1SK6D 2ZRSA 3CZTX 1EJ3A 3D75A 1QIWA 1WRZA 1KWOB 2L4HA 4DUQA 1F70A 1A29A 4MN0A 2LANA 1MQ1A 1KK7Y 2JZIA 3M0WA 1CFCA 1OMRA 4QJ4B 2E6WA 3BFBA 3D73A 4GGFC 5HKZA 1UUSA 2BCBA 5CSFA 2PYQA 1XA5A 2Y5IA 2BECA 1S36A 3FIAA 3GK4X 5AFPA 2QEBA 5TNCA 3S0GA 2FCDA 1LXFC 4OKHA 1SCVA 2JT3A 1ZFSA 3SS5A 2F2PA 2CTNA 1SR6B 2KGRA 2LVKA 2M49B 1XK4A 1B7TY 1SPYA 3PN7C 3SS4A 1DF0B 1F4QA 5G08A 2L2CA 2LE9B 5AERA 5HYDA 1LKJA 1FW4A 2KI6D 2L51A 2LCPA 3OB2B 2MAZA 4C0KA 3CABA 3GOFA 3PN7B 5ER5A 1AVSA 2JXLA 3Q8IA 2LHIA 3D0YB 3CZ2A 4C0LA 1NP8A 2KFFA 2JT0A 3B88A 1C3YA 1K9PA 1Y1UA 4A4CA 2OS8C 3TUYC 3KO0A 1BT6A 1Q80A 2HETA 3F45A 1M63B 3NHTA 1YX7A 3TZ1A 1UHNA 4GUKA 1C07A 2EC6C 4IL1A 1H8BA 1MF8B 5D3OA 2LLTA 2OS8B 3TUYB 1JBAA 1QTXA 1D1OA 1KFXL 3VRPA 5HKYA 1NYAA 2BL0C 2G2BA 2QPTA 4WQ3A 4A4BA 1OOFA 3BYAA 2EC6B 1K9KA 3R1OA 2KAVA 3TDIA 1B47A 3L4AA 5BPJA 2K8MB 3VRNA 1A2XA 1YURA 2KOTA 1G8IA 2BL0B 1YRTB 1DEKA 2ZFDA 4XJKA 4AQJA 1IJ5A 4QJ5B 2WOSA 2JWWA 2NZ0A 3EVUA 5FI7A 2JNXA 3SG5A 4DIRA 1KSMA 3QRXA 1SY9A 2M1KB 4JWQA 1FI6A 3S0DA 1BMOA 3FE6A 2F8PA 5KSZA 1QASA 2KHNA 1CDLA 2JRFA 1U5IA 1BR1B 2LLSA 1XYDA 1RFJA 4MSPA 3L47A 3BUOB 4OZDA 4ETOA 2LV7A 1M46A 2KI4C 2Y1NA 1PRWA 3CR2A 1QWVA 1CNPA 3O4XA 3NHIA 4Q04A 2EGDA 1KQVA 2LHLA 4QJ3B 3OGNA 3CR5X 5GQQC 2RGIA 1XFVO 1SSEB 3D0YA 4M2OA 1RECA 4YBHB 2M1UA 3PALA 1JWDA 2F33A 1MR8A 2F3ZA 1P28A 2BCAA 2KI4B 1EH2A 3NXAA 1TTXA 2MRDA 2KAXA 3IVTA 1A4PA 2Q4UA 5J3XA 1EL4A 1JFKA 1OE9B 1R6PA 3VB1A 1Y0VH 2OTGC 1QV1A 5D7FA 1RROA 2K2AA 3WXAA 4OR9B 4CFQA 3I5IC 2VRGA 2EHBA 2LVVA 3DVMA 4U8DA 2HPSA 3OX6A 1AJ5A 1CM4A 1C3ZA 1X02A 1BLQA 3DZTA 2LAPA 1DJZA 1N65A 2KI6C 5EL2A 3NSKA 1IGVA 2OTGB 3PATA 5I94A 1DJHA 3TDUA 3SJSA 1CDMA 3I5IB 4HSZA 1MXLC 2H61C 3CYZA 3DVKA 3BOWA 1UHJA 1DGUA 1JF2A 1XFRA 1RJVA 2G9BA 3OB1B 1MXEA 1KCYA 3GK2A 2NCPA 1NX2A 1OZSA 3EK8A 4CFRA 4NQGA 1BG1A 5HLVA 5CSJA 1KFXS 2NCOA 2Q91A 1K94A 4F0ZB 3A8RA 1OOGA 1DC1A 3DYEA 1NX1A 3OP0A 1JC2A 1XVJA 2WCLA 4DS7A 4PCWA 3FE8A 3V2LA 4OV2A 4I5KA 1AJ4A 2KLDA 2MHHA 2F3YA 1HQVA 2JPOA 1NCYA 3A4UB 2MJWB 1J1EA 2PASA 1IIOA 3TS5C 1ZMZA 2FJYA 3DVJA 3PM8A 4MZJA 2I7AA 5I2OA 3BUXB 1B4CA 1GJYA 1SMGA 3OBVA 4ZCVA 1PK0D 1YUUA 2KQ6A 1S3PA 4PE0A 1DJGA 4PE1A 5HKWA 2LP2A 1SL9A 1ZOTB 2L4IA 4YGDB 3TS5B 1DT7B 2PVBA 2JXCA 3BFHA 3SG3A 2ZNEA 1FPWA 2Y1MA 4P5OE 4PE4A 2O5GA 1K90D 2ZN9A 1EG4A 3K1EA 1IJ6A 2WORA 2LM5A 1TN4A 3KEVA 1KK7Z 1S5GY 1F55A 3CWGA 5AANA 3BUNB 2JC2A 4DCKA 1JSAA 2Y4QA 1BJFA 3LK0A 1Y6WA 1B8CA 1Y1XA 1SCMC 2KGBC 2WCHA 1MHOA 1TNWA 4MZLA 3S0BA 4KYNA 1K2HA 2LMUA 1NCXA 2F2OA 2BE4A 1A75B 2KYFA 1LA0A 2E30A 3RLZA 1SL8A 3SG7A 1PALA 4I5NB 3LCPC 1W7IB 3B7AA 1YTZC 2WCFA 2M97A 1G33A 1TUZA 3JVTC 4JQ0D 3I5FC 1NSHA 1CFDA 1L7ZA 1N0YA 1CTRA 1J7PA 1YVHA 4P2YB 1DTLA 1EG3A 1SNLA 4IJ7A 4INXA 5I2QA 1AK8A 1SBJA 3DF0B 4XYNA 3UNWA 1CFPA 1JUOA 3JVTB 1XFUO 3I5FB 1PVAA 1EXRA 3O4YA 4R1EA 1BOCA 4GGFA 5IBWA 4L9MA 3R1PA 1DF0A 1UHIA 1YUTA 2KDHA 2MA2A 4N1GA 3L4LA 2WCMA 3ICBA 1ZUZA 4N5XA 2K7OA 1YRUB 2PRUA 2PALA 4GAOA 3E3RA 3EVRA 2WC8A 3WNXB 1OOHA 1LA3A 2K7CA 2NXQA 4NDDA 2BNXA 2JPTA 4UPGA 1FI5A 2KYCA 2L5XB 2JQ6A 2M3WA 3EVVA 1CB1A 4CIDA 3EKHA 1FBVA 3BFAA 1QS7A 2JT8A 1B1GA 2O60A 2D8NA 3FWBA 4MZKA 1GQMA 4BY4A 2BKHB 2K60A 2KBMA 2YGUA 1QLKA 1OOJA 4PALA 4GGNA 2QEHA 3KPXA 1IQ5A 4OCIA 3JTDC 2JTZA 1OMVA 4HRHA 2JOJA 3UO9A 3D77A 1BODA 3PLFB 3PM2A 2JULA 4PHNA 5FI6A 5FYXA 3C1VA 4CLNA 2KSPA 2NLNA 2AMIA 3NSOA 4PHKA 2L2EA 1MUXA 2V53A 2LLUA 1ALWA 5KU1A 1QATA 3EK7A 2LVJA 1LINA 3JTDB 1TNQA 4YI8A 1XFWO 2ZKMX 4M2QA 1XK4C 1BU3A 1ORGA 3O2PA 2LUCA 4M2PA 3TDZA 5B8IB 1PULA 1F4OA 1RK9A 3AKBA 1WRLA 3I5GC 4WQ2A 1AUIB 3B87A 2SASA 3BXKA 1KFUL 3WHUB 4NDCA 2TN4A 3CS1A 1CKKA 3FWCA 2FJUB 3DY9A 2LC5A 4MLWA 3I5GB 4NDBA 3SG6A 3SG2A 4YGBB 3B6XA 3K21A 1RWYA 2K7BA 1YX8A 1XO5A 2L98A 3OHMB 4I5LB 5DKQA 2AUCA 1MWNA 1VRKA 2DOQA 5KTYA 1GM0A 2P71A 2LVIA 1XFZO 3LL8B 1NX3A 1QX7A 2KQYA 1RTP1 1TRFA 4GFTA 2KNEA 3SIBA 2A4JA 1NWDA 4JD9A 4MRXA 4FTGA 4N1FA 2I94A 1CLBA 1QVIZ 3OX5A 4INWA 1S6CA 1S6JA 1J1DA 4OVNF 2CCMA 3CZ1A 1SL7A 1OMDA 4YGEB 1DJWA 3D10A 1XFYO 2COLB 3R72A 2QDIA 4CPVA 2WCJA 3AAKA 1YR5A 5CSIA 1TNXA 2MLEC 4JPZB 3CR4X 1JFJA 4PHMA 1NIWA 5CPVA 2PQLA 3IQOA 2JTTA 1OZOA 1KQMC 1W7JB 4MBEA 5F6TA 2BE6A 5JJGA 5CSNA 1E8AA 1SYMA 2L5YA 1UP5A 3PSRA 4TNCA 1SR6C 1QX2A 1UHKA 2K0JA 2QEOA 1BR4B 1J7QA 4XJKB 1DQEA 2HQWA 4YI9A 1DVIA 1K95A 5FI2A 2PSRA 2M29A 1DELA 5DKRA 1KQMB 1CM1A 2I2RE 1YVLA 2WCBA 3GK1A 4JKTA 2LNKA 1JF0A 1WDCC 1TOPA 3AKAA 4GPLB 4ORAB 1KSOA 1U5IB 2BCXA 2M7LA 4D1EA 2JU0A 3LK1A 5JOLA 3NSLA 2MBXA 1PSRA 2H61A 1A03A 5DKNA 2WCEA 1K96A 1QJTA 3QMEA 5I2LA 5AEQA 3SS3A 1DJYA 4MVFA 2FCEA 1F71A 4C0JA 1C7VA 1WDCB 3BUMB 1UWOA 1J7OA 1B7TZ 1GGWA 4FQOA 2WC6A 4MRYA 1SCMB 1LVCD 1YUSA 2LP3A 3BQ3A 1ODBA 1TNPA 4PE7A 4YGCB 1CLLA 1L2OC 5PALA 4ICBA 2CBLA 1ALVA 2M7NA 2P70A 3BJHA 3I5HC 3CGAA 4MEWA 1K93D 3HX4A 3RM1A 2QEVA 2BBNA 1NPQA 1S6IA 1TWOA 1M39A 2KPHA 1T14A 2K2FA 1S1EA 1S5GZ 3PFVA 4GBAA 1OQPA 1IG5A 4FQTA 3SG4A 1GGZA 1KFUS 1L2OB 3B86A 2ZRTA 4PDZA 3ZWHA 1SRAA 3I5HB 1XFXO 1DGVA 5I8NA 3D74A 1WLMA 4AOMA 4ORBB 4E68A 1QXPA 3NGVA 1UHHA 3R1VA 1WRKA 2WC5A 2SCPA 4DRWA 2H8VA 1QV0A 3D78A 1NCZA 4PT1A 1SW8A 2QACA 4AQIA 2FOTA 2JNFA 2LMVA 2ZN8A 1B8RA 3KF9A 1CFFA 1CMFA 1Y1AA 2BAPA 4HREE 1B9AA 3ZNIA 1AP4A 3BOWB 2LUXA 3PJIA 5DICA 1LS8A 2KBIA 2PMYA 1AHRA 3CZ0A 2K7DA 1NUBA 1QX5B 3H4SE 3FS7A 3SIAA 1PVBA 1WLZA 2H2KA 1J7RA 5HL1A 1V1GA 1UURA 3MSEB 2WNDA 1FF1A 3NSIA 3VROA 2L50A 2HF5A 3IF7A 2CNPA 4BY5A 1CMGA 1OOIX 4YRUA 1A75A 3RZSA 1B8LA 3CTNA 3VRQA 1DMOA 2WCKA 4ZCUA 2GGMA 1CDPA 3D76A 3CLNA 4PHJA 3DD4A 2M9GA 3O6BA 1DJXA 1WY9A 1OSAA 1TCOB 1F8HA 2K61A 1W9ZA 1IRJA 2OPOA 3VGOA 2ISDA 3EG5B 3EK4A 3HCMA 5D69A 2GV5A 1IH0A 1TUJA 1V1FA 2B1UA 2KLEA 2P6BB 1IWQA 1K8UA 1TCFA 1PSBA 4I5JA 3S0FA 1NX0A 1H4BA 3DF0A 1IQ3A 2KFHA 2KAYA 2LMTA 4F7FA 3DVEA
chains in the Genus database with same CATH topology
1HT9A 2AAOA 4YGAA 1QLSA 1DJIA 3O78A 2CXJA 2M8UA 2M0RA 1J55A 1S26D 3KHEA 2GGZA 2ZNDA 2IS9A 1N2DA 3EKJA 1IKUA 1M45A 5HLOA 4WRIA 3WHTB 1QIVA 2BKIB 1M31A 2I18A 1TIZA 2BBMA 2R2IA 4GNKB 2KFGA 1C7WA 1QVIY 1SKTA 3IQQA 2MLFC 1F54A 4ORCB 5AXIA 1KK8C 4HRGA 3LLEA 2HQ8A 1G4YR 1R2UA 1K9UA 1KWOC 1BF5A 5K89A 3BUWB 3VRRA 5ER4X 1CLMA 4USLA 3AAJA 2L0PA 2CT9A 1ZACA 1CDNA 1KK8B 1SK6D 2ZRSA 3CZTX 1EJ3A 1QIWA 1WRZA 1KWOB 2L4HA 4DUQA 1F70A 1A29A 4MN0A 2LANA 1MQ1A 1KK7Y 2JZIA 3M0WA 1CFCA 1OMRA 4QJ4B 2E6WA 4GGFC 5HKZA 1UUSA 2BCBA 5CSFA 1XA5A 2Y5IA 2BECA 1S36A 3FIAA 3GK4X 5AFPA 5TNCA 2FCDA 1LXFC 4OKHA 1SCVA 2JT3A 1ZFSA 2F2PA 2CTNA 1SR6B 2KGRA 2LVKA 2M49B 1XK4A 1B7TY 1SPYA 3PN7C 1DF0B 1F4QA 5G08A 2LE9B 5AERA 5HYDA 1LKJA 1FW4A 2KI6D 2L51A 2LCPA 3OB2B 2MAZA 4C0KA 3GOFA 3PN7B 5ER5A 1AVSA 2JXLA 2LHIA 3D0YB 4C0LA 1NP8A 2KFFA 2JT0A 1K9PA 1Y1UA 4A4CA 2OS8C 3TUYC 3KO0A 1BT6A 1Q80A 2HETA 3F45A 1M63B 1YX7A 3TZ1A 1UHNA 4GUKA 1C07A 2EC6C 4IL1A 1H8BA 1MF8B 2LLTA 2OS8B 3TUYB 1JBAA 1QTXA 1D1OA 1KFXL 3VRPA 5HKYA 1NYAA 2BL0C 2G2BA 2QPTA 4WQ3A 4A4BA 3BYAA 2EC6B 1K9KA 2KAVA 3TDIA 1B47A 5BPJA 2K8MB 3VRNA 1A2XA 1YURA 2KOTA 1G8IA 2BL0B 1YRTB 2ZFDA 4XJKA 4AQJA 4QJ5B 1IJ5A 2WOSA 2JWWA 2NZ0A 3EVUA 2JNXA 3SG5A 4DIRA 1KSMA 3QRXA 1SY9A 2M1KB 4JWQA 1FI6A 1BMOA 2F8PA 5KSZA 1QASA 2KHNA 1CDLA 2JRFA 1U5IA 1BR1B 2LLSA 1XYDA 1RFJA 4MSPA 3BUOB 4ETOA 2LV7A 1M46A 2KI4C 2Y1NA 1PRWA 3CR2A 1CNPA 4Q04A 2EGDA 1KQVA 2LHLA 4QJ3B 3CR5X 5GQQC 2RGIA 1XFVO 3D0YA 4M2OA 1RECA 4YBHB 2M1UA 3PALA 1JWDA 2F33A 1MR8A 2F3ZA 2BCAA 2KI4B 1EH2A 3NXAA 1TTXA 2MRDA 2KAXA 1A4PA 2Q4UA 5J3XA 1EL4A 1JFKA 1OE9B 1R6PA 1Y0VH 2OTGC 1QV1A 5D7FA 1RROA 2K2AA 3WXAA 4OR9B 4CFQA 3I5IC 2VRGA 2EHBA 2LVVA 3DVMA 4U8DA 2HPSA 3OX6A 1AJ5A 1CM4A 1X02A 1BLQA 2LAPA 1DJZA 1N65A 2KI6C 3NSKA 1IGVA 2OTGB 3PATA 1DJHA 3TDUA 3SJSA 1CDMA 3I5IB 4HSZA 1MXLC 2H61C 3DVKA 3BOWA 1UHJA 1DGUA 1JF2A 1RJVA 2G9BA 3OB1B 1MXEA 1KCYA 3GK2A 2NCPA 1NX2A 1OZSA 3EK8A 4CFRA 4NQGA 1BG1A 5HLVA 5CSJA 1KFXS 2NCOA 2Q91A 1K94A 4F0ZB 3A8RA 1NX1A 3OP0A 1JC2A 1XVJA 4DS7A 4PCWA 4OV2A 4I5KA 1AJ4A 2MHHA 2F3YA 1HQVA 1NCYA 3A4UB 2MJWB 1J1EA 2PASA 3TS5C 1ZMZA 3DVJA 3PM8A 4MZJA 2I7AA 5I2OA 3BUXB 1B4CA 1GJYA 1SMGA 4ZCVA 1PK0D 1YUUA 2KQ6A 1S3PA 4PE0A 1DJGA 4PE1A 5HKWA 2LP2A 1SL9A 1ZOTB 2L4IA 4YGDB 3TS5B 1DT7B 2PVBA 2JXCA 3SG3A 2ZNEA 1FPWA 2Y1MA 4P5OE 4PE4A 2O5GA 1K90D 2ZN9A 1EG4A 1IJ6A 2WORA 2LM5A 1TN4A 3KEVA 1KK7Z 1S5GY 1F55A 3CWGA 5AANA 3BUNB 2JC2A 4DCKA 1JSAA 2Y4QA 1BJFA 3LK0A 1Y6WA 1B8CA 1Y1XA 1SCMC 2KGBC 4MZLA 1MHOA 1TNWA 1K2HA 2LMUA 1NCXA 2F2OA 2BE4A 1A75B 2KYFA 1LA0A 2E30A 3RLZA 1SL8A 3SG7A 1PALA 4I5NB 3LCPC 1W7IB 1YTZC 2WCFA 2M97A 1G33A 3JVTC 4JQ0D 3I5FC 1NSHA 1CFDA 1L7ZA 1N0YA 1CTRA 1J7PA 1YVHA 4P2YB 1DTLA 1EG3A 1SNLA 5I2QA 1AK8A 1SBJA 3DF0B 4XYNA 1CFPA 1JUOA 3JVTB 1XFUO 3I5FB 1PVAA 1EXRA 3O4YA 4R1EA 1BOCA 4GGFA 5IBWA 4L9MA 1DF0A 1UHIA 1YUTA 2KDHA 2MA2A 4N1GA 3ICBA 4N5XA 1ZUZA 2K7OA 1YRUB 2PRUA 2PALA 4GAOA 3E3RA 3EVRA 2WC8A 3WNXB 1LA3A 2K7CA 2NXQA 4NDDA 2JPTA 1FI5A 4UPGA 2KYCA 2L5XB 2JQ6A 2M3WA 3EVVA 1CB1A 4CIDA 3EKHA 1FBVA 1QS7A 2JT8A 1B1GA 2O60A 2D8NA 3FWBA 4MZKA 1GQMA 4BY4A 2BKHB 2KBMA 1QLKA 1OOJA 4PALA 4GGNA 3KPXA 1IQ5A 4OCIA 3JTDC 2JTZA 1OMVA 4HRHA 2JOJA 1BODA 3PLFB 2JULA 4PHNA 5FYXA 3C1VA 4CLNA 2KSPA 2NLNA 2AMIA 3NSOA 4PHKA 2L2EA 1MUXA 2V53A 2LLUA 1ALWA 5KU1A 1QATA 3EK7A 2LVJA 1LINA 3JTDB 1TNQA 4YI8A 1XFWO 2ZKMX 4M2QA 1XK4C 1BU3A 3O2PA 2LUCA 4M2PA 3TDZA 5B8IB 1PULA 1F4OA 1RK9A 3AKBA 1WRLA 3I5GC 4WQ2A 1AUIB 2SASA 3BXKA 1KFUL 3WHUB 4NDCA 2TN4A 3CS1A 1CKKA 3FWCA 2FJUB 4MLWA 2LC5A 3I5GB 4NDBA 3SG6A 3SG2A 4YGBB 3K21A 1RWYA 2K7BA 1YX8A 1XO5A 2L98A 3OHMB 4I5LB 5DKQA 2AUCA 1MWNA 1VRKA 2DOQA 5KTYA 2LVIA 1XFZO 3LL8B 1NX3A 1QX7A 2KQYA 1RTP1 1TRFA 4GFTA 2KNEA 3SIBA 2A4JA 1NWDA 4MRXA 4FTGA 4N1FA 2I94A 1CLBA 1QVIZ 3OX5A 1S6CA 1S6JA 1J1DA 4OVNF 2CCMA 4YGEB 1SL7A 1OMDA 1DJWA 3D10A 1XFYO 2COLB 4CPVA 3AAKA 1YR5A 5CSIA 1TNXA 2MLEC 4JPZB 3CR4X 1JFJA 4PHMA 1NIWA 5CPVA 3IQOA 2JTTA 1OZOA 1KQMC 1W7JB 4MBEA 5F6TA 2BE6A 5JJGA 5CSNA 1E8AA 1SYMA 1UP5A 3PSRA 4TNCA 1SR6C 1QX2A 1UHKA 2K0JA 1BR4B 1J7QA 4XJKB 4YI9A 2HQWA 1DVIA 1K95A 2PSRA 2M29A 5DKRA 1KQMB 1CM1A 2I2RE 1YVLA 2WCBA 3GK1A 2LNKA 1JF0A 1WDCC 1TOPA 3AKAA 4GPLB 4ORAB 1KSOA 1U5IB 2BCXA 2M7LA 4D1EA 2JU0A 3LK1A 5JOLA 3NSLA 2MBXA 1PSRA 2H61A 1A03A 5DKNA 2WCEA 1K96A 1QJTA 5I2LA 5AEQA 1DJYA 4MVFA 2FCEA 1F71A 4C0JA 1C7VA 1WDCB 3BUMB 1UWOA 1J7OA 1B7TZ 1GGWA 4FQOA 4MRYA 1SCMB 1LVCD 1YUSA 2LP3A 3BQ3A 1ODBA 1TNPA 4PE7A 4YGCB 1CLLA 1L2OC 5PALA 4ICBA 2CBLA 1ALVA 2M7NA 3I5HC 3CGAA 4MEWA 1K93D 3HX4A 3RM1A 2BBNA 1NPQA 1S6IA 1M39A 2K2FA 1S1EA 1S5GZ 3PFVA 4GBAA 1OQPA 1IG5A 3SG4A 1GGZA 1KFUS 1L2OB 4PDZA 2ZRTA 3ZWHA 1SRAA 3I5HB 1XFXO 1DGVA 5I8NA 1WLMA 4AOMA 4ORBB 4E68A 1QXPA 1UHHA 1WRKA 2SCPA 4DRWA 1QV0A 1NCZA 1SW8A 2QACA 4AQIA 2FOTA 2JNFA 2LMVA 2ZN8A 1B8RA 3KF9A 1CFFA 1CMFA 1Y1AA 4HREE 1B9AA 3ZNIA 1AP4A 3BOWB 2LUXA 2KBIA 2PMYA 1AHRA 2K7DA 1NUBA 1QX5B 3H4SE 3FS7A 3SIAA 1PVBA 1WLZA 2H2KA 1J7RA 1V1GA 1UURA 3MSEB 2WNDA 1FF1A 3NSIA 3VROA 2L50A 2HF5A 3IF7A 2CNPA 4BY5A 1CMGA 4YRUA 1A75A 1B8LA 3CTNA 3VRQA 1DMOA 4ZCUA 2GGMA 1CDPA 4PHJA 3CLNA 3DD4A 2M9GA 3O6BA 1DJXA 1WY9A 1OSAA 1TCOB 1F8HA 2K61A 1IRJA 2OPOA 3VGOA 2ISDA 3EK4A 3HCMA 5D69A 1IH0A 2GV5A 1V1FA 2B1UA 2P6BB 1IWQA 1K8UA 1TCFA 1PSBA 4I5JA 1NX0A 1H4BA 3DF0A 1IQ3A 2KFHA 2KAYA 2LMTA 3DVEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HT9 A;  2AAO A;  4YGA A;  1QLS A;  1DJI A;  3O78 A;  2CXJ A;  2M8U A;  2M0R A;  1J55 A;  1S26 D;  3KHE A;  2GGZ A;  2ZND A;  2IS9 A;  1N2D A;  3EKJ A;  1IKU A;  1M45 A;  5HLO A;  4WRI A;  3WHT B;  1QIV A;  2BKI B;  1M31 A;  2I18 A;  1TIZ A;  2BBM A;  2R2I A;  4GNK B;  2KFG A;  1C7W A;  1QVI Y;  1SKT A;  3IQQ A;  2MLF C;  1F54 A;  4ORC B;  5AXI A;  1KK8 C;  4HRG A;  3LLE A;  2HQ8 A;  1G4Y R;  1R2U A;  1K9U A;  1KWO C;  1BF5 A;  5K89 A;  3BUW B;  3VRR A;  5ER4 X;  1CLM A;  4USL A;  3AAJ A;  2L0P A;  2CT9 A;  1ZAC A;  1CDN A;  1KK8 B;  1SK6 D;  2ZRS A;  3CZT X;  1EJ3 A;  1QIW A;  1WRZ A;  1KWO B;  2L4H A;  4DUQ A;  1F70 A;  1A29 A;  4MN0 A;  2LAN A;  1MQ1 A;  1KK7 Y;  2JZI A;  3M0W A;  1CFC A;  1OMR A;  4QJ4 B;  2E6W A;  4GGF C;  5HKZ A;  1UUS A;  2BCB A;  5CSF A;  1XA5 A;  2Y5I A;  2BEC A;  1S36 A;  3FIA A;  3GK4 X;  5AFP A;  5TNC A;  2FCD A;  1LXF C;  4OKH A;  1SCV A;  2JT3 A;  1ZFS A;  2F2P A;  2CTN A;  1SR6 B;  2KGR A;  2LVK A;  2M49 B;  1XK4 A;  1B7T Y;  1SPY A;  3PN7 C;  1DF0 B;  1F4Q A;  5G08 A;  2LE9 B;  5AER A;  5HYD A;  1LKJ A;  1FW4 A;  2KI6 D;  2L51 A;  2LCP A;  3OB2 B;  2MAZ A;  4C0K A;  3GOF A;  3PN7 B;  5ER5 A;  1AVS A;  2JXL A;  2LHI A;  3D0Y B;  4C0L A;  1NP8 A;  2KFF A;  2JT0 A;  1K9P A;  1Y1U A;  4A4C A;  2OS8 C;  3TUY C;  3KO0 A;  1BT6 A;  1Q80 A;  2HET A;  3F45 A;  1M63 B;  1YX7 A;  3TZ1 A;  1UHN A;  4GUK A;  1C07 A;  2EC6 C;  4IL1 A;  1H8B A;  1MF8 B;  2LLT A;  2OS8 B;  3TUY B;  1JBA A;  1QTX A;  1D1O A;  1KFX L;  3VRP A;  5HKY A;  1NYA A;  2BL0 C;  2G2B A;  2QPT A;  4WQ3 A;  4A4B A;  3BYA A;  2EC6 B;  1K9K A;  2KAV A;  3TDI A;  1B47 A;  5BPJ A;  2K8M B;  3VRN A;  1A2X A;  1YUR A;  2KOT A;  1G8I A;  2BL0 B;  1YRT B;  2ZFD A;  4XJK A;  4AQJ A;  4QJ5 B;  1IJ5 A;  2WOS A;  2JWW A;  2NZ0 A;  3EVU A;  2JNX A;  3SG5 A;  4DIR A;  1KSM A;  3QRX A;  1SY9 A;  2M1K B;  4JWQ A;  1FI6 A;  1BMO A;  2F8P A;  5KSZ A;  1QAS A;  2KHN A;  1CDL A;  2JRF A;  1U5I A;  1BR1 B;  2LLS A;  1XYD A;  1RFJ A;  4MSP A;  3BUO B;  4ETO A;  2LV7 A;  1M46 A;  2KI4 C;  2Y1N A;  1PRW A;  3CR2 A;  1CNP A;  4Q04 A;  2EGD A;  1KQV A;  2LHL A;  4QJ3 B;  3CR5 X;  5GQQ C;  2RGI A;  1XFV O;  3D0Y A;  4M2O A;  1REC A;  4YBH B;  2M1U A;  3PAL A;  1JWD A;  2F33 A;  1MR8 A;  2F3Z A;  2BCA A;  2KI4 B;  1EH2 A;  3NXA A;  1TTX A;  2MRD A;  2KAX A;  1A4P A;  2Q4U A;  5J3X A;  1EL4 A;  1JFK A;  1OE9 B;  1R6P A;  1Y0V H;  2OTG C;  1QV1 A;  5D7F A;  1RRO A;  2K2A A;  3WXA A;  4OR9 B;  4CFQ A;  3I5I C;  2VRG A;  2EHB A;  2LVV A;  3DVM A;  4U8D A;  2HPS A;  3OX6 A;  1AJ5 A;  1CM4 A;  1X02 A;  1BLQ A;  2LAP A;  1DJZ A;  1N65 A;  2KI6 C;  3NSK A;  1IGV A;  2OTG B;  3PAT A;  1DJH A;  3TDU A;  3SJS A;  1CDM A;  3I5I B;  4HSZ A;  1MXL C;  2H61 C;  3DVK A;  3BOW A;  1UHJ A;  1DGU A;  1JF2 A;  1RJV A;  2G9B A;  3OB1 B;  1MXE A;  1KCY A;  3GK2 A;  2NCP A;  1NX2 A;  1OZS A;  3EK8 A;  4CFR A;  4NQG A;  1BG1 A;  5HLV A;  5CSJ A;  1KFX S;  2NCO A;  2Q91 A;  1K94 A;  4F0Z B;  3A8R A;  1NX1 A;  3OP0 A;  1JC2 A;  1XVJ A;  4DS7 A;  4PCW A;  4OV2 A;  4I5K A;  1AJ4 A;  2MHH A;  2F3Y A;  1HQV A;  1NCY A;  3A4U B;  2MJW B;  1J1E A;  2PAS A;  3TS5 C;  1ZMZ A;  3DVJ A;  3PM8 A;  4MZJ A;  2I7A A;  5I2O A;  3BUX B;  1B4C A;  1GJY A;  1SMG A;  4ZCV A;  1PK0 D;  1YUU A;  2KQ6 A;  1S3P A;  4PE0 A;  1DJG A;  4PE1 A;  5HKW A;  2LP2 A;  1SL9 A;  1ZOT B;  2L4I A;  4YGD B;  3TS5 B;  1DT7 B;  2PVB A;  2JXC A;  3SG3 A;  2ZNE A;  1FPW A;  2Y1M A;  4P5O E;  4PE4 A;  2O5G A;  1K90 D;  2ZN9 A;  1EG4 A;  1IJ6 A;  2WOR A;  2LM5 A;  1TN4 A;  3KEV A;  1KK7 Z;  1S5G Y;  1F55 A;  3CWG A;  5AAN A;  3BUN B;  2JC2 A;  4DCK A;  1JSA A;  2Y4Q A;  1BJF A;  3LK0 A;  1Y6W A;  1B8C A;  1Y1X A;  1SCM C;  2KGB C;  4MZL A;  1MHO A;  1TNW A;  1K2H A;  2LMU A;  1NCX A;  2F2O A;  2BE4 A;  1A75 B;  2KYF A;  1LA0 A;  2E30 A;  3RLZ A;  1SL8 A;  3SG7 A;  1PAL A;  4I5N B;  3LCP C;  1W7I B;  1YTZ C;  2WCF A;  2M97 A;  1G33 A;  3JVT C;  4JQ0 D;  3I5F C;  1NSH A;  1CFD A;  1L7Z A;  1N0Y A;  1CTR A;  1J7P A;  1YVH A;  4P2Y B;  1DTL A;  1EG3 A;  1SNL A;  5I2Q A;  1AK8 A;  1SBJ A;  3DF0 B;  4XYN A;  1CFP A;  1JUO A;  3JVT B;  1XFU O;  3I5F B;  1PVA A;  1EXR A;  3O4Y A;  4R1E A;  1BOC A;  4GGF A;  5IBW A;  4L9M A;  1DF0 A;  1UHI A;  1YUT A;  2KDH A;  2MA2 A;  4N1G A;  3ICB A;  4N5X A;  1ZUZ A;  2K7O A;  1YRU B;  2PRU A;  2PAL A;  4GAO A;  3E3R A;  3EVR A;  2WC8 A;  3WNX B;  1LA3 A;  2K7C A;  2NXQ A;  4NDD A;  2JPT A;  1FI5 A;  4UPG A;  2KYC A;  2L5X B;  2JQ6 A;  2M3W A;  3EVV A;  1CB1 A;  4CID A;  3EKH A;  1FBV A;  1QS7 A;  2JT8 A;  1B1G A;  2O60 A;  2D8N A;  3FWB A;  4MZK A;  1GQM A;  4BY4 A;  2BKH B;  2KBM A;  1QLK A;  1OOJ A;  4PAL A;  4GGN A;  3KPX A;  1IQ5 A;  4OCI A;  3JTD C;  2JTZ A;  1OMV A;  4HRH A;  2JOJ A;  1BOD A;  3PLF B;  2JUL A;  4PHN A;  5FYX A;  3C1V A;  4CLN A;  2KSP A;  2NLN A;  2AMI A;  3NSO A;  4PHK A;  2L2E A;  1MUX A;  2V53 A;  2LLU A;  1ALW A;  5KU1 A;  1QAT A;  3EK7 A;  2LVJ A;  1LIN A;  3JTD B;  1TNQ A;  4YI8 A;  1XFW O;  2ZKM X;  4M2Q A;  1XK4 C;  1BU3 A;  3O2P A;  2LUC A;  4M2P A;  3TDZ A;  5B8I B;  1PUL A;  1F4O A;  1RK9 A;  3AKB A;  1WRL A;  3I5G C;  4WQ2 A;  1AUI B;  2SAS A;  3BXK A;  1KFU L;  3WHU B;  4NDC A;  2TN4 A;  3CS1 A;  1CKK A;  3FWC A;  2FJU B;  4MLW A;  2LC5 A;  3I5G B;  4NDB A;  3SG6 A;  3SG2 A;  4YGB B;  3K21 A;  1RWY A;  2K7B A;  1YX8 A;  1XO5 A;  2L98 A;  3OHM B;  4I5L B;  5DKQ A;  2AUC A;  1MWN A;  1VRK A;  2DOQ A;  5KTY A;  2LVI A;  1XFZ O;  3LL8 B;  1NX3 A;  1QX7 A;  2KQY A;  1RTP 1;  1TRF A;  4GFT A;  2KNE A;  3SIB A;  2A4J A;  1NWD A;  4MRX A;  4FTG A;  4N1F A;  2I94 A;  1CLB A;  1QVI Z;  3OX5 A;  1S6C A;  1S6J A;  1J1D A;  4OVN F;  2CCM A;  4YGE B;  1SL7 A;  1OMD A;  1DJW A;  3D10 A;  1XFY O;  2COL B;  4CPV A;  3AAK A;  1YR5 A;  5CSI A;  1TNX A;  2MLE C;  4JPZ B;  3CR4 X;  1JFJ A;  4PHM A;  1NIW A;  5CPV A;  3IQO A;  2JTT A;  1OZO A;  1KQM C;  1W7J B;  4MBE A;  5F6T A;  2BE6 A;  5JJG A;  5CSN A;  1E8A A;  1SYM A;  1UP5 A;  3PSR A;  4TNC A;  1SR6 C;  1QX2 A;  1UHK A;  2K0J A;  1BR4 B;  1J7Q A;  4XJK B;  4YI9 A;  2HQW A;  1DVI A;  1K95 A;  2PSR A;  2M29 A;  5DKR A;  1KQM B;  1CM1 A;  2I2R E;  1YVL A;  2WCB A;  3GK1 A;  2LNK A;  1JF0 A;  1WDC C;  1TOP A;  3AKA A;  4GPL B;  4ORA B;  1KSO A;  1U5I B;  2BCX A;  2M7L A;  4D1E A;  2JU0 A;  3LK1 A;  5JOL A;  3NSL A;  2MBX A;  1PSR A;  2H61 A;  1A03 A;  5DKN A;  2WCE A;  1K96 A;  1QJT A;  5I2L A;  5AEQ A;  1DJY A;  4MVF A;  2FCE A;  1F71 A;  4C0J A;  1C7V A;  1WDC B;  3BUM B;  1UWO A;  1J7O A;  1B7T Z;  1GGW A;  4FQO A;  4MRY A;  1SCM B;  1LVC D;  1YUS A;  2LP3 A;  3BQ3 A;  1ODB A;  1TNP A;  4PE7 A;  4YGC B;  1CLL A;  1L2O C;  5PAL A;  4ICB A;  2CBL A;  1ALV A;  2M7N A;  3I5H C;  3CGA A;  4MEW A;  1K93 D;  3HX4 A;  3RM1 A;  2BBN A;  1NPQ A;  1S6I A;  1M39 A;  2K2F A;  1S1E A;  1S5G Z;  3PFV A;  4GBA A;  1OQP A;  1IG5 A;  3SG4 A;  1GGZ A;  1KFU S;  1L2O B;  4PDZ A;  2ZRT A;  3ZWH A;  1SRA A;  3I5H B;  1XFX O;  1DGV A;  5I8N A;  1WLM A;  4AOM A;  4ORB B;  4E68 A;  1QXP A;  1UHH A;  1WRK A;  2SCP A;  4DRW A;  1QV0 A;  1NCZ A;  1SW8 A;  2QAC A;  4AQI A;  2FOT A;  2JNF A;  2LMV A;  2ZN8 A;  1B8R A;  3KF9 A;  1CFF A;  1CMF A;  1Y1A A;  4HRE E;  1B9A A;  3ZNI A;  1AP4 A;  3BOW B;  2LUX A;  2KBI A;  2PMY A;  1AHR A;  2K7D A;  1NUB A;  1QX5 B;  3H4S E;  3FS7 A;  3SIA A;  1PVB A;  1WLZ A;  2H2K A;  1J7R A;  1V1G A;  1UUR A;  3MSE B;  2WND A;  1FF1 A;  3NSI A;  3VRO A;  2L50 A;  2HF5 A;  3IF7 A;  2CNP A;  4BY5 A;  1CMG A;  4YRU A;  1A75 A;  1B8L A;  3CTN A;  3VRQ A;  1DMO A;  4ZCU A;  2GGM A;  1CDP A;  4PHJ A;  3CLN A;  3DD4 A;  2M9G A;  3O6B A;  1DJX A;  1WY9 A;  1OSA A;  1TCO B;  1F8H A;  2K61 A;  1IRJ A;  2OPO A;  3VGO A;  2ISD A;  3EK4 A;  3HCM A;  5D69 A;  1IH0 A;  2GV5 A;  1V1F A;  2B1U A;  2P6B B;  1IWQ A;  1K8U A;  1TCF A;  1PSB A;  4I5J A;  1NX0 A;  1H4B A;  3DF0 A;  1IQ3 A;  2KFH A;  2KAY A;  2LMT A;  3DVE A; 
#chains in the Genus database with same CATH topology
 1HT9 A;  2AAO A;  4YGA A;  1QLS A;  1DJI A;  3O78 A;  2GTE A;  2CXJ A;  2M8U A;  2M0R A;  3DXL A;  1J55 A;  3FE9 A;  1S26 D;  3KHE A;  3N7H A;  2GGZ A;  1Z2C B;  2ZND A;  2IS9 A;  1N2D A;  3EKJ A;  1IKU A;  1M45 A;  5HLO A;  3S0A A;  4WRI A;  3WHT B;  1QIV A;  2BKI B;  1M31 A;  2I18 A;  1TIZ A;  2BBM A;  2R2I A;  4GNK B;  2KFG A;  2ERB A;  1OW4 A;  1C7W A;  1QVI Y;  1SKT A;  1Z4H A;  3IQQ A;  2MLF C;  1F54 A;  4ORC B;  5AXI A;  1KK8 C;  4HRG A;  3LLE A;  2HQ8 A;  1G4Y R;  1R2U A;  1K9U A;  1KWO C;  1BF5 A;  5K89 A;  3BUW B;  3S0E A;  3VRR A;  5ER4 X;  1CLM A;  4USL A;  3AAJ A;  2L0P A;  2CT9 A;  3CDN A;  1ZAC A;  1CDN A;  1KK8 B;  1SK6 D;  2ZRS A;  3CZT X;  1EJ3 A;  3D75 A;  1QIW A;  1WRZ A;  1KWO B;  2L4H A;  4DUQ A;  1F70 A;  1A29 A;  4MN0 A;  2LAN A;  1MQ1 A;  1KK7 Y;  2JZI A;  3M0W A;  1CFC A;  1OMR A;  4QJ4 B;  2E6W A;  3BFB A;  3D73 A;  4GGF C;  5HKZ A;  1UUS A;  2BCB A;  5CSF A;  2PYQ A;  1XA5 A;  2Y5I A;  2BEC A;  1S36 A;  3FIA A;  3GK4 X;  5AFP A;  2QEB A;  5TNC A;  3S0G A;  2FCD A;  1LXF C;  4OKH A;  1SCV A;  2JT3 A;  1ZFS A;  3SS5 A;  2F2P A;  2CTN A;  1SR6 B;  2KGR A;  2LVK A;  2M49 B;  1XK4 A;  1B7T Y;  1SPY A;  3PN7 C;  3SS4 A;  1DF0 B;  1F4Q A;  5G08 A;  2L2C A;  2LE9 B;  5AER A;  5HYD A;  1LKJ A;  1FW4 A;  2KI6 D;  2L51 A;  2LCP A;  3OB2 B;  2MAZ A;  4C0K A;  3CAB A;  3GOF A;  3PN7 B;  5ER5 A;  1AVS A;  2JXL A;  3Q8I A;  2LHI A;  3D0Y B;  3CZ2 A;  4C0L A;  1NP8 A;  2KFF A;  2JT0 A;  3B88 A;  1C3Y A;  1K9P A;  1Y1U A;  4A4C A;  2OS8 C;  3TUY C;  3KO0 A;  1BT6 A;  1Q80 A;  2HET A;  3F45 A;  1M63 B;  3NHT A;  1YX7 A;  3TZ1 A;  1UHN A;  4GUK A;  1C07 A;  2EC6 C;  4IL1 A;  1H8B A;  1MF8 B;  5D3O A;  2LLT A;  2OS8 B;  3TUY B;  1JBA A;  1QTX A;  1D1O A;  1KFX L;  3VRP A;  5HKY A;  1NYA A;  2BL0 C;  2G2B A;  2QPT A;  4WQ3 A;  4A4B A;  1OOF A;  3BYA A;  2EC6 B;  1K9K A;  3R1O A;  2KAV A;  3TDI A;  1B47 A;  3L4A A;  5BPJ A;  2K8M B;  3VRN A;  1A2X A;  1YUR A;  2KOT A;  1G8I A;  2BL0 B;  1YRT B;  1DEK A;  2ZFD A;  4XJK A;  4AQJ A;  1IJ5 A;  4QJ5 B;  2WOS A;  2JWW A;  2NZ0 A;  3EVU A;  5FI7 A;  2JNX A;  3SG5 A;  4DIR A;  1KSM A;  3QRX A;  1SY9 A;  2M1K B;  4JWQ A;  1FI6 A;  3S0D A;  1BMO A;  3FE6 A;  2F8P A;  5KSZ A;  1QAS A;  2KHN A;  1CDL A;  2JRF A;  1U5I A;  1BR1 B;  2LLS A;  1XYD A;  1RFJ A;  4MSP A;  3L47 A;  3BUO B;  4OZD A;  4ETO A;  2LV7 A;  1M46 A;  2KI4 C;  2Y1N A;  1PRW A;  3CR2 A;  1QWV A;  1CNP A;  3O4X A;  3NHI A;  4Q04 A;  2EGD A;  1KQV A;  2LHL A;  4QJ3 B;  3OGN A;  3CR5 X;  5GQQ C;  2RGI A;  1XFV O;  1SSE B;  3D0Y A;  4M2O A;  1REC A;  4YBH B;  2M1U A;  3PAL A;  1JWD A;  2F33 A;  1MR8 A;  2F3Z A;  1P28 A;  2BCA A;  2KI4 B;  1EH2 A;  3NXA A;  1TTX A;  2MRD A;  2KAX A;  3IVT A;  1A4P A;  2Q4U A;  5J3X A;  1EL4 A;  1JFK A;  1OE9 B;  1R6P A;  3VB1 A;  1Y0V H;  2OTG C;  1QV1 A;  5D7F A;  1RRO A;  2K2A A;  3WXA A;  4OR9 B;  4CFQ A;  3I5I C;  2VRG A;  2EHB A;  2LVV A;  3DVM A;  4U8D A;  2HPS A;  3OX6 A;  1AJ5 A;  1CM4 A;  1C3Z A;  1X02 A;  1BLQ A;  3DZT A;  2LAP A;  1DJZ A;  1N65 A;  2KI6 C;  5EL2 A;  3NSK A;  1IGV A;  2OTG B;  3PAT A;  5I94 A;  1DJH A;  3TDU A;  3SJS A;  1CDM A;  3I5I B;  4HSZ A;  1MXL C;  2H61 C;  3CYZ A;  3DVK A;  3BOW A;  1UHJ A;  1DGU A;  1JF2 A;  1XFR A;  1RJV A;  2G9B A;  3OB1 B;  1MXE A;  1KCY A;  3GK2 A;  2NCP A;  1NX2 A;  1OZS A;  3EK8 A;  4CFR A;  4NQG A;  1BG1 A;  5HLV A;  5CSJ A;  1KFX S;  2NCO A;  2Q91 A;  1K94 A;  4F0Z B;  3A8R A;  1OOG A;  1DC1 A;  3DYE A;  1NX1 A;  3OP0 A;  1JC2 A;  1XVJ A;  2WCL A;  4DS7 A;  4PCW A;  3FE8 A;  3V2L A;  4OV2 A;  4I5K A;  1AJ4 A;  2KLD A;  2MHH A;  2F3Y A;  1HQV A;  2JPO A;  1NCY A;  3A4U B;  2MJW B;  1J1E A;  2PAS A;  1IIO A;  3TS5 C;  1ZMZ A;  2FJY A;  3DVJ A;  3PM8 A;  4MZJ A;  2I7A A;  5I2O A;  3BUX B;  1B4C A;  1GJY A;  1SMG A;  3OBV A;  4ZCV A;  1PK0 D;  1YUU A;  2KQ6 A;  1S3P A;  4PE0 A;  1DJG A;  4PE1 A;  5HKW A;  2LP2 A;  1SL9 A;  1ZOT B;  2L4I A;  4YGD B;  3TS5 B;  1DT7 B;  2PVB A;  2JXC A;  3BFH A;  3SG3 A;  2ZNE A;  1FPW A;  2Y1M A;  4P5O E;  4PE4 A;  2O5G A;  1K90 D;  2ZN9 A;  1EG4 A;  3K1E A;  1IJ6 A;  2WOR A;  2LM5 A;  1TN4 A;  3KEV A;  1KK7 Z;  1S5G Y;  1F55 A;  3CWG A;  5AAN A;  3BUN B;  2JC2 A;  4DCK A;  1JSA A;  2Y4Q A;  1BJF A;  3LK0 A;  1Y6W A;  1B8C A;  1Y1X A;  1SCM C;  2KGB C;  2WCH A;  1MHO A;  1TNW A;  4MZL A;  3S0B A;  4KYN A;  1K2H A;  2LMU A;  1NCX A;  2F2O A;  2BE4 A;  1A75 B;  2KYF A;  1LA0 A;  2E30 A;  3RLZ A;  1SL8 A;  3SG7 A;  1PAL A;  4I5N B;  3LCP C;  1W7I B;  3B7A A;  1YTZ C;  2WCF A;  2M97 A;  1G33 A;  1TUZ A;  3JVT C;  4JQ0 D;  3I5F C;  1NSH A;  1CFD A;  1L7Z A;  1N0Y A;  1CTR A;  1J7P A;  1YVH A;  4P2Y B;  1DTL A;  1EG3 A;  1SNL A;  4IJ7 A;  4INX A;  5I2Q A;  1AK8 A;  1SBJ A;  3DF0 B;  4XYN A;  3UNW A;  1CFP A;  1JUO A;  3JVT B;  1XFU O;  3I5F B;  1PVA A;  1EXR A;  3O4Y A;  4R1E A;  1BOC A;  4GGF A;  5IBW A;  4L9M A;  3R1P A;  1DF0 A;  1UHI A;  1YUT A;  2KDH A;  2MA2 A;  4N1G A;  3L4L A;  2WCM A;  3ICB A;  1ZUZ A;  4N5X A;  2K7O A;  1YRU B;  2PRU A;  2PAL A;  4GAO A;  3E3R A;  3EVR A;  2WC8 A;  3WNX B;  1OOH A;  1LA3 A;  2K7C A;  2NXQ A;  4NDD A;  2BNX A;  2JPT A;  4UPG A;  1FI5 A;  2KYC A;  2L5X B;  2JQ6 A;  2M3W A;  3EVV A;  1CB1 A;  4CID A;  3EKH A;  1FBV A;  3BFA A;  1QS7 A;  2JT8 A;  1B1G A;  2O60 A;  2D8N A;  3FWB A;  4MZK A;  1GQM A;  4BY4 A;  2BKH B;  2K60 A;  2KBM A;  2YGU A;  1QLK A;  1OOJ A;  4PAL A;  4GGN A;  2QEH A;  3KPX A;  1IQ5 A;  4OCI A;  3JTD C;  2JTZ A;  1OMV A;  4HRH A;  2JOJ A;  3UO9 A;  3D77 A;  1BOD A;  3PLF B;  3PM2 A;  2JUL A;  4PHN A;  5FI6 A;  5FYX A;  3C1V A;  4CLN A;  2KSP A;  2NLN A;  2AMI A;  3NSO A;  4PHK A;  2L2E A;  1MUX A;  2V53 A;  2LLU A;  1ALW A;  5KU1 A;  1QAT A;  3EK7 A;  2LVJ A;  1LIN A;  3JTD B;  1TNQ A;  4YI8 A;  1XFW O;  2ZKM X;  4M2Q A;  1XK4 C;  1BU3 A;  1ORG A;  3O2P A;  2LUC A;  4M2P A;  3TDZ A;  5B8I B;  1PUL A;  1F4O A;  1RK9 A;  3AKB A;  1WRL A;  3I5G C;  4WQ2 A;  1AUI B;  3B87 A;  2SAS A;  3BXK A;  1KFU L;  3WHU B;  4NDC A;  2TN4 A;  3CS1 A;  1CKK A;  3FWC A;  2FJU B;  3DY9 A;  2LC5 A;  4MLW A;  3I5G B;  4NDB A;  3SG6 A;  3SG2 A;  4YGB B;  3B6X A;  3K21 A;  1RWY A;  2K7B A;  1YX8 A;  1XO5 A;  2L98 A;  3OHM B;  4I5L B;  5DKQ A;  2AUC A;  1MWN A;  1VRK A;  2DOQ A;  5KTY A;  1GM0 A;  2P71 A;  2LVI A;  1XFZ O;  3LL8 B;  1NX3 A;  1QX7 A;  2KQY A;  1RTP 1;  1TRF A;  4GFT A;  2KNE A;  3SIB A;  2A4J A;  1NWD A;  4JD9 A;  4MRX A;  4FTG A;  4N1F A;  2I94 A;  1CLB A;  1QVI Z;  3OX5 A;  4INW A;  1S6C A;  1S6J A;  1J1D A;  4OVN F;  2CCM A;  3CZ1 A;  1SL7 A;  1OMD A;  4YGE B;  1DJW A;  3D10 A;  1XFY O;  2COL B;  3R72 A;  2QDI A;  4CPV A;  2WCJ A;  3AAK A;  1YR5 A;  5CSI A;  1TNX A;  2MLE C;  4JPZ B;  3CR4 X;  1JFJ A;  4PHM A;  1NIW A;  5CPV A;  2PQL A;  3IQO A;  2JTT A;  1OZO A;  1KQM C;  1W7J B;  4MBE A;  5F6T A;  2BE6 A;  5JJG A;  5CSN A;  1E8A A;  1SYM A;  2L5Y A;  1UP5 A;  3PSR A;  4TNC A;  1SR6 C;  1QX2 A;  1UHK A;  2K0J A;  2QEO A;  1BR4 B;  1J7Q A;  4XJK B;  1DQE A;  2HQW A;  4YI9 A;  1DVI A;  1K95 A;  5FI2 A;  2PSR A;  2M29 A;  1DEL A;  5DKR A;  1KQM B;  1CM1 A;  2I2R E;  1YVL A;  2WCB A;  3GK1 A;  4JKT A;  2LNK A;  1JF0 A;  1WDC C;  1TOP A;  3AKA A;  4GPL B;  4ORA B;  1KSO A;  1U5I B;  2BCX A;  2M7L A;  4D1E A;  2JU0 A;  3LK1 A;  5JOL A;  3NSL A;  2MBX A;  1PSR A;  2H61 A;  1A03 A;  5DKN A;  2WCE A;  1K96 A;  1QJT A;  3QME A;  5I2L A;  5AEQ A;  3SS3 A;  1DJY A;  4MVF A;  2FCE A;  1F71 A;  4C0J A;  1C7V A;  1WDC B;  3BUM B;  1UWO A;  1J7O A;  1B7T Z;  1GGW A;  4FQO A;  2WC6 A;  4MRY A;  1SCM B;  1LVC D;  1YUS A;  2LP3 A;  3BQ3 A;  1ODB A;  1TNP A;  4PE7 A;  4YGC B;  1CLL A;  1L2O C;  5PAL A;  4ICB A;  2CBL A;  1ALV A;  2M7N A;  2P70 A;  3BJH A;  3I5H C;  3CGA A;  4MEW A;  1K93 D;  3HX4 A;  3RM1 A;  2QEV A;  2BBN A;  1NPQ A;  1S6I A;  1TWO A;  1M39 A;  2KPH A;  1T14 A;  2K2F A;  1S1E A;  1S5G Z;  3PFV A;  4GBA A;  1OQP A;  1IG5 A;  4FQT A;  3SG4 A;  1GGZ A;  1KFU S;  1L2O B;  3B86 A;  2ZRT A;  4PDZ A;  3ZWH A;  1SRA A;  3I5H B;  1XFX O;  1DGV A;  5I8N A;  3D74 A;  1WLM A;  4AOM A;  4ORB B;  4E68 A;  1QXP A;  3NGV A;  1UHH A;  3R1V A;  1WRK A;  2WC5 A;  2SCP A;  4DRW A;  2H8V A;  1QV0 A;  3D78 A;  1NCZ A;  4PT1 A;  1SW8 A;  2QAC A;  4AQI A;  2FOT A;  2JNF A;  2LMV A;  2ZN8 A;  1B8R A;  3KF9 A;  1CFF A;  1CMF A;  1Y1A A;  2BAP A;  4HRE E;  1B9A A;  3ZNI A;  1AP4 A;  3BOW B;  2LUX A;  3PJI A;  5DIC A;  1LS8 A;  2KBI A;  2PMY A;  1AHR A;  3CZ0 A;  2K7D A;  1NUB A;  1QX5 B;  3H4S E;  3FS7 A;  3SIA A;  1PVB A;  1WLZ A;  2H2K A;  1J7R A;  5HL1 A;  1V1G A;  1UUR A;  3MSE B;  2WND A;  1FF1 A;  3NSI A;  3VRO A;  2L50 A;  2HF5 A;  3IF7 A;  2CNP A;  4BY5 A;  1CMG A;  1OOI X;  4YRU A;  1A75 A;  3RZS A;  1B8L A;  3CTN A;  3VRQ A;  1DMO A;  2WCK A;  4ZCU A;  2GGM A;  1CDP A;  3D76 A;  3CLN A;  4PHJ A;  3DD4 A;  2M9G A;  3O6B A;  1DJX A;  1WY9 A;  1OSA A;  1TCO B;  1F8H A;  2K61 A;  1W9Z A;  1IRJ A;  2OPO A;  3VGO A;  2ISD A;  3EG5 B;  3EK4 A;  3HCM A;  5D69 A;  2GV5 A;  1IH0 A;  1TUJ A;  1V1F A;  2B1U A;  2KLE A;  2P6B B;  1IWQ A;  1K8U A;  1TCF A;  1PSB A;  4I5J A;  3S0F A;  1NX0 A;  1H4B A;  3DF0 A;  1IQ3 A;  2KFH A;  2KAY A;  2LMT A;  4F7F A;  3DVE A; 
#chains in the Genus database with same CATH homology
 1HT9 A;  2AAO A;  4YGA A;  1QLS A;  1DJI A;  3O78 A;  2CXJ A;  2M8U A;  2M0R A;  1J55 A;  1S26 D;  3KHE A;  2GGZ A;  2ZND A;  2IS9 A;  1N2D A;  3EKJ A;  1IKU A;  1M45 A;  5HLO A;  4WRI A;  3WHT B;  1QIV A;  2BKI B;  1M31 A;  2I18 A;  1TIZ A;  2BBM A;  2R2I A;  4GNK B;  2KFG A;  1C7W A;  1QVI Y;  1SKT A;  3IQQ A;  2MLF C;  1F54 A;  4ORC B;  5AXI A;  1KK8 C;  4HRG A;  3LLE A;  2HQ8 A;  1G4Y R;  1R2U A;  1K9U A;  1KWO C;  1BF5 A;  5K89 A;  3BUW B;  3VRR A;  5ER4 X;  1CLM A;  4USL A;  3AAJ A;  2L0P A;  2CT9 A;  1ZAC A;  1CDN A;  1KK8 B;  1SK6 D;  2ZRS A;  3CZT X;  1EJ3 A;  1QIW A;  1WRZ A;  1KWO B;  2L4H A;  4DUQ A;  1F70 A;  1A29 A;  4MN0 A;  2LAN A;  1MQ1 A;  1KK7 Y;  2JZI A;  3M0W A;  1CFC A;  1OMR A;  4QJ4 B;  2E6W A;  4GGF C;  5HKZ A;  1UUS A;  2BCB A;  5CSF A;  1XA5 A;  2Y5I A;  2BEC A;  1S36 A;  3FIA A;  3GK4 X;  5AFP A;  5TNC A;  2FCD A;  1LXF C;  4OKH A;  1SCV A;  2JT3 A;  1ZFS A;  2F2P A;  2CTN A;  1SR6 B;  2KGR A;  2LVK A;  2M49 B;  1XK4 A;  1B7T Y;  1SPY A;  3PN7 C;  1DF0 B;  1F4Q A;  5G08 A;  2LE9 B;  5AER A;  5HYD A;  1LKJ A;  1FW4 A;  2KI6 D;  2L51 A;  2LCP A;  3OB2 B;  2MAZ A;  4C0K A;  3GOF A;  3PN7 B;  5ER5 A;  1AVS A;  2JXL A;  2LHI A;  3D0Y B;  4C0L A;  1NP8 A;  2KFF A;  2JT0 A;  1K9P A;  1Y1U A;  4A4C A;  2OS8 C;  3TUY C;  3KO0 A;  1BT6 A;  1Q80 A;  2HET A;  3F45 A;  1M63 B;  1YX7 A;  3TZ1 A;  1UHN A;  4GUK A;  1C07 A;  2EC6 C;  4IL1 A;  1H8B A;  1MF8 B;  2LLT A;  2OS8 B;  3TUY B;  1JBA A;  1QTX A;  1D1O A;  1KFX L;  3VRP A;  5HKY A;  1NYA A;  2BL0 C;  2G2B A;  2QPT A;  4WQ3 A;  4A4B A;  3BYA A;  2EC6 B;  1K9K A;  2KAV A;  3TDI A;  1B47 A;  5BPJ A;  2K8M B;  3VRN A;  1A2X A;  1YUR A;  2KOT A;  1G8I A;  2BL0 B;  1YRT B;  2ZFD A;  4XJK A;  4AQJ A;  4QJ5 B;  1IJ5 A;  2WOS A;  2JWW A;  2NZ0 A;  3EVU A;  2JNX A;  3SG5 A;  4DIR A;  1KSM A;  3QRX A;  1SY9 A;  2M1K B;  4JWQ A;  1FI6 A;  1BMO A;  2F8P A;  5KSZ A;  1QAS A;  2KHN A;  1CDL A;  2JRF A;  1U5I A;  1BR1 B;  2LLS A;  1XYD A;  1RFJ A;  4MSP A;  3BUO B;  4ETO A;  2LV7 A;  1M46 A;  2KI4 C;  2Y1N A;  1PRW A;  3CR2 A;  1CNP A;  4Q04 A;  2EGD A;  1KQV A;  2LHL A;  4QJ3 B;  3CR5 X;  5GQQ C;  2RGI A;  1XFV O;  3D0Y A;  4M2O A;  1REC A;  4YBH B;  2M1U A;  3PAL A;  1JWD A;  2F33 A;  1MR8 A;  2F3Z A;  2BCA A;  2KI4 B;  1EH2 A;  3NXA A;  1TTX A;  2MRD A;  2KAX A;  1A4P A;  2Q4U A;  5J3X A;  1EL4 A;  1JFK A;  1OE9 B;  1R6P A;  1Y0V H;  2OTG C;  1QV1 A;  5D7F A;  1RRO A;  2K2A A;  3WXA A;  4OR9 B;  4CFQ A;  3I5I C;  2VRG A;  2EHB A;  2LVV A;  3DVM A;  4U8D A;  2HPS A;  3OX6 A;  1AJ5 A;  1CM4 A;  1X02 A;  1BLQ A;  2LAP A;  1DJZ A;  1N65 A;  2KI6 C;  3NSK A;  1IGV A;  2OTG B;  3PAT A;  1DJH A;  3TDU A;  3SJS A;  1CDM A;  3I5I B;  4HSZ A;  1MXL C;  2H61 C;  3DVK A;  3BOW A;  1UHJ A;  1DGU A;  1JF2 A;  1RJV A;  2G9B A;  3OB1 B;  1MXE A;  1KCY A;  3GK2 A;  2NCP A;  1NX2 A;  1OZS A;  3EK8 A;  4CFR A;  4NQG A;  1BG1 A;  5HLV A;  5CSJ A;  1KFX S;  2NCO A;  2Q91 A;  1K94 A;  4F0Z B;  3A8R A;  1NX1 A;  3OP0 A;  1JC2 A;  1XVJ A;  4DS7 A;  4PCW A;  4OV2 A;  4I5K A;  1AJ4 A;  2MHH A;  2F3Y A;  1HQV A;  1NCY A;  3A4U B;  2MJW B;  1J1E A;  2PAS A;  3TS5 C;  1ZMZ A;  3DVJ A;  3PM8 A;  4MZJ A;  2I7A A;  5I2O A;  3BUX B;  1B4C A;  1GJY A;  1SMG A;  4ZCV A;  1PK0 D;  1YUU A;  2KQ6 A;  1S3P A;  4PE0 A;  1DJG A;  4PE1 A;  5HKW A;  2LP2 A;  1SL9 A;  1ZOT B;  2L4I A;  4YGD B;  3TS5 B;  1DT7 B;  2PVB A;  2JXC A;  3SG3 A;  2ZNE A;  1FPW A;  2Y1M A;  4P5O E;  4PE4 A;  2O5G A;  1K90 D;  2ZN9 A;  1EG4 A;  1IJ6 A;  2WOR A;  2LM5 A;  1TN4 A;  3KEV A;  1KK7 Z;  1S5G Y;  1F55 A;  3CWG A;  5AAN A;  3BUN B;  2JC2 A;  4DCK A;  1JSA A;  2Y4Q A;  1BJF A;  3LK0 A;  1Y6W A;  1B8C A;  1Y1X A;  1SCM C;  2KGB C;  4MZL A;  1MHO A;  1TNW A;  1K2H A;  2LMU A;  1NCX A;  2F2O A;  2BE4 A;  1A75 B;  2KYF A;  1LA0 A;  2E30 A;  3RLZ A;  1SL8 A;  3SG7 A;  1PAL A;  4I5N B;  3LCP C;  1W7I B;  1YTZ C;  2WCF A;  2M97 A;  1G33 A;  3JVT C;  4JQ0 D;  3I5F C;  1NSH A;  1CFD A;  1L7Z A;  1N0Y A;  1CTR A;  1J7P A;  1YVH A;  4P2Y B;  1DTL A;  1EG3 A;  1SNL A;  5I2Q A;  1AK8 A;  1SBJ A;  3DF0 B;  4XYN A;  1CFP A;  1JUO A;  3JVT B;  1XFU O;  3I5F B;  1PVA A;  1EXR A;  3O4Y A;  4R1E A;  1BOC A;  4GGF A;  5IBW A;  4L9M A;  1DF0 A;  1UHI A;  1YUT A;  2KDH A;  2MA2 A;  4N1G A;  3ICB A;  4N5X A;  1ZUZ A;  2K7O A;  1YRU B;  2PRU A;  2PAL A;  4GAO A;  3E3R A;  3EVR A;  2WC8 A;  3WNX B;  1LA3 A;  2K7C A;  2NXQ A;  4NDD A;  2JPT A;  1FI5 A;  4UPG A;  2KYC A;  2L5X B;  2JQ6 A;  2M3W A;  3EVV A;  1CB1 A;  4CID A;  3EKH A;  1FBV A;  1QS7 A;  2JT8 A;  1B1G A;  2O60 A;  2D8N A;  3FWB A;  4MZK A;  1GQM A;  4BY4 A;  2BKH B;  2KBM A;  1QLK A;  1OOJ A;  4PAL A;  4GGN A;  3KPX A;  1IQ5 A;  4OCI A;  3JTD C;  2JTZ A;  1OMV A;  4HRH A;  2JOJ A;  1BOD A;  3PLF B;  2JUL A;  4PHN A;  5FYX A;  3C1V A;  4CLN A;  2KSP A;  2NLN A;  2AMI A;  3NSO A;  4PHK A;  2L2E A;  1MUX A;  2V53 A;  2LLU A;  1ALW A;  5KU1 A;  1QAT A;  3EK7 A;  2LVJ A;  1LIN A;  3JTD B;  1TNQ A;  4YI8 A;  1XFW O;  2ZKM X;  4M2Q A;  1XK4 C;  1BU3 A;  3O2P A;  2LUC A;  4M2P A;  3TDZ A;  5B8I B;  1PUL A;  1F4O A;  1RK9 A;  3AKB A;  1WRL A;  3I5G C;  4WQ2 A;  1AUI B;  2SAS A;  3BXK A;  1KFU L;  3WHU B;  4NDC A;  2TN4 A;  3CS1 A;  1CKK A;  3FWC A;  2FJU B;  4MLW A;  2LC5 A;  3I5G B;  4NDB A;  3SG6 A;  3SG2 A;  4YGB B;  3K21 A;  1RWY A;  2K7B A;  1YX8 A;  1XO5 A;  2L98 A;  3OHM B;  4I5L B;  5DKQ A;  2AUC A;  1MWN A;  1VRK A;  2DOQ A;  5KTY A;  2LVI A;  1XFZ O;  3LL8 B;  1NX3 A;  1QX7 A;  2KQY A;  1RTP 1;  1TRF A;  4GFT A;  2KNE A;  3SIB A;  2A4J A;  1NWD A;  4MRX A;  4FTG A;  4N1F A;  2I94 A;  1CLB A;  1QVI Z;  3OX5 A;  1S6C A;  1S6J A;  1J1D A;  4OVN F;  2CCM A;  4YGE B;  1SL7 A;  1OMD A;  1DJW A;  3D10 A;  1XFY O;  2COL B;  4CPV A;  3AAK A;  1YR5 A;  5CSI A;  1TNX A;  2MLE C;  4JPZ B;  3CR4 X;  1JFJ A;  4PHM A;  1NIW A;  5CPV A;  3IQO A;  2JTT A;  1OZO A;  1KQM C;  1W7J B;  4MBE A;  5F6T A;  2BE6 A;  5JJG A;  5CSN A;  1E8A A;  1SYM A;  1UP5 A;  3PSR A;  4TNC A;  1SR6 C;  1QX2 A;  1UHK A;  2K0J A;  1BR4 B;  1J7Q A;  4XJK B;  4YI9 A;  2HQW A;  1DVI A;  1K95 A;  2PSR A;  2M29 A;  5DKR A;  1KQM B;  1CM1 A;  2I2R E;  1YVL A;  2WCB A;  3GK1 A;  2LNK A;  1JF0 A;  1WDC C;  1TOP A;  3AKA A;  4GPL B;  4ORA B;  1KSO A;  1U5I B;  2BCX A;  2M7L A;  4D1E A;  2JU0 A;  3LK1 A;  5JOL A;  3NSL A;  2MBX A;  1PSR A;  2H61 A;  1A03 A;  5DKN A;  2WCE A;  1K96 A;  1QJT A;  5I2L A;  5AEQ A;  1DJY A;  4MVF A;  2FCE A;  1F71 A;  4C0J A;  1C7V A;  1WDC B;  3BUM B;  1UWO A;  1J7O A;  1B7T Z;  1GGW A;  4FQO A;  4MRY A;  1SCM B;  1LVC D;  1YUS A;  2LP3 A;  3BQ3 A;  1ODB A;  1TNP A;  4PE7 A;  4YGC B;  1CLL A;  1L2O C;  5PAL A;  4ICB A;  2CBL A;  1ALV A;  2M7N A;  3I5H C;  3CGA A;  4MEW A;  1K93 D;  3HX4 A;  3RM1 A;  2BBN A;  1NPQ A;  1S6I A;  1M39 A;  2K2F A;  1S1E A;  1S5G Z;  3PFV A;  4GBA A;  1OQP A;  1IG5 A;  3SG4 A;  1GGZ A;  1KFU S;  1L2O B;  4PDZ A;  2ZRT A;  3ZWH A;  1SRA A;  3I5H B;  1XFX O;  1DGV A;  5I8N A;  1WLM A;  4AOM A;  4ORB B;  4E68 A;  1QXP A;  1UHH A;  1WRK A;  2SCP A;  4DRW A;  1QV0 A;  1NCZ A;  1SW8 A;  2QAC A;  4AQI A;  2FOT A;  2JNF A;  2LMV A;  2ZN8 A;  1B8R A;  3KF9 A;  1CFF A;  1CMF A;  1Y1A A;  4HRE E;  1B9A A;  3ZNI A;  1AP4 A;  3BOW B;  2LUX A;  2KBI A;  2PMY A;  1AHR A;  2K7D A;  1NUB A;  1QX5 B;  3H4S E;  3FS7 A;  3SIA A;  1PVB A;  1WLZ A;  2H2K A;  1J7R A;  1V1G A;  1UUR A;  3MSE B;  2WND A;  1FF1 A;  3NSI A;  3VRO A;  2L50 A;  2HF5 A;  3IF7 A;  2CNP A;  4BY5 A;  1CMG A;  4YRU A;  1A75 A;  1B8L A;  3CTN A;  3VRQ A;  1DMO A;  4ZCU A;  2GGM A;  1CDP A;  4PHJ A;  3CLN A;  3DD4 A;  2M9G A;  3O6B A;  1DJX A;  1WY9 A;  1OSA A;  1TCO B;  1F8H A;  2K61 A;  1IRJ A;  2OPO A;  3VGO A;  2ISD A;  3EK4 A;  3HCM A;  5D69 A;  1IH0 A;  2GV5 A;  1V1F A;  2B1U A;  2P6B B;  1IWQ A;  1K8U A;  1TCF A;  1PSB A;  4I5J A;  1NX0 A;  1H4B A;  3DF0 A;  1IQ3 A;  2KFH A;  2KAY A;  2LMT A;  3DVE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...