4UPGA

X-ray structure of calcium-free human sorcin
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
169
structure length
169
Chain Sequence
QTQDPLYGYFAAVAGQDGQIDADELQRCLTQSGIAGGYKPFNLETCRLMVSMLDRDMSGTMGFNEFKELWAVLNGWRQHFISFDTDRSGTVDPQELQKALTTMGFRLSPQAVNSIAKRYSTNGKITFDDYIACCVKLRALTDSFRRRDTAQQGVVNFPYDDFIQCVMSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SORCIN
publication title Structural Basis of Sorcin-Mediated Calcium-Dependent Signal Transduction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 59
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 2014-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13405 EF-hand_6 EF-hand domain
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4upgA00
1OSAA 1XK4C 1CFFA 1MR8A 1X02A 2M49B 4HREE 2KGRA 3TDUA 4OCIA 2CBLA 1CDLA 1NYAA 4ORAB 3I5GB 5I2QA 2JWWA 3WXAA 1GGZA 1NSHA 3CLNA 4M2QA 2LHIA 4WQ3A 1SL9A 2KFFA 1B47A 1A2XA 1FI5A 1H8BA 2COLB 5JOLA 3GK1A 4YRUA 1NX0A 1R2UA 1KK8B 1DTLA 2Y1NA 4PCWA 1FBVA 2JQ6A 3GOFA 1AUIB 4I5LB 3RLZA 2QACA 3NSLA 2F3ZA 4M2OA 4MSPA 3GK4X 3PM8A 2LP2A 2JULA 1SK6D 1KK7Y 2LMTA 2D8NA 1PULA 2JNFA 4YI9A 1XVJA 2K8MB 1S5GY 3KHEA 2K7DA 3PSRA 5K89A 1FF1A 2IS9A 3O2PA 2LMVA 2K7OA 2M7NA 2ZFDA 1HQVA 1NX2A 1OE9B 5HLVA 2ZN9A 1SPYA 1JUOA 3EK8A 3PLFB 4ZCUA 3TS5C 4ORCB 2QPTA 1UHHA 1Y6WA 2JRFA 1M45A 1QASA 5KU1A 1G4YR 1F54A 2OS8C 1KFXS 1K9UA 1SL7A 1YUSA 5I2OA 4L9MA 5DKNA 1BOCA 2JXCA 1ZACA 2LANA 4PE1A 1IH0A 1OMDA 3I5FC 2LM5A 2H61C 1QVIY 2LAPA 3MSEB 4PHJA 3A4UB 1IWQA 2BCAA 1VRKA 2KHNA 3KO0A 1ALWA 2BL0B 3EKJA 5FYXA 1CB1A 1RTP1 1KFUS 1EL4A 4YBHB 3HCMA 2LNKA 2K2AA 5AERA 2EC6B 4YGCB 2PALA 1N0YA 2GV5A 4MVFA 2M7LA 1NP8A 1WDCC 1E8AA 1F71A 1GJYA 2ZRTA 1CDNA 1KCYA 3A8RA 2MLFC 1K8UA 2LVVA 1S3PA 1B8RA 2TN4A 5AFPA 1WY9A 2MBXA 1KSOA 2K0JA 4CFQA 2AUCA 1IRJA 2WOSA 4PE4A 3KPXA 4YGEB 2JOJA 2I18A 2LLUA 1BG1A 2LUCA 2ZNDA 5F6TA 2AAOA 2OTGB 3IQQA 2CTNA 3VRNA 3CR2A 3D0YA 4XJKA 2JXLA 3O6BA 3DVKA 4D1EA 1TCOB 1YRUB 1J7RA 3DF0A 1IGVA 3E3RA 1SYMA 1C7WA 1N2DA 1XO5A 2NZ0A 3I5IB 1NX1A 1SNLA 4GUKA 4BY5A 1L2OB 2Y5IA 2NLNA 3LL8B 5AANA 2MA2A 3D0YB 4XJKB 2Y4QA 1CMGA 5ER5A 4PE0A 4ORBB 1IJ5A 1BR4B 1M31A 4MZJA 2SCPA 1KFXL 2E6WA 1QX2A 1WLMA 1CMFA 2HETA 4BY4A 4JWQA 4PDZA 2KYCA 2FJUB 2ZN8A 4JPZB 1AJ5A 1B1GA 1AVSA 3KF9A 3I5GC 4PHMA 1G8IA 1A4PA 2BKHB 1MF8B 2H2KA 5I2LA 2BBMA 4I5JA 1QX7A 1KK8C 2KAVA 1BLQA 2LHLA 1J7OA 4I5NB 3BXKA 5HYDA 1JFKA 1H4BA 1CDMA 1QV1A 2WCBA 4UPGA 2K7BA 2PMYA 4FQOA 2SASA 1PALA 2EHBA 1SR6B 1B7TY 1W7JB 2PVBA 3OX6A 3PATA 5AEQA 4YGBB 3JVTB 1PRWA 4WRIA 4YI8A 5HKZA 1NUBA 3EVRA 2MJWB 1YURA 1B8CA 2KAYA 3LK1A 1XYDA 2CCMA 2KI6C 1EH2A 2L5XB 3BUXB 2M97A 3LLEA 5I8NA 3D10A 1XFVO 1QIWA 1NCYA 4C0JA 2LVIA 1QLSA 1CM4A 3TUYB 1FI6A 3SG7A 1UP5A 4NDDA 3SG2A 4ETOA 1F55A 3SIAA 2AMIA 1S36A 1SW8A 2KFHA 4N1GA 1GQMA 1QLKA 1PVBA 1MQ1A 1UHIA 2G9BA 1TN4A 1ALVA 1A03A 1TNWA 3EKHA 4AQJA 2JT8A 1DJHA 2CXJA 2BL0C 3PN7C 3EVVA 4XYNA 3AAKA 2M8UA 1PVAA 3AAJA 2HQ8A 3O78A 3C1VA 4NQGA 3NSKA 2EC6C 2K7CA 4IL1A 2P6BB 1SRAA 2KQYA 4MN0A 2CNPA 1A29A 2F2PA 1XFYO 3ICBA 5BPJA 3CR4X 4MZLA 4DCKA 1OOJA 3OB1B 2ISDA 1WRZA 2WORA 4JQ0D 2KSPA 3VROA 3IQOA 4HRHA 4CLNA 3DVJA 1PSBA 3EK7A 3OP0A 1F4OA 2LCPA 2LLTA 2KNEA 1MXEA 1YUTA 5ER4X 3VRPA 1QIVA 1IKUA 3QRXA 4F0ZB 1CLMA 1HT9A 2KI4B 1F4QA 1QX5B 2OTGC 4PE7A 5CSIA 3BUNB 2PRUA 1DGVA 1UHKA 4C0LA 2LLSA 2PSRA 5CSNA 2KQ6A 2KBIA 1QTXA 2L50A 1L7ZA 4WQ2A 1S26D 3FIAA 4HSZA 3NSIA 3SG3A 2L4IA 2F3YA 3I5IC 1DT7B 1L2OC 1LKJA 2BKIB 2I7AA 1XFXO 1FPWA 2Q91A 4PHKA 1S6JA 4DRWA 1R6PA 2NXQA 3WHTB 1K95A 2R2IA 1KQVA 1TRFA 2JT3A 3FS7A 1JF0A 1K9PA 5D69A 4OR9B 1WLZA 3RM1A 3BUOB 1UHNA 5KTYA 1J7QA 2M3WA 1K94A 1UWOA 1UURA 2JU0A 1OMRA 1AP4A 1B4CA 5JJGA 1K96A 1TTXA 3KEVA 3PALA 2L51A 1DJGA 2LP3A 3JTDB 1CKKA 1NX3A 1CNPA 3CZTX 1WRKA 4U8DA 2BE6A 3I5HB 1KWOB 1JWDA 5HLOA 2VRGA 1LA3A 1OMVA 2MLEC 1Y1AA 2LC5A 4DIRA 1QS7A 1XFWO 1LA0A 2BE4A 4P5OE 3PFVA 2Y1MA 4DUQA 2RGIA 3TDIA 2EGDA 1RFJA 2M1UA 1SCVA 4A4CA 1CFPA 1RJVA 4QJ5B 1F70A 1YVHA 2LVKA 3SIBA 1SR6C 1JF2A 1B8LA 1C7VA 4GGFA 1SCMB 4YGDB 4FTGA 3JVTC 5AXIA 5HKWA 5D7FA 2L98A 4MBEA 2KGBC 4CIDA 1ZMZA 1NPQA 2KDHA 1EJ3A 4PALA 2L2EA 1KFUL 1S6IA 1F8HA 1BJFA 3DVMA 1G33A 1YVLA 4GNKB 1EG4A 2MRDA 3EVUA 2FOTA 3CTNA 5CSFA 3CGAA 1ODBA 2LUXA 5HKYA 3TUYC 2LV7A 1NCZA 3VRQA 2M0RA 5IBWA 2BECA 1Y1UA 3BUMB 2KOTA 3CS1A 1YUUA 1JBAA 2F8PA 2O5GA 3BOWA 1RECA 1FW4A 1MUXA 1PK0D 2OPOA 2V53A 4MLWA 2F33A 2MAZA 4TNCA 2I94A 4QJ4B 1M46A 1QJTA 1CLBA 1OQPA 4MEWA 3AKAA 1YR5A 2L4HA 3SG5A 5TNCA 3NSOA 1YTZC 1DMOA 3FWCA 3HX4A 4C0KA 2M9GA 1K93D 2G2BA 3BOWB 2FCEA 4YGAA 1CM1A 1CTRA 3WHUB 2F2OA 1IJ6A 2JTTA 1KQMB 1AHRA 4DS7A 4MRXA 4N5XA 3SJSA 2NCPA 2BCBA 3CR5X 2HPSA 5B8IB 1BT6A 1J7PA 1W7IB 1ZUZA 4QJ3B 2KI4C 4CFRA 1BODA 1BR1B 4PHNA 1CLLA 1NWDA 1SMGA 1XK4A 1RK9A 1ZOTB 1WRLA 5GQQC 2K61A 5KSZA 1QXPA 2LE9B 1Y0VH 2JPTA 4OKHA 4GPLB 4I5KA 1AJ4A 1CDPA 1ZFSA 5G08A 3SG6A 1YX8A 2CT9A 1D1OA 1UHJA 1DVIA 4MRYA 2LVJA 1OZOA 3OB2B 2JC2A 1K90D 4NDCA 4Q04A 2MHHA 1SKTA 1BU3A 3TDZA 3BUWB 3K21A 3EK4A 1B7TZ 1AK8A 2BCXA 2I2RE 4GBAA 1XFZO 4MZKA 4USLA 1RWYA 3GK2A 1IQ5A 2O60A 1YRTB 1DJWA 3JTDC 1M63B 3IF7A 2K2FA 3CWGA 5DKRA 1XA5A 2WC8A 1KWOC 3I5HC 4HRGA 1DJIA 3ZWHA 4ICBA 3BQ3A 1V1GA 4GGNA 2ZKMX 1J55A 3TZ1A 3WNXB 2A4JA 1SY9A 5CSJA 1OZSA 1C07A 3PN7B 3AKBA 2KBMA 1U5IA 2GGMA 3O4YA 1CFCA 1S1EA 1KK7Z 1JSAA 1YX7A 3BYAA 1K9KA 3M0WA 2JZIA 1B9AA 1LVCD 1MHOA 4R1EA 2FCDA 1SCMC 1DF0A 1S5GZ 1DGUA 2H61A 2KYFA 1Y1XA 2Q4UA 3TS5B 5PALA 1Q80A 2ZNEA 4A4BA 1RROA 2OS8B 2DOQA 1U5IB 2KFGA 4E68A 1QV0A 1CFDA 1DJZA 1TIZA 2LMUA 3I5FB 4GGFC 4OVNF 1S6CA 3F45A 1DF0B 3NXAA 2ZRSA 5CPVA 1BMOA 1TNXA 3VGOA 3LCPC 1TCFA 2WNDA 1MWNA 4OV2A 5DKQA 4CPVA 1IQ3A 1DJYA 2JTZA 1N65A 3FWBA 1QVIZ 4ZCVA 1LXFC 4P2YB 1K2HA 1JC2A 1WDCB 1EG3A 1QATA 1SBJA 3SG4A 2B1UA 4GAOA 4GFTA 1M39A 1UUSA 2HQWA 2GGZA 1IG5A 1XFUO 1LINA 1BF5A 4NDBA 1KQMC 3DF0B 1DJXA 1PSRA 3LK0A 1A75A 1TNQA 1GGWA 2KI6D 2WCEA 2E30A 2JT0A 3DD4A 3OX5A 1SL8A 4AOMA 1NCXA 3OHMB 5J3XA 2M1KB 3ZNIA 4M2PA 1EXRA 1MXLC 1KSMA 2HF5A 1TNPA 2WCFA 3VRRA 3H4SE 1J1EA 4N1FA 1JFJA 1A75B 1V1FA 2M29A 2BBNA 4AQIA 2NCOA 1NIWA 2L0PA 2KAXA 2JNXA 2PASA 1TOPA 3DVEA 1J1DA
chains in the Genus database with same CATH superfamily
1OSAA 1XK4C 1CFFA 1MR8A 1X02A 2M49B 4HREE 2KGRA 3TDUA 3OGNA 3DY9A 2CBLA 4OCIA 1CDLA 1NYAA 4ORAB 3I5GB 3FE9A 5I2QA 2JWWA 3WXAA 1GGZA 1NSHA 3CLNA 4M2QA 2LHIA 4WQ3A 1SL9A 2KFFA 1B47A 4INXA 1A2XA 1FI5A 1H8BA 2COLB 5JOLA 3GK1A 4YRUA 1NX0A 1R2UA 1KK8B 3BJHA 1DTLA 2Y1NA 4PCWA 1FBVA 2JQ6A 3GOFA 1AUIB 4I5LB 3RLZA 2K60A 2QACA 3NSLA 2F3ZA 4M2OA 4MSPA 3GK4X 3PM8A 2LP2A 3L4AA 2JULA 1SK6D 1KK7Y 2LMTA 2D8NA 1PULA 2JNFA 4YI9A 1XVJA 2K8MB 2QEBA 1S5GY 2WCLA 3KHEA 2K7DA 1OW4A 1Z2CB 3BFAA 3PSRA 5K89A 2IS9A 3O2PA 2LMVA 2K7OA 2M7NA 2ZFDA 1HQVA 1FF1A 1NX2A 2KPHA 1OE9B 5HLVA 2ZN9A 1SPYA 1JUOA 3EK8A 3PLFB 4ZCUA 3TS5C 4ORCB 2QPTA 1UHHA 1Y6WA 2JRFA 1M45A 1QASA 5KU1A 1G4YR 1F54A 2OS8C 3D77A 1KFXS 1K9UA 1SL7A 1YUSA 5I2OA 4L9MA 2PQLA 5DKNA 1BOCA 2JXCA 1ZACA 2LANA 4PE1A 1IH0A 1OMDA 3I5FC 2LM5A 2H61C 1QVIY 2LAPA 3MSEB 4PHJA 3A4UB 1IWQA 2BCAA 1VRKA 2KHNA 2L5YA 1ALWA 3KO0A 2BL0B 3EKJA 2GTEA 5FYXA 1CB1A 1RTP1 1KFUS 1EL4A 4YBHB 3HCMA 2LNKA 2K2AA 3DZTA 3R1PA 5AERA 2EC6B 4YGCB 2PALA 1N0YA 2GV5A 4MVFA 2M7LA 1NP8A 1WDCC 1E8AA 1F71A 1GJYA 2ZRTA 3QMEA 1CDNA 1KCYA 3A8RA 2MLFC 3EG5B 1K8UA 2LVVA 1S3PA 1B8RA 2TN4A 4KYNA 5AFPA 1WY9A 2MBXA 1KSOA 2K0JA 4CFQA 2AUCA 1IRJA 2WOSA 4PE4A 3KPXA 4JD9A 4YGEB 1DELA 2JOJA 2I18A 2LLUA 1BG1A 2LUCA 2ZNDA 5F6TA 2AAOA 2OTGB 3IQQA 2CTNA 3VRNA 3CR2A 3D0YA 4XJKA 2JXLA 3O6BA 3DVKA 2WCJA 4D1EA 1TCOB 1OOGA 1YRUB 1J7RA 3DF0A 1IGVA 3E3RA 1SYMA 2JPOA 1C7WA 3BFBA 1N2DA 1XO5A 2NZ0A 3I5IB 5FI7A 1NX1A 1SNLA 4GUKA 4BY5A 1L2OB 2Y5IA 2NLNA 3LL8B 5AANA 2MA2A 3D0YB 4XJKB 3S0AA 2Y4QA 2H8VA 3B86A 3DYEA 5ER5A 1CMGA 4PE0A 4ORBB 1IJ5A 1BR4B 1M31A 4MZJA 2SCPA 1KFXL 2E6WA 1QX2A 1WLMA 1CMFA 2HETA 3S0DA 4BY4A 4JWQA 4PDZA 2KYCA 2FJUB 2ZN8A 4JPZB 1AJ5A 1B1GA 1AVSA 3KF9A 4IJ7A 3UNWA 3I5GC 4PHMA 1G8IA 1TWOA 1A4PA 2BKHB 1MF8B 2H2KA 5I2LA 2BBMA 4I5JA 1QX7A 1KK8C 3CZ2A 2KAVA 1BLQA 2LHLA 1J7OA 4I5NB 3BXKA 5HYDA 1JFKA 1H4BA 1CDMA 1QV1A 2WCBA 4UPGA 2K7BA 2PMYA 4FQOA 2WCKA 1OOHA 1PALA 2SASA 2EHBA 1SR6B 1B7TY 1W7JB 1SSEB 2PVBA 3OX6A 3PATA 5AEQA 4YGBB 3JVTB 1PRWA 4WRIA 4YI8A 5HKZA 1NUBA 3NHTA 3EVRA 4PT1A 2MJWB 1YURA 1B8CA 2KAYA 3BFHA 1XYDA 2CCMA 2KI6C 3LK1A 2L5XB 1EH2A 3K1EA 3BUXB 2M97A 3LLEA 5I8NA 3D10A 1XFVO 1QIWA 1NCYA 4C0JA 2LVIA 1QLSA 1CM4A 3TUYB 1FI6A 3SG7A 1UP5A 4NDDA 3SG2A 4ETOA 1F55A 3SIAA 2AMIA 1S36A 1SW8A 2KFHA 4N1GA 1GQMA 1QWVA 3R72A 1QLKA 1PVBA 1MQ1A 1UHIA 2G9BA 1TN4A 1ALVA 1A03A 1DC1A 1TNWA 3EKHA 4AQJA 2JT8A 1DJHA 2CXJA 2BL0C 3PN7C 3DXLA 3EVVA 4XYNA 3AAKA 2M8UA 1PVAA 3AAJA 2HQ8A 3O78A 3C1VA 4NQGA 3NSKA 2EC6C 2K7CA 4IL1A 2P6BB 1SRAA 2KQYA 2QDIA 4MN0A 2CNPA 1A29A 2F2PA 1XFYO 3ICBA 5BPJA 3CR4X 4MZLA 4DCKA 1OOJA 3OB1B 2ISDA 3D76A 4FQTA 1WRZA 2WORA 4JQ0D 2KSPA 1XFRA 3IQOA 4HRHA 3VROA 3DVJA 2QEHA 4CLNA 1PSBA 3EK7A 3OP0A 1F4OA 2LCPA 2LLTA 2KNEA 1MXEA 1YUTA 2PYQA 5ER4X 3PM2A 3VRPA 1QIVA 1IKUA 3QRXA 4F0ZB 1CLMA 1HT9A 2KI4B 1F4QA 1QX5B 2OTGC 3L4LA 4PE7A 5CSIA 3BUNB 2PRUA 1DGVA 1UHKA 4C0LA 2LLSA 2PSRA 3CZ1A 5CSNA 2KQ6A 2KBIA 1QTXA 2L50A 1W9ZA 1L7ZA 2WC5A 4WQ2A 1S26D 3FIAA 4HSZA 3NSIA 3SG3A 2L4IA 2F3YA 3I5IC 1DT7B 1L2OC 1LKJA 2BKIB 2I7AA 1XFXO 1FPWA 2Q91A 2YGUA 4PHKA 1S6JA 4DRWA 2WCMA 1R6PA 2NXQA 3WHTB 1K95A 2R2IA 3FE6A 1KQVA 1TRFA 2JT3A 3FS7A 1JF0A 1K9PA 5D69A 4OR9B 1WLZA 3RM1A 3BUOB 1UHNA 2QEVA 5KTYA 2M3WA 1K94A 1UWOA 1UURA 1J7QA 1GM0A 2JU0A 1OMRA 2WCHA 1AP4A 1B4CA 1OOIX 5JJGA 1K96A 1TTXA 3KEVA 3PALA 2L51A 1DJGA 2LP3A 3JTDB 1CKKA 1NX3A 1CNPA 3CZTX 3VB1A 1WRKA 4U8DA 2BE6A 3I5HB 1KWOB 1JWDA 5HLOA 3SS5A 2VRGA 1LA3A 1OMVA 2MLEC 3B7AA 1Y1AA 2LC5A 4DIRA 1QS7A 1XFWO 1LA0A 3O4XA 2BE4A 4P5OE 3PFVA 2Y1MA 4DUQA 2RGIA 3TDIA 2EGDA 1RFJA 2M1UA 1SCVA 4A4CA 1CFPA 1IIOA 1RJVA 4QJ5B 1F70A 3S0EA 1YVHA 2LVKA 3SIBA 1SR6C 1JF2A 1LS8A 1B8LA 3UO9A 1C7VA 4GGFA 1SCMB 4YGDB 4FTGA 3JVTC 5AXIA 5HKWA 5D7FA 2L98A 4MBEA 2KGBC 4CIDA 1ZMZA 1NPQA 2KDHA 1EJ3A 4PALA 2L2EA 1KFUL 1S6IA 1F8HA 1BJFA 2KLEA 1G33A 1YVLA 3DVMA 1EG4A 2MRDA 3EVUA 3OBVA 4GNKB 2FOTA 3CTNA 3L47A 3N7HA 5CSFA 3CGAA 1ODBA 2LUXA 5HKYA 3TUYC 2LV7A 1NCZA 2FJYA 3VRQA 2M0RA 3PJIA 5IBWA 1Y1UA 2BECA 3BUMB 2KOTA 3CS1A 1YUUA 1JBAA 2F8PA 2O5GA 3BOWA 3V2LA 1RECA 1FW4A 1MUXA 1PK0D 2OPOA 2V53A 4MLWA 3FE8A 2F33A 2MAZA 4TNCA 2QEOA 2I94A 4QJ4B 1M46A 1QJTA 1CLBA 3IVTA 1OQPA 4MEWA 3AKAA 1YR5A 2L4HA 3SG5A 5TNCA 3NSOA 1Z4HA 1YTZC 1DMOA 1T14A 3FWCA 3HX4A 2M9GA 1K93D 4C0KA 2G2BA 3BOWB 2FCEA 4YGAA 1CM1A 1CTRA 3WHUB 2F2OA 3D74A 1IJ6A 2JTTA 1KQMB 1AHRA 4DS7A 1P28A 3SS3A 1C3YA 4MRXA 5DICA 4N5XA 3SJSA 2NCPA 2BCBA 3CR5X 2HPSA 5B8IB 1BT6A 1J7PA 1W7IB 1ZUZA 4QJ3B 5FI6A 2KI4C 3D78A 4CFRA 1BODA 1BR1B 4PHNA 1CLLA 1NWDA 1SMGA 1XK4A 1RK9A 1ZOTB 4INWA 2P70A 5FI2A 1WRLA 2L2CA 5GQQC 2K61A 5KSZA 3Q8IA 1QXPA 2LE9B 1Y0VH 2JPTA 3CDNA 4OKHA 4JKTA 4GPLB 4I5KA 1AJ4A 1CDPA 1ZFSA 5G08A 3SG6A 1YX8A 2KLDA 2CT9A 1D1OA 1DQEA 1UHJA 1DVIA 4MRYA 2LVJA 1OZOA 3OB2B 2JC2A 1K90D 4NDCA 4Q04A 2MHHA 1SKTA 1BU3A 3TDZA 3BUWB 1C3ZA 3K21A 3EK4A 1B7TZ 1AK8A 2BCXA 2I2RE 4GBAA 1XFZO 4MZKA 4USLA 1RWYA 3GK2A 3NGVA 2BNXA 1IQ5A 2O60A 1YRTB 1DJWA 2ERBA 3JTDC 1M63B 3IF7A 2K2FA 3CWGA 5DKRA 1OOFA 1XA5A 1KWOC 2WC8A 3I5HC 1DJIA 4HRGA 3ZWHA 4ICBA 2WC6A 3BQ3A 3B6XA 3CZ0A 1V1GA 4GGNA 2ZKMX 1J55A 3TZ1A 3WNXB 2A4JA 2BAPA 1SY9A 5CSJA 1OZSA 1C07A 3PN7B 3AKBA 2KBMA 1U5IA 2GGMA 3O4YA 1CFCA 1S1EA 1KK7Z 5HL1A 1YX7A 1JSAA 3BYAA 1K9KA 3M0WA 2JZIA 1B9AA 4F7FA 1LVCD 1MHOA 4R1EA 2FCDA 1SCMC 3D73A 5EL2A 1DF0A 1S5GZ 1DGUA 2H61A 2KYFA 1Y1XA 2Q4UA 3TS5B 5PALA 1Q80A 2ZNEA 3R1OA 4A4BA 3S0GA 1RROA 2OS8B 1ORGA 2DOQA 1U5IB 2KFGA 4E68A 1QV0A 1CFDA 1DJZA 3D75A 1TIZA 2LMUA 3NHIA 3SS4A 3I5FB 4GGFC 4OVNF 1S6CA 3F45A 1DF0B 3NXAA 2ZRSA 5CPVA 1BMOA 1TNXA 3VGOA 3LCPC 1TCFA 2WNDA 1MWNA 3B88A 4OV2A 5DKQA 4CPVA 3R1VA 1DJYA 1IQ3A 2JTZA 1N65A 3FWBA 1QVIZ 4ZCVA 1LXFC 4P2YB 4OZDA 1K2HA 1JC2A 5I94A 1WDCB 1EG3A 1QATA 1SBJA 3SG4A 2B1UA 4GAOA 4GFTA 1M39A 1UUSA 2HQWA 1TUJA 1IG5A 1XFUO 2GGZA 1LINA 1TUZA 1BF5A 4NDBA 1KQMC 3DF0B 1DJXA 1PSRA 3LK0A 1A75A 1TNQA 1GGWA 2KI6D 2WCEA 2E30A 2JT0A 3DD4A 3OX5A 3RZSA 1SL8A 4AOMA 1NCXA 3OHMB 5J3XA 2M1KB 1DEKA 4M2PA 1EXRA 1MXLC 3ZNIA 1KSMA 2HF5A 1TNPA 5D3OA 2WCFA 3VRRA 3H4SE 1J1EA 3S0FA 4N1FA 3CABA 1JFJA 3CYZA 1A75B 1V1FA 2M29A 2BBNA 4AQIA 2NCOA 1NIWA 2L0PA 2P71A 2KAXA 3S0BA 2JNXA 2PASA 1TOPA 3B87A 3DVEA 1J1DA
chains in the Genus database with same CATH topology
1OSAA 1XK4C 1CFFA 1MR8A 1X02A 2M49B 4HREE 2KGRA 3TDUA 4OCIA 2CBLA 1CDLA 1NYAA 4ORAB 3I5GB 5I2QA 2JWWA 3WXAA 1GGZA 1NSHA 3CLNA 4M2QA 2LHIA 4WQ3A 1SL9A 2KFFA 1B47A 1A2XA 1FI5A 1H8BA 2COLB 5JOLA 3GK1A 4YRUA 1NX0A 1R2UA 1KK8B 1DTLA 2Y1NA 4PCWA 1FBVA 2JQ6A 3GOFA 1AUIB 4I5LB 3RLZA 2QACA 3NSLA 2F3ZA 4M2OA 4MSPA 3GK4X 3PM8A 2LP2A 2JULA 1SK6D 1KK7Y 2LMTA 2D8NA 1PULA 2JNFA 4YI9A 1XVJA 2K8MB 1S5GY 3KHEA 2K7DA 3PSRA 5K89A 1FF1A 2IS9A 3O2PA 2LMVA 2K7OA 2M7NA 2ZFDA 1HQVA 1NX2A 1OE9B 5HLVA 2ZN9A 1SPYA 1JUOA 3EK8A 3PLFB 4ZCUA 3TS5C 4ORCB 2QPTA 1UHHA 1Y6WA 2JRFA 1M45A 1QASA 5KU1A 1G4YR 1F54A 2OS8C 1KFXS 1K9UA 1SL7A 1YUSA 5I2OA 4L9MA 5DKNA 1BOCA 2JXCA 1ZACA 2LANA 4PE1A 1IH0A 1OMDA 3I5FC 2LM5A 2H61C 1QVIY 2LAPA 3MSEB 4PHJA 3A4UB 1IWQA 2BCAA 1VRKA 2KHNA 3KO0A 1ALWA 2BL0B 3EKJA 5FYXA 1CB1A 1RTP1 1KFUS 1EL4A 4YBHB 3HCMA 2LNKA 2K2AA 5AERA 2EC6B 4YGCB 2PALA 1N0YA 2GV5A 4MVFA 2M7LA 1NP8A 1WDCC 1E8AA 1F71A 1GJYA 2ZRTA 1CDNA 1KCYA 3A8RA 2MLFC 1K8UA 2LVVA 1S3PA 1B8RA 2TN4A 5AFPA 1WY9A 2MBXA 1KSOA 2K0JA 4CFQA 2AUCA 1IRJA 2WOSA 4PE4A 3KPXA 4YGEB 2JOJA 2I18A 2LLUA 1BG1A 2LUCA 2ZNDA 5F6TA 2AAOA 2OTGB 3IQQA 2CTNA 3VRNA 3CR2A 3D0YA 4XJKA 2JXLA 3O6BA 3DVKA 4D1EA 1TCOB 1YRUB 1J7RA 3DF0A 1IGVA 3E3RA 1SYMA 1C7WA 1N2DA 1XO5A 2NZ0A 3I5IB 1NX1A 1SNLA 4GUKA 4BY5A 1L2OB 2Y5IA 2NLNA 3LL8B 5AANA 2MA2A 3D0YB 4XJKB 2Y4QA 1CMGA 5ER5A 4PE0A 4ORBB 1IJ5A 1BR4B 1M31A 4MZJA 2SCPA 1KFXL 2E6WA 1QX2A 1WLMA 1CMFA 2HETA 4BY4A 4JWQA 4PDZA 2KYCA 2FJUB 2ZN8A 4JPZB 1AJ5A 1B1GA 1AVSA 3KF9A 3I5GC 4PHMA 1G8IA 1A4PA 2BKHB 1MF8B 2H2KA 5I2LA 2BBMA 4I5JA 1QX7A 1KK8C 2KAVA 1BLQA 2LHLA 1J7OA 4I5NB 3BXKA 5HYDA 1JFKA 1H4BA 1CDMA 1QV1A 2WCBA 4UPGA 2K7BA 2PMYA 4FQOA 2SASA 1PALA 2EHBA 1SR6B 1B7TY 1W7JB 2PVBA 3OX6A 3PATA 5AEQA 4YGBB 3JVTB 1PRWA 4WRIA 4YI8A 5HKZA 1NUBA 3EVRA 2MJWB 1YURA 1B8CA 2KAYA 3LK1A 1XYDA 2CCMA 2KI6C 1EH2A 2L5XB 3BUXB 2M97A 3LLEA 5I8NA 3D10A 1XFVO 1QIWA 1NCYA 4C0JA 2LVIA 1QLSA 1CM4A 3TUYB 1FI6A 3SG7A 1UP5A 4NDDA 3SG2A 4ETOA 1F55A 3SIAA 2AMIA 1S36A 1SW8A 2KFHA 4N1GA 1GQMA 1QLKA 1PVBA 1MQ1A 1UHIA 2G9BA 1TN4A 1ALVA 1A03A 1TNWA 3EKHA 4AQJA 2JT8A 1DJHA 2CXJA 2BL0C 3PN7C 3EVVA 4XYNA 3AAKA 2M8UA 1PVAA 3AAJA 2HQ8A 3O78A 3C1VA 4NQGA 3NSKA 2EC6C 2K7CA 4IL1A 2P6BB 1SRAA 2KQYA 4MN0A 2CNPA 1A29A 2F2PA 1XFYO 3ICBA 5BPJA 3CR4X 4MZLA 4DCKA 1OOJA 3OB1B 2ISDA 1WRZA 2WORA 4JQ0D 2KSPA 3VROA 3IQOA 4HRHA 4CLNA 3DVJA 1PSBA 3EK7A 3OP0A 1F4OA 2LCPA 2LLTA 2KNEA 1MXEA 1YUTA 5ER4X 3VRPA 1QIVA 1IKUA 3QRXA 4F0ZB 1CLMA 1HT9A 2KI4B 1F4QA 1QX5B 2OTGC 4PE7A 5CSIA 3BUNB 2PRUA 1DGVA 1UHKA 4C0LA 2LLSA 2PSRA 5CSNA 2KQ6A 2KBIA 1QTXA 2L50A 1L7ZA 4WQ2A 1S26D 3FIAA 4HSZA 3NSIA 3SG3A 2L4IA 2F3YA 3I5IC 1DT7B 1L2OC 1LKJA 2BKIB 2I7AA 1XFXO 1FPWA 2Q91A 4PHKA 1S6JA 4DRWA 1R6PA 2NXQA 3WHTB 1K95A 2R2IA 1KQVA 1TRFA 2JT3A 3FS7A 1JF0A 1K9PA 5D69A 4OR9B 1WLZA 3RM1A 3BUOB 1UHNA 5KTYA 1J7QA 2M3WA 1K94A 1UWOA 1UURA 2JU0A 1OMRA 1AP4A 1B4CA 5JJGA 1K96A 1TTXA 3KEVA 3PALA 2L51A 1DJGA 2LP3A 3JTDB 1CKKA 1NX3A 1CNPA 3CZTX 1WRKA 4U8DA 2BE6A 3I5HB 1KWOB 1JWDA 5HLOA 2VRGA 1LA3A 1OMVA 2MLEC 1Y1AA 2LC5A 4DIRA 1QS7A 1XFWO 1LA0A 2BE4A 4P5OE 3PFVA 2Y1MA 4DUQA 2RGIA 3TDIA 2EGDA 1RFJA 2M1UA 1SCVA 4A4CA 1CFPA 1RJVA 4QJ5B 1F70A 1YVHA 2LVKA 3SIBA 1SR6C 1JF2A 1B8LA 1C7VA 4GGFA 1SCMB 4YGDB 4FTGA 3JVTC 5AXIA 5HKWA 5D7FA 2L98A 4MBEA 2KGBC 4CIDA 1ZMZA 1NPQA 2KDHA 1EJ3A 4PALA 2L2EA 1KFUL 1S6IA 1F8HA 1BJFA 3DVMA 1G33A 1YVLA 4GNKB 1EG4A 2MRDA 3EVUA 2FOTA 3CTNA 5CSFA 3CGAA 1ODBA 2LUXA 5HKYA 3TUYC 2LV7A 1NCZA 3VRQA 2M0RA 5IBWA 2BECA 1Y1UA 3BUMB 2KOTA 3CS1A 1YUUA 1JBAA 2F8PA 2O5GA 3BOWA 1RECA 1FW4A 1MUXA 1PK0D 2OPOA 2V53A 4MLWA 2F33A 2MAZA 4TNCA 2I94A 4QJ4B 1M46A 1QJTA 1CLBA 1OQPA 4MEWA 3AKAA 1YR5A 2L4HA 3SG5A 5TNCA 3NSOA 1YTZC 1DMOA 3FWCA 3HX4A 4C0KA 2M9GA 1K93D 2G2BA 3BOWB 2FCEA 4YGAA 1CM1A 1CTRA 3WHUB 2F2OA 1IJ6A 2JTTA 1KQMB 1AHRA 4DS7A 4MRXA 4N5XA 3SJSA 2NCPA 2BCBA 3CR5X 2HPSA 5B8IB 1BT6A 1J7PA 1W7IB 1ZUZA 4QJ3B 2KI4C 4CFRA 1BODA 1BR1B 4PHNA 1CLLA 1NWDA 1SMGA 1XK4A 1RK9A 1ZOTB 1WRLA 5GQQC 2K61A 5KSZA 1QXPA 2LE9B 1Y0VH 2JPTA 4OKHA 4GPLB 4I5KA 1AJ4A 1CDPA 1ZFSA 5G08A 3SG6A 1YX8A 2CT9A 1D1OA 1UHJA 1DVIA 4MRYA 2LVJA 1OZOA 3OB2B 2JC2A 1K90D 4NDCA 4Q04A 2MHHA 1SKTA 1BU3A 3TDZA 3BUWB 3K21A 3EK4A 1B7TZ 1AK8A 2BCXA 2I2RE 4GBAA 1XFZO 4MZKA 4USLA 1RWYA 3GK2A 1IQ5A 2O60A 1YRTB 1DJWA 3JTDC 1M63B 3IF7A 2K2FA 3CWGA 5DKRA 1XA5A 2WC8A 1KWOC 3I5HC 4HRGA 1DJIA 3ZWHA 4ICBA 3BQ3A 1V1GA 4GGNA 2ZKMX 1J55A 3TZ1A 3WNXB 2A4JA 1SY9A 5CSJA 1OZSA 1C07A 3PN7B 3AKBA 2KBMA 1U5IA 2GGMA 3O4YA 1CFCA 1S1EA 1KK7Z 1JSAA 1YX7A 3BYAA 1K9KA 3M0WA 2JZIA 1B9AA 1LVCD 1MHOA 4R1EA 2FCDA 1SCMC 1DF0A 1S5GZ 1DGUA 2H61A 2KYFA 1Y1XA 2Q4UA 3TS5B 5PALA 1Q80A 2ZNEA 4A4BA 1RROA 2OS8B 2DOQA 1U5IB 2KFGA 4E68A 1QV0A 1CFDA 1DJZA 1TIZA 2LMUA 3I5FB 4GGFC 4OVNF 1S6CA 3F45A 1DF0B 3NXAA 2ZRSA 5CPVA 1BMOA 1TNXA 3VGOA 3LCPC 1TCFA 2WNDA 1MWNA 4OV2A 5DKQA 4CPVA 1IQ3A 1DJYA 2JTZA 1N65A 3FWBA 1QVIZ 4ZCVA 1LXFC 4P2YB 1K2HA 1JC2A 1WDCB 1EG3A 1QATA 1SBJA 3SG4A 2B1UA 4GAOA 4GFTA 1M39A 1UUSA 2HQWA 2GGZA 1IG5A 1XFUO 1LINA 1BF5A 4NDBA 1KQMC 3DF0B 1DJXA 1PSRA 3LK0A 1A75A 1TNQA 1GGWA 2KI6D 2WCEA 2E30A 2JT0A 3DD4A 3OX5A 1SL8A 4AOMA 1NCXA 3OHMB 5J3XA 2M1KB 3ZNIA 4M2PA 1EXRA 1MXLC 1KSMA 2HF5A 1TNPA 2WCFA 3VRRA 3H4SE 1J1EA 4N1FA 1JFJA 1A75B 1V1FA 2M29A 2BBNA 4AQIA 2NCOA 1NIWA 2L0PA 2KAXA 2JNXA 2PASA 1TOPA 3DVEA 1J1DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OSA A;  1XK4 C;  1CFF A;  1MR8 A;  1X02 A;  2M49 B;  4HRE E;  2KGR A;  3TDU A;  4OCI A;  2CBL A;  1CDL A;  1NYA A;  4ORA B;  3I5G B;  5I2Q A;  2JWW A;  3WXA A;  1GGZ A;  1NSH A;  3CLN A;  4M2Q A;  2LHI A;  4WQ3 A;  1SL9 A;  2KFF A;  1B47 A;  1A2X A;  1FI5 A;  1H8B A;  2COL B;  5JOL A;  3GK1 A;  4YRU A;  1NX0 A;  1R2U A;  1KK8 B;  1DTL A;  2Y1N A;  4PCW A;  1FBV A;  2JQ6 A;  3GOF A;  1AUI B;  4I5L B;  3RLZ A;  2QAC A;  3NSL A;  2F3Z A;  4M2O A;  4MSP A;  3GK4 X;  3PM8 A;  2LP2 A;  2JUL A;  1SK6 D;  1KK7 Y;  2LMT A;  2D8N A;  1PUL A;  2JNF A;  4YI9 A;  1XVJ A;  2K8M B;  1S5G Y;  3KHE A;  2K7D A;  3PSR A;  5K89 A;  1FF1 A;  2IS9 A;  3O2P A;  2LMV A;  2K7O A;  2M7N A;  2ZFD A;  1HQV A;  1NX2 A;  1OE9 B;  5HLV A;  2ZN9 A;  1SPY A;  1JUO A;  3EK8 A;  3PLF B;  4ZCU A;  3TS5 C;  4ORC B;  2QPT A;  1UHH A;  1Y6W A;  2JRF A;  1M45 A;  1QAS A;  5KU1 A;  1G4Y R;  1F54 A;  2OS8 C;  1KFX S;  1K9U A;  1SL7 A;  1YUS A;  5I2O A;  4L9M A;  5DKN A;  1BOC A;  2JXC A;  1ZAC A;  2LAN A;  4PE1 A;  1IH0 A;  1OMD A;  3I5F C;  2LM5 A;  2H61 C;  1QVI Y;  2LAP A;  3MSE B;  4PHJ A;  3A4U B;  1IWQ A;  2BCA A;  1VRK A;  2KHN A;  3KO0 A;  1ALW A;  2BL0 B;  3EKJ A;  5FYX A;  1CB1 A;  1RTP 1;  1KFU S;  1EL4 A;  4YBH B;  3HCM A;  2LNK A;  2K2A A;  5AER A;  2EC6 B;  4YGC B;  2PAL A;  1N0Y A;  2GV5 A;  4MVF A;  2M7L A;  1NP8 A;  1WDC C;  1E8A A;  1F71 A;  1GJY A;  2ZRT A;  1CDN A;  1KCY A;  3A8R A;  2MLF C;  1K8U A;  2LVV A;  1S3P A;  1B8R A;  2TN4 A;  5AFP A;  1WY9 A;  2MBX A;  1KSO A;  2K0J A;  4CFQ A;  2AUC A;  1IRJ A;  2WOS A;  4PE4 A;  3KPX A;  4YGE B;  2JOJ A;  2I18 A;  2LLU A;  1BG1 A;  2LUC A;  2ZND A;  5F6T A;  2AAO A;  2OTG B;  3IQQ A;  2CTN A;  3VRN A;  3CR2 A;  3D0Y A;  4XJK A;  2JXL A;  3O6B A;  3DVK A;  4D1E A;  1TCO B;  1YRU B;  1J7R A;  3DF0 A;  1IGV A;  3E3R A;  1SYM A;  1C7W A;  1N2D A;  1XO5 A;  2NZ0 A;  3I5I B;  1NX1 A;  1SNL A;  4GUK A;  4BY5 A;  1L2O B;  2Y5I A;  2NLN A;  3LL8 B;  5AAN A;  2MA2 A;  3D0Y B;  4XJK B;  2Y4Q A;  1CMG A;  5ER5 A;  4PE0 A;  4ORB B;  1IJ5 A;  1BR4 B;  1M31 A;  4MZJ A;  2SCP A;  1KFX L;  2E6W A;  1QX2 A;  1WLM A;  1CMF A;  2HET A;  4BY4 A;  4JWQ A;  4PDZ A;  2KYC A;  2FJU B;  2ZN8 A;  4JPZ B;  1AJ5 A;  1B1G A;  1AVS A;  3KF9 A;  3I5G C;  4PHM A;  1G8I A;  1A4P A;  2BKH B;  1MF8 B;  2H2K A;  5I2L A;  2BBM A;  4I5J A;  1QX7 A;  1KK8 C;  2KAV A;  1BLQ A;  2LHL A;  1J7O A;  4I5N B;  3BXK A;  5HYD A;  1JFK A;  1H4B A;  1CDM A;  1QV1 A;  2WCB A;  4UPG A;  2K7B A;  2PMY A;  4FQO A;  2SAS A;  1PAL A;  2EHB A;  1SR6 B;  1B7T Y;  1W7J B;  2PVB A;  3OX6 A;  3PAT A;  5AEQ A;  4YGB B;  3JVT B;  1PRW A;  4WRI A;  4YI8 A;  5HKZ A;  1NUB A;  3EVR A;  2MJW B;  1YUR A;  1B8C A;  2KAY A;  3LK1 A;  1XYD A;  2CCM A;  2KI6 C;  1EH2 A;  2L5X B;  3BUX B;  2M97 A;  3LLE A;  5I8N A;  3D10 A;  1XFV O;  1QIW A;  1NCY A;  4C0J A;  2LVI A;  1QLS A;  1CM4 A;  3TUY B;  1FI6 A;  3SG7 A;  1UP5 A;  4NDD A;  3SG2 A;  4ETO A;  1F55 A;  3SIA A;  2AMI A;  1S36 A;  1SW8 A;  2KFH A;  4N1G A;  1GQM A;  1QLK A;  1PVB A;  1MQ1 A;  1UHI A;  2G9B A;  1TN4 A;  1ALV A;  1A03 A;  1TNW A;  3EKH A;  4AQJ A;  2JT8 A;  1DJH A;  2CXJ A;  2BL0 C;  3PN7 C;  3EVV A;  4XYN A;  3AAK A;  2M8U A;  1PVA A;  3AAJ A;  2HQ8 A;  3O78 A;  3C1V A;  4NQG A;  3NSK A;  2EC6 C;  2K7C A;  4IL1 A;  2P6B B;  1SRA A;  2KQY A;  4MN0 A;  2CNP A;  1A29 A;  2F2P A;  1XFY O;  3ICB A;  5BPJ A;  3CR4 X;  4MZL A;  4DCK A;  1OOJ A;  3OB1 B;  2ISD A;  1WRZ A;  2WOR A;  4JQ0 D;  2KSP A;  3VRO A;  3IQO A;  4HRH A;  4CLN A;  3DVJ A;  1PSB A;  3EK7 A;  3OP0 A;  1F4O A;  2LCP A;  2LLT A;  2KNE A;  1MXE A;  1YUT A;  5ER4 X;  3VRP A;  1QIV A;  1IKU A;  3QRX A;  4F0Z B;  1CLM A;  1HT9 A;  2KI4 B;  1F4Q A;  1QX5 B;  2OTG C;  4PE7 A;  5CSI A;  3BUN B;  2PRU A;  1DGV A;  1UHK A;  4C0L A;  2LLS A;  2PSR A;  5CSN A;  2KQ6 A;  2KBI A;  1QTX A;  2L50 A;  1L7Z A;  4WQ2 A;  1S26 D;  3FIA A;  4HSZ A;  3NSI A;  3SG3 A;  2L4I A;  2F3Y A;  3I5I C;  1DT7 B;  1L2O C;  1LKJ A;  2BKI B;  2I7A A;  1XFX O;  1FPW A;  2Q91 A;  4PHK A;  1S6J A;  4DRW A;  1R6P A;  2NXQ A;  3WHT B;  1K95 A;  2R2I A;  1KQV A;  1TRF A;  2JT3 A;  3FS7 A;  1JF0 A;  1K9P A;  5D69 A;  4OR9 B;  1WLZ A;  3RM1 A;  3BUO B;  1UHN A;  5KTY A;  1J7Q A;  2M3W A;  1K94 A;  1UWO A;  1UUR A;  2JU0 A;  1OMR A;  1AP4 A;  1B4C A;  5JJG A;  1K96 A;  1TTX A;  3KEV A;  3PAL A;  2L51 A;  1DJG A;  2LP3 A;  3JTD B;  1CKK A;  1NX3 A;  1CNP A;  3CZT X;  1WRK A;  4U8D A;  2BE6 A;  3I5H B;  1KWO B;  1JWD A;  5HLO A;  2VRG A;  1LA3 A;  1OMV A;  2MLE C;  1Y1A A;  2LC5 A;  4DIR A;  1QS7 A;  1XFW O;  1LA0 A;  2BE4 A;  4P5O E;  3PFV A;  2Y1M A;  4DUQ A;  2RGI A;  3TDI A;  2EGD A;  1RFJ A;  2M1U A;  1SCV A;  4A4C A;  1CFP A;  1RJV A;  4QJ5 B;  1F70 A;  1YVH A;  2LVK A;  3SIB A;  1SR6 C;  1JF2 A;  1B8L A;  1C7V A;  4GGF A;  1SCM B;  4YGD B;  4FTG A;  3JVT C;  5AXI A;  5HKW A;  5D7F A;  2L98 A;  4MBE A;  2KGB C;  4CID A;  1ZMZ A;  1NPQ A;  2KDH A;  1EJ3 A;  4PAL A;  2L2E A;  1KFU L;  1S6I A;  1F8H A;  1BJF A;  3DVM A;  1G33 A;  1YVL A;  4GNK B;  1EG4 A;  2MRD A;  3EVU A;  2FOT A;  3CTN A;  5CSF A;  3CGA A;  1ODB A;  2LUX A;  5HKY A;  3TUY C;  2LV7 A;  1NCZ A;  3VRQ A;  2M0R A;  5IBW A;  2BEC A;  1Y1U A;  3BUM B;  2KOT A;  3CS1 A;  1YUU A;  1JBA A;  2F8P A;  2O5G A;  3BOW A;  1REC A;  1FW4 A;  1MUX A;  1PK0 D;  2OPO A;  2V53 A;  4MLW A;  2F33 A;  2MAZ A;  4TNC A;  2I94 A;  4QJ4 B;  1M46 A;  1QJT A;  1CLB A;  1OQP A;  4MEW A;  3AKA A;  1YR5 A;  2L4H A;  3SG5 A;  5TNC A;  3NSO A;  1YTZ C;  1DMO A;  3FWC A;  3HX4 A;  4C0K A;  2M9G A;  1K93 D;  2G2B A;  3BOW B;  2FCE A;  4YGA A;  1CM1 A;  1CTR A;  3WHU B;  2F2O A;  1IJ6 A;  2JTT A;  1KQM B;  1AHR A;  4DS7 A;  4MRX A;  4N5X A;  3SJS A;  2NCP A;  2BCB A;  3CR5 X;  2HPS A;  5B8I B;  1BT6 A;  1J7P A;  1W7I B;  1ZUZ A;  4QJ3 B;  2KI4 C;  4CFR A;  1BOD A;  1BR1 B;  4PHN A;  1CLL A;  1NWD A;  1SMG A;  1XK4 A;  1RK9 A;  1ZOT B;  1WRL A;  5GQQ C;  2K61 A;  5KSZ A;  1QXP A;  2LE9 B;  1Y0V H;  2JPT A;  4OKH A;  4GPL B;  4I5K A;  1AJ4 A;  1CDP A;  1ZFS A;  5G08 A;  3SG6 A;  1YX8 A;  2CT9 A;  1D1O A;  1UHJ A;  1DVI A;  4MRY A;  2LVJ A;  1OZO A;  3OB2 B;  2JC2 A;  1K90 D;  4NDC A;  4Q04 A;  2MHH A;  1SKT A;  1BU3 A;  3TDZ A;  3BUW B;  3K21 A;  3EK4 A;  1B7T Z;  1AK8 A;  2BCX A;  2I2R E;  4GBA A;  1XFZ O;  4MZK A;  4USL A;  1RWY A;  3GK2 A;  1IQ5 A;  2O60 A;  1YRT B;  1DJW A;  3JTD C;  1M63 B;  3IF7 A;  2K2F A;  3CWG A;  5DKR A;  1XA5 A;  2WC8 A;  1KWO C;  3I5H C;  4HRG A;  1DJI A;  3ZWH A;  4ICB A;  3BQ3 A;  1V1G A;  4GGN A;  2ZKM X;  1J55 A;  3TZ1 A;  3WNX B;  2A4J A;  1SY9 A;  5CSJ A;  1OZS A;  1C07 A;  3PN7 B;  3AKB A;  2KBM A;  1U5I A;  2GGM A;  3O4Y A;  1CFC A;  1S1E A;  1KK7 Z;  1JSA A;  1YX7 A;  3BYA A;  1K9K A;  3M0W A;  2JZI A;  1B9A A;  1LVC D;  1MHO A;  4R1E A;  2FCD A;  1SCM C;  1DF0 A;  1S5G Z;  1DGU A;  2H61 A;  2KYF A;  1Y1X A;  2Q4U A;  3TS5 B;  5PAL A;  1Q80 A;  2ZNE A;  4A4B A;  1RRO A;  2OS8 B;  2DOQ A;  1U5I B;  2KFG A;  4E68 A;  1QV0 A;  1CFD A;  1DJZ A;  1TIZ A;  2LMU A;  3I5F B;  4GGF C;  4OVN F;  1S6C A;  3F45 A;  1DF0 B;  3NXA A;  2ZRS A;  5CPV A;  1BMO A;  1TNX A;  3VGO A;  3LCP C;  1TCF A;  2WND A;  1MWN A;  4OV2 A;  5DKQ A;  4CPV A;  1IQ3 A;  1DJY A;  2JTZ A;  1N65 A;  3FWB A;  1QVI Z;  4ZCV A;  1LXF C;  4P2Y B;  1K2H A;  1JC2 A;  1WDC B;  1EG3 A;  1QAT A;  1SBJ A;  3SG4 A;  2B1U A;  4GAO A;  4GFT A;  1M39 A;  1UUS A;  2HQW A;  2GGZ A;  1IG5 A;  1XFU O;  1LIN A;  1BF5 A;  4NDB A;  1KQM C;  3DF0 B;  1DJX A;  1PSR A;  3LK0 A;  1A75 A;  1TNQ A;  1GGW A;  2KI6 D;  2WCE A;  2E30 A;  2JT0 A;  3DD4 A;  3OX5 A;  1SL8 A;  4AOM A;  1NCX A;  3OHM B;  5J3X A;  2M1K B;  3ZNI A;  4M2P A;  1EXR A;  1MXL C;  1KSM A;  2HF5 A;  1TNP A;  2WCF A;  3VRR A;  3H4S E;  1J1E A;  4N1F A;  1JFJ A;  1A75 B;  1V1F A;  2M29 A;  2BBN A;  4AQI A;  2NCO A;  1NIW A;  2L0P A;  2KAX A;  2JNX A;  2PAS A;  1TOP A;  3DVE A;  1J1D A; 
#chains in the Genus database with same CATH topology
 1OSA A;  1XK4 C;  1CFF A;  1MR8 A;  1X02 A;  2M49 B;  4HRE E;  2KGR A;  3TDU A;  3OGN A;  3DY9 A;  2CBL A;  4OCI A;  1CDL A;  1NYA A;  4ORA B;  3I5G B;  3FE9 A;  5I2Q A;  2JWW A;  3WXA A;  1GGZ A;  1NSH A;  3CLN A;  4M2Q A;  2LHI A;  4WQ3 A;  1SL9 A;  2KFF A;  1B47 A;  4INX A;  1A2X A;  1FI5 A;  1H8B A;  2COL B;  5JOL A;  3GK1 A;  4YRU A;  1NX0 A;  1R2U A;  1KK8 B;  3BJH A;  1DTL A;  2Y1N A;  4PCW A;  1FBV A;  2JQ6 A;  3GOF A;  1AUI B;  4I5L B;  3RLZ A;  2K60 A;  2QAC A;  3NSL A;  2F3Z A;  4M2O A;  4MSP A;  3GK4 X;  3PM8 A;  2LP2 A;  3L4A A;  2JUL A;  1SK6 D;  1KK7 Y;  2LMT A;  2D8N A;  1PUL A;  2JNF A;  4YI9 A;  1XVJ A;  2K8M B;  2QEB A;  1S5G Y;  2WCL A;  3KHE A;  2K7D A;  1OW4 A;  1Z2C B;  3BFA A;  3PSR A;  5K89 A;  2IS9 A;  3O2P A;  2LMV A;  2K7O A;  2M7N A;  2ZFD A;  1HQV A;  1FF1 A;  1NX2 A;  2KPH A;  1OE9 B;  5HLV A;  2ZN9 A;  1SPY A;  1JUO A;  3EK8 A;  3PLF B;  4ZCU A;  3TS5 C;  4ORC B;  2QPT A;  1UHH A;  1Y6W A;  2JRF A;  1M45 A;  1QAS A;  5KU1 A;  1G4Y R;  1F54 A;  2OS8 C;  3D77 A;  1KFX S;  1K9U A;  1SL7 A;  1YUS A;  5I2O A;  4L9M A;  2PQL A;  5DKN A;  1BOC A;  2JXC A;  1ZAC A;  2LAN A;  4PE1 A;  1IH0 A;  1OMD A;  3I5F C;  2LM5 A;  2H61 C;  1QVI Y;  2LAP A;  3MSE B;  4PHJ A;  3A4U B;  1IWQ A;  2BCA A;  1VRK A;  2KHN A;  2L5Y A;  1ALW A;  3KO0 A;  2BL0 B;  3EKJ A;  2GTE A;  5FYX A;  1CB1 A;  1RTP 1;  1KFU S;  1EL4 A;  4YBH B;  3HCM A;  2LNK A;  2K2A A;  3DZT A;  3R1P A;  5AER A;  2EC6 B;  4YGC B;  2PAL A;  1N0Y A;  2GV5 A;  4MVF A;  2M7L A;  1NP8 A;  1WDC C;  1E8A A;  1F71 A;  1GJY A;  2ZRT A;  3QME A;  1CDN A;  1KCY A;  3A8R A;  2MLF C;  3EG5 B;  1K8U A;  2LVV A;  1S3P A;  1B8R A;  2TN4 A;  4KYN A;  5AFP A;  1WY9 A;  2MBX A;  1KSO A;  2K0J A;  4CFQ A;  2AUC A;  1IRJ A;  2WOS A;  4PE4 A;  3KPX A;  4JD9 A;  4YGE B;  1DEL A;  2JOJ A;  2I18 A;  2LLU A;  1BG1 A;  2LUC A;  2ZND A;  5F6T A;  2AAO A;  2OTG B;  3IQQ A;  2CTN A;  3VRN A;  3CR2 A;  3D0Y A;  4XJK A;  2JXL A;  3O6B A;  3DVK A;  2WCJ A;  4D1E A;  1TCO B;  1OOG A;  1YRU B;  1J7R A;  3DF0 A;  1IGV A;  3E3R A;  1SYM A;  2JPO A;  1C7W A;  3BFB A;  1N2D A;  1XO5 A;  2NZ0 A;  3I5I B;  5FI7 A;  1NX1 A;  1SNL A;  4GUK A;  4BY5 A;  1L2O B;  2Y5I A;  2NLN A;  3LL8 B;  5AAN A;  2MA2 A;  3D0Y B;  4XJK B;  3S0A A;  2Y4Q A;  2H8V A;  3B86 A;  3DYE A;  5ER5 A;  1CMG A;  4PE0 A;  4ORB B;  1IJ5 A;  1BR4 B;  1M31 A;  4MZJ A;  2SCP A;  1KFX L;  2E6W A;  1QX2 A;  1WLM A;  1CMF A;  2HET A;  3S0D A;  4BY4 A;  4JWQ A;  4PDZ A;  2KYC A;  2FJU B;  2ZN8 A;  4JPZ B;  1AJ5 A;  1B1G A;  1AVS A;  3KF9 A;  4IJ7 A;  3UNW A;  3I5G C;  4PHM A;  1G8I A;  1TWO A;  1A4P A;  2BKH B;  1MF8 B;  2H2K A;  5I2L A;  2BBM A;  4I5J A;  1QX7 A;  1KK8 C;  3CZ2 A;  2KAV A;  1BLQ A;  2LHL A;  1J7O A;  4I5N B;  3BXK A;  5HYD A;  1JFK A;  1H4B A;  1CDM A;  1QV1 A;  2WCB A;  4UPG A;  2K7B A;  2PMY A;  4FQO A;  2WCK A;  1OOH A;  1PAL A;  2SAS A;  2EHB A;  1SR6 B;  1B7T Y;  1W7J B;  1SSE B;  2PVB A;  3OX6 A;  3PAT A;  5AEQ A;  4YGB B;  3JVT B;  1PRW A;  4WRI A;  4YI8 A;  5HKZ A;  1NUB A;  3NHT A;  3EVR A;  4PT1 A;  2MJW B;  1YUR A;  1B8C A;  2KAY A;  3BFH A;  1XYD A;  2CCM A;  2KI6 C;  3LK1 A;  2L5X B;  1EH2 A;  3K1E A;  3BUX B;  2M97 A;  3LLE A;  5I8N A;  3D10 A;  1XFV O;  1QIW A;  1NCY A;  4C0J A;  2LVI A;  1QLS A;  1CM4 A;  3TUY B;  1FI6 A;  3SG7 A;  1UP5 A;  4NDD A;  3SG2 A;  4ETO A;  1F55 A;  3SIA A;  2AMI A;  1S36 A;  1SW8 A;  2KFH A;  4N1G A;  1GQM A;  1QWV A;  3R72 A;  1QLK A;  1PVB A;  1MQ1 A;  1UHI A;  2G9B A;  1TN4 A;  1ALV A;  1A03 A;  1DC1 A;  1TNW A;  3EKH A;  4AQJ A;  2JT8 A;  1DJH A;  2CXJ A;  2BL0 C;  3PN7 C;  3DXL A;  3EVV A;  4XYN A;  3AAK A;  2M8U A;  1PVA A;  3AAJ A;  2HQ8 A;  3O78 A;  3C1V A;  4NQG A;  3NSK A;  2EC6 C;  2K7C A;  4IL1 A;  2P6B B;  1SRA A;  2KQY A;  2QDI A;  4MN0 A;  2CNP A;  1A29 A;  2F2P A;  1XFY O;  3ICB A;  5BPJ A;  3CR4 X;  4MZL A;  4DCK A;  1OOJ A;  3OB1 B;  2ISD A;  3D76 A;  4FQT A;  1WRZ A;  2WOR A;  4JQ0 D;  2KSP A;  1XFR A;  3IQO A;  4HRH A;  3VRO A;  3DVJ A;  2QEH A;  4CLN A;  1PSB A;  3EK7 A;  3OP0 A;  1F4O A;  2LCP A;  2LLT A;  2KNE A;  1MXE A;  1YUT A;  2PYQ A;  5ER4 X;  3PM2 A;  3VRP A;  1QIV A;  1IKU A;  3QRX A;  4F0Z B;  1CLM A;  1HT9 A;  2KI4 B;  1F4Q A;  1QX5 B;  2OTG C;  3L4L A;  4PE7 A;  5CSI A;  3BUN B;  2PRU A;  1DGV A;  1UHK A;  4C0L A;  2LLS A;  2PSR A;  3CZ1 A;  5CSN A;  2KQ6 A;  2KBI A;  1QTX A;  2L50 A;  1W9Z A;  1L7Z A;  2WC5 A;  4WQ2 A;  1S26 D;  3FIA A;  4HSZ A;  3NSI A;  3SG3 A;  2L4I A;  2F3Y A;  3I5I C;  1DT7 B;  1L2O C;  1LKJ A;  2BKI B;  2I7A A;  1XFX O;  1FPW A;  2Q91 A;  2YGU A;  4PHK A;  1S6J A;  4DRW A;  2WCM A;  1R6P A;  2NXQ A;  3WHT B;  1K95 A;  2R2I A;  3FE6 A;  1KQV A;  1TRF A;  2JT3 A;  3FS7 A;  1JF0 A;  1K9P A;  5D69 A;  4OR9 B;  1WLZ A;  3RM1 A;  3BUO B;  1UHN A;  2QEV A;  5KTY A;  2M3W A;  1K94 A;  1UWO A;  1UUR A;  1J7Q A;  1GM0 A;  2JU0 A;  1OMR A;  2WCH A;  1AP4 A;  1B4C A;  1OOI X;  5JJG A;  1K96 A;  1TTX A;  3KEV A;  3PAL A;  2L51 A;  1DJG A;  2LP3 A;  3JTD B;  1CKK A;  1NX3 A;  1CNP A;  3CZT X;  3VB1 A;  1WRK A;  4U8D A;  2BE6 A;  3I5H B;  1KWO B;  1JWD A;  5HLO A;  3SS5 A;  2VRG A;  1LA3 A;  1OMV A;  2MLE C;  3B7A A;  1Y1A A;  2LC5 A;  4DIR A;  1QS7 A;  1XFW O;  1LA0 A;  3O4X A;  2BE4 A;  4P5O E;  3PFV A;  2Y1M A;  4DUQ A;  2RGI A;  3TDI A;  2EGD A;  1RFJ A;  2M1U A;  1SCV A;  4A4C A;  1CFP A;  1IIO A;  1RJV A;  4QJ5 B;  1F70 A;  3S0E A;  1YVH A;  2LVK A;  3SIB A;  1SR6 C;  1JF2 A;  1LS8 A;  1B8L A;  3UO9 A;  1C7V A;  4GGF A;  1SCM B;  4YGD B;  4FTG A;  3JVT C;  5AXI A;  5HKW A;  5D7F A;  2L98 A;  4MBE A;  2KGB C;  4CID A;  1ZMZ A;  1NPQ A;  2KDH A;  1EJ3 A;  4PAL A;  2L2E A;  1KFU L;  1S6I A;  1F8H A;  1BJF A;  2KLE A;  1G33 A;  1YVL A;  3DVM A;  1EG4 A;  2MRD A;  3EVU A;  3OBV A;  4GNK B;  2FOT A;  3CTN A;  3L47 A;  3N7H A;  5CSF A;  3CGA A;  1ODB A;  2LUX A;  5HKY A;  3TUY C;  2LV7 A;  1NCZ A;  2FJY A;  3VRQ A;  2M0R A;  3PJI A;  5IBW A;  1Y1U A;  2BEC A;  3BUM B;  2KOT A;  3CS1 A;  1YUU A;  1JBA A;  2F8P A;  2O5G A;  3BOW A;  3V2L A;  1REC A;  1FW4 A;  1MUX A;  1PK0 D;  2OPO A;  2V53 A;  4MLW A;  3FE8 A;  2F33 A;  2MAZ A;  4TNC A;  2QEO A;  2I94 A;  4QJ4 B;  1M46 A;  1QJT A;  1CLB A;  3IVT A;  1OQP A;  4MEW A;  3AKA A;  1YR5 A;  2L4H A;  3SG5 A;  5TNC A;  3NSO A;  1Z4H A;  1YTZ C;  1DMO A;  1T14 A;  3FWC A;  3HX4 A;  2M9G A;  1K93 D;  4C0K A;  2G2B A;  3BOW B;  2FCE A;  4YGA A;  1CM1 A;  1CTR A;  3WHU B;  2F2O A;  3D74 A;  1IJ6 A;  2JTT A;  1KQM B;  1AHR A;  4DS7 A;  1P28 A;  3SS3 A;  1C3Y A;  4MRX A;  5DIC A;  4N5X A;  3SJS A;  2NCP A;  2BCB A;  3CR5 X;  2HPS A;  5B8I B;  1BT6 A;  1J7P A;  1W7I B;  1ZUZ A;  4QJ3 B;  5FI6 A;  2KI4 C;  3D78 A;  4CFR A;  1BOD A;  1BR1 B;  4PHN A;  1CLL A;  1NWD A;  1SMG A;  1XK4 A;  1RK9 A;  1ZOT B;  4INW A;  2P70 A;  5FI2 A;  1WRL A;  2L2C A;  5GQQ C;  2K61 A;  5KSZ A;  3Q8I A;  1QXP A;  2LE9 B;  1Y0V H;  2JPT A;  3CDN A;  4OKH A;  4JKT A;  4GPL B;  4I5K A;  1AJ4 A;  1CDP A;  1ZFS A;  5G08 A;  3SG6 A;  1YX8 A;  2KLD A;  2CT9 A;  1D1O A;  1DQE A;  1UHJ A;  1DVI A;  4MRY A;  2LVJ A;  1OZO A;  3OB2 B;  2JC2 A;  1K90 D;  4NDC A;  4Q04 A;  2MHH A;  1SKT A;  1BU3 A;  3TDZ A;  3BUW B;  1C3Z A;  3K21 A;  3EK4 A;  1B7T Z;  1AK8 A;  2BCX A;  2I2R E;  4GBA A;  1XFZ O;  4MZK A;  4USL A;  1RWY A;  3GK2 A;  3NGV A;  2BNX A;  1IQ5 A;  2O60 A;  1YRT B;  1DJW A;  2ERB A;  3JTD C;  1M63 B;  3IF7 A;  2K2F A;  3CWG A;  5DKR A;  1OOF A;  1XA5 A;  1KWO C;  2WC8 A;  3I5H C;  1DJI A;  4HRG A;  3ZWH A;  4ICB A;  2WC6 A;  3BQ3 A;  3B6X A;  3CZ0 A;  1V1G A;  4GGN A;  2ZKM X;  1J55 A;  3TZ1 A;  3WNX B;  2A4J A;  2BAP A;  1SY9 A;  5CSJ A;  1OZS A;  1C07 A;  3PN7 B;  3AKB A;  2KBM A;  1U5I A;  2GGM A;  3O4Y A;  1CFC A;  1S1E A;  1KK7 Z;  5HL1 A;  1YX7 A;  1JSA A;  3BYA A;  1K9K A;  3M0W A;  2JZI A;  1B9A A;  4F7F A;  1LVC D;  1MHO A;  4R1E A;  2FCD A;  1SCM C;  3D73 A;  5EL2 A;  1DF0 A;  1S5G Z;  1DGU A;  2H61 A;  2KYF A;  1Y1X A;  2Q4U A;  3TS5 B;  5PAL A;  1Q80 A;  2ZNE A;  3R1O A;  4A4B A;  3S0G A;  1RRO A;  2OS8 B;  1ORG A;  2DOQ A;  1U5I B;  2KFG A;  4E68 A;  1QV0 A;  1CFD A;  1DJZ A;  3D75 A;  1TIZ A;  2LMU A;  3NHI A;  3SS4 A;  3I5F B;  4GGF C;  4OVN F;  1S6C A;  3F45 A;  1DF0 B;  3NXA A;  2ZRS A;  5CPV A;  1BMO A;  1TNX A;  3VGO A;  3LCP C;  1TCF A;  2WND A;  1MWN A;  3B88 A;  4OV2 A;  5DKQ A;  4CPV A;  3R1V A;  1DJY A;  1IQ3 A;  2JTZ A;  1N65 A;  3FWB A;  1QVI Z;  4ZCV A;  1LXF C;  4P2Y B;  4OZD A;  1K2H A;  1JC2 A;  5I94 A;  1WDC B;  1EG3 A;  1QAT A;  1SBJ A;  3SG4 A;  2B1U A;  4GAO A;  4GFT A;  1M39 A;  1UUS A;  2HQW A;  1TUJ A;  1IG5 A;  1XFU O;  2GGZ A;  1LIN A;  1TUZ A;  1BF5 A;  4NDB A;  1KQM C;  3DF0 B;  1DJX A;  1PSR A;  3LK0 A;  1A75 A;  1TNQ A;  1GGW A;  2KI6 D;  2WCE A;  2E30 A;  2JT0 A;  3DD4 A;  3OX5 A;  3RZS A;  1SL8 A;  4AOM A;  1NCX A;  3OHM B;  5J3X A;  2M1K B;  1DEK A;  4M2P A;  1EXR A;  1MXL C;  3ZNI A;  1KSM A;  2HF5 A;  1TNP A;  5D3O A;  2WCF A;  3VRR A;  3H4S E;  1J1E A;  3S0F A;  4N1F A;  3CAB A;  1JFJ A;  3CYZ A;  1A75 B;  1V1F A;  2M29 A;  2BBN A;  4AQI A;  2NCO A;  1NIW A;  2L0P A;  2P71 A;  2KAX A;  3S0B A;  2JNX A;  2PAS A;  1TOP A;  3B87 A;  3DVE A;  1J1D A; 
#chains in the Genus database with same CATH homology
 1OSA A;  1XK4 C;  1CFF A;  1MR8 A;  1X02 A;  2M49 B;  4HRE E;  2KGR A;  3TDU A;  4OCI A;  2CBL A;  1CDL A;  1NYA A;  4ORA B;  3I5G B;  5I2Q A;  2JWW A;  3WXA A;  1GGZ A;  1NSH A;  3CLN A;  4M2Q A;  2LHI A;  4WQ3 A;  1SL9 A;  2KFF A;  1B47 A;  1A2X A;  1FI5 A;  1H8B A;  2COL B;  5JOL A;  3GK1 A;  4YRU A;  1NX0 A;  1R2U A;  1KK8 B;  1DTL A;  2Y1N A;  4PCW A;  1FBV A;  2JQ6 A;  3GOF A;  1AUI B;  4I5L B;  3RLZ A;  2QAC A;  3NSL A;  2F3Z A;  4M2O A;  4MSP A;  3GK4 X;  3PM8 A;  2LP2 A;  2JUL A;  1SK6 D;  1KK7 Y;  2LMT A;  2D8N A;  1PUL A;  2JNF A;  4YI9 A;  1XVJ A;  2K8M B;  1S5G Y;  3KHE A;  2K7D A;  3PSR A;  5K89 A;  1FF1 A;  2IS9 A;  3O2P A;  2LMV A;  2K7O A;  2M7N A;  2ZFD A;  1HQV A;  1NX2 A;  1OE9 B;  5HLV A;  2ZN9 A;  1SPY A;  1JUO A;  3EK8 A;  3PLF B;  4ZCU A;  3TS5 C;  4ORC B;  2QPT A;  1UHH A;  1Y6W A;  2JRF A;  1M45 A;  1QAS A;  5KU1 A;  1G4Y R;  1F54 A;  2OS8 C;  1KFX S;  1K9U A;  1SL7 A;  1YUS A;  5I2O A;  4L9M A;  5DKN A;  1BOC A;  2JXC A;  1ZAC A;  2LAN A;  4PE1 A;  1IH0 A;  1OMD A;  3I5F C;  2LM5 A;  2H61 C;  1QVI Y;  2LAP A;  3MSE B;  4PHJ A;  3A4U B;  1IWQ A;  2BCA A;  1VRK A;  2KHN A;  3KO0 A;  1ALW A;  2BL0 B;  3EKJ A;  5FYX A;  1CB1 A;  1RTP 1;  1KFU S;  1EL4 A;  4YBH B;  3HCM A;  2LNK A;  2K2A A;  5AER A;  2EC6 B;  4YGC B;  2PAL A;  1N0Y A;  2GV5 A;  4MVF A;  2M7L A;  1NP8 A;  1WDC C;  1E8A A;  1F71 A;  1GJY A;  2ZRT A;  1CDN A;  1KCY A;  3A8R A;  2MLF C;  1K8U A;  2LVV A;  1S3P A;  1B8R A;  2TN4 A;  5AFP A;  1WY9 A;  2MBX A;  1KSO A;  2K0J A;  4CFQ A;  2AUC A;  1IRJ A;  2WOS A;  4PE4 A;  3KPX A;  4YGE B;  2JOJ A;  2I18 A;  2LLU A;  1BG1 A;  2LUC A;  2ZND A;  5F6T A;  2AAO A;  2OTG B;  3IQQ A;  2CTN A;  3VRN A;  3CR2 A;  3D0Y A;  4XJK A;  2JXL A;  3O6B A;  3DVK A;  4D1E A;  1TCO B;  1YRU B;  1J7R A;  3DF0 A;  1IGV A;  3E3R A;  1SYM A;  1C7W A;  1N2D A;  1XO5 A;  2NZ0 A;  3I5I B;  1NX1 A;  1SNL A;  4GUK A;  4BY5 A;  1L2O B;  2Y5I A;  2NLN A;  3LL8 B;  5AAN A;  2MA2 A;  3D0Y B;  4XJK B;  2Y4Q A;  1CMG A;  5ER5 A;  4PE0 A;  4ORB B;  1IJ5 A;  1BR4 B;  1M31 A;  4MZJ A;  2SCP A;  1KFX L;  2E6W A;  1QX2 A;  1WLM A;  1CMF A;  2HET A;  4BY4 A;  4JWQ A;  4PDZ A;  2KYC A;  2FJU B;  2ZN8 A;  4JPZ B;  1AJ5 A;  1B1G A;  1AVS A;  3KF9 A;  3I5G C;  4PHM A;  1G8I A;  1A4P A;  2BKH B;  1MF8 B;  2H2K A;  5I2L A;  2BBM A;  4I5J A;  1QX7 A;  1KK8 C;  2KAV A;  1BLQ A;  2LHL A;  1J7O A;  4I5N B;  3BXK A;  5HYD A;  1JFK A;  1H4B A;  1CDM A;  1QV1 A;  2WCB A;  4UPG A;  2K7B A;  2PMY A;  4FQO A;  2SAS A;  1PAL A;  2EHB A;  1SR6 B;  1B7T Y;  1W7J B;  2PVB A;  3OX6 A;  3PAT A;  5AEQ A;  4YGB B;  3JVT B;  1PRW A;  4WRI A;  4YI8 A;  5HKZ A;  1NUB A;  3EVR A;  2MJW B;  1YUR A;  1B8C A;  2KAY A;  3LK1 A;  1XYD A;  2CCM A;  2KI6 C;  1EH2 A;  2L5X B;  3BUX B;  2M97 A;  3LLE A;  5I8N A;  3D10 A;  1XFV O;  1QIW A;  1NCY A;  4C0J A;  2LVI A;  1QLS A;  1CM4 A;  3TUY B;  1FI6 A;  3SG7 A;  1UP5 A;  4NDD A;  3SG2 A;  4ETO A;  1F55 A;  3SIA A;  2AMI A;  1S36 A;  1SW8 A;  2KFH A;  4N1G A;  1GQM A;  1QLK A;  1PVB A;  1MQ1 A;  1UHI A;  2G9B A;  1TN4 A;  1ALV A;  1A03 A;  1TNW A;  3EKH A;  4AQJ A;  2JT8 A;  1DJH A;  2CXJ A;  2BL0 C;  3PN7 C;  3EVV A;  4XYN A;  3AAK A;  2M8U A;  1PVA A;  3AAJ A;  2HQ8 A;  3O78 A;  3C1V A;  4NQG A;  3NSK A;  2EC6 C;  2K7C A;  4IL1 A;  2P6B B;  1SRA A;  2KQY A;  4MN0 A;  2CNP A;  1A29 A;  2F2P A;  1XFY O;  3ICB A;  5BPJ A;  3CR4 X;  4MZL A;  4DCK A;  1OOJ A;  3OB1 B;  2ISD A;  1WRZ A;  2WOR A;  4JQ0 D;  2KSP A;  3VRO A;  3IQO A;  4HRH A;  4CLN A;  3DVJ A;  1PSB A;  3EK7 A;  3OP0 A;  1F4O A;  2LCP A;  2LLT A;  2KNE A;  1MXE A;  1YUT A;  5ER4 X;  3VRP A;  1QIV A;  1IKU A;  3QRX A;  4F0Z B;  1CLM A;  1HT9 A;  2KI4 B;  1F4Q A;  1QX5 B;  2OTG C;  4PE7 A;  5CSI A;  3BUN B;  2PRU A;  1DGV A;  1UHK A;  4C0L A;  2LLS A;  2PSR A;  5CSN A;  2KQ6 A;  2KBI A;  1QTX A;  2L50 A;  1L7Z A;  4WQ2 A;  1S26 D;  3FIA A;  4HSZ A;  3NSI A;  3SG3 A;  2L4I A;  2F3Y A;  3I5I C;  1DT7 B;  1L2O C;  1LKJ A;  2BKI B;  2I7A A;  1XFX O;  1FPW A;  2Q91 A;  4PHK A;  1S6J A;  4DRW A;  1R6P A;  2NXQ A;  3WHT B;  1K95 A;  2R2I A;  1KQV A;  1TRF A;  2JT3 A;  3FS7 A;  1JF0 A;  1K9P A;  5D69 A;  4OR9 B;  1WLZ A;  3RM1 A;  3BUO B;  1UHN A;  5KTY A;  1J7Q A;  2M3W A;  1K94 A;  1UWO A;  1UUR A;  2JU0 A;  1OMR A;  1AP4 A;  1B4C A;  5JJG A;  1K96 A;  1TTX A;  3KEV A;  3PAL A;  2L51 A;  1DJG A;  2LP3 A;  3JTD B;  1CKK A;  1NX3 A;  1CNP A;  3CZT X;  1WRK A;  4U8D A;  2BE6 A;  3I5H B;  1KWO B;  1JWD A;  5HLO A;  2VRG A;  1LA3 A;  1OMV A;  2MLE C;  1Y1A A;  2LC5 A;  4DIR A;  1QS7 A;  1XFW O;  1LA0 A;  2BE4 A;  4P5O E;  3PFV A;  2Y1M A;  4DUQ A;  2RGI A;  3TDI A;  2EGD A;  1RFJ A;  2M1U A;  1SCV A;  4A4C A;  1CFP A;  1RJV A;  4QJ5 B;  1F70 A;  1YVH A;  2LVK A;  3SIB A;  1SR6 C;  1JF2 A;  1B8L A;  1C7V A;  4GGF A;  1SCM B;  4YGD B;  4FTG A;  3JVT C;  5AXI A;  5HKW A;  5D7F A;  2L98 A;  4MBE A;  2KGB C;  4CID A;  1ZMZ A;  1NPQ A;  2KDH A;  1EJ3 A;  4PAL A;  2L2E A;  1KFU L;  1S6I A;  1F8H A;  1BJF A;  3DVM A;  1G33 A;  1YVL A;  4GNK B;  1EG4 A;  2MRD A;  3EVU A;  2FOT A;  3CTN A;  5CSF A;  3CGA A;  1ODB A;  2LUX A;  5HKY A;  3TUY C;  2LV7 A;  1NCZ A;  3VRQ A;  2M0R A;  5IBW A;  2BEC A;  1Y1U A;  3BUM B;  2KOT A;  3CS1 A;  1YUU A;  1JBA A;  2F8P A;  2O5G A;  3BOW A;  1REC A;  1FW4 A;  1MUX A;  1PK0 D;  2OPO A;  2V53 A;  4MLW A;  2F33 A;  2MAZ A;  4TNC A;  2I94 A;  4QJ4 B;  1M46 A;  1QJT A;  1CLB A;  1OQP A;  4MEW A;  3AKA A;  1YR5 A;  2L4H A;  3SG5 A;  5TNC A;  3NSO A;  1YTZ C;  1DMO A;  3FWC A;  3HX4 A;  4C0K A;  2M9G A;  1K93 D;  2G2B A;  3BOW B;  2FCE A;  4YGA A;  1CM1 A;  1CTR A;  3WHU B;  2F2O A;  1IJ6 A;  2JTT A;  1KQM B;  1AHR A;  4DS7 A;  4MRX A;  4N5X A;  3SJS A;  2NCP A;  2BCB A;  3CR5 X;  2HPS A;  5B8I B;  1BT6 A;  1J7P A;  1W7I B;  1ZUZ A;  4QJ3 B;  2KI4 C;  4CFR A;  1BOD A;  1BR1 B;  4PHN A;  1CLL A;  1NWD A;  1SMG A;  1XK4 A;  1RK9 A;  1ZOT B;  1WRL A;  5GQQ C;  2K61 A;  5KSZ A;  1QXP A;  2LE9 B;  1Y0V H;  2JPT A;  4OKH A;  4GPL B;  4I5K A;  1AJ4 A;  1CDP A;  1ZFS A;  5G08 A;  3SG6 A;  1YX8 A;  2CT9 A;  1D1O A;  1UHJ A;  1DVI A;  4MRY A;  2LVJ A;  1OZO A;  3OB2 B;  2JC2 A;  1K90 D;  4NDC A;  4Q04 A;  2MHH A;  1SKT A;  1BU3 A;  3TDZ A;  3BUW B;  3K21 A;  3EK4 A;  1B7T Z;  1AK8 A;  2BCX A;  2I2R E;  4GBA A;  1XFZ O;  4MZK A;  4USL A;  1RWY A;  3GK2 A;  1IQ5 A;  2O60 A;  1YRT B;  1DJW A;  3JTD C;  1M63 B;  3IF7 A;  2K2F A;  3CWG A;  5DKR A;  1XA5 A;  2WC8 A;  1KWO C;  3I5H C;  4HRG A;  1DJI A;  3ZWH A;  4ICB A;  3BQ3 A;  1V1G A;  4GGN A;  2ZKM X;  1J55 A;  3TZ1 A;  3WNX B;  2A4J A;  1SY9 A;  5CSJ A;  1OZS A;  1C07 A;  3PN7 B;  3AKB A;  2KBM A;  1U5I A;  2GGM A;  3O4Y A;  1CFC A;  1S1E A;  1KK7 Z;  1JSA A;  1YX7 A;  3BYA A;  1K9K A;  3M0W A;  2JZI A;  1B9A A;  1LVC D;  1MHO A;  4R1E A;  2FCD A;  1SCM C;  1DF0 A;  1S5G Z;  1DGU A;  2H61 A;  2KYF A;  1Y1X A;  2Q4U A;  3TS5 B;  5PAL A;  1Q80 A;  2ZNE A;  4A4B A;  1RRO A;  2OS8 B;  2DOQ A;  1U5I B;  2KFG A;  4E68 A;  1QV0 A;  1CFD A;  1DJZ A;  1TIZ A;  2LMU A;  3I5F B;  4GGF C;  4OVN F;  1S6C A;  3F45 A;  1DF0 B;  3NXA A;  2ZRS A;  5CPV A;  1BMO A;  1TNX A;  3VGO A;  3LCP C;  1TCF A;  2WND A;  1MWN A;  4OV2 A;  5DKQ A;  4CPV A;  1IQ3 A;  1DJY A;  2JTZ A;  1N65 A;  3FWB A;  1QVI Z;  4ZCV A;  1LXF C;  4P2Y B;  1K2H A;  1JC2 A;  1WDC B;  1EG3 A;  1QAT A;  1SBJ A;  3SG4 A;  2B1U A;  4GAO A;  4GFT A;  1M39 A;  1UUS A;  2HQW A;  2GGZ A;  1IG5 A;  1XFU O;  1LIN A;  1BF5 A;  4NDB A;  1KQM C;  3DF0 B;  1DJX A;  1PSR A;  3LK0 A;  1A75 A;  1TNQ A;  1GGW A;  2KI6 D;  2WCE A;  2E30 A;  2JT0 A;  3DD4 A;  3OX5 A;  1SL8 A;  4AOM A;  1NCX A;  3OHM B;  5J3X A;  2M1K B;  3ZNI A;  4M2P A;  1EXR A;  1MXL C;  1KSM A;  2HF5 A;  1TNP A;  2WCF A;  3VRR A;  3H4S E;  1J1E A;  4N1F A;  1JFJ A;  1A75 B;  1V1F A;  2M29 A;  2BBN A;  4AQI A;  2NCO A;  1NIW A;  2L0P A;  2KAX A;  2JNX A;  2PAS A;  1TOP A;  3DVE A;  1J1D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...