3NSIA

Crystal structure of the post-refolded s100a3 protein expressed in insect cell
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
96
structure length
96
Chain Sequence
PLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFRECDYNKFMSVLDTNKDCEVDFVEYVRSLACLCLYCHEYFKDCPSEPPC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Protein S100-A3
publication title Refined crystal structures of human Ca(2+)/Zn(2+)-binding S100A3 protein characterized by two disulfide bridges
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3nsiA00
4YGAA 1LINA 4L9MA 1IQ3A 3EK8A 1U5IA 1NIWA 3WHTB 2PRUA 1YR5A 2KQ6A 2KOTA 1QX7A 2KHNA 3VRNA 2AUCA 4ORAB 3AKBA 3AKAA 1KWOC 1G4YR 2OTGB 2NCPA 1DJZA 5HKZA 2B1UA 3OX5A 2M8UA 1MWNA 1WY9A 4C0LA 2EC6B 3LK1A 1DJWA 2WNDA 1AVSA 1QVIY 2KGRA 2BBNA 1QTXA 1X02A 3BXKA 2L0PA 1MHOA 3ZWHA 3VRRA 1XFYO 2WC8A 2M1UA 1QIVA 3EKHA 1MR8A 1YX7A 1G8IA 2OS8C 1V1FA 2JTTA 3SG7A 2JULA 1YVHA 2Q91A 5TNCA 3GK2A 2KI6D 1KQMB 2Y4QA 5I2LA 1SY9A 1YUSA 3IQQA 2K7CA 5HKYA 4DIRA 2NZ0A 3PN7C 4PE0A 1TIZA 3EKJA 5AEQA 4DRWA 1XA5A 2VRGA 4XYNA 5PALA 2MHHA 1UUSA 1CDNA 1M46A 1K9PA 3NXAA 2QPTA 5CSIA 5DKNA 1OSAA 1W7JB 1DJGA 1B9AA 1BMOA 1S6CA 1CLLA 2V53A 1E8AA 3H4SE 1S3PA 3RLZA 2JZIA 1PSRA 4PE4A 1BLQA 1A75B 1EXRA 2OPOA 3NSIA 4CFQA 2I7AA 2K8MB 1IRJA 1J1EA 1DGVA 3OP0A 1JSAA 2KFFA 1FF1A 2JT8A 1CLMA 1IGVA 2O5GA 1EJ3A 4HSZA 1WLZA 4MRYA 4PDZA 5DKRA 3JTDC 1WRLA 1QXPA 3I5IC 1VRKA 1F70A 2JXCA 1J1DA 1XK4A 1QV0A 1WDCB 2JNFA 3GOFA 1SYMA 3JVTC 2M9GA 2PSRA 3C1VA 3SG2A 4A4CA 2BCAA 2G9BA 1JF2A 1UHKA 2SCPA 1TNWA 3IQOA 4JQ0D 2JQ6A 2M7NA 2CBLA 2L2EA 5HYDA 1L2OB 1JWDA 1IQ5A 2R2IA 2FCDA 3SG6A 1J7PA 1DTLA 1Y1UA 2SASA 2LHLA 1M31A 1JF0A 2CXJA 2M7LA 4AQIA 2NCOA 2GGMA 3SJSA 1GJYA 3QRXA 1FW4A 2I18A 3FWCA 1BU3A 1BG1A 4MBEA 1SCMC 1QLSA 1KK8C 3EVRA 4IL1A 1XFVO 2COLB 3VROA 1PRWA 3O2PA 1YRUB 2GGZA 1SR6B 2Y1MA 2IS9A 2PMYA 2KI4B 2BL0C 4PE1A 2LVVA 2O60A 2MLEC 4PHNA 2CTNA 3CR4X 1AP4A 2PASA 4PALA 1D1OA 1PSBA 3O4YA 5JOLA 2K7BA 1MQ1A 1TNXA 4DCKA 4YBHB 1J7RA 2JNXA 3O78A 1U5IB 3M0WA 4R1EA 2FJUB 1G33A 1Y1XA 1IJ5A 2LP2A 3F45A 1QLKA 1F4QA 3CR5X 1PALA 1CMGA 2RGIA 3D0YA 1ZOTB 4I5JA 1ZMZA 2K2AA 2BE4A 3SG4A 5ER4X 3AAKA 3PATA 1F55A 1NYAA 2JPTA 1MXLC 2M3WA 2EGDA 2KGBC 2M97A 1F4OA 1NCXA 1WRZA 1YUTA 2PALA 3I5FC 5AXIA 3CS1A 4GGFC 3KHEA 2WORA 1EL4A 3I5HB 1BR1B 3TS5C 4QJ4B 5CSNA 1Y0VH 1BODA 2KBMA 2K61A 4N1FA 4PHKA 4U8DA 2MLFC 2ZNDA 1TN4A 1EG3A 1K90D 4WRIA 4XJKA 1DT7B 5J3XA 2JU0A 1K94A 1DJIA 4I5LB 4AQJA 1M45A 1SL8A 3HX4A 2DOQA 2LP3A 2L51A 3EK4A 2OTGC 3BUNB 3AAJA 1OMVA 1IG5A 5KSZA 1CLBA 1C7VA 3VRQA 2LVJA 3GK4X 4CPVA 5CSJA 3OHMB 4MZLA 1RFJA 1IJ6A 2ZN8A 2EC6C 1XYDA 3MSEB 5BPJA 1SNLA 1DJHA 2KFGA 4HREE 2LLUA 2BBMA 1N0YA 4YGDB 1RTP1 2MJWB 1XFZO 2LUXA 1CNPA 1NX0A 2F33A 1CFPA 3O6BA 1QATA 4ICBA 2L5XB 1UHNA 2I2RE 1FI5A 1SL9A 1C7WA 1RECA 2LVIA 1L7ZA 1XO5A 3PLFB 5CPVA 1CM1A 2LMUA 1KQMC 1S26D 3IF7A 1K96A 2LHIA 3PN7B 1NWDA 2JXLA 1RK9A 1CDPA 1YRTB 3ICBA 1ODBA 2NLNA 3TUYB 1LA0A 1W7IB 1QX2A 1J7QA 1QX5B 1ZFSA 1UHIA 4YI9A 4MLWA 1Y1AA 1ZUZA 4PCWA 5D7FA 1AHRA 1B8LA 2JWWA 5AFPA 1FI6A 2KBIA 4ZCVA 1AUIB 4OCIA 2CNPA 4DS7A 1JBAA 4MEWA 4MZKA 1DF0A 4ORBB 3I5IB 2FOTA 4MSPA 3ZNIA 5HKWA 3PALA 3GK1A 1CM4A 2JRFA 1CKKA 3BOWA 4ZCUA 2BCBA 2JT3A 1EH2A 1CFDA 1BF5A 1M63B 1EG4A 5IBWA 2WCFA 2M29A 4QJ3B 2WCEA 1KCYA 4NDCA 5GQQC 1QJTA 5ER5A 2BCXA 1R6PA 1ALWA 4E68A 1B1GA 1S5GY 3BQ3A 1F8HA 1PVAA 1B8RA 3OB2B 3NSOA 4OV2A 3CGAA 4YGCB 1L2OC 4HRGA 1DMOA 2Y1NA 1CMFA 1MXEA 1FBVA 1LXFC 1ALVA 1CFCA 1JFKA 1A4PA 1AJ5A 1F71A 1BOCA 1AJ4A 5HLVA 2KYFA 2H61C 3OB1B 4YRUA 3I5GC 1B8CA 1J55A 3D0YB 2NXQA 3SIBA 1HQVA 1BT6A 4WQ3A 4BY5A 2KFHA 3E3RA 1RROA 2G2BA 3WXAA 2TN4A 4MZJA 1OE9B 1RJVA 1K95A 1CDMA 1SR6C 4PE7A 3EVUA 2MAZA 2ZRSA 1NP8A 2KI4C 3CWGA 1JC2A 3KPXA 1A29A 1R2UA 1DGUA 5F6TA 5JJGA 1XFWO 1PK0D 1S6JA 2M0RA 1K93D 4AOMA 4C0JA 1YURA 4NDBA 1SK6D 1S5GZ 3BUXB 3DF0B 4GUKA 4M2QA 4XJKB 1YUUA 2E30A 4M2OA 5G08A 4C0KA 4QJ5B 3K21A 4JWQA 1TNQA 4Q04A 4DUQA 2MBXA 1WRKA 1SW8A 1H8BA 4GAOA 1XFUO 2LMTA 4I5NB 3LL8B 4WQ2A 2PVBA 1CTRA 1SMGA 2L4IA 4NDDA 2FCEA 2JT0A 3BUOB 2ISDA 2LVKA 5FYXA 2HQ8A 4N5XA 3DF0A 3DVJA 5D69A 1LKJA 1QIWA 1NCYA 1TRFA 2M1KB 3TDIA 4BY4A 4P5OE 3I5HC 1ZACA 1NUBA 1B7TY 1YVLA 2F2OA 1CDLA 1IH0A 2JTZA 3DD4A 3A4UB 2LMVA 5I8NA 2K2FA 1IKUA 4MN0A 1BJFA 1KWOB 1WLMA 2CT9A 1KK7Z 1KSOA 1NX3A 2ZRTA 3TZ1A 2K7DA 4GGFA 1SBJA 2LNKA 2WCBA 1Q80A 4NQGA 1F54A 5DKQA 4YGBB 4OKHA 1QS7A 2HQWA 1OZSA 2KYCA 3VRPA 2MA2A 3LK0A 4ETOA 1Y6WA 2K7OA 4OVNF 1AK8A 1S36A 1KFXL 1DJYA 1NSHA 2HETA 4YI8A 2BE6A 2OS8B 2ZNEA 3WHUB 1MF8B 4P2YB 2LANA 4OR9B 1FPWA 2KQYA 3SG3A 2JC2A 2LCPA 2JOJA 4GBAA 3CR2A 2A4JA 1J7OA 5KTYA 4N1GA 3WNXB 4PHJA 1V1GA 1DVIA 2BKIB 1OQPA 1B7TZ 3VGOA 1KQVA 2ZFDA 3EK7A 3SG5A 1LA3A 1OOJA 1DF0B 4CIDA 1CB1A 2KAYA 1UWOA 2K0JA 2P6BB 2QACA 3KO0A 3TDUA 4MVFA 1QASA 1XK4C 3RM1A 2AMIA 1TCFA 3BOWB 1GGZA 1UP5A 3FWBA 4CFRA 1NCZA 1PULA 5I2QA 3A8RA 1OZOA 1CFFA 1UURA 1UHHA 1YX8A 2LLSA 1SKTA 3SIAA 1K8UA 4HRHA 1B4CA 3TUYC 1YTZC 2L4HA 2M49B 3NSKA 2HPSA 2KAXA 3PFVA 3CZTX 5I2OA 1MUXA 1K2HA 1N2DA 2LV7A 2D8NA 2LAPA 1BR4B 2BECA 3D10A 3JTDB 1A03A 2WOSA 4JPZB 5CSFA 3TDZA 2LE9B 1WDCC 2L50A 3DVEA 4ORCB 3JVTB 1QVIZ 4TNCA 1B47A 3BUMB 4USLA 1QV1A 1XVJA 4MRXA 1KFUL 1NPQA 1JUOA 2F2PA 1TCOB 2KAVA 3NSLA 1H4BA 1KFXS 4CLNA 1HT9A 1A75A 2KNEA 1M39A 4YGEB 2LUCA 2KDHA 2CCMA 2Y5IA 1OMRA 1PVBA 3FIAA 3EVVA 2ZKMX 2E6WA 1S6IA 3LCPC 3DVMA 3BYAA 3PM8A 1C07A 1SCMB 4GNKB 1KK8B 1GQMA 4GGNA 5AERA 1NX2A 3CTNA 4UPGA 2L98A 2F3YA 2ZN9A 1UHJA 1RWYA 1GGWA 2EHBA 2BL0B 3I5GB 1SRAA 4GFTA 4FQOA 3HCMA 1TTXA 4I5KA 4PHMA 1KSMA 4A4BA 1K9UA 1KK7Y 1SCVA 3OX6A 2KI6C 1LVCD 1IWQA 3DVKA 1JFJA 2MRDA 3LLEA 1TNPA 1SPYA 1DJXA 2LLTA 2BKHB 3FS7A 2H61A 2GV5A 1OMDA 4M2PA 2F8PA 2Q4UA 3KF9A 1N65A 5HLOA 1NX1A 4FTGA 1SL7A 3CLNA 3KEVA 5K89A 2KSPA 1KFUS 1A2XA 1XFXO 2HF5A 5KU1A 3BUWB 3PSRA 3I5FB 4GPLB 4D1EA 2F3ZA 2H2KA 1K9KA 5AANA 3TS5B 4F0ZB 2LC5A 2LM5A 1TOPA 5B8IB 2AAOA 2I94A 1S1EA
chains in the Genus database with same CATH superfamily
4YGAA 1LINA 4L9MA 1IQ3A 1T14A 3EK8A 1U5IA 1NIWA 2QEVA 3R1OA 3WHTB 2PRUA 1YR5A 2KQ6A 2KOTA 2BAPA 1QX7A 2KHNA 3VRNA 3VB1A 2AUCA 4ORAB 3AKBA 3AKAA 1KWOC 1G4YR 3R1PA 2OTGB 2NCPA 1DJZA 5HKZA 2P70A 2B1UA 4JD9A 3OX5A 2M8UA 1MWNA 1WY9A 4C0LA 2EC6B 3LK1A 3D73A 1DJWA 2WNDA 1AVSA 1QVIY 2KGRA 2BBNA 3S0GA 1QTXA 1X02A 3BXKA 2L0PA 1MHOA 3ZWHA 3UO9A 3VRRA 1XFYO 2WC8A 1TUJA 2M1UA 1QIVA 3EKHA 5D3OA 1MR8A 1YX7A 1G8IA 2OS8C 1V1FA 2JTTA 3SG7A 2JULA 1YVHA 2Q91A 1C3ZA 5TNCA 3GK2A 2KI6D 1KQMB 2Y4QA 1DQEA 5I2LA 3PJIA 2P71A 1SY9A 1YUSA 3IQQA 2K7CA 5HKYA 4DIRA 2NZ0A 3PN7C 3B86A 4PE0A 1TIZA 3EKJA 5AEQA 3O4XA 4DRWA 1XA5A 2VRGA 4XYNA 5PALA 2MHHA 1UUSA 1CDNA 1M46A 1K9PA 3NXAA 2QPTA 5CSIA 5DKNA 4PT1A 1OSAA 1W7JB 1DJGA 1B9AA 1BMOA 1S6CA 1CLLA 2V53A 1E8AA 3H4SE 1S3PA 1SSEB 2JZIA 1PSRA 4PE4A 3RLZA 1A75B 1EXRA 1BLQA 3DYEA 2OPOA 3NSIA 1QWVA 4CFQA 2I7AA 2K8MB 1IRJA 1J1EA 1DGVA 3OP0A 1JSAA 2KFFA 1FF1A 2JT8A 1CLMA 1IGVA 2O5GA 1EJ3A 4HSZA 1WLZA 4MRYA 4PDZA 5DKRA 3JTDC 1WRLA 1QXPA 3I5IC 1VRKA 4IJ7A 4KYNA 2JXCA 1F70A 2K60A 1J1DA 1XK4A 1QV0A 1WDCB 2JNFA 3B6XA 3GOFA 1SYMA 3JVTC 2M9GA 2PSRA 3C1VA 3SG2A 4A4CA 2BCAA 5HL1A 2G9BA 1JF2A 1UHKA 3S0AA 2SCPA 1TNWA 3FE6A 3IQOA 4JQ0D 2JQ6A 3S0BA 2M7NA 2CBLA 2QDIA 1Z4HA 2L2EA 3D76A 5HYDA 1L2OB 1JWDA 1IQ5A 2R2IA 2FCDA 3SG6A 1J7PA 1DTLA 1Y1UA 3B7AA 3NHIA 2SASA 2LHLA 1M31A 3IVTA 2WCJA 4INWA 1JF0A 2CXJA 2M7LA 4AQIA 2NCOA 1Z2CB 2GGMA 3PM2A 3SJSA 1GJYA 3QRXA 3FE9A 1FW4A 2I18A 3FWCA 1BU3A 3NGVA 1BG1A 4MBEA 1SCMC 1QLSA 1KK8C 3EVRA 3L4LA 4IL1A 1XFVO 2COLB 3VROA 3R1VA 1PRWA 3O2PA 1YRUB 2GGZA 1SR6B 3CZ1A 3S0EA 2Y1MA 1KQVA 2IS9A 1OOIX 2PMYA 2KI4B 2BL0C 2L2CA 4PE1A 2LVVA 2O60A 2MLEC 4PHNA 2CTNA 3CR4X 1AP4A 2PASA 4PALA 1D1OA 1PSBA 3O4YA 3D77A 5JOLA 2K7BA 1MQ1A 1TNXA 3CYZA 3BFBA 4DCKA 4YBHB 1J7RA 2JNXA 3O78A 1U5IB 3M0WA 1ORGA 2JPOA 4R1EA 2FJUB 1G33A 1Y1XA 1IJ5A 2LP2A 3F45A 1QLKA 1F4QA 3CR5X 5EL2A 1PALA 1CMGA 2RGIA 3D0YA 1ZOTB 4I5JA 1ZMZA 2K2AA 2BE4A 3SG4A 3R72A 3AAKA 3PATA 5ER4X 1F55A 1NYAA 2JPTA 1MXLC 2M3WA 3S0DA 2EGDA 2KGBC 2M97A 1F4OA 1NCXA 1WRZA 1YUTA 2GTEA 2PALA 3I5FC 3CS1A 4GGFC 5AXIA 3KHEA 2WORA 1EL4A 3I5HB 1BR1B 3TS5C 4QJ4B 5CSNA 1Y0VH 1BODA 2KBMA 2K61A 4N1FA 4PHKA 4U8DA 2MLFC 2ZNDA 1TN4A 1EG3A 1K90D 4WRIA 4XJKA 1DT7B 5J3XA 2JU0A 1K94A 1DJIA 4I5LB 4AQJA 1M45A 1SL8A 3HX4A 3SS4A 2DOQA 2LP3A 1IIOA 2L51A 2WCMA 3EK4A 2OTGC 3BUNB 3AAJA 3D74A 1OMVA 1IG5A 5KSZA 1CLBA 1C7VA 3VRQA 3DXLA 2LVJA 3GK4X 4CPVA 5CSJA 3OHMB 4MZLA 1RFJA 1IJ6A 2ZN8A 2EC6C 1XYDA 3MSEB 5BPJA 1SNLA 2BNXA 1DJHA 2KFGA 4HREE 2LLUA 2BBMA 2KLEA 1N0YA 4YGDB 3BFAA 1RTP1 2MJWB 1XFZO 2LUXA 3K1EA 1CNPA 1NX0A 2F33A 1CFPA 3O6BA 1QATA 4ICBA 3NHTA 2L5XB 1UHNA 2I2RE 1FI5A 5FI2A 1SL9A 1C7WA 1RECA 2LVIA 1B4CA 1L7ZA 2KPHA 1XO5A 3PLFB 5CPVA 1LS8A 1CM1A 2LMUA 1KQMC 1S26D 3IF7A 2FJYA 1TWOA 1K96A 2LHIA 3PN7B 1NWDA 2JXLA 1RK9A 1CDPA 1YRTB 3ICBA 1ODBA 2KLDA 2NLNA 3TUYB 1LA0A 1W7IB 1QX2A 1J7QA 1QX5B 1ZFSA 1UHIA 4YI9A 4MLWA 1Y1AA 1ZUZA 4PCWA 5D7FA 1AHRA 1B8LA 2JWWA 5AFPA 1FI6A 2KBIA 4ZCVA 1AUIB 4OCIA 2CNPA 4DS7A 1JBAA 4MEWA 4MZKA 1DF0A 4ORBB 3I5IB 2FOTA 4MSPA 3ZNIA 5HKWA 3PALA 3GK1A 3D75A 1CM4A 4F7FA 2ERBA 2JRFA 1CKKA 3BOWA 4ZCUA 2BCBA 2JT3A 1EH2A 3CZ0A 1CFDA 1BF5A 1M63B 1EG4A 5IBWA 2WCFA 2M29A 4QJ3B 2WCEA 1KCYA 4NDCA 5GQQC 1QJTA 5ER5A 5FI7A 2BCXA 1R6PA 1ALWA 4E68A 1B1GA 1S5GY 3BQ3A 5I94A 1F8HA 1PVAA 1B8RA 3OB2B 1DEKA 3NSOA 3D78A 4OV2A 3CGAA 4YGCB 1L2OC 4HRGA 1DMOA 3S0FA 2Y1NA 2L5YA 1CMFA 1MXEA 1W9ZA 3L4AA 1FBVA 1LXFC 1ALVA 1CFCA 1JFKA 1A4PA 1AJ5A 3UNWA 1F71A 1BOCA 1AJ4A 5HLVA 2KYFA 2H61C 3OB1B 4YRUA 3I5GC 1B8CA 1J55A 3D0YB 2NXQA 3SIBA 1HQVA 1BT6A 4WQ3A 4BY5A 2KFHA 3E3RA 1RROA 2G2BA 3WXAA 2TN4A 4MZJA 1OE9B 1RJVA 1K95A 4OZDA 1CDMA 1SR6C 4PE7A 3EVUA 3BFHA 2MAZA 2ZRSA 1NP8A 2KI4C 3CWGA 1JC2A 3KPXA 1A29A 1R2UA 1DGUA 5F6TA 5JJGA 1XFWO 4INXA 1PK0D 1S6JA 2M0RA 1K93D 4AOMA 4C0JA 3SS5A 1YURA 3B88A 4NDBA 1SK6D 1S5GZ 3BUXB 3DF0B 4GUKA 4M2QA 4XJKB 1YUUA 2E30A 4M2OA 5G08A 4C0KA 4QJ5B 3K21A 4JWQA 1TNQA 4Q04A 2WCKA 4DUQA 4FQTA 1WRKA 2MBXA 1SW8A 1H8BA 4GAOA 3V2LA 1XFUO 2LMTA 4I5NB 3LL8B 4WQ2A 2PVBA 1CTRA 1OOGA 1SMGA 3OGNA 2L4IA 4NDDA 2FCEA 2JT0A 3BUOB 2ISDA 2LVKA 5FYXA 2HQ8A 4N5XA 3DF0A 3DVJA 5D69A 1LKJA 1QIWA 1NCYA 1TRFA 2M1KB 3TDIA 4BY4A 4P5OE 3I5HC 1ZACA 1NUBA 1B7TY 1YVLA 2F2OA 1CDLA 1IH0A 2JTZA 3DD4A 3A4UB 2LMVA 5I8NA 2K2FA 1IKUA 4MN0A 1BJFA 1KWOB 1WLMA 2CT9A 1KK7Z 1OOFA 1KSOA 1NX3A 2ZRTA 3TZ1A 1C3YA 2QEHA 2K7DA 4GGFA 1SBJA 2LNKA 2WCBA 1Q80A 4NQGA 1F54A 1OOHA 5DKQA 4YGBB 4OKHA 1QS7A 1GM0A 2HQWA 1OZSA 2KYCA 3VRPA 2MA2A 3LK0A 3Q8IA 1Y6WA 2K7OA 4OVNF 4ETOA 1AK8A 1S36A 1KFXL 1DJYA 3EG5B 1NSHA 2HETA 4YI8A 2BE6A 2OS8B 2ZNEA 3RZSA 3WHUB 1MF8B 3DZTA 4P2YB 2LANA 4OR9B 1FPWA 2KQYA 3SG3A 2JC2A 2LCPA 2JOJA 4GBAA 3CR2A 2A4JA 1J7OA 5KTYA 4N1GA 3WNXB 4PHJA 1V1GA 1DVIA 2BKIB 1OQPA 1B7TZ 2WCLA 3L47A 2ZFDA 3EK7A 3SG5A 3VGOA 3CDNA 1LA3A 1OOJA 1DF0B 4CIDA 1CB1A 2KAYA 1UWOA 2K0JA 2P6BB 2QACA 3KO0A 3TDUA 4MVFA 1QASA 1XK4C 3RM1A 2AMIA 1TCFA 3BOWB 1GGZA 1UP5A 1P28A 3FWBA 4CFRA 1NCZA 1PULA 5I2QA 3CABA 3A8RA 5FI6A 1OZOA 1CFFA 1UURA 1UHHA 1YX8A 2LLSA 1SKTA 3SIAA 1K8UA 4HRHA 3SS3A 3TUYC 1YTZC 2L4HA 2M49B 3NSKA 2HPSA 2KAXA 3PFVA 3CZTX 5I2OA 1MUXA 2WC6A 1K2HA 1N2DA 2LV7A 2D8NA 2LAPA 1BR4B 2BECA 3D10A 3JTDB 1A03A 2WOSA 4JPZB 5CSFA 3TDZA 2LE9B 1WDCC 2L50A 3DVEA 4ORCB 3JVTB 1QVIZ 4TNCA 1B47A 3BUMB 4USLA 1XFRA 3DY9A 1QV1A 1XVJA 3B87A 4MRXA 1KFUL 1NPQA 1JUOA 2F2PA 1TCOB 2KAVA 3NSLA 1H4BA 1KFXS 3N7HA 4CLNA 1HT9A 1A75A 2KNEA 1M39A 4YGEB 2LUCA 2KDHA 2WCHA 2CCMA 2Y5IA 1OMRA 1PVBA 3FIAA 3EVVA 2ZKMX 2E6WA 1S6IA 3LCPC 1DELA 3BYAA 3DVMA 3PM8A 4JKTA 5DICA 1DC1A 1C07A 1SCMB 4GNKB 1KK8B 1GQMA 3FE8A 4GGNA 1TUZA 5AERA 1NX2A 3CTNA 4UPGA 2L98A 2F3YA 2ZN9A 1UHJA 1RWYA 1GGWA 2EHBA 2BL0B 2H8VA 2PYQA 3I5GB 1SRAA 4GFTA 4FQOA 3HCMA 1TTXA 4I5KA 4PHMA 1KSMA 4A4BA 1K9UA 1KK7Y 1SCVA 2YGUA 3OX6A 1OW4A 2KI6C 1LVCD 1IWQA 3DVKA 3QMEA 1JFJA 2MRDA 3LLEA 2WC5A 1TNPA 1SPYA 1DJXA 2LLTA 2BKHB 3CZ2A 3FS7A 2H61A 2GV5A 1OMDA 4M2PA 2F8PA 2Q4UA 3BJHA 3KF9A 1N65A 5HLOA 1NX1A 4FTGA 1SL7A 3CLNA 3KEVA 3OBVA 5K89A 2KSPA 1KFUS 1A2XA 1XFXO 2HF5A 5KU1A 3BUWB 3PSRA 3I5FB 4GPLB 4D1EA 2F3ZA 2H2KA 1K9KA 5AANA 2QEBA 2PQLA 3TS5B 4F0ZB 2LC5A 2LM5A 1TOPA 2QEOA 5B8IB 2AAOA 2I94A 1S1EA
chains in the Genus database with same CATH topology
4YGAA 1LINA 4L9MA 1IQ3A 3EK8A 1U5IA 1NIWA 3WHTB 2PRUA 1YR5A 2KQ6A 2KOTA 1QX7A 2KHNA 3VRNA 2AUCA 4ORAB 3AKBA 3AKAA 1KWOC 1G4YR 2OTGB 2NCPA 1DJZA 5HKZA 2B1UA 3OX5A 2M8UA 1MWNA 1WY9A 4C0LA 2EC6B 3LK1A 1DJWA 2WNDA 1AVSA 1QVIY 2KGRA 2BBNA 1QTXA 1X02A 3BXKA 2L0PA 1MHOA 3ZWHA 3VRRA 1XFYO 2WC8A 2M1UA 1QIVA 3EKHA 1MR8A 1YX7A 1G8IA 2OS8C 1V1FA 2JTTA 3SG7A 2JULA 1YVHA 2Q91A 5TNCA 3GK2A 2KI6D 1KQMB 2Y4QA 5I2LA 1SY9A 1YUSA 3IQQA 2K7CA 5HKYA 4DIRA 2NZ0A 3PN7C 4PE0A 1TIZA 3EKJA 5AEQA 4DRWA 1XA5A 2VRGA 4XYNA 5PALA 2MHHA 1UUSA 1CDNA 1M46A 1K9PA 3NXAA 2QPTA 5CSIA 5DKNA 1OSAA 1W7JB 1DJGA 1B9AA 1BMOA 1S6CA 1CLLA 2V53A 1E8AA 3H4SE 1S3PA 3RLZA 2JZIA 1PSRA 4PE4A 1BLQA 1A75B 1EXRA 2OPOA 3NSIA 4CFQA 2I7AA 2K8MB 1IRJA 1J1EA 1DGVA 3OP0A 1JSAA 2KFFA 1FF1A 2JT8A 1CLMA 1IGVA 2O5GA 1EJ3A 4HSZA 1WLZA 4MRYA 4PDZA 5DKRA 3JTDC 1WRLA 1QXPA 3I5IC 1VRKA 1F70A 2JXCA 1J1DA 1XK4A 1QV0A 1WDCB 2JNFA 3GOFA 1SYMA 3JVTC 2M9GA 2PSRA 3C1VA 3SG2A 4A4CA 2BCAA 2G9BA 1JF2A 1UHKA 2SCPA 1TNWA 3IQOA 4JQ0D 2JQ6A 2M7NA 2CBLA 2L2EA 5HYDA 1L2OB 1JWDA 1IQ5A 2R2IA 2FCDA 3SG6A 1J7PA 1DTLA 1Y1UA 2SASA 2LHLA 1M31A 1JF0A 2CXJA 2M7LA 4AQIA 2NCOA 2GGMA 3SJSA 1GJYA 3QRXA 1FW4A 2I18A 3FWCA 1BU3A 1BG1A 4MBEA 1SCMC 1QLSA 1KK8C 3EVRA 4IL1A 1XFVO 2COLB 3VROA 1PRWA 3O2PA 1YRUB 2GGZA 1SR6B 2Y1MA 2IS9A 2PMYA 2KI4B 2BL0C 4PE1A 2LVVA 2O60A 2MLEC 4PHNA 2CTNA 3CR4X 1AP4A 2PASA 4PALA 1D1OA 1PSBA 3O4YA 5JOLA 2K7BA 1MQ1A 1TNXA 4DCKA 4YBHB 1J7RA 2JNXA 3O78A 1U5IB 3M0WA 4R1EA 2FJUB 1G33A 1Y1XA 1IJ5A 2LP2A 3F45A 1QLKA 1F4QA 3CR5X 1PALA 1CMGA 2RGIA 3D0YA 1ZOTB 4I5JA 1ZMZA 2K2AA 2BE4A 3SG4A 5ER4X 3AAKA 3PATA 1F55A 1NYAA 2JPTA 1MXLC 2M3WA 2EGDA 2KGBC 2M97A 1F4OA 1NCXA 1WRZA 1YUTA 2PALA 3I5FC 5AXIA 3CS1A 4GGFC 3KHEA 2WORA 1EL4A 3I5HB 1BR1B 3TS5C 4QJ4B 5CSNA 1Y0VH 1BODA 2KBMA 2K61A 4N1FA 4PHKA 4U8DA 2MLFC 2ZNDA 1TN4A 1EG3A 1K90D 4WRIA 4XJKA 1DT7B 5J3XA 2JU0A 1K94A 1DJIA 4I5LB 4AQJA 1M45A 1SL8A 3HX4A 2DOQA 2LP3A 2L51A 3EK4A 2OTGC 3BUNB 3AAJA 1OMVA 1IG5A 5KSZA 1CLBA 1C7VA 3VRQA 2LVJA 3GK4X 4CPVA 5CSJA 3OHMB 4MZLA 1RFJA 1IJ6A 2ZN8A 2EC6C 1XYDA 3MSEB 5BPJA 1SNLA 1DJHA 2KFGA 4HREE 2LLUA 2BBMA 1N0YA 4YGDB 1RTP1 2MJWB 1XFZO 2LUXA 1CNPA 1NX0A 2F33A 1CFPA 3O6BA 1QATA 4ICBA 2L5XB 1UHNA 2I2RE 1FI5A 1SL9A 1C7WA 1RECA 2LVIA 1L7ZA 1XO5A 3PLFB 5CPVA 1CM1A 2LMUA 1KQMC 1S26D 3IF7A 1K96A 2LHIA 3PN7B 1NWDA 2JXLA 1RK9A 1CDPA 1YRTB 3ICBA 1ODBA 2NLNA 3TUYB 1LA0A 1W7IB 1QX2A 1J7QA 1QX5B 1ZFSA 1UHIA 4YI9A 4MLWA 1Y1AA 1ZUZA 4PCWA 5D7FA 1AHRA 1B8LA 2JWWA 5AFPA 1FI6A 2KBIA 4ZCVA 1AUIB 4OCIA 2CNPA 4DS7A 1JBAA 4MEWA 4MZKA 1DF0A 4ORBB 3I5IB 2FOTA 4MSPA 3ZNIA 5HKWA 3PALA 3GK1A 1CM4A 2JRFA 1CKKA 3BOWA 4ZCUA 2BCBA 2JT3A 1EH2A 1CFDA 1BF5A 1M63B 1EG4A 5IBWA 2WCFA 2M29A 4QJ3B 2WCEA 1KCYA 4NDCA 5GQQC 1QJTA 5ER5A 2BCXA 1R6PA 1ALWA 4E68A 1B1GA 1S5GY 3BQ3A 1F8HA 1PVAA 1B8RA 3OB2B 3NSOA 4OV2A 3CGAA 4YGCB 1L2OC 4HRGA 1DMOA 2Y1NA 1CMFA 1MXEA 1FBVA 1LXFC 1ALVA 1CFCA 1JFKA 1A4PA 1AJ5A 1F71A 1BOCA 1AJ4A 5HLVA 2KYFA 2H61C 3OB1B 4YRUA 3I5GC 1B8CA 1J55A 3D0YB 2NXQA 3SIBA 1HQVA 1BT6A 4WQ3A 4BY5A 2KFHA 3E3RA 1RROA 2G2BA 3WXAA 2TN4A 4MZJA 1OE9B 1RJVA 1K95A 1CDMA 1SR6C 4PE7A 3EVUA 2MAZA 2ZRSA 1NP8A 2KI4C 3CWGA 1JC2A 3KPXA 1A29A 1R2UA 1DGUA 5F6TA 5JJGA 1XFWO 1PK0D 1S6JA 2M0RA 1K93D 4AOMA 4C0JA 1YURA 4NDBA 1SK6D 1S5GZ 3BUXB 3DF0B 4GUKA 4M2QA 4XJKB 1YUUA 2E30A 4M2OA 5G08A 4C0KA 4QJ5B 3K21A 4JWQA 1TNQA 4Q04A 4DUQA 2MBXA 1WRKA 1SW8A 1H8BA 4GAOA 1XFUO 2LMTA 4I5NB 3LL8B 4WQ2A 2PVBA 1CTRA 1SMGA 2L4IA 4NDDA 2FCEA 2JT0A 3BUOB 2ISDA 2LVKA 5FYXA 2HQ8A 4N5XA 3DF0A 3DVJA 5D69A 1LKJA 1QIWA 1NCYA 1TRFA 2M1KB 3TDIA 4BY4A 4P5OE 3I5HC 1ZACA 1NUBA 1B7TY 1YVLA 2F2OA 1CDLA 1IH0A 2JTZA 3DD4A 3A4UB 2LMVA 5I8NA 2K2FA 1IKUA 4MN0A 1BJFA 1KWOB 1WLMA 2CT9A 1KK7Z 1KSOA 1NX3A 2ZRTA 3TZ1A 2K7DA 4GGFA 1SBJA 2LNKA 2WCBA 1Q80A 4NQGA 1F54A 5DKQA 4YGBB 4OKHA 1QS7A 2HQWA 1OZSA 2KYCA 3VRPA 2MA2A 3LK0A 4ETOA 1Y6WA 2K7OA 4OVNF 1AK8A 1S36A 1KFXL 1DJYA 1NSHA 2HETA 4YI8A 2BE6A 2OS8B 2ZNEA 3WHUB 1MF8B 4P2YB 2LANA 4OR9B 1FPWA 2KQYA 3SG3A 2JC2A 2LCPA 2JOJA 4GBAA 3CR2A 2A4JA 1J7OA 5KTYA 4N1GA 3WNXB 4PHJA 1V1GA 1DVIA 2BKIB 1OQPA 1B7TZ 3VGOA 1KQVA 2ZFDA 3EK7A 3SG5A 1LA3A 1OOJA 1DF0B 4CIDA 1CB1A 2KAYA 1UWOA 2K0JA 2P6BB 2QACA 3KO0A 3TDUA 4MVFA 1QASA 1XK4C 3RM1A 2AMIA 1TCFA 3BOWB 1GGZA 1UP5A 3FWBA 4CFRA 1NCZA 1PULA 5I2QA 3A8RA 1OZOA 1CFFA 1UURA 1UHHA 1YX8A 2LLSA 1SKTA 3SIAA 1K8UA 4HRHA 1B4CA 3TUYC 1YTZC 2L4HA 2M49B 3NSKA 2HPSA 2KAXA 3PFVA 3CZTX 5I2OA 1MUXA 1K2HA 1N2DA 2LV7A 2D8NA 2LAPA 1BR4B 2BECA 3D10A 3JTDB 1A03A 2WOSA 4JPZB 5CSFA 3TDZA 2LE9B 1WDCC 2L50A 3DVEA 4ORCB 3JVTB 1QVIZ 4TNCA 1B47A 3BUMB 4USLA 1QV1A 1XVJA 4MRXA 1KFUL 1NPQA 1JUOA 2F2PA 1TCOB 2KAVA 3NSLA 1H4BA 1KFXS 4CLNA 1HT9A 1A75A 2KNEA 1M39A 4YGEB 2LUCA 2KDHA 2CCMA 2Y5IA 1OMRA 1PVBA 3FIAA 3EVVA 2ZKMX 2E6WA 1S6IA 3LCPC 3DVMA 3BYAA 3PM8A 1C07A 1SCMB 4GNKB 1KK8B 1GQMA 4GGNA 5AERA 1NX2A 3CTNA 4UPGA 2L98A 2F3YA 2ZN9A 1UHJA 1RWYA 1GGWA 2EHBA 2BL0B 3I5GB 1SRAA 4GFTA 4FQOA 3HCMA 1TTXA 4I5KA 4PHMA 1KSMA 4A4BA 1K9UA 1KK7Y 1SCVA 3OX6A 2KI6C 1LVCD 1IWQA 3DVKA 1JFJA 2MRDA 3LLEA 1TNPA 1SPYA 1DJXA 2LLTA 2BKHB 3FS7A 2H61A 2GV5A 1OMDA 4M2PA 2F8PA 2Q4UA 3KF9A 1N65A 5HLOA 1NX1A 4FTGA 1SL7A 3CLNA 3KEVA 5K89A 2KSPA 1KFUS 1A2XA 1XFXO 2HF5A 5KU1A 3BUWB 3PSRA 3I5FB 4GPLB 4D1EA 2F3ZA 2H2KA 1K9KA 5AANA 3TS5B 4F0ZB 2LC5A 2LM5A 1TOPA 5B8IB 2AAOA 2I94A 1S1EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YGA A;  1LIN A;  4L9M A;  1IQ3 A;  3EK8 A;  1U5I A;  1NIW A;  3WHT B;  2PRU A;  1YR5 A;  2KQ6 A;  2KOT A;  1QX7 A;  2KHN A;  3VRN A;  2AUC A;  4ORA B;  3AKB A;  3AKA A;  1KWO C;  1G4Y R;  2OTG B;  2NCP A;  1DJZ A;  5HKZ A;  2B1U A;  3OX5 A;  2M8U A;  1MWN A;  1WY9 A;  4C0L A;  2EC6 B;  3LK1 A;  1DJW A;  2WND A;  1AVS A;  1QVI Y;  2KGR A;  2BBN A;  1QTX A;  1X02 A;  3BXK A;  2L0P A;  1MHO A;  3ZWH A;  3VRR A;  1XFY O;  2WC8 A;  2M1U A;  1QIV A;  3EKH A;  1MR8 A;  1YX7 A;  1G8I A;  2OS8 C;  1V1F A;  2JTT A;  3SG7 A;  2JUL A;  1YVH A;  2Q91 A;  5TNC A;  3GK2 A;  2KI6 D;  1KQM B;  2Y4Q A;  5I2L A;  1SY9 A;  1YUS A;  3IQQ A;  2K7C A;  5HKY A;  4DIR A;  2NZ0 A;  3PN7 C;  4PE0 A;  1TIZ A;  3EKJ A;  5AEQ A;  4DRW A;  1XA5 A;  2VRG A;  4XYN A;  5PAL A;  2MHH A;  1UUS A;  1CDN A;  1M46 A;  1K9P A;  3NXA A;  2QPT A;  5CSI A;  5DKN A;  1OSA A;  1W7J B;  1DJG A;  1B9A A;  1BMO A;  1S6C A;  1CLL A;  2V53 A;  1E8A A;  3H4S E;  1S3P A;  3RLZ A;  2JZI A;  1PSR A;  4PE4 A;  1BLQ A;  1A75 B;  1EXR A;  2OPO A;  3NSI A;  4CFQ A;  2I7A A;  2K8M B;  1IRJ A;  1J1E A;  1DGV A;  3OP0 A;  1JSA A;  2KFF A;  1FF1 A;  2JT8 A;  1CLM A;  1IGV A;  2O5G A;  1EJ3 A;  4HSZ A;  1WLZ A;  4MRY A;  4PDZ A;  5DKR A;  3JTD C;  1WRL A;  1QXP A;  3I5I C;  1VRK A;  1F70 A;  2JXC A;  1J1D A;  1XK4 A;  1QV0 A;  1WDC B;  2JNF A;  3GOF A;  1SYM A;  3JVT C;  2M9G A;  2PSR A;  3C1V A;  3SG2 A;  4A4C A;  2BCA A;  2G9B A;  1JF2 A;  1UHK A;  2SCP A;  1TNW A;  3IQO A;  4JQ0 D;  2JQ6 A;  2M7N A;  2CBL A;  2L2E A;  5HYD A;  1L2O B;  1JWD A;  1IQ5 A;  2R2I A;  2FCD A;  3SG6 A;  1J7P A;  1DTL A;  1Y1U A;  2SAS A;  2LHL A;  1M31 A;  1JF0 A;  2CXJ A;  2M7L A;  4AQI A;  2NCO A;  2GGM A;  3SJS A;  1GJY A;  3QRX A;  1FW4 A;  2I18 A;  3FWC A;  1BU3 A;  1BG1 A;  4MBE A;  1SCM C;  1QLS A;  1KK8 C;  3EVR A;  4IL1 A;  1XFV O;  2COL B;  3VRO A;  1PRW A;  3O2P A;  1YRU B;  2GGZ A;  1SR6 B;  2Y1M A;  2IS9 A;  2PMY A;  2KI4 B;  2BL0 C;  4PE1 A;  2LVV A;  2O60 A;  2MLE C;  4PHN A;  2CTN A;  3CR4 X;  1AP4 A;  2PAS A;  4PAL A;  1D1O A;  1PSB A;  3O4Y A;  5JOL A;  2K7B A;  1MQ1 A;  1TNX A;  4DCK A;  4YBH B;  1J7R A;  2JNX A;  3O78 A;  1U5I B;  3M0W A;  4R1E A;  2FJU B;  1G33 A;  1Y1X A;  1IJ5 A;  2LP2 A;  3F45 A;  1QLK A;  1F4Q A;  3CR5 X;  1PAL A;  1CMG A;  2RGI A;  3D0Y A;  1ZOT B;  4I5J A;  1ZMZ A;  2K2A A;  2BE4 A;  3SG4 A;  5ER4 X;  3AAK A;  3PAT A;  1F55 A;  1NYA A;  2JPT A;  1MXL C;  2M3W A;  2EGD A;  2KGB C;  2M97 A;  1F4O A;  1NCX A;  1WRZ A;  1YUT A;  2PAL A;  3I5F C;  5AXI A;  3CS1 A;  4GGF C;  3KHE A;  2WOR A;  1EL4 A;  3I5H B;  1BR1 B;  3TS5 C;  4QJ4 B;  5CSN A;  1Y0V H;  1BOD A;  2KBM A;  2K61 A;  4N1F A;  4PHK A;  4U8D A;  2MLF C;  2ZND A;  1TN4 A;  1EG3 A;  1K90 D;  4WRI A;  4XJK A;  1DT7 B;  5J3X A;  2JU0 A;  1K94 A;  1DJI A;  4I5L B;  4AQJ A;  1M45 A;  1SL8 A;  3HX4 A;  2DOQ A;  2LP3 A;  2L51 A;  3EK4 A;  2OTG C;  3BUN B;  3AAJ A;  1OMV A;  1IG5 A;  5KSZ A;  1CLB A;  1C7V A;  3VRQ A;  2LVJ A;  3GK4 X;  4CPV A;  5CSJ A;  3OHM B;  4MZL A;  1RFJ A;  1IJ6 A;  2ZN8 A;  2EC6 C;  1XYD A;  3MSE B;  5BPJ A;  1SNL A;  1DJH A;  2KFG A;  4HRE E;  2LLU A;  2BBM A;  1N0Y A;  4YGD B;  1RTP 1;  2MJW B;  1XFZ O;  2LUX A;  1CNP A;  1NX0 A;  2F33 A;  1CFP A;  3O6B A;  1QAT A;  4ICB A;  2L5X B;  1UHN A;  2I2R E;  1FI5 A;  1SL9 A;  1C7W A;  1REC A;  2LVI A;  1L7Z A;  1XO5 A;  3PLF B;  5CPV A;  1CM1 A;  2LMU A;  1KQM C;  1S26 D;  3IF7 A;  1K96 A;  2LHI A;  3PN7 B;  1NWD A;  2JXL A;  1RK9 A;  1CDP A;  1YRT B;  3ICB A;  1ODB A;  2NLN A;  3TUY B;  1LA0 A;  1W7I B;  1QX2 A;  1J7Q A;  1QX5 B;  1ZFS A;  1UHI A;  4YI9 A;  4MLW A;  1Y1A A;  1ZUZ A;  4PCW A;  5D7F A;  1AHR A;  1B8L A;  2JWW A;  5AFP A;  1FI6 A;  2KBI A;  4ZCV A;  1AUI B;  4OCI A;  2CNP A;  4DS7 A;  1JBA A;  4MEW A;  4MZK A;  1DF0 A;  4ORB B;  3I5I B;  2FOT A;  4MSP A;  3ZNI A;  5HKW A;  3PAL A;  3GK1 A;  1CM4 A;  2JRF A;  1CKK A;  3BOW A;  4ZCU A;  2BCB A;  2JT3 A;  1EH2 A;  1CFD A;  1BF5 A;  1M63 B;  1EG4 A;  5IBW A;  2WCF A;  2M29 A;  4QJ3 B;  2WCE A;  1KCY A;  4NDC A;  5GQQ C;  1QJT A;  5ER5 A;  2BCX A;  1R6P A;  1ALW A;  4E68 A;  1B1G A;  1S5G Y;  3BQ3 A;  1F8H A;  1PVA A;  1B8R A;  3OB2 B;  3NSO A;  4OV2 A;  3CGA A;  4YGC B;  1L2O C;  4HRG A;  1DMO A;  2Y1N A;  1CMF A;  1MXE A;  1FBV A;  1LXF C;  1ALV A;  1CFC A;  1JFK A;  1A4P A;  1AJ5 A;  1F71 A;  1BOC A;  1AJ4 A;  5HLV A;  2KYF A;  2H61 C;  3OB1 B;  4YRU A;  3I5G C;  1B8C A;  1J55 A;  3D0Y B;  2NXQ A;  3SIB A;  1HQV A;  1BT6 A;  4WQ3 A;  4BY5 A;  2KFH A;  3E3R A;  1RRO A;  2G2B A;  3WXA A;  2TN4 A;  4MZJ A;  1OE9 B;  1RJV A;  1K95 A;  1CDM A;  1SR6 C;  4PE7 A;  3EVU A;  2MAZ A;  2ZRS A;  1NP8 A;  2KI4 C;  3CWG A;  1JC2 A;  3KPX A;  1A29 A;  1R2U A;  1DGU A;  5F6T A;  5JJG A;  1XFW O;  1PK0 D;  1S6J A;  2M0R A;  1K93 D;  4AOM A;  4C0J A;  1YUR A;  4NDB A;  1SK6 D;  1S5G Z;  3BUX B;  3DF0 B;  4GUK A;  4M2Q A;  4XJK B;  1YUU A;  2E30 A;  4M2O A;  5G08 A;  4C0K A;  4QJ5 B;  3K21 A;  4JWQ A;  1TNQ A;  4Q04 A;  4DUQ A;  2MBX A;  1WRK A;  1SW8 A;  1H8B A;  4GAO A;  1XFU O;  2LMT A;  4I5N B;  3LL8 B;  4WQ2 A;  2PVB A;  1CTR A;  1SMG A;  2L4I A;  4NDD A;  2FCE A;  2JT0 A;  3BUO B;  2ISD A;  2LVK A;  5FYX A;  2HQ8 A;  4N5X A;  3DF0 A;  3DVJ A;  5D69 A;  1LKJ A;  1QIW A;  1NCY A;  1TRF A;  2M1K B;  3TDI A;  4BY4 A;  4P5O E;  3I5H C;  1ZAC A;  1NUB A;  1B7T Y;  1YVL A;  2F2O A;  1CDL A;  1IH0 A;  2JTZ A;  3DD4 A;  3A4U B;  2LMV A;  5I8N A;  2K2F A;  1IKU A;  4MN0 A;  1BJF A;  1KWO B;  1WLM A;  2CT9 A;  1KK7 Z;  1KSO A;  1NX3 A;  2ZRT A;  3TZ1 A;  2K7D A;  4GGF A;  1SBJ A;  2LNK A;  2WCB A;  1Q80 A;  4NQG A;  1F54 A;  5DKQ A;  4YGB B;  4OKH A;  1QS7 A;  2HQW A;  1OZS A;  2KYC A;  3VRP A;  2MA2 A;  3LK0 A;  4ETO A;  1Y6W A;  2K7O A;  4OVN F;  1AK8 A;  1S36 A;  1KFX L;  1DJY A;  1NSH A;  2HET A;  4YI8 A;  2BE6 A;  2OS8 B;  2ZNE A;  3WHU B;  1MF8 B;  4P2Y B;  2LAN A;  4OR9 B;  1FPW A;  2KQY A;  3SG3 A;  2JC2 A;  2LCP A;  2JOJ A;  4GBA A;  3CR2 A;  2A4J A;  1J7O A;  5KTY A;  4N1G A;  3WNX B;  4PHJ A;  1V1G A;  1DVI A;  2BKI B;  1OQP A;  1B7T Z;  3VGO A;  1KQV A;  2ZFD A;  3EK7 A;  3SG5 A;  1LA3 A;  1OOJ A;  1DF0 B;  4CID A;  1CB1 A;  2KAY A;  1UWO A;  2K0J A;  2P6B B;  2QAC A;  3KO0 A;  3TDU A;  4MVF A;  1QAS A;  1XK4 C;  3RM1 A;  2AMI A;  1TCF A;  3BOW B;  1GGZ A;  1UP5 A;  3FWB A;  4CFR A;  1NCZ A;  1PUL A;  5I2Q A;  3A8R A;  1OZO A;  1CFF A;  1UUR A;  1UHH A;  1YX8 A;  2LLS A;  1SKT A;  3SIA A;  1K8U A;  4HRH A;  1B4C A;  3TUY C;  1YTZ C;  2L4H A;  2M49 B;  3NSK A;  2HPS A;  2KAX A;  3PFV A;  3CZT X;  5I2O A;  1MUX A;  1K2H A;  1N2D A;  2LV7 A;  2D8N A;  2LAP A;  1BR4 B;  2BEC A;  3D10 A;  3JTD B;  1A03 A;  2WOS A;  4JPZ B;  5CSF A;  3TDZ A;  2LE9 B;  1WDC C;  2L50 A;  3DVE A;  4ORC B;  3JVT B;  1QVI Z;  4TNC A;  1B47 A;  3BUM B;  4USL A;  1QV1 A;  1XVJ A;  4MRX A;  1KFU L;  1NPQ A;  1JUO A;  2F2P A;  1TCO B;  2KAV A;  3NSL A;  1H4B A;  1KFX S;  4CLN A;  1HT9 A;  1A75 A;  2KNE A;  1M39 A;  4YGE B;  2LUC A;  2KDH A;  2CCM A;  2Y5I A;  1OMR A;  1PVB A;  3FIA A;  3EVV A;  2ZKM X;  2E6W A;  1S6I A;  3LCP C;  3DVM A;  3BYA A;  3PM8 A;  1C07 A;  1SCM B;  4GNK B;  1KK8 B;  1GQM A;  4GGN A;  5AER A;  1NX2 A;  3CTN A;  4UPG A;  2L98 A;  2F3Y A;  2ZN9 A;  1UHJ A;  1RWY A;  1GGW A;  2EHB A;  2BL0 B;  3I5G B;  1SRA A;  4GFT A;  4FQO A;  3HCM A;  1TTX A;  4I5K A;  4PHM A;  1KSM A;  4A4B A;  1K9U A;  1KK7 Y;  1SCV A;  3OX6 A;  2KI6 C;  1LVC D;  1IWQ A;  3DVK A;  1JFJ A;  2MRD A;  3LLE A;  1TNP A;  1SPY A;  1DJX A;  2LLT A;  2BKH B;  3FS7 A;  2H61 A;  2GV5 A;  1OMD A;  4M2P A;  2F8P A;  2Q4U A;  3KF9 A;  1N65 A;  5HLO A;  1NX1 A;  4FTG A;  1SL7 A;  3CLN A;  3KEV A;  5K89 A;  2KSP A;  1KFU S;  1A2X A;  1XFX O;  2HF5 A;  5KU1 A;  3BUW B;  3PSR A;  3I5F B;  4GPL B;  4D1E A;  2F3Z A;  2H2K A;  1K9K A;  5AAN A;  3TS5 B;  4F0Z B;  2LC5 A;  2LM5 A;  1TOP A;  5B8I B;  2AAO A;  2I94 A;  1S1E A; 
#chains in the Genus database with same CATH topology
 4YGA A;  1LIN A;  4L9M A;  1IQ3 A;  1T14 A;  3EK8 A;  1U5I A;  1NIW A;  2QEV A;  3R1O A;  3WHT B;  2PRU A;  1YR5 A;  2KQ6 A;  2KOT A;  2BAP A;  1QX7 A;  2KHN A;  3VRN A;  3VB1 A;  2AUC A;  4ORA B;  3AKB A;  3AKA A;  1KWO C;  1G4Y R;  3R1P A;  2OTG B;  2NCP A;  1DJZ A;  5HKZ A;  2P70 A;  2B1U A;  4JD9 A;  3OX5 A;  2M8U A;  1MWN A;  1WY9 A;  4C0L A;  2EC6 B;  3LK1 A;  3D73 A;  1DJW A;  2WND A;  1AVS A;  1QVI Y;  2KGR A;  2BBN A;  3S0G A;  1QTX A;  1X02 A;  3BXK A;  2L0P A;  1MHO A;  3ZWH A;  3UO9 A;  3VRR A;  1XFY O;  2WC8 A;  1TUJ A;  2M1U A;  1QIV A;  3EKH A;  5D3O A;  1MR8 A;  1YX7 A;  1G8I A;  2OS8 C;  1V1F A;  2JTT A;  3SG7 A;  2JUL A;  1YVH A;  2Q91 A;  1C3Z A;  5TNC A;  3GK2 A;  2KI6 D;  1KQM B;  2Y4Q A;  1DQE A;  5I2L A;  3PJI A;  2P71 A;  1SY9 A;  1YUS A;  3IQQ A;  2K7C A;  5HKY A;  4DIR A;  2NZ0 A;  3PN7 C;  3B86 A;  4PE0 A;  1TIZ A;  3EKJ A;  5AEQ A;  3O4X A;  4DRW A;  1XA5 A;  2VRG A;  4XYN A;  5PAL A;  2MHH A;  1UUS A;  1CDN A;  1M46 A;  1K9P A;  3NXA A;  2QPT A;  5CSI A;  5DKN A;  4PT1 A;  1OSA A;  1W7J B;  1DJG A;  1B9A A;  1BMO A;  1S6C A;  1CLL A;  2V53 A;  1E8A A;  3H4S E;  1S3P A;  1SSE B;  2JZI A;  1PSR A;  4PE4 A;  3RLZ A;  1A75 B;  1EXR A;  1BLQ A;  3DYE A;  2OPO A;  3NSI A;  1QWV A;  4CFQ A;  2I7A A;  2K8M B;  1IRJ A;  1J1E A;  1DGV A;  3OP0 A;  1JSA A;  2KFF A;  1FF1 A;  2JT8 A;  1CLM A;  1IGV A;  2O5G A;  1EJ3 A;  4HSZ A;  1WLZ A;  4MRY A;  4PDZ A;  5DKR A;  3JTD C;  1WRL A;  1QXP A;  3I5I C;  1VRK A;  4IJ7 A;  4KYN A;  2JXC A;  1F70 A;  2K60 A;  1J1D A;  1XK4 A;  1QV0 A;  1WDC B;  2JNF A;  3B6X A;  3GOF A;  1SYM A;  3JVT C;  2M9G A;  2PSR A;  3C1V A;  3SG2 A;  4A4C A;  2BCA A;  5HL1 A;  2G9B A;  1JF2 A;  1UHK A;  3S0A A;  2SCP A;  1TNW A;  3FE6 A;  3IQO A;  4JQ0 D;  2JQ6 A;  3S0B A;  2M7N A;  2CBL A;  2QDI A;  1Z4H A;  2L2E A;  3D76 A;  5HYD A;  1L2O B;  1JWD A;  1IQ5 A;  2R2I A;  2FCD A;  3SG6 A;  1J7P A;  1DTL A;  1Y1U A;  3B7A A;  3NHI A;  2SAS A;  2LHL A;  1M31 A;  3IVT A;  2WCJ A;  4INW A;  1JF0 A;  2CXJ A;  2M7L A;  4AQI A;  2NCO A;  1Z2C B;  2GGM A;  3PM2 A;  3SJS A;  1GJY A;  3QRX A;  3FE9 A;  1FW4 A;  2I18 A;  3FWC A;  1BU3 A;  3NGV A;  1BG1 A;  4MBE A;  1SCM C;  1QLS A;  1KK8 C;  3EVR A;  3L4L A;  4IL1 A;  1XFV O;  2COL B;  3VRO A;  3R1V A;  1PRW A;  3O2P A;  1YRU B;  2GGZ A;  1SR6 B;  3CZ1 A;  3S0E A;  2Y1M A;  1KQV A;  2IS9 A;  1OOI X;  2PMY A;  2KI4 B;  2BL0 C;  2L2C A;  4PE1 A;  2LVV A;  2O60 A;  2MLE C;  4PHN A;  2CTN A;  3CR4 X;  1AP4 A;  2PAS A;  4PAL A;  1D1O A;  1PSB A;  3O4Y A;  3D77 A;  5JOL A;  2K7B A;  1MQ1 A;  1TNX A;  3CYZ A;  3BFB A;  4DCK A;  4YBH B;  1J7R A;  2JNX A;  3O78 A;  1U5I B;  3M0W A;  1ORG A;  2JPO A;  4R1E A;  2FJU B;  1G33 A;  1Y1X A;  1IJ5 A;  2LP2 A;  3F45 A;  1QLK A;  1F4Q A;  3CR5 X;  5EL2 A;  1PAL A;  1CMG A;  2RGI A;  3D0Y A;  1ZOT B;  4I5J A;  1ZMZ A;  2K2A A;  2BE4 A;  3SG4 A;  3R72 A;  3AAK A;  3PAT A;  5ER4 X;  1F55 A;  1NYA A;  2JPT A;  1MXL C;  2M3W A;  3S0D A;  2EGD A;  2KGB C;  2M97 A;  1F4O A;  1NCX A;  1WRZ A;  1YUT A;  2GTE A;  2PAL A;  3I5F C;  3CS1 A;  4GGF C;  5AXI A;  3KHE A;  2WOR A;  1EL4 A;  3I5H B;  1BR1 B;  3TS5 C;  4QJ4 B;  5CSN A;  1Y0V H;  1BOD A;  2KBM A;  2K61 A;  4N1F A;  4PHK A;  4U8D A;  2MLF C;  2ZND A;  1TN4 A;  1EG3 A;  1K90 D;  4WRI A;  4XJK A;  1DT7 B;  5J3X A;  2JU0 A;  1K94 A;  1DJI A;  4I5L B;  4AQJ A;  1M45 A;  1SL8 A;  3HX4 A;  3SS4 A;  2DOQ A;  2LP3 A;  1IIO A;  2L51 A;  2WCM A;  3EK4 A;  2OTG C;  3BUN B;  3AAJ A;  3D74 A;  1OMV A;  1IG5 A;  5KSZ A;  1CLB A;  1C7V A;  3VRQ A;  3DXL A;  2LVJ A;  3GK4 X;  4CPV A;  5CSJ A;  3OHM B;  4MZL A;  1RFJ A;  1IJ6 A;  2ZN8 A;  2EC6 C;  1XYD A;  3MSE B;  5BPJ A;  1SNL A;  2BNX A;  1DJH A;  2KFG A;  4HRE E;  2LLU A;  2BBM A;  2KLE A;  1N0Y A;  4YGD B;  3BFA A;  1RTP 1;  2MJW B;  1XFZ O;  2LUX A;  3K1E A;  1CNP A;  1NX0 A;  2F33 A;  1CFP A;  3O6B A;  1QAT A;  4ICB A;  3NHT A;  2L5X B;  1UHN A;  2I2R E;  1FI5 A;  5FI2 A;  1SL9 A;  1C7W A;  1REC A;  2LVI A;  1B4C A;  1L7Z A;  2KPH A;  1XO5 A;  3PLF B;  5CPV A;  1LS8 A;  1CM1 A;  2LMU A;  1KQM C;  1S26 D;  3IF7 A;  2FJY A;  1TWO A;  1K96 A;  2LHI A;  3PN7 B;  1NWD A;  2JXL A;  1RK9 A;  1CDP A;  1YRT B;  3ICB A;  1ODB A;  2KLD A;  2NLN A;  3TUY B;  1LA0 A;  1W7I B;  1QX2 A;  1J7Q A;  1QX5 B;  1ZFS A;  1UHI A;  4YI9 A;  4MLW A;  1Y1A A;  1ZUZ A;  4PCW A;  5D7F A;  1AHR A;  1B8L A;  2JWW A;  5AFP A;  1FI6 A;  2KBI A;  4ZCV A;  1AUI B;  4OCI A;  2CNP A;  4DS7 A;  1JBA A;  4MEW A;  4MZK A;  1DF0 A;  4ORB B;  3I5I B;  2FOT A;  4MSP A;  3ZNI A;  5HKW A;  3PAL A;  3GK1 A;  3D75 A;  1CM4 A;  4F7F A;  2ERB A;  2JRF A;  1CKK A;  3BOW A;  4ZCU A;  2BCB A;  2JT3 A;  1EH2 A;  3CZ0 A;  1CFD A;  1BF5 A;  1M63 B;  1EG4 A;  5IBW A;  2WCF A;  2M29 A;  4QJ3 B;  2WCE A;  1KCY A;  4NDC A;  5GQQ C;  1QJT A;  5ER5 A;  5FI7 A;  2BCX A;  1R6P A;  1ALW A;  4E68 A;  1B1G A;  1S5G Y;  3BQ3 A;  5I94 A;  1F8H A;  1PVA A;  1B8R A;  3OB2 B;  1DEK A;  3NSO A;  3D78 A;  4OV2 A;  3CGA A;  4YGC B;  1L2O C;  4HRG A;  1DMO A;  3S0F A;  2Y1N A;  2L5Y A;  1CMF A;  1MXE A;  1W9Z A;  3L4A A;  1FBV A;  1LXF C;  1ALV A;  1CFC A;  1JFK A;  1A4P A;  1AJ5 A;  3UNW A;  1F71 A;  1BOC A;  1AJ4 A;  5HLV A;  2KYF A;  2H61 C;  3OB1 B;  4YRU A;  3I5G C;  1B8C A;  1J55 A;  3D0Y B;  2NXQ A;  3SIB A;  1HQV A;  1BT6 A;  4WQ3 A;  4BY5 A;  2KFH A;  3E3R A;  1RRO A;  2G2B A;  3WXA A;  2TN4 A;  4MZJ A;  1OE9 B;  1RJV A;  1K95 A;  4OZD A;  1CDM A;  1SR6 C;  4PE7 A;  3EVU A;  3BFH A;  2MAZ A;  2ZRS A;  1NP8 A;  2KI4 C;  3CWG A;  1JC2 A;  3KPX A;  1A29 A;  1R2U A;  1DGU A;  5F6T A;  5JJG A;  1XFW O;  4INX A;  1PK0 D;  1S6J A;  2M0R A;  1K93 D;  4AOM A;  4C0J A;  3SS5 A;  1YUR A;  3B88 A;  4NDB A;  1SK6 D;  1S5G Z;  3BUX B;  3DF0 B;  4GUK A;  4M2Q A;  4XJK B;  1YUU A;  2E30 A;  4M2O A;  5G08 A;  4C0K A;  4QJ5 B;  3K21 A;  4JWQ A;  1TNQ A;  4Q04 A;  2WCK A;  4DUQ A;  4FQT A;  1WRK A;  2MBX A;  1SW8 A;  1H8B A;  4GAO A;  3V2L A;  1XFU O;  2LMT A;  4I5N B;  3LL8 B;  4WQ2 A;  2PVB A;  1CTR A;  1OOG A;  1SMG A;  3OGN A;  2L4I A;  4NDD A;  2FCE A;  2JT0 A;  3BUO B;  2ISD A;  2LVK A;  5FYX A;  2HQ8 A;  4N5X A;  3DF0 A;  3DVJ A;  5D69 A;  1LKJ A;  1QIW A;  1NCY A;  1TRF A;  2M1K B;  3TDI A;  4BY4 A;  4P5O E;  3I5H C;  1ZAC A;  1NUB A;  1B7T Y;  1YVL A;  2F2O A;  1CDL A;  1IH0 A;  2JTZ A;  3DD4 A;  3A4U B;  2LMV A;  5I8N A;  2K2F A;  1IKU A;  4MN0 A;  1BJF A;  1KWO B;  1WLM A;  2CT9 A;  1KK7 Z;  1OOF A;  1KSO A;  1NX3 A;  2ZRT A;  3TZ1 A;  1C3Y A;  2QEH A;  2K7D A;  4GGF A;  1SBJ A;  2LNK A;  2WCB A;  1Q80 A;  4NQG A;  1F54 A;  1OOH A;  5DKQ A;  4YGB B;  4OKH A;  1QS7 A;  1GM0 A;  2HQW A;  1OZS A;  2KYC A;  3VRP A;  2MA2 A;  3LK0 A;  3Q8I A;  1Y6W A;  2K7O A;  4OVN F;  4ETO A;  1AK8 A;  1S36 A;  1KFX L;  1DJY A;  3EG5 B;  1NSH A;  2HET A;  4YI8 A;  2BE6 A;  2OS8 B;  2ZNE A;  3RZS A;  3WHU B;  1MF8 B;  3DZT A;  4P2Y B;  2LAN A;  4OR9 B;  1FPW A;  2KQY A;  3SG3 A;  2JC2 A;  2LCP A;  2JOJ A;  4GBA A;  3CR2 A;  2A4J A;  1J7O A;  5KTY A;  4N1G A;  3WNX B;  4PHJ A;  1V1G A;  1DVI A;  2BKI B;  1OQP A;  1B7T Z;  2WCL A;  3L47 A;  2ZFD A;  3EK7 A;  3SG5 A;  3VGO A;  3CDN A;  1LA3 A;  1OOJ A;  1DF0 B;  4CID A;  1CB1 A;  2KAY A;  1UWO A;  2K0J A;  2P6B B;  2QAC A;  3KO0 A;  3TDU A;  4MVF A;  1QAS A;  1XK4 C;  3RM1 A;  2AMI A;  1TCF A;  3BOW B;  1GGZ A;  1UP5 A;  1P28 A;  3FWB A;  4CFR A;  1NCZ A;  1PUL A;  5I2Q A;  3CAB A;  3A8R A;  5FI6 A;  1OZO A;  1CFF A;  1UUR A;  1UHH A;  1YX8 A;  2LLS A;  1SKT A;  3SIA A;  1K8U A;  4HRH A;  3SS3 A;  3TUY C;  1YTZ C;  2L4H A;  2M49 B;  3NSK A;  2HPS A;  2KAX A;  3PFV A;  3CZT X;  5I2O A;  1MUX A;  2WC6 A;  1K2H A;  1N2D A;  2LV7 A;  2D8N A;  2LAP A;  1BR4 B;  2BEC A;  3D10 A;  3JTD B;  1A03 A;  2WOS A;  4JPZ B;  5CSF A;  3TDZ A;  2LE9 B;  1WDC C;  2L50 A;  3DVE A;  4ORC B;  3JVT B;  1QVI Z;  4TNC A;  1B47 A;  3BUM B;  4USL A;  1XFR A;  3DY9 A;  1QV1 A;  1XVJ A;  3B87 A;  4MRX A;  1KFU L;  1NPQ A;  1JUO A;  2F2P A;  1TCO B;  2KAV A;  3NSL A;  1H4B A;  1KFX S;  3N7H A;  4CLN A;  1HT9 A;  1A75 A;  2KNE A;  1M39 A;  4YGE B;  2LUC A;  2KDH A;  2WCH A;  2CCM A;  2Y5I A;  1OMR A;  1PVB A;  3FIA A;  3EVV A;  2ZKM X;  2E6W A;  1S6I A;  3LCP C;  1DEL A;  3BYA A;  3DVM A;  3PM8 A;  4JKT A;  5DIC A;  1DC1 A;  1C07 A;  1SCM B;  4GNK B;  1KK8 B;  1GQM A;  3FE8 A;  4GGN A;  1TUZ A;  5AER A;  1NX2 A;  3CTN A;  4UPG A;  2L98 A;  2F3Y A;  2ZN9 A;  1UHJ A;  1RWY A;  1GGW A;  2EHB A;  2BL0 B;  2H8V A;  2PYQ A;  3I5G B;  1SRA A;  4GFT A;  4FQO A;  3HCM A;  1TTX A;  4I5K A;  4PHM A;  1KSM A;  4A4B A;  1K9U A;  1KK7 Y;  1SCV A;  2YGU A;  3OX6 A;  1OW4 A;  2KI6 C;  1LVC D;  1IWQ A;  3DVK A;  3QME A;  1JFJ A;  2MRD A;  3LLE A;  2WC5 A;  1TNP A;  1SPY A;  1DJX A;  2LLT A;  2BKH B;  3CZ2 A;  3FS7 A;  2H61 A;  2GV5 A;  1OMD A;  4M2P A;  2F8P A;  2Q4U A;  3BJH A;  3KF9 A;  1N65 A;  5HLO A;  1NX1 A;  4FTG A;  1SL7 A;  3CLN A;  3KEV A;  3OBV A;  5K89 A;  2KSP A;  1KFU S;  1A2X A;  1XFX O;  2HF5 A;  5KU1 A;  3BUW B;  3PSR A;  3I5F B;  4GPL B;  4D1E A;  2F3Z A;  2H2K A;  1K9K A;  5AAN A;  2QEB A;  2PQL A;  3TS5 B;  4F0Z B;  2LC5 A;  2LM5 A;  1TOP A;  2QEO A;  5B8I B;  2AAO A;  2I94 A;  1S1E A; 
#chains in the Genus database with same CATH homology
 4YGA A;  1LIN A;  4L9M A;  1IQ3 A;  3EK8 A;  1U5I A;  1NIW A;  3WHT B;  2PRU A;  1YR5 A;  2KQ6 A;  2KOT A;  1QX7 A;  2KHN A;  3VRN A;  2AUC A;  4ORA B;  3AKB A;  3AKA A;  1KWO C;  1G4Y R;  2OTG B;  2NCP A;  1DJZ A;  5HKZ A;  2B1U A;  3OX5 A;  2M8U A;  1MWN A;  1WY9 A;  4C0L A;  2EC6 B;  3LK1 A;  1DJW A;  2WND A;  1AVS A;  1QVI Y;  2KGR A;  2BBN A;  1QTX A;  1X02 A;  3BXK A;  2L0P A;  1MHO A;  3ZWH A;  3VRR A;  1XFY O;  2WC8 A;  2M1U A;  1QIV A;  3EKH A;  1MR8 A;  1YX7 A;  1G8I A;  2OS8 C;  1V1F A;  2JTT A;  3SG7 A;  2JUL A;  1YVH A;  2Q91 A;  5TNC A;  3GK2 A;  2KI6 D;  1KQM B;  2Y4Q A;  5I2L A;  1SY9 A;  1YUS A;  3IQQ A;  2K7C A;  5HKY A;  4DIR A;  2NZ0 A;  3PN7 C;  4PE0 A;  1TIZ A;  3EKJ A;  5AEQ A;  4DRW A;  1XA5 A;  2VRG A;  4XYN A;  5PAL A;  2MHH A;  1UUS A;  1CDN A;  1M46 A;  1K9P A;  3NXA A;  2QPT A;  5CSI A;  5DKN A;  1OSA A;  1W7J B;  1DJG A;  1B9A A;  1BMO A;  1S6C A;  1CLL A;  2V53 A;  1E8A A;  3H4S E;  1S3P A;  3RLZ A;  2JZI A;  1PSR A;  4PE4 A;  1BLQ A;  1A75 B;  1EXR A;  2OPO A;  3NSI A;  4CFQ A;  2I7A A;  2K8M B;  1IRJ A;  1J1E A;  1DGV A;  3OP0 A;  1JSA A;  2KFF A;  1FF1 A;  2JT8 A;  1CLM A;  1IGV A;  2O5G A;  1EJ3 A;  4HSZ A;  1WLZ A;  4MRY A;  4PDZ A;  5DKR A;  3JTD C;  1WRL A;  1QXP A;  3I5I C;  1VRK A;  1F70 A;  2JXC A;  1J1D A;  1XK4 A;  1QV0 A;  1WDC B;  2JNF A;  3GOF A;  1SYM A;  3JVT C;  2M9G A;  2PSR A;  3C1V A;  3SG2 A;  4A4C A;  2BCA A;  2G9B A;  1JF2 A;  1UHK A;  2SCP A;  1TNW A;  3IQO A;  4JQ0 D;  2JQ6 A;  2M7N A;  2CBL A;  2L2E A;  5HYD A;  1L2O B;  1JWD A;  1IQ5 A;  2R2I A;  2FCD A;  3SG6 A;  1J7P A;  1DTL A;  1Y1U A;  2SAS A;  2LHL A;  1M31 A;  1JF0 A;  2CXJ A;  2M7L A;  4AQI A;  2NCO A;  2GGM A;  3SJS A;  1GJY A;  3QRX A;  1FW4 A;  2I18 A;  3FWC A;  1BU3 A;  1BG1 A;  4MBE A;  1SCM C;  1QLS A;  1KK8 C;  3EVR A;  4IL1 A;  1XFV O;  2COL B;  3VRO A;  1PRW A;  3O2P A;  1YRU B;  2GGZ A;  1SR6 B;  2Y1M A;  2IS9 A;  2PMY A;  2KI4 B;  2BL0 C;  4PE1 A;  2LVV A;  2O60 A;  2MLE C;  4PHN A;  2CTN A;  3CR4 X;  1AP4 A;  2PAS A;  4PAL A;  1D1O A;  1PSB A;  3O4Y A;  5JOL A;  2K7B A;  1MQ1 A;  1TNX A;  4DCK A;  4YBH B;  1J7R A;  2JNX A;  3O78 A;  1U5I B;  3M0W A;  4R1E A;  2FJU B;  1G33 A;  1Y1X A;  1IJ5 A;  2LP2 A;  3F45 A;  1QLK A;  1F4Q A;  3CR5 X;  1PAL A;  1CMG A;  2RGI A;  3D0Y A;  1ZOT B;  4I5J A;  1ZMZ A;  2K2A A;  2BE4 A;  3SG4 A;  5ER4 X;  3AAK A;  3PAT A;  1F55 A;  1NYA A;  2JPT A;  1MXL C;  2M3W A;  2EGD A;  2KGB C;  2M97 A;  1F4O A;  1NCX A;  1WRZ A;  1YUT A;  2PAL A;  3I5F C;  5AXI A;  3CS1 A;  4GGF C;  3KHE A;  2WOR A;  1EL4 A;  3I5H B;  1BR1 B;  3TS5 C;  4QJ4 B;  5CSN A;  1Y0V H;  1BOD A;  2KBM A;  2K61 A;  4N1F A;  4PHK A;  4U8D A;  2MLF C;  2ZND A;  1TN4 A;  1EG3 A;  1K90 D;  4WRI A;  4XJK A;  1DT7 B;  5J3X A;  2JU0 A;  1K94 A;  1DJI A;  4I5L B;  4AQJ A;  1M45 A;  1SL8 A;  3HX4 A;  2DOQ A;  2LP3 A;  2L51 A;  3EK4 A;  2OTG C;  3BUN B;  3AAJ A;  1OMV A;  1IG5 A;  5KSZ A;  1CLB A;  1C7V A;  3VRQ A;  2LVJ A;  3GK4 X;  4CPV A;  5CSJ A;  3OHM B;  4MZL A;  1RFJ A;  1IJ6 A;  2ZN8 A;  2EC6 C;  1XYD A;  3MSE B;  5BPJ A;  1SNL A;  1DJH A;  2KFG A;  4HRE E;  2LLU A;  2BBM A;  1N0Y A;  4YGD B;  1RTP 1;  2MJW B;  1XFZ O;  2LUX A;  1CNP A;  1NX0 A;  2F33 A;  1CFP A;  3O6B A;  1QAT A;  4ICB A;  2L5X B;  1UHN A;  2I2R E;  1FI5 A;  1SL9 A;  1C7W A;  1REC A;  2LVI A;  1L7Z A;  1XO5 A;  3PLF B;  5CPV A;  1CM1 A;  2LMU A;  1KQM C;  1S26 D;  3IF7 A;  1K96 A;  2LHI A;  3PN7 B;  1NWD A;  2JXL A;  1RK9 A;  1CDP A;  1YRT B;  3ICB A;  1ODB A;  2NLN A;  3TUY B;  1LA0 A;  1W7I B;  1QX2 A;  1J7Q A;  1QX5 B;  1ZFS A;  1UHI A;  4YI9 A;  4MLW A;  1Y1A A;  1ZUZ A;  4PCW A;  5D7F A;  1AHR A;  1B8L A;  2JWW A;  5AFP A;  1FI6 A;  2KBI A;  4ZCV A;  1AUI B;  4OCI A;  2CNP A;  4DS7 A;  1JBA A;  4MEW A;  4MZK A;  1DF0 A;  4ORB B;  3I5I B;  2FOT A;  4MSP A;  3ZNI A;  5HKW A;  3PAL A;  3GK1 A;  1CM4 A;  2JRF A;  1CKK A;  3BOW A;  4ZCU A;  2BCB A;  2JT3 A;  1EH2 A;  1CFD A;  1BF5 A;  1M63 B;  1EG4 A;  5IBW A;  2WCF A;  2M29 A;  4QJ3 B;  2WCE A;  1KCY A;  4NDC A;  5GQQ C;  1QJT A;  5ER5 A;  2BCX A;  1R6P A;  1ALW A;  4E68 A;  1B1G A;  1S5G Y;  3BQ3 A;  1F8H A;  1PVA A;  1B8R A;  3OB2 B;  3NSO A;  4OV2 A;  3CGA A;  4YGC B;  1L2O C;  4HRG A;  1DMO A;  2Y1N A;  1CMF A;  1MXE A;  1FBV A;  1LXF C;  1ALV A;  1CFC A;  1JFK A;  1A4P A;  1AJ5 A;  1F71 A;  1BOC A;  1AJ4 A;  5HLV A;  2KYF A;  2H61 C;  3OB1 B;  4YRU A;  3I5G C;  1B8C A;  1J55 A;  3D0Y B;  2NXQ A;  3SIB A;  1HQV A;  1BT6 A;  4WQ3 A;  4BY5 A;  2KFH A;  3E3R A;  1RRO A;  2G2B A;  3WXA A;  2TN4 A;  4MZJ A;  1OE9 B;  1RJV A;  1K95 A;  1CDM A;  1SR6 C;  4PE7 A;  3EVU A;  2MAZ A;  2ZRS A;  1NP8 A;  2KI4 C;  3CWG A;  1JC2 A;  3KPX A;  1A29 A;  1R2U A;  1DGU A;  5F6T A;  5JJG A;  1XFW O;  1PK0 D;  1S6J A;  2M0R A;  1K93 D;  4AOM A;  4C0J A;  1YUR A;  4NDB A;  1SK6 D;  1S5G Z;  3BUX B;  3DF0 B;  4GUK A;  4M2Q A;  4XJK B;  1YUU A;  2E30 A;  4M2O A;  5G08 A;  4C0K A;  4QJ5 B;  3K21 A;  4JWQ A;  1TNQ A;  4Q04 A;  4DUQ A;  2MBX A;  1WRK A;  1SW8 A;  1H8B A;  4GAO A;  1XFU O;  2LMT A;  4I5N B;  3LL8 B;  4WQ2 A;  2PVB A;  1CTR A;  1SMG A;  2L4I A;  4NDD A;  2FCE A;  2JT0 A;  3BUO B;  2ISD A;  2LVK A;  5FYX A;  2HQ8 A;  4N5X A;  3DF0 A;  3DVJ A;  5D69 A;  1LKJ A;  1QIW A;  1NCY A;  1TRF A;  2M1K B;  3TDI A;  4BY4 A;  4P5O E;  3I5H C;  1ZAC A;  1NUB A;  1B7T Y;  1YVL A;  2F2O A;  1CDL A;  1IH0 A;  2JTZ A;  3DD4 A;  3A4U B;  2LMV A;  5I8N A;  2K2F A;  1IKU A;  4MN0 A;  1BJF A;  1KWO B;  1WLM A;  2CT9 A;  1KK7 Z;  1KSO A;  1NX3 A;  2ZRT A;  3TZ1 A;  2K7D A;  4GGF A;  1SBJ A;  2LNK A;  2WCB A;  1Q80 A;  4NQG A;  1F54 A;  5DKQ A;  4YGB B;  4OKH A;  1QS7 A;  2HQW A;  1OZS A;  2KYC A;  3VRP A;  2MA2 A;  3LK0 A;  4ETO A;  1Y6W A;  2K7O A;  4OVN F;  1AK8 A;  1S36 A;  1KFX L;  1DJY A;  1NSH A;  2HET A;  4YI8 A;  2BE6 A;  2OS8 B;  2ZNE A;  3WHU B;  1MF8 B;  4P2Y B;  2LAN A;  4OR9 B;  1FPW A;  2KQY A;  3SG3 A;  2JC2 A;  2LCP A;  2JOJ A;  4GBA A;  3CR2 A;  2A4J A;  1J7O A;  5KTY A;  4N1G A;  3WNX B;  4PHJ A;  1V1G A;  1DVI A;  2BKI B;  1OQP A;  1B7T Z;  3VGO A;  1KQV A;  2ZFD A;  3EK7 A;  3SG5 A;  1LA3 A;  1OOJ A;  1DF0 B;  4CID A;  1CB1 A;  2KAY A;  1UWO A;  2K0J A;  2P6B B;  2QAC A;  3KO0 A;  3TDU A;  4MVF A;  1QAS A;  1XK4 C;  3RM1 A;  2AMI A;  1TCF A;  3BOW B;  1GGZ A;  1UP5 A;  3FWB A;  4CFR A;  1NCZ A;  1PUL A;  5I2Q A;  3A8R A;  1OZO A;  1CFF A;  1UUR A;  1UHH A;  1YX8 A;  2LLS A;  1SKT A;  3SIA A;  1K8U A;  4HRH A;  1B4C A;  3TUY C;  1YTZ C;  2L4H A;  2M49 B;  3NSK A;  2HPS A;  2KAX A;  3PFV A;  3CZT X;  5I2O A;  1MUX A;  1K2H A;  1N2D A;  2LV7 A;  2D8N A;  2LAP A;  1BR4 B;  2BEC A;  3D10 A;  3JTD B;  1A03 A;  2WOS A;  4JPZ B;  5CSF A;  3TDZ A;  2LE9 B;  1WDC C;  2L50 A;  3DVE A;  4ORC B;  3JVT B;  1QVI Z;  4TNC A;  1B47 A;  3BUM B;  4USL A;  1QV1 A;  1XVJ A;  4MRX A;  1KFU L;  1NPQ A;  1JUO A;  2F2P A;  1TCO B;  2KAV A;  3NSL A;  1H4B A;  1KFX S;  4CLN A;  1HT9 A;  1A75 A;  2KNE A;  1M39 A;  4YGE B;  2LUC A;  2KDH A;  2CCM A;  2Y5I A;  1OMR A;  1PVB A;  3FIA A;  3EVV A;  2ZKM X;  2E6W A;  1S6I A;  3LCP C;  3DVM A;  3BYA A;  3PM8 A;  1C07 A;  1SCM B;  4GNK B;  1KK8 B;  1GQM A;  4GGN A;  5AER A;  1NX2 A;  3CTN A;  4UPG A;  2L98 A;  2F3Y A;  2ZN9 A;  1UHJ A;  1RWY A;  1GGW A;  2EHB A;  2BL0 B;  3I5G B;  1SRA A;  4GFT A;  4FQO A;  3HCM A;  1TTX A;  4I5K A;  4PHM A;  1KSM A;  4A4B A;  1K9U A;  1KK7 Y;  1SCV A;  3OX6 A;  2KI6 C;  1LVC D;  1IWQ A;  3DVK A;  1JFJ A;  2MRD A;  3LLE A;  1TNP A;  1SPY A;  1DJX A;  2LLT A;  2BKH B;  3FS7 A;  2H61 A;  2GV5 A;  1OMD A;  4M2P A;  2F8P A;  2Q4U A;  3KF9 A;  1N65 A;  5HLO A;  1NX1 A;  4FTG A;  1SL7 A;  3CLN A;  3KEV A;  5K89 A;  2KSP A;  1KFU S;  1A2X A;  1XFX O;  2HF5 A;  5KU1 A;  3BUW B;  3PSR A;  3I5F B;  4GPL B;  4D1E A;  2F3Z A;  2H2K A;  1K9K A;  5AAN A;  3TS5 B;  4F0Z B;  2LC5 A;  2LM5 A;  1TOP A;  5B8I B;  2AAO A;  2I94 A;  1S1E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...