4UPGA

X-ray structure of calcium-free human sorcin
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
169
structure length
169
Chain Sequence
b'QTQDPLYGYFAAVAGQDGQIDADELQRCLTQSGIAGGYKPFNLETCRLMVSMLDRDMSGTMGFNEFKELWAVLNGWRQHFISFDTDRSGTVDPQELQKALTTMGFRLSPQAVNSIAKRYSTNGKITFDDYIACCVKLRALTDSFRRRDTAQQGVVNFPYDDFIQCVMSV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SORCIN
publication title Structural Basis of Sorcin-Mediated Calcium-Dependent Signal Transduction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 59
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 2014-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13405 EF-hand_6 EF-hand domain
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4upgA00
1WLMA 1DJIA 1MXLC 4PHNA 5HKWA 2DOQA 1TCOB 2EGDA 2LE9B 3VRNA 3VRPA 2KOTA 5BPJA 1GGZA 2JNFA 2LVKA 2H61A 3I5HB 1G4YR 5CSIA 2V53A 1CNPA 1RTP1 1S26D 5HKZA 3EVVA 1BT6A 2Q4UA 3EK4A 2KDHA 1NUBA 1W7JB 1WRZA 1CDMA 3KPXA 2CXJA 4I5LB 2PRUA 1CFCA 1L2OB 5I2LA 3JVTC 3LK0A 4OR9B 2L4IA 1RECA 1Y1UA 2MAZA 3VRRA 2Y4QA 4PHJA 1NPQA 1V1FA 2LHLA 2LLTA 5AEQA 2KI4B 5CPVA 1MHOA 2F3YA 1DF0B 2NXQA 1QX7A 3EK8A 4YI9A 1KQMC 2HPSA 1FW4A 2BE4A 2WOSA 2P6BB 4YBHB 4MRYA 2KGRA 2KGBC 1CLBA 1UHIA 2BL0C 3RLZA 2K8MB 3WHUB 2R2IA 2I2RE 1IGVA 1XVJA 4GUKA 2WCFA 1NCYA 2WCBA 5KU1A 3CZTX 3CR2A 3OHMB 1CDPA 1CFFA 1KWOB 3FIAA 5DKNA 3DF0B 4F0ZB 3NSLA 2CT9A 1ALVA 1NIWA 4GGFA 1LVCD 2ZFDA 1AP4A 1NX2A 4XJKB 4CLNA 1KFXS 1B8CA 1PRWA 2JZIA 1YVLA 2M49B 2M9GA 2L98A 1SNLA 1SBJA 2F33A 2LLUA 2HETA 4GGNA 4JQ0D 1LXFC 1RROA 2M0RA 2LVIA 2RGIA 3BUXB 4ZCVA 1ZFSA 3PALA 4DRWA 2K7CA 1QX5B 4CPVA 2MLFC 1XFVO 1DGVA 3TZ1A 1EG4A 2ZNDA 1OZSA 3DVMA 3RM1A 1J55A 2BBMA 3IQQA 1B47A 3JVTB 1ODBA 1FBVA 1MUXA 1QTXA 1M45A 2NLNA 4CFQA 3GK4X 1SMGA 1A4PA 2NCPA 3TDIA 1YX8A 1EG3A 1CB1A 4A4CA 2LANA 3CR4X 2LVJA 1JUOA 2L51A 5HKYA 1TIZA 1OZOA 1CTRA 1S1EA 2H2KA 1XK4C 1C7WA 3FWBA 4GGFC 3I5HC 3VRQA 2BL0B 3GK2A 3PFVA 2OS8B 4USLA 2M3WA 1SL7A 3BOWB 3D0YB 1MWNA 3NSIA 4WQ3A 3GK1A 1M46A 1A03A 1UHKA 1IH0A 1L2OC 1NX1A 1OOJA 4MBEA 5FYXA 3LL8B 2TN4A 4ICBA 1K90D 1GQMA 1QLSA 2KBIA 4MZLA 2O5GA 2AMIA 1MF8B 1TOPA 1W7IB 2IS9A 5B8IB 1F71A 2LC5A 1JSAA 3NXAA 2KFFA 1NCXA 1HT9A 1FF1A 1F54A 3O4YA 2KYFA 1UHJA 1A75A 4WRIA 1B8RA 3A4UB 3DVEA 2ZN8A 4E68A 1F8HA 1UHNA 1MQ1A 1R2UA 4ORAB 1WRLA 4PDZA 2BE6A 2PMYA 3KF9A 4HRGA 1JF0A 1G8IA 4QJ4B 5I2OA 3KHEA 3EK7A 4ORBB 5I8NA 2L4HA 3BQ3A 3SG5A 1YR5A 1WY9A 1RJVA 1DTLA 4YGEB 4DIRA 4YRUA 1IQ5A 1C7VA 3LLEA 3PN7C 4OVNF 4M2PA 1N0YA 2EHBA 3NSOA 2MJWB 1SYMA 1EXRA 1LKJA 4NDCA 1F55A 3FWCA 2QACA 4AQJA 2LM5A 2LMVA 4PE0A 1SCMC 2LNKA 2MA2A 4R1EA 4DCKA 1MXEA 1NWDA 1KFXL 1J7OA 3EVUA 3PM8A 3CR5X 2E6WA 2KAYA 2JNXA 3CLNA 1KK8C 1CLLA 1TNQA 1NYAA 2GV5A 2LV7A 4AOMA 4HSZA 1RFJA 1A29A 2BCXA 2KNEA 2M8UA 3O6BA 4OV2A 1DVIA 4GNKB 4MLWA 3O2PA 4C0LA 2COLB 3GOFA 5PALA 2ZRSA 1XFXO 1AHRA 3JTDC 2GGZA 2KYCA 3I5GB 1K96A 1BJFA 5HLOA 3VROA 4MZKA 1S6IA 2OS8C 3OB1B 2K7OA 1QX2A 1FI6A 1AJ5A 2JT8A 2L50A 2JTZA 3SG4A 3OP0A 1QVIZ 3M0WA 4PE1A 2JQ6A 4FQOA 1J7QA 4CIDA 5AFPA 1CM4A 2FJUB 1SCVA 1PK0D 1XYDA 3BUWB 5HYDA 1SPYA 3TDUA 1K94A 4PCWA 2H61C 3TS5B 2GGMA 2LMTA 2WC8A 2Y1MA 3PN7B 4MN0A 1D1OA 1XFUO 1BMOA 3KO0A 2LVVA 2LUXA 1Y1AA 3SG7A 2CBLA 1BOCA 3DVKA 1SL9A 2OTGC 3IQOA 1UP5A 4YGDB 1GGWA 1V1GA 1EJ3A 1JF2A 1B8LA 1K9UA 4OKHA 1SCMB 2KSPA 5D7FA 1LINA 3O78A 1CMGA 1YTZC 1S5GZ 4WQ2A 2Y1NA 2WCEA 3H4SE 1AK8A 4MSPA 1WLZA 2KFHA 5D69A 3ZNIA 1UUSA 2EC6C 1J7RA 3MSEB 3SG6A 1KK8B 5F6TA 1A75B 1ZACA 2KI6D 1K93D 4DUQA 1XA5A 2ZN9A 3JTDB 2G9BA 2Q91A 5G08A 1JFKA 3C1VA 1QJTA 4GFTA 1OMDA 2PASA 1HQVA 1JBAA 3QRXA 5K89A 1YX7A 1K8UA 1IG5A 4JWQA 1CFPA 1N65A 2KAXA 1QVIY 1SRAA 1IJ5A 5GQQC 2M7LA 1EL4A 2I7AA 1N2DA 1NP8A 1F4QA 4PE4A 5I2QA 3AAJA 2JPTA 3IF7A 3SG3A 2JOJA 4HREE 2A4JA 1DJXA 1LA3A 3WNXB 3I5GC 1PVBA 1TNXA 1U5IA 1B7TY 2L2EA 2KAVA 2LP2A 2LUCA 1CDNA 2OTGB 5CSFA 1YUUA 1CMFA 1SR6B 2MLEC 1DMOA 2JT0A 1IWQA 5KSZA 4L9MA 1XFYO 1J1DA 1TNWA 1IJ6A 2ZKMX 1PSRA 3KEVA 1S5GY 1JFJA 1XFZO 1OE9B 1RWYA 3PSRA 1YUTA 4ORCB 2EC6B 2D8NA 3WHTB 3BYAA 1ALWA 1XFWO 5CSJA 4OCIA 1DJHA 3TS5C 1VRKA 2MRDA 1FI5A 2JWWA 1QLKA 4C0JA 4NDBA 2K0JA 1H8BA 4A4BA 1DJWA 1G33A 4CFRA 1J1EA 1SKTA 2PALA 1DJYA 2JXCA 2PVBA 4QJ5B 2CNPA 1L7ZA 5J3XA 3HCMA 1IRJA 1SW8A 2SCPA 2M29A 3PATA 2LP3A 2K2AA 3LCPC 2BKIB 4U8DA 1M63B 1OSAA 1S36A 2KFGA 3EVRA 1K9PA 1SL8A 2MBXA 1K2HA 2L5XB 4C0KA 3I5IC 2JRFA 1ZUZA 3DD4A 4NQGA 2LAPA 2O60A 4QJ3B 1LA0A 1OMVA 2M1KB 1M31A 5DKRA 1JWDA 1CM1A 3SJSA 3LK1A 1PULA 1WRKA 1J7PA 1AJ4A 2NZ0A 3VGOA 2G2BA 1KFUS 4MVFA 2LLSA 4MRXA 1Y1XA 4I5NB 1NX0A 5CSNA 2M7NA 4MZJA 1C07A 4Q04A 5AERA 1Y6WA 2JTTA 3AKAA 3AKBA 1M39A 4ETOA 2CCMA 2HF5A 3HX4A 1EH2A 3CS1A 2WNDA 1YVHA 1QV0A 1A2XA 2I18A 3BUMB 3D10A 1CLMA 1TN4A 2B1UA 1FPWA 1QXPA 1CDLA 1NSHA 2JXLA 2KQYA 1BODA 2LHIA 2K7DA 2F2OA 1WDCB 1YURA 2I94A 1KK7Z 1NX3A 5DKQA 3SIBA 2AUCA 1B7TZ 4I5JA 1PALA 1TRFA 1AVSA 3I5FB 2K2FA 1KCYA 2ISDA 2JT3A 1SR6C 2CTNA 2F2PA 2KBMA 2K61A 2Y5IA 4FTGA 3BXKA 4M2OA 3AAKA 2F8PA 3E3RA 3SIAA 1XK4A 1MR8A 2QPTA 2VRGA 5KTYA 1H4BA 1QS7A 2JU0A 4AQIA 1U5IB 1B9AA 3I5IB 4P2YB 4BY5A 2JC2A 4I5KA 5TNCA 4TNCA 2BKHB 1BR1B 1RK9A 3K21A 3EKHA 4M2QA 5IBWA 3SG2A 1TNPA 1BF5A 4PHKA 1R6PA 3ZWHA 2FCEA 5ER5A 1UURA 1S3PA 1DF0A 2L0PA 4HRHA 3CWGA 4N1FA 1QV1A 4ZCUA 3A8RA 5AANA 3NSKA 1DJZA 2BCBA 1QATA 4UPGA 1K95A 1CKKA 2JULA 4YGCB 1BU3A 2FCDA 5JJGA 3TUYC 1DJGA 1KSMA 1QASA 3OX5A 2K7BA 4PHMA 1PSBA 4JPZB 1S6JA 2BBNA 2M97A 1OQPA 2AAOA 3DF0A 1JC2A 2LCPA 4XYNA 1KQMB 4YGBB 4YGAA 4XJKA 1YRUB 1SY9A 1KK7Y 2KHNA 2LMUA 3DVJA 1DT7B 4YI8A 2PSRA 3FS7A 2E30A 5HLVA 2OPOA 2BCAA 1TTXA 2FOTA 1BR4B 2ZNEA 3ICBA 4GBAA 4P5OE 1PVAA 1QIWA 1XO5A 4N5XA 4GPLB 1SK6D 4MEWA 1Q80A 2F3ZA 3OX6A 2WORA 1YRTB 4N1GA 1F4OA 2KI4C 1UWOA 3BUOB 2BECA 3CTNA 4IL1A 2KQ6A 1X02A 1TCFA 3F45A 3TDZA 1KFUL 1OMRA 3CGAA 2HQWA 4PE7A 4PALA 1IKUA 1F70A 1WDCC 1BLQA 1AUIB 2M1UA 5JOLA 1IQ3A 1B4CA 1ZMZA 1ZOTB 1DGUA 3EKJA 3PLFB 4DS7A 1CFDA 1KSOA 2SASA 3I5FC 1S6CA 4NDDA 3BUNB 1GJYA 4GAOA 1Y0VH 2HQ8A 2ZRTA 3OB2B 5ER4X 1KWOC 4BY4A 1KQVA 1UHHA 1YUSA 1E8AA 3TUYB 1K9KA 1B1GA 1BG1A 2MHHA 4D1EA 3BOWA 2KI6C 3D0YA 2NCOA 5AXIA 1QIVA 1NCZA 3WXAA
chains in the Genus database with same CATH superfamily
1WLMA 1DJIA 1MXLC 4PHNA 5HKWA 2DOQA 3S0FA 1TCOB 2EGDA 2LE9B 3VRNA 3VRPA 2KOTA 5BPJA 3FE9A 1GGZA 2JNFA 2LVKA 2H61A 3I5HB 1G4YR 5CSIA 2V53A 1CNPA 1RTP1 1S26D 5HKZA 3EVVA 1BT6A 2Q4UA 3EK4A 2KDHA 1NUBA 1W7JB 1WRZA 1CDMA 3KPXA 2CXJA 4I5LB 2PRUA 1CFCA 3R1PA 3DXLA 1L2OB 5I2LA 3RZSA 3JVTC 3LK0A 4OR9B 2WCMA 2L4IA 1RECA 1Y1UA 2MAZA 3VRRA 2Y4QA 4PHJA 1NPQA 1V1FA 2LHLA 2LLTA 5AEQA 2KI4B 5CPVA 1MHOA 2F3YA 1DF0B 2NXQA 1OOIX 1QX7A 3EK8A 4YI9A 1KQMC 3D78A 2HPSA 1FW4A 2BE4A 2WOSA 2P6BB 4YBHB 4MRYA 3N7HA 2KGRA 2KGBC 3BFBA 1CLBA 1UHIA 2BL0C 3RLZA 2K8MB 3WHUB 2R2IA 2I2RE 1IGVA 1XVJA 4GUKA 2GTEA 2WCFA 1NCYA 2WCBA 5KU1A 3CZTX 3CR2A 3OHMB 1CDPA 1CFFA 1KWOB 3QMEA 3V2LA 3FIAA 4INWA 3DF0B 5DKNA 4F0ZB 3NSLA 2CT9A 1ALVA 1NIWA 4GGFA 3S0EA 1LVCD 2ZFDA 1AP4A 1NX2A 4XJKB 4CLNA 1KFXS 1B8CA 1PRWA 2JZIA 1YVLA 2M49B 2M9GA 2L98A 3NHTA 1SNLA 1SBJA 2F33A 2LLUA 3S0BA 2HETA 4GGNA 4JQ0D 1LXFC 1RROA 2M0RA 2LVIA 2RGIA 3BUXB 4ZCVA 1ZFSA 3PALA 4DRWA 3FE8A 2K7CA 1QX5B 4CPVA 2MLFC 2WCKA 1XFVO 1DEKA 1DGVA 3TZ1A 1EG4A 2ZNDA 3L4AA 1OZSA 1C3YA 3DVMA 3RM1A 1J55A 3L47A 2BBMA 3IQQA 1B47A 3JVTB 1ODBA 3D74A 1FBVA 1MUXA 1QTXA 1M45A 2NLNA 4CFQA 3GK4X 3OBVA 1SMGA 1A4PA 2NCPA 3TDIA 1YX8A 1EG3A 1CB1A 4A4CA 2LANA 3CR4X 1ORGA 2LVJA 1JUOA 2L51A 5HKYA 1TIZA 1OZOA 1CTRA 1S1EA 2H2KA 1XK4C 1C7WA 1OOFA 3CZ1A 3FWBA 4GGFC 3I5HC 3VRQA 2BL0B 3GK2A 3O4XA 3PFVA 2OS8B 4USLA 2M3WA 1SL7A 3BOWB 3D0YB 1MWNA 3NSIA 4WQ3A 3GK1A 1M46A 1A03A 1UHKA 1IH0A 1L2OC 1NX1A 1OOJA 4MBEA 5FYXA 3LL8B 2TN4A 4ICBA 1K90D 1TUJA 4JD9A 1GQMA 1QLSA 2KBIA 4MZLA 2O5GA 2AMIA 1MF8B 1TOPA 1W7IB 3VB1A 2IS9A 5B8IB 1F71A 1DC1A 2LC5A 1JSAA 3NXAA 2KFFA 1NCXA 1HT9A 1FF1A 1F54A 3O4YA 2KYFA 1UHJA 1A75A 4WRIA 1B8RA 3A4UB 3DVEA 2ZN8A 4E68A 1F8HA 1UHNA 1MQ1A 1R2UA 4ORAB 1WRLA 4PDZA 2BE6A 2PMYA 3KF9A 4HRGA 1JF0A 1G8IA 4QJ4B 5I2OA 3SS3A 3KHEA 3EK7A 2WCHA 4ORBB 5I8NA 3S0DA 2ERBA 2L4HA 3BQ3A 5FI7A 1YR5A 1WY9A 1RJVA 1DTLA 4YGEB 3SG5A 4DIRA 1IQ5A 4YRUA 3LLEA 3PN7C 4OVNF 4M2PA 1N0YA 2EHBA 3NSOA 5I94A 2MJWB 1SYMA 1EXRA 1LKJA 4NDCA 1F55A 3FWCA 2QACA 4AQJA 2LM5A 2LMVA 2KLDA 4PE0A 1SCMC 2LNKA 2MA2A 4R1EA 4DCKA 3IVTA 1MXEA 1NWDA 2JPOA 1KFXL 1J7OA 3EVUA 3PM8A 3CR5X 2E6WA 2KAYA 2JNXA 3CLNA 1KK8C 1CLLA 1TNQA 1NYAA 2GV5A 2LV7A 4AOMA 4HSZA 1RFJA 1A29A 2BCXA 2KNEA 2M8UA 3O6BA 4OV2A 1DVIA 4GNKB 1W9ZA 1LS8A 2BAPA 2QEOA 2QEVA 3O2PA 2COLB 3GOFA 4MLWA 5PALA 4C0LA 2ZRSA 1XFXO 1AHRA 3JTDC 2GGZA 2KYCA 3I5GB 1K96A 1BJFA 5HLOA 1Z2CB 3VROA 4FQTA 4MZKA 1S6IA 3CZ2A 2OS8C 3OB1B 2K7OA 1QX2A 4OZDA 1AJ5A 1FI6A 2JT8A 2L50A 2JTZA 3SG4A 3OP0A 1QVIZ 3M0WA 4PE1A 2JQ6A 4FQOA 1J7QA 4CIDA 5AFPA 1CM4A 2FJUB 5EL2A 1SCVA 1PK0D 1XYDA 3BUWB 5HYDA 2H8VA 1SPYA 3TDUA 1K94A 4PCWA 2H61C 3D75A 2GGMA 3TS5B 2LMTA 2WC8A 2BNXA 2Y1MA 3PN7B 4MN0A 1D1OA 1XFUO 1P28A 1BMOA 3KO0A 2LVVA 2LUXA 1Y1AA 3SG7A 2CBLA 1BOCA 3DVKA 1SL9A 2OTGC 3IQOA 1UP5A 4YGDB 1IIOA 1GGWA 1V1GA 1EJ3A 1JF2A 1B8LA 1K9UA 3D77A 1SCMB 4OKHA 2KSPA 3B88A 2QDIA 5D7FA 1LINA 3O78A 1CMGA 1YTZC 1S5GZ 3CYZA 4WQ2A 2Y1NA 2WCEA 3H4SE 1AK8A 4MSPA 1WLZA 2KFHA 5D69A 2WCJA 1UUSA 2EC6C 1J7RA 3MSEB 3PJIA 1KK8B 3SG6A 3ZNIA 5F6TA 1A75B 1ZACA 1T14A 2KI6D 1K93D 4DUQA 1XA5A 2QEHA 1QWVA 2ZN9A 3JTDB 2G9BA 2Q91A 3CABA 5G08A 1JFKA 3C1VA 1QJTA 3DY9A 4GFTA 1OMDA 2P71A 2PASA 4JKTA 1HQVA 1JBAA 3QRXA 5K89A 1YX7A 3UO9A 1K8UA 1OW4A 1IG5A 3B87A 4JWQA 3SS4A 1CFPA 1N65A 2KAXA 1QVIY 3K1EA 1SRAA 1IJ5A 5GQQC 2M7LA 1EL4A 2I7AA 1N2DA 1NP8A 1F4QA 4PE4A 5I2QA 3AAJA 2JPTA 3IF7A 3SG3A 2JOJA 4HREE 2A4JA 1DJXA 1LA3A 3WNXB 1GM0A 4F7FA 3I5GC 1PVBA 1TNXA 1U5IA 1B7TY 2L2EA 2KAVA 2LP2A 2LUCA 3NHIA 2OTGB 1CDNA 5CSFA 1YUUA 2YGUA 1CMFA 1SR6B 2MLEC 1DMOA 2JT0A 1IWQA 5KSZA 3B7AA 4L9MA 1XFYO 1J1DA 1TNWA 1IJ6A 2ZKMX 1DQEA 1PSRA 3KEVA 1S5GY 1JFJA 1XFZO 1OE9B 1RWYA 3PSRA 1YUTA 2QEBA 4ORCB 2EC6B 2D8NA 3WHTB 3BYAA 1ALWA 1XFWO 5CSJA 4OCIA 1DJHA 3TS5C 1VRKA 3DYEA 3L4LA 2MRDA 1FI5A 2JWWA 1QLKA 4C0JA 4NDBA 2K0JA 1H8BA 3FE6A 4A4BA 1DJWA 1G33A 4CFRA 2WC6A 1J1EA 1SKTA 2PALA 1DJYA 2JXCA 3CZ0A 2PVBA 4QJ5B 2CNPA 1L7ZA 5J3XA 3BJHA 3B86A 3HCMA 1IRJA 1SW8A 2SCPA 2M29A 3PATA 4IJ7A 2LP3A 2K2AA 3LCPC 2BKIB 4U8DA 1M63B 1OSAA 1S36A 2KFGA 3EVRA 1K9PA 1SL8A 1XFRA 2MBXA 5HL1A 1DELA 2L5XB 1K2HA 4C0KA 3I5IC 2JRFA 1ZUZA 3DD4A 3R1OA 4NQGA 2LAPA 2O60A 4QJ3B 1LA0A 1OMVA 2M1KB 3EG5B 1M31A 2KLEA 5DKRA 1JWDA 1CM1A 3SJSA 3LK1A 1PULA 1WRKA 1J7PA 1AJ4A 2NZ0A 3VGOA 2G2BA 1KFUS 1TUZA 4MVFA 2LLSA 4MRXA 1Y1XA 4I5NB 1NX0A 5CSNA 2M7NA 4MZJA 1C07A 4Q04A 5AERA 1Y6WA 2JTTA 3AKAA 3AKBA 1M39A 4ETOA 3D76A 1OOHA 2CCMA 2HF5A 3HX4A 2WC5A 1EH2A 3CS1A 2WNDA 1YVHA 1QV0A 1A2XA 2I18A 3BUMB 3D10A 1CLMA 1TN4A 2B1UA 3CDNA 1FPWA 1QXPA 3PM2A 1CDLA 1NSHA 2JXLA 2KQYA 2P70A 5FI2A 1BODA 2LHIA 2K7DA 2F2OA 1WDCB 1YURA 2I94A 1KK7Z 1NX3A 5DKQA 3SIBA 2AUCA 3S0GA 1B7TZ 4I5JA 1PALA 1TRFA 1AVSA 3I5FB 1OOGA 2K2FA 3OGNA 1KCYA 2ISDA 2JT3A 1SR6C 2CTNA 2F2PA 2KBMA 2K61A 2Y5IA 4KYNA 4FTGA 3BXKA 4M2OA 3AAKA 2F8PA 3E3RA 3SIAA 3B6XA 1XK4A 1MR8A 2QPTA 2VRGA 5KTYA 1H4BA 1QS7A 1Z4HA 2JU0A 4PT1A 1U5IB 4AQIA 3DZTA 2FJYA 1B9AA 3I5IB 4P2YB 4BY5A 2JC2A 3NGVA 4I5KA 5TNCA 1C3ZA 2BKHB 4TNCA 1BR1B 1RK9A 3K21A 3EKHA 4M2QA 5IBWA 3SG2A 1TNPA 1BF5A 4PHKA 1R6PA 3ZWHA 2FCEA 5ER5A 1UURA 1S3PA 1DF0A 2L0PA 4HRHA 2PQLA 3CWGA 4N1FA 1QV1A 4ZCUA 3A8RA 5AANA 3NSKA 1DJZA 2BCBA 1QATA 4UPGA 1K95A 1CKKA 2JULA 4YGCB 1BU3A 2FCDA 5JJGA 3TUYC 1DJGA 1KSMA 1QASA 3OX5A 2K7BA 4PHMA 1PSBA 3UNWA 2KPHA 4JPZB 1S6JA 2BBNA 2M97A 1OQPA 2AAOA 3D73A 3DF0A 1JC2A 2LCPA 4XYNA 1SSEB 1KQMB 2PYQA 4YGBB 4YGAA 4XJKA 1YRUB 1SY9A 1KK7Y 2KHNA 2LMUA 3DVJA 1DT7B 4YI8A 2PSRA 3FS7A 2E30A 3S0AA 5HLVA 3R1VA 2L2CA 2OPOA 2BCAA 1TTXA 1TWOA 2FOTA 1BR4B 2WCLA 2ZNEA 3ICBA 4GBAA 4P5OE 1PVAA 1QIWA 1XO5A 4N5XA 4GPLB 1SK6D 4MEWA 5DICA 1Q80A 2F3ZA 3OX6A 2WORA 1YRTB 4N1GA 1F4OA 2KI4C 1UWOA 3BUOB 2BECA 3CTNA 4IL1A 2KQ6A 1X02A 1TCFA 3F45A 3TDZA 1KFUL 1OMRA 3CGAA 2HQWA 4PE7A 4PALA 1IKUA 1F70A 1WDCC 3Q8IA 1BLQA 1AUIB 2M1UA 4INXA 5JOLA 5FI6A 1IQ3A 1B4CA 1ZMZA 1ZOTB 1DGUA 2K60A 3EKJA 3PLFB 1CFDA 1KSOA 2SASA 3I5FC 4DS7A 1C7VA 1S6CA 2L5YA 4NDDA 3BUNB 1GJYA 4GAOA 1Y0VH 2HQ8A 3R72A 2ZRTA 3OB2B 5ER4X 1KWOC 4BY4A 1KQVA 1UHHA 1YUSA 1E8AA 3TUYB 1K9KA 1B1GA 1BG1A 2MHHA 4D1EA 3BFHA 2KI6C 3BOWA 3D0YA 2NCOA 5D3OA 3SS5A 3BFAA 5AXIA 1QIVA 1NCZA 3WXAA
chains in the Genus database with same CATH topology
1WLMA 1DJIA 1MXLC 4PHNA 5HKWA 2DOQA 1TCOB 2EGDA 2LE9B 3VRNA 3VRPA 2KOTA 5BPJA 1GGZA 2JNFA 2LVKA 2H61A 3I5HB 1G4YR 5CSIA 2V53A 1CNPA 1RTP1 1S26D 5HKZA 3EVVA 1BT6A 2Q4UA 3EK4A 2KDHA 1NUBA 1W7JB 1WRZA 1CDMA 3KPXA 2CXJA 4I5LB 2PRUA 1CFCA 1L2OB 5I2LA 3JVTC 3LK0A 4OR9B 2L4IA 1RECA 1Y1UA 2MAZA 3VRRA 2Y4QA 4PHJA 1NPQA 1V1FA 2LHLA 2LLTA 5AEQA 2KI4B 5CPVA 1MHOA 2F3YA 1DF0B 2NXQA 1QX7A 3EK8A 4YI9A 1KQMC 2HPSA 1FW4A 2BE4A 2WOSA 2P6BB 4YBHB 4MRYA 2KGRA 2KGBC 1CLBA 1UHIA 2BL0C 3RLZA 2K8MB 3WHUB 2R2IA 2I2RE 1IGVA 1XVJA 4GUKA 2WCFA 1NCYA 2WCBA 5KU1A 3CZTX 3CR2A 3OHMB 1CDPA 1CFFA 1KWOB 3FIAA 5DKNA 3DF0B 4F0ZB 3NSLA 2CT9A 1ALVA 1NIWA 4GGFA 1LVCD 2ZFDA 1AP4A 1NX2A 4XJKB 4CLNA 1KFXS 1B8CA 1PRWA 2JZIA 1YVLA 2M49B 2M9GA 2L98A 1SNLA 1SBJA 2F33A 2LLUA 2HETA 4GGNA 4JQ0D 1LXFC 1RROA 2M0RA 2LVIA 2RGIA 3BUXB 4ZCVA 1ZFSA 3PALA 4DRWA 2K7CA 1QX5B 4CPVA 2MLFC 1XFVO 1DGVA 3TZ1A 1EG4A 2ZNDA 1OZSA 3DVMA 3RM1A 1J55A 2BBMA 3IQQA 1B47A 3JVTB 1ODBA 1FBVA 1MUXA 1QTXA 1M45A 2NLNA 4CFQA 3GK4X 1SMGA 1A4PA 2NCPA 3TDIA 1YX8A 1EG3A 1CB1A 4A4CA 2LANA 3CR4X 2LVJA 1JUOA 2L51A 5HKYA 1TIZA 1OZOA 1CTRA 1S1EA 2H2KA 1XK4C 1C7WA 3FWBA 4GGFC 3I5HC 3VRQA 2BL0B 3GK2A 3PFVA 2OS8B 4USLA 2M3WA 1SL7A 3BOWB 3D0YB 1MWNA 3NSIA 4WQ3A 3GK1A 1M46A 1A03A 1UHKA 1IH0A 1L2OC 1NX1A 1OOJA 4MBEA 5FYXA 3LL8B 2TN4A 4ICBA 1K90D 1GQMA 1QLSA 2KBIA 4MZLA 2O5GA 2AMIA 1MF8B 1TOPA 1W7IB 2IS9A 5B8IB 1F71A 2LC5A 1JSAA 3NXAA 2KFFA 1NCXA 1HT9A 1FF1A 1F54A 3O4YA 2KYFA 1UHJA 1A75A 4WRIA 1B8RA 3A4UB 3DVEA 2ZN8A 4E68A 1F8HA 1UHNA 1MQ1A 1R2UA 4ORAB 1WRLA 4PDZA 2BE6A 2PMYA 3KF9A 4HRGA 1JF0A 1G8IA 4QJ4B 5I2OA 3KHEA 3EK7A 4ORBB 5I8NA 2L4HA 3BQ3A 3SG5A 1YR5A 1WY9A 1RJVA 1DTLA 4YGEB 4DIRA 4YRUA 1IQ5A 1C7VA 3LLEA 3PN7C 4OVNF 4M2PA 1N0YA 2EHBA 3NSOA 2MJWB 1SYMA 1EXRA 1LKJA 4NDCA 1F55A 3FWCA 2QACA 4AQJA 2LM5A 2LMVA 4PE0A 1SCMC 2LNKA 2MA2A 4R1EA 4DCKA 1MXEA 1NWDA 1KFXL 1J7OA 3EVUA 3PM8A 3CR5X 2E6WA 2KAYA 2JNXA 3CLNA 1KK8C 1CLLA 1TNQA 1NYAA 2GV5A 2LV7A 4AOMA 4HSZA 1RFJA 1A29A 2BCXA 2KNEA 2M8UA 3O6BA 4OV2A 1DVIA 4GNKB 4MLWA 3O2PA 4C0LA 2COLB 3GOFA 5PALA 2ZRSA 1XFXO 1AHRA 3JTDC 2GGZA 2KYCA 3I5GB 1K96A 1BJFA 5HLOA 3VROA 4MZKA 1S6IA 2OS8C 3OB1B 2K7OA 1QX2A 1FI6A 1AJ5A 2JT8A 2L50A 2JTZA 3SG4A 3OP0A 1QVIZ 3M0WA 4PE1A 2JQ6A 4FQOA 1J7QA 4CIDA 5AFPA 1CM4A 2FJUB 1SCVA 1PK0D 1XYDA 3BUWB 5HYDA 1SPYA 3TDUA 1K94A 4PCWA 2H61C 3TS5B 2GGMA 2LMTA 2WC8A 2Y1MA 3PN7B 4MN0A 1D1OA 1XFUO 1BMOA 3KO0A 2LVVA 2LUXA 1Y1AA 3SG7A 2CBLA 1BOCA 3DVKA 1SL9A 2OTGC 3IQOA 1UP5A 4YGDB 1GGWA 1V1GA 1EJ3A 1JF2A 1B8LA 1K9UA 4OKHA 1SCMB 2KSPA 5D7FA 1LINA 3O78A 1CMGA 1YTZC 1S5GZ 4WQ2A 2Y1NA 2WCEA 3H4SE 1AK8A 4MSPA 1WLZA 2KFHA 5D69A 3ZNIA 1UUSA 2EC6C 1J7RA 3MSEB 3SG6A 1KK8B 5F6TA 1A75B 1ZACA 2KI6D 1K93D 4DUQA 1XA5A 2ZN9A 3JTDB 2G9BA 2Q91A 5G08A 1JFKA 3C1VA 1QJTA 4GFTA 1OMDA 2PASA 1HQVA 1JBAA 3QRXA 5K89A 1YX7A 1K8UA 1IG5A 4JWQA 1CFPA 1N65A 2KAXA 1QVIY 1SRAA 1IJ5A 5GQQC 2M7LA 1EL4A 2I7AA 1N2DA 1NP8A 1F4QA 4PE4A 5I2QA 3AAJA 2JPTA 3IF7A 3SG3A 2JOJA 4HREE 2A4JA 1DJXA 1LA3A 3WNXB 3I5GC 1PVBA 1TNXA 1U5IA 1B7TY 2L2EA 2KAVA 2LP2A 2LUCA 1CDNA 2OTGB 5CSFA 1YUUA 1CMFA 1SR6B 2MLEC 1DMOA 2JT0A 1IWQA 5KSZA 4L9MA 1XFYO 1J1DA 1TNWA 1IJ6A 2ZKMX 1PSRA 3KEVA 1S5GY 1JFJA 1XFZO 1OE9B 1RWYA 3PSRA 1YUTA 4ORCB 2EC6B 2D8NA 3WHTB 3BYAA 1ALWA 1XFWO 5CSJA 4OCIA 1DJHA 3TS5C 1VRKA 2MRDA 1FI5A 2JWWA 1QLKA 4C0JA 4NDBA 2K0JA 1H8BA 4A4BA 1DJWA 1G33A 4CFRA 1J1EA 1SKTA 2PALA 1DJYA 2JXCA 2PVBA 4QJ5B 2CNPA 1L7ZA 5J3XA 3HCMA 1IRJA 1SW8A 2SCPA 2M29A 3PATA 2LP3A 2K2AA 3LCPC 2BKIB 4U8DA 1M63B 1OSAA 1S36A 2KFGA 3EVRA 1K9PA 1SL8A 2MBXA 1K2HA 2L5XB 4C0KA 3I5IC 2JRFA 1ZUZA 3DD4A 4NQGA 2LAPA 2O60A 4QJ3B 1LA0A 1OMVA 2M1KB 1M31A 5DKRA 1JWDA 1CM1A 3SJSA 3LK1A 1PULA 1WRKA 1J7PA 1AJ4A 2NZ0A 3VGOA 2G2BA 1KFUS 4MVFA 2LLSA 4MRXA 1Y1XA 4I5NB 1NX0A 5CSNA 2M7NA 4MZJA 1C07A 4Q04A 5AERA 1Y6WA 2JTTA 3AKAA 3AKBA 1M39A 4ETOA 2CCMA 2HF5A 3HX4A 1EH2A 3CS1A 2WNDA 1YVHA 1QV0A 1A2XA 2I18A 3BUMB 3D10A 1CLMA 1TN4A 2B1UA 1FPWA 1QXPA 1CDLA 1NSHA 2JXLA 2KQYA 1BODA 2LHIA 2K7DA 2F2OA 1WDCB 1YURA 2I94A 1KK7Z 1NX3A 5DKQA 3SIBA 2AUCA 1B7TZ 4I5JA 1PALA 1TRFA 1AVSA 3I5FB 2K2FA 1KCYA 2ISDA 2JT3A 1SR6C 2CTNA 2F2PA 2KBMA 2K61A 2Y5IA 4FTGA 3BXKA 4M2OA 3AAKA 2F8PA 3E3RA 3SIAA 1XK4A 1MR8A 2QPTA 2VRGA 5KTYA 1H4BA 1QS7A 2JU0A 4AQIA 1U5IB 1B9AA 3I5IB 4P2YB 4BY5A 2JC2A 4I5KA 5TNCA 4TNCA 2BKHB 1BR1B 1RK9A 3K21A 3EKHA 4M2QA 5IBWA 3SG2A 1TNPA 1BF5A 4PHKA 1R6PA 3ZWHA 2FCEA 5ER5A 1UURA 1S3PA 1DF0A 2L0PA 4HRHA 3CWGA 4N1FA 1QV1A 4ZCUA 3A8RA 5AANA 3NSKA 1DJZA 2BCBA 1QATA 4UPGA 1K95A 1CKKA 2JULA 4YGCB 1BU3A 2FCDA 5JJGA 3TUYC 1DJGA 1KSMA 1QASA 3OX5A 2K7BA 4PHMA 1PSBA 4JPZB 1S6JA 2BBNA 2M97A 1OQPA 2AAOA 3DF0A 1JC2A 2LCPA 4XYNA 1KQMB 4YGBB 4YGAA 4XJKA 1YRUB 1SY9A 1KK7Y 2KHNA 2LMUA 3DVJA 1DT7B 4YI8A 2PSRA 3FS7A 2E30A 5HLVA 2OPOA 2BCAA 1TTXA 2FOTA 1BR4B 2ZNEA 3ICBA 4GBAA 4P5OE 1PVAA 1QIWA 1XO5A 4N5XA 4GPLB 1SK6D 4MEWA 1Q80A 2F3ZA 3OX6A 2WORA 1YRTB 4N1GA 1F4OA 2KI4C 1UWOA 3BUOB 2BECA 3CTNA 4IL1A 2KQ6A 1X02A 1TCFA 3F45A 3TDZA 1KFUL 1OMRA 3CGAA 2HQWA 4PE7A 4PALA 1IKUA 1F70A 1WDCC 1BLQA 1AUIB 2M1UA 5JOLA 1IQ3A 1B4CA 1ZMZA 1ZOTB 1DGUA 3EKJA 3PLFB 4DS7A 1CFDA 1KSOA 2SASA 3I5FC 1S6CA 4NDDA 3BUNB 1GJYA 4GAOA 1Y0VH 2HQ8A 2ZRTA 3OB2B 5ER4X 1KWOC 4BY4A 1KQVA 1UHHA 1YUSA 1E8AA 3TUYB 1K9KA 1B1GA 1BG1A 2MHHA 4D1EA 3BOWA 2KI6C 3D0YA 2NCOA 5AXIA 1QIVA 1NCZA 3WXAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WLM A;  1DJI A;  1MXL C;  4PHN A;  5HKW A;  2DOQ A;  1TCO B;  2EGD A;  2LE9 B;  3VRN A;  3VRP A;  2KOT A;  5BPJ A;  1GGZ A;  2JNF A;  2LVK A;  2H61 A;  3I5H B;  1G4Y R;  5CSI A;  2V53 A;  1CNP A;  1RTP 1;  1S26 D;  5HKZ A;  3EVV A;  1BT6 A;  2Q4U A;  3EK4 A;  2KDH A;  1NUB A;  1W7J B;  1WRZ A;  1CDM A;  3KPX A;  2CXJ A;  4I5L B;  2PRU A;  1CFC A;  1L2O B;  5I2L A;  3JVT C;  3LK0 A;  4OR9 B;  2L4I A;  1REC A;  1Y1U A;  2MAZ A;  3VRR A;  2Y4Q A;  4PHJ A;  1NPQ A;  1V1F A;  2LHL A;  2LLT A;  5AEQ A;  2KI4 B;  5CPV A;  1MHO A;  2F3Y A;  1DF0 B;  2NXQ A;  1QX7 A;  3EK8 A;  4YI9 A;  1KQM C;  2HPS A;  1FW4 A;  2BE4 A;  2WOS A;  2P6B B;  4YBH B;  4MRY A;  2KGR A;  2KGB C;  1CLB A;  1UHI A;  2BL0 C;  3RLZ A;  2K8M B;  3WHU B;  2R2I A;  2I2R E;  1IGV A;  1XVJ A;  4GUK A;  2WCF A;  1NCY A;  2WCB A;  5KU1 A;  3CZT X;  3CR2 A;  3OHM B;  1CDP A;  1CFF A;  1KWO B;  3FIA A;  5DKN A;  3DF0 B;  4F0Z B;  3NSL A;  2CT9 A;  1ALV A;  1NIW A;  4GGF A;  1LVC D;  2ZFD A;  1AP4 A;  1NX2 A;  4XJK B;  4CLN A;  1KFX S;  1B8C A;  1PRW A;  2JZI A;  1YVL A;  2M49 B;  2M9G A;  2L98 A;  1SNL A;  1SBJ A;  2F33 A;  2LLU A;  2HET A;  4GGN A;  4JQ0 D;  1LXF C;  1RRO A;  2M0R A;  2LVI A;  2RGI A;  3BUX B;  4ZCV A;  1ZFS A;  3PAL A;  4DRW A;  2K7C A;  1QX5 B;  4CPV A;  2MLF C;  1XFV O;  1DGV A;  3TZ1 A;  1EG4 A;  2ZND A;  1OZS A;  3DVM A;  3RM1 A;  1J55 A;  2BBM A;  3IQQ A;  1B47 A;  3JVT B;  1ODB A;  1FBV A;  1MUX A;  1QTX A;  1M45 A;  2NLN A;  4CFQ A;  3GK4 X;  1SMG A;  1A4P A;  2NCP A;  3TDI A;  1YX8 A;  1EG3 A;  1CB1 A;  4A4C A;  2LAN A;  3CR4 X;  2LVJ A;  1JUO A;  2L51 A;  5HKY A;  1TIZ A;  1OZO A;  1CTR A;  1S1E A;  2H2K A;  1XK4 C;  1C7W A;  3FWB A;  4GGF C;  3I5H C;  3VRQ A;  2BL0 B;  3GK2 A;  3PFV A;  2OS8 B;  4USL A;  2M3W A;  1SL7 A;  3BOW B;  3D0Y B;  1MWN A;  3NSI A;  4WQ3 A;  3GK1 A;  1M46 A;  1A03 A;  1UHK A;  1IH0 A;  1L2O C;  1NX1 A;  1OOJ A;  4MBE A;  5FYX A;  3LL8 B;  2TN4 A;  4ICB A;  1K90 D;  1GQM A;  1QLS A;  2KBI A;  4MZL A;  2O5G A;  2AMI A;  1MF8 B;  1TOP A;  1W7I B;  2IS9 A;  5B8I B;  1F71 A;  2LC5 A;  1JSA A;  3NXA A;  2KFF A;  1NCX A;  1HT9 A;  1FF1 A;  1F54 A;  3O4Y A;  2KYF A;  1UHJ A;  1A75 A;  4WRI A;  1B8R A;  3A4U B;  3DVE A;  2ZN8 A;  4E68 A;  1F8H A;  1UHN A;  1MQ1 A;  1R2U A;  4ORA B;  1WRL A;  4PDZ A;  2BE6 A;  2PMY A;  3KF9 A;  4HRG A;  1JF0 A;  1G8I A;  4QJ4 B;  5I2O A;  3KHE A;  3EK7 A;  4ORB B;  5I8N A;  2L4H A;  3BQ3 A;  3SG5 A;  1YR5 A;  1WY9 A;  1RJV A;  1DTL A;  4YGE B;  4DIR A;  4YRU A;  1IQ5 A;  1C7V A;  3LLE A;  3PN7 C;  4OVN F;  4M2P A;  1N0Y A;  2EHB A;  3NSO A;  2MJW B;  1SYM A;  1EXR A;  1LKJ A;  4NDC A;  1F55 A;  3FWC A;  2QAC A;  4AQJ A;  2LM5 A;  2LMV A;  4PE0 A;  1SCM C;  2LNK A;  2MA2 A;  4R1E A;  4DCK A;  1MXE A;  1NWD A;  1KFX L;  1J7O A;  3EVU A;  3PM8 A;  3CR5 X;  2E6W A;  2KAY A;  2JNX A;  3CLN A;  1KK8 C;  1CLL A;  1TNQ A;  1NYA A;  2GV5 A;  2LV7 A;  4AOM A;  4HSZ A;  1RFJ A;  1A29 A;  2BCX A;  2KNE A;  2M8U A;  3O6B A;  4OV2 A;  1DVI A;  4GNK B;  4MLW A;  3O2P A;  4C0L A;  2COL B;  3GOF A;  5PAL A;  2ZRS A;  1XFX O;  1AHR A;  3JTD C;  2GGZ A;  2KYC A;  3I5G B;  1K96 A;  1BJF A;  5HLO A;  3VRO A;  4MZK A;  1S6I A;  2OS8 C;  3OB1 B;  2K7O A;  1QX2 A;  1FI6 A;  1AJ5 A;  2JT8 A;  2L50 A;  2JTZ A;  3SG4 A;  3OP0 A;  1QVI Z;  3M0W A;  4PE1 A;  2JQ6 A;  4FQO A;  1J7Q A;  4CID A;  5AFP A;  1CM4 A;  2FJU B;  1SCV A;  1PK0 D;  1XYD A;  3BUW B;  5HYD A;  1SPY A;  3TDU A;  1K94 A;  4PCW A;  2H61 C;  3TS5 B;  2GGM A;  2LMT A;  2WC8 A;  2Y1M A;  3PN7 B;  4MN0 A;  1D1O A;  1XFU O;  1BMO A;  3KO0 A;  2LVV A;  2LUX A;  1Y1A A;  3SG7 A;  2CBL A;  1BOC A;  3DVK A;  1SL9 A;  2OTG C;  3IQO A;  1UP5 A;  4YGD B;  1GGW A;  1V1G A;  1EJ3 A;  1JF2 A;  1B8L A;  1K9U A;  4OKH A;  1SCM B;  2KSP A;  5D7F A;  1LIN A;  3O78 A;  1CMG A;  1YTZ C;  1S5G Z;  4WQ2 A;  2Y1N A;  2WCE A;  3H4S E;  1AK8 A;  4MSP A;  1WLZ A;  2KFH A;  5D69 A;  3ZNI A;  1UUS A;  2EC6 C;  1J7R A;  3MSE B;  3SG6 A;  1KK8 B;  5F6T A;  1A75 B;  1ZAC A;  2KI6 D;  1K93 D;  4DUQ A;  1XA5 A;  2ZN9 A;  3JTD B;  2G9B A;  2Q91 A;  5G08 A;  1JFK A;  3C1V A;  1QJT A;  4GFT A;  1OMD A;  2PAS A;  1HQV A;  1JBA A;  3QRX A;  5K89 A;  1YX7 A;  1K8U A;  1IG5 A;  4JWQ A;  1CFP A;  1N65 A;  2KAX A;  1QVI Y;  1SRA A;  1IJ5 A;  5GQQ C;  2M7L A;  1EL4 A;  2I7A A;  1N2D A;  1NP8 A;  1F4Q A;  4PE4 A;  5I2Q A;  3AAJ A;  2JPT A;  3IF7 A;  3SG3 A;  2JOJ A;  4HRE E;  2A4J A;  1DJX A;  1LA3 A;  3WNX B;  3I5G C;  1PVB A;  1TNX A;  1U5I A;  1B7T Y;  2L2E A;  2KAV A;  2LP2 A;  2LUC A;  1CDN A;  2OTG B;  5CSF A;  1YUU A;  1CMF A;  1SR6 B;  2MLE C;  1DMO A;  2JT0 A;  1IWQ A;  5KSZ A;  4L9M A;  1XFY O;  1J1D A;  1TNW A;  1IJ6 A;  2ZKM X;  1PSR A;  3KEV A;  1S5G Y;  1JFJ A;  1XFZ O;  1OE9 B;  1RWY A;  3PSR A;  1YUT A;  4ORC B;  2EC6 B;  2D8N A;  3WHT B;  3BYA A;  1ALW A;  1XFW O;  5CSJ A;  4OCI A;  1DJH A;  3TS5 C;  1VRK A;  2MRD A;  1FI5 A;  2JWW A;  1QLK A;  4C0J A;  4NDB A;  2K0J A;  1H8B A;  4A4B A;  1DJW A;  1G33 A;  4CFR A;  1J1E A;  1SKT A;  2PAL A;  1DJY A;  2JXC A;  2PVB A;  4QJ5 B;  2CNP A;  1L7Z A;  5J3X A;  3HCM A;  1IRJ A;  1SW8 A;  2SCP A;  2M29 A;  3PAT A;  2LP3 A;  2K2A A;  3LCP C;  2BKI B;  4U8D A;  1M63 B;  1OSA A;  1S36 A;  2KFG A;  3EVR A;  1K9P A;  1SL8 A;  2MBX A;  1K2H A;  2L5X B;  4C0K A;  3I5I C;  2JRF A;  1ZUZ A;  3DD4 A;  4NQG A;  2LAP A;  2O60 A;  4QJ3 B;  1LA0 A;  1OMV A;  2M1K B;  1M31 A;  5DKR A;  1JWD A;  1CM1 A;  3SJS A;  3LK1 A;  1PUL A;  1WRK A;  1J7P A;  1AJ4 A;  2NZ0 A;  3VGO A;  2G2B A;  1KFU S;  4MVF A;  2LLS A;  4MRX A;  1Y1X A;  4I5N B;  1NX0 A;  5CSN A;  2M7N A;  4MZJ A;  1C07 A;  4Q04 A;  5AER A;  1Y6W A;  2JTT A;  3AKA A;  3AKB A;  1M39 A;  4ETO A;  2CCM A;  2HF5 A;  3HX4 A;  1EH2 A;  3CS1 A;  2WND A;  1YVH A;  1QV0 A;  1A2X A;  2I18 A;  3BUM B;  3D10 A;  1CLM A;  1TN4 A;  2B1U A;  1FPW A;  1QXP A;  1CDL A;  1NSH A;  2JXL A;  2KQY A;  1BOD A;  2LHI A;  2K7D A;  2F2O A;  1WDC B;  1YUR A;  2I94 A;  1KK7 Z;  1NX3 A;  5DKQ A;  3SIB A;  2AUC A;  1B7T Z;  4I5J A;  1PAL A;  1TRF A;  1AVS A;  3I5F B;  2K2F A;  1KCY A;  2ISD A;  2JT3 A;  1SR6 C;  2CTN A;  2F2P A;  2KBM A;  2K61 A;  2Y5I A;  4FTG A;  3BXK A;  4M2O A;  3AAK A;  2F8P A;  3E3R A;  3SIA A;  1XK4 A;  1MR8 A;  2QPT A;  2VRG A;  5KTY A;  1H4B A;  1QS7 A;  2JU0 A;  4AQI A;  1U5I B;  1B9A A;  3I5I B;  4P2Y B;  4BY5 A;  2JC2 A;  4I5K A;  5TNC A;  4TNC A;  2BKH B;  1BR1 B;  1RK9 A;  3K21 A;  3EKH A;  4M2Q A;  5IBW A;  3SG2 A;  1TNP A;  1BF5 A;  4PHK A;  1R6P A;  3ZWH A;  2FCE A;  5ER5 A;  1UUR A;  1S3P A;  1DF0 A;  2L0P A;  4HRH A;  3CWG A;  4N1F A;  1QV1 A;  4ZCU A;  3A8R A;  5AAN A;  3NSK A;  1DJZ A;  2BCB A;  1QAT A;  4UPG A;  1K95 A;  1CKK A;  2JUL A;  4YGC B;  1BU3 A;  2FCD A;  5JJG A;  3TUY C;  1DJG A;  1KSM A;  1QAS A;  3OX5 A;  2K7B A;  4PHM A;  1PSB A;  4JPZ B;  1S6J A;  2BBN A;  2M97 A;  1OQP A;  2AAO A;  3DF0 A;  1JC2 A;  2LCP A;  4XYN A;  1KQM B;  4YGB B;  4YGA A;  4XJK A;  1YRU B;  1SY9 A;  1KK7 Y;  2KHN A;  2LMU A;  3DVJ A;  1DT7 B;  4YI8 A;  2PSR A;  3FS7 A;  2E30 A;  5HLV A;  2OPO A;  2BCA A;  1TTX A;  2FOT A;  1BR4 B;  2ZNE A;  3ICB A;  4GBA A;  4P5O E;  1PVA A;  1QIW A;  1XO5 A;  4N5X A;  4GPL B;  1SK6 D;  4MEW A;  1Q80 A;  2F3Z A;  3OX6 A;  2WOR A;  1YRT B;  4N1G A;  1F4O A;  2KI4 C;  1UWO A;  3BUO B;  2BEC A;  3CTN A;  4IL1 A;  2KQ6 A;  1X02 A;  1TCF A;  3F45 A;  3TDZ A;  1KFU L;  1OMR A;  3CGA A;  2HQW A;  4PE7 A;  4PAL A;  1IKU A;  1F70 A;  1WDC C;  1BLQ A;  1AUI B;  2M1U A;  5JOL A;  1IQ3 A;  1B4C A;  1ZMZ A;  1ZOT B;  1DGU A;  3EKJ A;  3PLF B;  4DS7 A;  1CFD A;  1KSO A;  2SAS A;  3I5F C;  1S6C A;  4NDD A;  3BUN B;  1GJY A;  4GAO A;  1Y0V H;  2HQ8 A;  2ZRT A;  3OB2 B;  5ER4 X;  1KWO C;  4BY4 A;  1KQV A;  1UHH A;  1YUS A;  1E8A A;  3TUY B;  1K9K A;  1B1G A;  1BG1 A;  2MHH A;  4D1E A;  3BOW A;  2KI6 C;  3D0Y A;  2NCO A;  5AXI A;  1QIV A;  1NCZ A;  3WXA A; 
#chains in the Genus database with same CATH topology
 1WLM A;  1DJI A;  1MXL C;  4PHN A;  5HKW A;  2DOQ A;  3S0F A;  1TCO B;  2EGD A;  2LE9 B;  3VRN A;  3VRP A;  2KOT A;  5BPJ A;  3FE9 A;  1GGZ A;  2JNF A;  2LVK A;  2H61 A;  3I5H B;  1G4Y R;  5CSI A;  2V53 A;  1CNP A;  1RTP 1;  1S26 D;  5HKZ A;  3EVV A;  1BT6 A;  2Q4U A;  3EK4 A;  2KDH A;  1NUB A;  1W7J B;  1WRZ A;  1CDM A;  3KPX A;  2CXJ A;  4I5L B;  2PRU A;  1CFC A;  3R1P A;  3DXL A;  1L2O B;  5I2L A;  3RZS A;  3JVT C;  3LK0 A;  4OR9 B;  2WCM A;  2L4I A;  1REC A;  1Y1U A;  2MAZ A;  3VRR A;  2Y4Q A;  4PHJ A;  1NPQ A;  1V1F A;  2LHL A;  2LLT A;  5AEQ A;  2KI4 B;  5CPV A;  1MHO A;  2F3Y A;  1DF0 B;  2NXQ A;  1OOI X;  1QX7 A;  3EK8 A;  4YI9 A;  1KQM C;  3D78 A;  2HPS A;  1FW4 A;  2BE4 A;  2WOS A;  2P6B B;  4YBH B;  4MRY A;  3N7H A;  2KGR A;  2KGB C;  3BFB A;  1CLB A;  1UHI A;  2BL0 C;  3RLZ A;  2K8M B;  3WHU B;  2R2I A;  2I2R E;  1IGV A;  1XVJ A;  4GUK A;  2GTE A;  2WCF A;  1NCY A;  2WCB A;  5KU1 A;  3CZT X;  3CR2 A;  3OHM B;  1CDP A;  1CFF A;  1KWO B;  3QME A;  3V2L A;  3FIA A;  4INW A;  3DF0 B;  5DKN A;  4F0Z B;  3NSL A;  2CT9 A;  1ALV A;  1NIW A;  4GGF A;  3S0E A;  1LVC D;  2ZFD A;  1AP4 A;  1NX2 A;  4XJK B;  4CLN A;  1KFX S;  1B8C A;  1PRW A;  2JZI A;  1YVL A;  2M49 B;  2M9G A;  2L98 A;  3NHT A;  1SNL A;  1SBJ A;  2F33 A;  2LLU A;  3S0B A;  2HET A;  4GGN A;  4JQ0 D;  1LXF C;  1RRO A;  2M0R A;  2LVI A;  2RGI A;  3BUX B;  4ZCV A;  1ZFS A;  3PAL A;  4DRW A;  3FE8 A;  2K7C A;  1QX5 B;  4CPV A;  2MLF C;  2WCK A;  1XFV O;  1DEK A;  1DGV A;  3TZ1 A;  1EG4 A;  2ZND A;  3L4A A;  1OZS A;  1C3Y A;  3DVM A;  3RM1 A;  1J55 A;  3L47 A;  2BBM A;  3IQQ A;  1B47 A;  3JVT B;  1ODB A;  3D74 A;  1FBV A;  1MUX A;  1QTX A;  1M45 A;  2NLN A;  4CFQ A;  3GK4 X;  3OBV A;  1SMG A;  1A4P A;  2NCP A;  3TDI A;  1YX8 A;  1EG3 A;  1CB1 A;  4A4C A;  2LAN A;  3CR4 X;  1ORG A;  2LVJ A;  1JUO A;  2L51 A;  5HKY A;  1TIZ A;  1OZO A;  1CTR A;  1S1E A;  2H2K A;  1XK4 C;  1C7W A;  1OOF A;  3CZ1 A;  3FWB A;  4GGF C;  3I5H C;  3VRQ A;  2BL0 B;  3GK2 A;  3O4X A;  3PFV A;  2OS8 B;  4USL A;  2M3W A;  1SL7 A;  3BOW B;  3D0Y B;  1MWN A;  3NSI A;  4WQ3 A;  3GK1 A;  1M46 A;  1A03 A;  1UHK A;  1IH0 A;  1L2O C;  1NX1 A;  1OOJ A;  4MBE A;  5FYX A;  3LL8 B;  2TN4 A;  4ICB A;  1K90 D;  1TUJ A;  4JD9 A;  1GQM A;  1QLS A;  2KBI A;  4MZL A;  2O5G A;  2AMI A;  1MF8 B;  1TOP A;  1W7I B;  3VB1 A;  2IS9 A;  5B8I B;  1F71 A;  1DC1 A;  2LC5 A;  1JSA A;  3NXA A;  2KFF A;  1NCX A;  1HT9 A;  1FF1 A;  1F54 A;  3O4Y A;  2KYF A;  1UHJ A;  1A75 A;  4WRI A;  1B8R A;  3A4U B;  3DVE A;  2ZN8 A;  4E68 A;  1F8H A;  1UHN A;  1MQ1 A;  1R2U A;  4ORA B;  1WRL A;  4PDZ A;  2BE6 A;  2PMY A;  3KF9 A;  4HRG A;  1JF0 A;  1G8I A;  4QJ4 B;  5I2O A;  3SS3 A;  3KHE A;  3EK7 A;  2WCH A;  4ORB B;  5I8N A;  3S0D A;  2ERB A;  2L4H A;  3BQ3 A;  5FI7 A;  1YR5 A;  1WY9 A;  1RJV A;  1DTL A;  4YGE B;  3SG5 A;  4DIR A;  1IQ5 A;  4YRU A;  3LLE A;  3PN7 C;  4OVN F;  4M2P A;  1N0Y A;  2EHB A;  3NSO A;  5I94 A;  2MJW B;  1SYM A;  1EXR A;  1LKJ A;  4NDC A;  1F55 A;  3FWC A;  2QAC A;  4AQJ A;  2LM5 A;  2LMV A;  2KLD A;  4PE0 A;  1SCM C;  2LNK A;  2MA2 A;  4R1E A;  4DCK A;  3IVT A;  1MXE A;  1NWD A;  2JPO A;  1KFX L;  1J7O A;  3EVU A;  3PM8 A;  3CR5 X;  2E6W A;  2KAY A;  2JNX A;  3CLN A;  1KK8 C;  1CLL A;  1TNQ A;  1NYA A;  2GV5 A;  2LV7 A;  4AOM A;  4HSZ A;  1RFJ A;  1A29 A;  2BCX A;  2KNE A;  2M8U A;  3O6B A;  4OV2 A;  1DVI A;  4GNK B;  1W9Z A;  1LS8 A;  2BAP A;  2QEO A;  2QEV A;  3O2P A;  2COL B;  3GOF A;  4MLW A;  5PAL A;  4C0L A;  2ZRS A;  1XFX O;  1AHR A;  3JTD C;  2GGZ A;  2KYC A;  3I5G B;  1K96 A;  1BJF A;  5HLO A;  1Z2C B;  3VRO A;  4FQT A;  4MZK A;  1S6I A;  3CZ2 A;  2OS8 C;  3OB1 B;  2K7O A;  1QX2 A;  4OZD A;  1AJ5 A;  1FI6 A;  2JT8 A;  2L50 A;  2JTZ A;  3SG4 A;  3OP0 A;  1QVI Z;  3M0W A;  4PE1 A;  2JQ6 A;  4FQO A;  1J7Q A;  4CID A;  5AFP A;  1CM4 A;  2FJU B;  5EL2 A;  1SCV A;  1PK0 D;  1XYD A;  3BUW B;  5HYD A;  2H8V A;  1SPY A;  3TDU A;  1K94 A;  4PCW A;  2H61 C;  3D75 A;  2GGM A;  3TS5 B;  2LMT A;  2WC8 A;  2BNX A;  2Y1M A;  3PN7 B;  4MN0 A;  1D1O A;  1XFU O;  1P28 A;  1BMO A;  3KO0 A;  2LVV A;  2LUX A;  1Y1A A;  3SG7 A;  2CBL A;  1BOC A;  3DVK A;  1SL9 A;  2OTG C;  3IQO A;  1UP5 A;  4YGD B;  1IIO A;  1GGW A;  1V1G A;  1EJ3 A;  1JF2 A;  1B8L A;  1K9U A;  3D77 A;  1SCM B;  4OKH A;  2KSP A;  3B88 A;  2QDI A;  5D7F A;  1LIN A;  3O78 A;  1CMG A;  1YTZ C;  1S5G Z;  3CYZ A;  4WQ2 A;  2Y1N A;  2WCE A;  3H4S E;  1AK8 A;  4MSP A;  1WLZ A;  2KFH A;  5D69 A;  2WCJ A;  1UUS A;  2EC6 C;  1J7R A;  3MSE B;  3PJI A;  1KK8 B;  3SG6 A;  3ZNI A;  5F6T A;  1A75 B;  1ZAC A;  1T14 A;  2KI6 D;  1K93 D;  4DUQ A;  1XA5 A;  2QEH A;  1QWV A;  2ZN9 A;  3JTD B;  2G9B A;  2Q91 A;  3CAB A;  5G08 A;  1JFK A;  3C1V A;  1QJT A;  3DY9 A;  4GFT A;  1OMD A;  2P71 A;  2PAS A;  4JKT A;  1HQV A;  1JBA A;  3QRX A;  5K89 A;  1YX7 A;  3UO9 A;  1K8U A;  1OW4 A;  1IG5 A;  3B87 A;  4JWQ A;  3SS4 A;  1CFP A;  1N65 A;  2KAX A;  1QVI Y;  3K1E A;  1SRA A;  1IJ5 A;  5GQQ C;  2M7L A;  1EL4 A;  2I7A A;  1N2D A;  1NP8 A;  1F4Q A;  4PE4 A;  5I2Q A;  3AAJ A;  2JPT A;  3IF7 A;  3SG3 A;  2JOJ A;  4HRE E;  2A4J A;  1DJX A;  1LA3 A;  3WNX B;  1GM0 A;  4F7F A;  3I5G C;  1PVB A;  1TNX A;  1U5I A;  1B7T Y;  2L2E A;  2KAV A;  2LP2 A;  2LUC A;  3NHI A;  2OTG B;  1CDN A;  5CSF A;  1YUU A;  2YGU A;  1CMF A;  1SR6 B;  2MLE C;  1DMO A;  2JT0 A;  1IWQ A;  5KSZ A;  3B7A A;  4L9M A;  1XFY O;  1J1D A;  1TNW A;  1IJ6 A;  2ZKM X;  1DQE A;  1PSR A;  3KEV A;  1S5G Y;  1JFJ A;  1XFZ O;  1OE9 B;  1RWY A;  3PSR A;  1YUT A;  2QEB A;  4ORC B;  2EC6 B;  2D8N A;  3WHT B;  3BYA A;  1ALW A;  1XFW O;  5CSJ A;  4OCI A;  1DJH A;  3TS5 C;  1VRK A;  3DYE A;  3L4L A;  2MRD A;  1FI5 A;  2JWW A;  1QLK A;  4C0J A;  4NDB A;  2K0J A;  1H8B A;  3FE6 A;  4A4B A;  1DJW A;  1G33 A;  4CFR A;  2WC6 A;  1J1E A;  1SKT A;  2PAL A;  1DJY A;  2JXC A;  3CZ0 A;  2PVB A;  4QJ5 B;  2CNP A;  1L7Z A;  5J3X A;  3BJH A;  3B86 A;  3HCM A;  1IRJ A;  1SW8 A;  2SCP A;  2M29 A;  3PAT A;  4IJ7 A;  2LP3 A;  2K2A A;  3LCP C;  2BKI B;  4U8D A;  1M63 B;  1OSA A;  1S36 A;  2KFG A;  3EVR A;  1K9P A;  1SL8 A;  1XFR A;  2MBX A;  5HL1 A;  1DEL A;  2L5X B;  1K2H A;  4C0K A;  3I5I C;  2JRF A;  1ZUZ A;  3DD4 A;  3R1O A;  4NQG A;  2LAP A;  2O60 A;  4QJ3 B;  1LA0 A;  1OMV A;  2M1K B;  3EG5 B;  1M31 A;  2KLE A;  5DKR A;  1JWD A;  1CM1 A;  3SJS A;  3LK1 A;  1PUL A;  1WRK A;  1J7P A;  1AJ4 A;  2NZ0 A;  3VGO A;  2G2B A;  1KFU S;  1TUZ A;  4MVF A;  2LLS A;  4MRX A;  1Y1X A;  4I5N B;  1NX0 A;  5CSN A;  2M7N A;  4MZJ A;  1C07 A;  4Q04 A;  5AER A;  1Y6W A;  2JTT A;  3AKA A;  3AKB A;  1M39 A;  4ETO A;  3D76 A;  1OOH A;  2CCM A;  2HF5 A;  3HX4 A;  2WC5 A;  1EH2 A;  3CS1 A;  2WND A;  1YVH A;  1QV0 A;  1A2X A;  2I18 A;  3BUM B;  3D10 A;  1CLM A;  1TN4 A;  2B1U A;  3CDN A;  1FPW A;  1QXP A;  3PM2 A;  1CDL A;  1NSH A;  2JXL A;  2KQY A;  2P70 A;  5FI2 A;  1BOD A;  2LHI A;  2K7D A;  2F2O A;  1WDC B;  1YUR A;  2I94 A;  1KK7 Z;  1NX3 A;  5DKQ A;  3SIB A;  2AUC A;  3S0G A;  1B7T Z;  4I5J A;  1PAL A;  1TRF A;  1AVS A;  3I5F B;  1OOG A;  2K2F A;  3OGN A;  1KCY A;  2ISD A;  2JT3 A;  1SR6 C;  2CTN A;  2F2P A;  2KBM A;  2K61 A;  2Y5I A;  4KYN A;  4FTG A;  3BXK A;  4M2O A;  3AAK A;  2F8P A;  3E3R A;  3SIA A;  3B6X A;  1XK4 A;  1MR8 A;  2QPT A;  2VRG A;  5KTY A;  1H4B A;  1QS7 A;  1Z4H A;  2JU0 A;  4PT1 A;  1U5I B;  4AQI A;  3DZT A;  2FJY A;  1B9A A;  3I5I B;  4P2Y B;  4BY5 A;  2JC2 A;  3NGV A;  4I5K A;  5TNC A;  1C3Z A;  2BKH B;  4TNC A;  1BR1 B;  1RK9 A;  3K21 A;  3EKH A;  4M2Q A;  5IBW A;  3SG2 A;  1TNP A;  1BF5 A;  4PHK A;  1R6P A;  3ZWH A;  2FCE A;  5ER5 A;  1UUR A;  1S3P A;  1DF0 A;  2L0P A;  4HRH A;  2PQL A;  3CWG A;  4N1F A;  1QV1 A;  4ZCU A;  3A8R A;  5AAN A;  3NSK A;  1DJZ A;  2BCB A;  1QAT A;  4UPG A;  1K95 A;  1CKK A;  2JUL A;  4YGC B;  1BU3 A;  2FCD A;  5JJG A;  3TUY C;  1DJG A;  1KSM A;  1QAS A;  3OX5 A;  2K7B A;  4PHM A;  1PSB A;  3UNW A;  2KPH A;  4JPZ B;  1S6J A;  2BBN A;  2M97 A;  1OQP A;  2AAO A;  3D73 A;  3DF0 A;  1JC2 A;  2LCP A;  4XYN A;  1SSE B;  1KQM B;  2PYQ A;  4YGB B;  4YGA A;  4XJK A;  1YRU B;  1SY9 A;  1KK7 Y;  2KHN A;  2LMU A;  3DVJ A;  1DT7 B;  4YI8 A;  2PSR A;  3FS7 A;  2E30 A;  3S0A A;  5HLV A;  3R1V A;  2L2C A;  2OPO A;  2BCA A;  1TTX A;  1TWO A;  2FOT A;  1BR4 B;  2WCL A;  2ZNE A;  3ICB A;  4GBA A;  4P5O E;  1PVA A;  1QIW A;  1XO5 A;  4N5X A;  4GPL B;  1SK6 D;  4MEW A;  5DIC A;  1Q80 A;  2F3Z A;  3OX6 A;  2WOR A;  1YRT B;  4N1G A;  1F4O A;  2KI4 C;  1UWO A;  3BUO B;  2BEC A;  3CTN A;  4IL1 A;  2KQ6 A;  1X02 A;  1TCF A;  3F45 A;  3TDZ A;  1KFU L;  1OMR A;  3CGA A;  2HQW A;  4PE7 A;  4PAL A;  1IKU A;  1F70 A;  1WDC C;  3Q8I A;  1BLQ A;  1AUI B;  2M1U A;  4INX A;  5JOL A;  5FI6 A;  1IQ3 A;  1B4C A;  1ZMZ A;  1ZOT B;  1DGU A;  2K60 A;  3EKJ A;  3PLF B;  1CFD A;  1KSO A;  2SAS A;  3I5F C;  4DS7 A;  1C7V A;  1S6C A;  2L5Y A;  4NDD A;  3BUN B;  1GJY A;  4GAO A;  1Y0V H;  2HQ8 A;  3R72 A;  2ZRT A;  3OB2 B;  5ER4 X;  1KWO C;  4BY4 A;  1KQV A;  1UHH A;  1YUS A;  1E8A A;  3TUY B;  1K9K A;  1B1G A;  1BG1 A;  2MHH A;  4D1E A;  3BFH A;  2KI6 C;  3BOW A;  3D0Y A;  2NCO A;  5D3O A;  3SS5 A;  3BFA A;  5AXI A;  1QIV A;  1NCZ A;  3WXA A; 
#chains in the Genus database with same CATH homology
 1WLM A;  1DJI A;  1MXL C;  4PHN A;  5HKW A;  2DOQ A;  1TCO B;  2EGD A;  2LE9 B;  3VRN A;  3VRP A;  2KOT A;  5BPJ A;  1GGZ A;  2JNF A;  2LVK A;  2H61 A;  3I5H B;  1G4Y R;  5CSI A;  2V53 A;  1CNP A;  1RTP 1;  1S26 D;  5HKZ A;  3EVV A;  1BT6 A;  2Q4U A;  3EK4 A;  2KDH A;  1NUB A;  1W7J B;  1WRZ A;  1CDM A;  3KPX A;  2CXJ A;  4I5L B;  2PRU A;  1CFC A;  1L2O B;  5I2L A;  3JVT C;  3LK0 A;  4OR9 B;  2L4I A;  1REC A;  1Y1U A;  2MAZ A;  3VRR A;  2Y4Q A;  4PHJ A;  1NPQ A;  1V1F A;  2LHL A;  2LLT A;  5AEQ A;  2KI4 B;  5CPV A;  1MHO A;  2F3Y A;  1DF0 B;  2NXQ A;  1QX7 A;  3EK8 A;  4YI9 A;  1KQM C;  2HPS A;  1FW4 A;  2BE4 A;  2WOS A;  2P6B B;  4YBH B;  4MRY A;  2KGR A;  2KGB C;  1CLB A;  1UHI A;  2BL0 C;  3RLZ A;  2K8M B;  3WHU B;  2R2I A;  2I2R E;  1IGV A;  1XVJ A;  4GUK A;  2WCF A;  1NCY A;  2WCB A;  5KU1 A;  3CZT X;  3CR2 A;  3OHM B;  1CDP A;  1CFF A;  1KWO B;  3FIA A;  5DKN A;  3DF0 B;  4F0Z B;  3NSL A;  2CT9 A;  1ALV A;  1NIW A;  4GGF A;  1LVC D;  2ZFD A;  1AP4 A;  1NX2 A;  4XJK B;  4CLN A;  1KFX S;  1B8C A;  1PRW A;  2JZI A;  1YVL A;  2M49 B;  2M9G A;  2L98 A;  1SNL A;  1SBJ A;  2F33 A;  2LLU A;  2HET A;  4GGN A;  4JQ0 D;  1LXF C;  1RRO A;  2M0R A;  2LVI A;  2RGI A;  3BUX B;  4ZCV A;  1ZFS A;  3PAL A;  4DRW A;  2K7C A;  1QX5 B;  4CPV A;  2MLF C;  1XFV O;  1DGV A;  3TZ1 A;  1EG4 A;  2ZND A;  1OZS A;  3DVM A;  3RM1 A;  1J55 A;  2BBM A;  3IQQ A;  1B47 A;  3JVT B;  1ODB A;  1FBV A;  1MUX A;  1QTX A;  1M45 A;  2NLN A;  4CFQ A;  3GK4 X;  1SMG A;  1A4P A;  2NCP A;  3TDI A;  1YX8 A;  1EG3 A;  1CB1 A;  4A4C A;  2LAN A;  3CR4 X;  2LVJ A;  1JUO A;  2L51 A;  5HKY A;  1TIZ A;  1OZO A;  1CTR A;  1S1E A;  2H2K A;  1XK4 C;  1C7W A;  3FWB A;  4GGF C;  3I5H C;  3VRQ A;  2BL0 B;  3GK2 A;  3PFV A;  2OS8 B;  4USL A;  2M3W A;  1SL7 A;  3BOW B;  3D0Y B;  1MWN A;  3NSI A;  4WQ3 A;  3GK1 A;  1M46 A;  1A03 A;  1UHK A;  1IH0 A;  1L2O C;  1NX1 A;  1OOJ A;  4MBE A;  5FYX A;  3LL8 B;  2TN4 A;  4ICB A;  1K90 D;  1GQM A;  1QLS A;  2KBI A;  4MZL A;  2O5G A;  2AMI A;  1MF8 B;  1TOP A;  1W7I B;  2IS9 A;  5B8I B;  1F71 A;  2LC5 A;  1JSA A;  3NXA A;  2KFF A;  1NCX A;  1HT9 A;  1FF1 A;  1F54 A;  3O4Y A;  2KYF A;  1UHJ A;  1A75 A;  4WRI A;  1B8R A;  3A4U B;  3DVE A;  2ZN8 A;  4E68 A;  1F8H A;  1UHN A;  1MQ1 A;  1R2U A;  4ORA B;  1WRL A;  4PDZ A;  2BE6 A;  2PMY A;  3KF9 A;  4HRG A;  1JF0 A;  1G8I A;  4QJ4 B;  5I2O A;  3KHE A;  3EK7 A;  4ORB B;  5I8N A;  2L4H A;  3BQ3 A;  3SG5 A;  1YR5 A;  1WY9 A;  1RJV A;  1DTL A;  4YGE B;  4DIR A;  4YRU A;  1IQ5 A;  1C7V A;  3LLE A;  3PN7 C;  4OVN F;  4M2P A;  1N0Y A;  2EHB A;  3NSO A;  2MJW B;  1SYM A;  1EXR A;  1LKJ A;  4NDC A;  1F55 A;  3FWC A;  2QAC A;  4AQJ A;  2LM5 A;  2LMV A;  4PE0 A;  1SCM C;  2LNK A;  2MA2 A;  4R1E A;  4DCK A;  1MXE A;  1NWD A;  1KFX L;  1J7O A;  3EVU A;  3PM8 A;  3CR5 X;  2E6W A;  2KAY A;  2JNX A;  3CLN A;  1KK8 C;  1CLL A;  1TNQ A;  1NYA A;  2GV5 A;  2LV7 A;  4AOM A;  4HSZ A;  1RFJ A;  1A29 A;  2BCX A;  2KNE A;  2M8U A;  3O6B A;  4OV2 A;  1DVI A;  4GNK B;  4MLW A;  3O2P A;  4C0L A;  2COL B;  3GOF A;  5PAL A;  2ZRS A;  1XFX O;  1AHR A;  3JTD C;  2GGZ A;  2KYC A;  3I5G B;  1K96 A;  1BJF A;  5HLO A;  3VRO A;  4MZK A;  1S6I A;  2OS8 C;  3OB1 B;  2K7O A;  1QX2 A;  1FI6 A;  1AJ5 A;  2JT8 A;  2L50 A;  2JTZ A;  3SG4 A;  3OP0 A;  1QVI Z;  3M0W A;  4PE1 A;  2JQ6 A;  4FQO A;  1J7Q A;  4CID A;  5AFP A;  1CM4 A;  2FJU B;  1SCV A;  1PK0 D;  1XYD A;  3BUW B;  5HYD A;  1SPY A;  3TDU A;  1K94 A;  4PCW A;  2H61 C;  3TS5 B;  2GGM A;  2LMT A;  2WC8 A;  2Y1M A;  3PN7 B;  4MN0 A;  1D1O A;  1XFU O;  1BMO A;  3KO0 A;  2LVV A;  2LUX A;  1Y1A A;  3SG7 A;  2CBL A;  1BOC A;  3DVK A;  1SL9 A;  2OTG C;  3IQO A;  1UP5 A;  4YGD B;  1GGW A;  1V1G A;  1EJ3 A;  1JF2 A;  1B8L A;  1K9U A;  4OKH A;  1SCM B;  2KSP A;  5D7F A;  1LIN A;  3O78 A;  1CMG A;  1YTZ C;  1S5G Z;  4WQ2 A;  2Y1N A;  2WCE A;  3H4S E;  1AK8 A;  4MSP A;  1WLZ A;  2KFH A;  5D69 A;  3ZNI A;  1UUS A;  2EC6 C;  1J7R A;  3MSE B;  3SG6 A;  1KK8 B;  5F6T A;  1A75 B;  1ZAC A;  2KI6 D;  1K93 D;  4DUQ A;  1XA5 A;  2ZN9 A;  3JTD B;  2G9B A;  2Q91 A;  5G08 A;  1JFK A;  3C1V A;  1QJT A;  4GFT A;  1OMD A;  2PAS A;  1HQV A;  1JBA A;  3QRX A;  5K89 A;  1YX7 A;  1K8U A;  1IG5 A;  4JWQ A;  1CFP A;  1N65 A;  2KAX A;  1QVI Y;  1SRA A;  1IJ5 A;  5GQQ C;  2M7L A;  1EL4 A;  2I7A A;  1N2D A;  1NP8 A;  1F4Q A;  4PE4 A;  5I2Q A;  3AAJ A;  2JPT A;  3IF7 A;  3SG3 A;  2JOJ A;  4HRE E;  2A4J A;  1DJX A;  1LA3 A;  3WNX B;  3I5G C;  1PVB A;  1TNX A;  1U5I A;  1B7T Y;  2L2E A;  2KAV A;  2LP2 A;  2LUC A;  1CDN A;  2OTG B;  5CSF A;  1YUU A;  1CMF A;  1SR6 B;  2MLE C;  1DMO A;  2JT0 A;  1IWQ A;  5KSZ A;  4L9M A;  1XFY O;  1J1D A;  1TNW A;  1IJ6 A;  2ZKM X;  1PSR A;  3KEV A;  1S5G Y;  1JFJ A;  1XFZ O;  1OE9 B;  1RWY A;  3PSR A;  1YUT A;  4ORC B;  2EC6 B;  2D8N A;  3WHT B;  3BYA A;  1ALW A;  1XFW O;  5CSJ A;  4OCI A;  1DJH A;  3TS5 C;  1VRK A;  2MRD A;  1FI5 A;  2JWW A;  1QLK A;  4C0J A;  4NDB A;  2K0J A;  1H8B A;  4A4B A;  1DJW A;  1G33 A;  4CFR A;  1J1E A;  1SKT A;  2PAL A;  1DJY A;  2JXC A;  2PVB A;  4QJ5 B;  2CNP A;  1L7Z A;  5J3X A;  3HCM A;  1IRJ A;  1SW8 A;  2SCP A;  2M29 A;  3PAT A;  2LP3 A;  2K2A A;  3LCP C;  2BKI B;  4U8D A;  1M63 B;  1OSA A;  1S36 A;  2KFG A;  3EVR A;  1K9P A;  1SL8 A;  2MBX A;  1K2H A;  2L5X B;  4C0K A;  3I5I C;  2JRF A;  1ZUZ A;  3DD4 A;  4NQG A;  2LAP A;  2O60 A;  4QJ3 B;  1LA0 A;  1OMV A;  2M1K B;  1M31 A;  5DKR A;  1JWD A;  1CM1 A;  3SJS A;  3LK1 A;  1PUL A;  1WRK A;  1J7P A;  1AJ4 A;  2NZ0 A;  3VGO A;  2G2B A;  1KFU S;  4MVF A;  2LLS A;  4MRX A;  1Y1X A;  4I5N B;  1NX0 A;  5CSN A;  2M7N A;  4MZJ A;  1C07 A;  4Q04 A;  5AER A;  1Y6W A;  2JTT A;  3AKA A;  3AKB A;  1M39 A;  4ETO A;  2CCM A;  2HF5 A;  3HX4 A;  1EH2 A;  3CS1 A;  2WND A;  1YVH A;  1QV0 A;  1A2X A;  2I18 A;  3BUM B;  3D10 A;  1CLM A;  1TN4 A;  2B1U A;  1FPW A;  1QXP A;  1CDL A;  1NSH A;  2JXL A;  2KQY A;  1BOD A;  2LHI A;  2K7D A;  2F2O A;  1WDC B;  1YUR A;  2I94 A;  1KK7 Z;  1NX3 A;  5DKQ A;  3SIB A;  2AUC A;  1B7T Z;  4I5J A;  1PAL A;  1TRF A;  1AVS A;  3I5F B;  2K2F A;  1KCY A;  2ISD A;  2JT3 A;  1SR6 C;  2CTN A;  2F2P A;  2KBM A;  2K61 A;  2Y5I A;  4FTG A;  3BXK A;  4M2O A;  3AAK A;  2F8P A;  3E3R A;  3SIA A;  1XK4 A;  1MR8 A;  2QPT A;  2VRG A;  5KTY A;  1H4B A;  1QS7 A;  2JU0 A;  4AQI A;  1U5I B;  1B9A A;  3I5I B;  4P2Y B;  4BY5 A;  2JC2 A;  4I5K A;  5TNC A;  4TNC A;  2BKH B;  1BR1 B;  1RK9 A;  3K21 A;  3EKH A;  4M2Q A;  5IBW A;  3SG2 A;  1TNP A;  1BF5 A;  4PHK A;  1R6P A;  3ZWH A;  2FCE A;  5ER5 A;  1UUR A;  1S3P A;  1DF0 A;  2L0P A;  4HRH A;  3CWG A;  4N1F A;  1QV1 A;  4ZCU A;  3A8R A;  5AAN A;  3NSK A;  1DJZ A;  2BCB A;  1QAT A;  4UPG A;  1K95 A;  1CKK A;  2JUL A;  4YGC B;  1BU3 A;  2FCD A;  5JJG A;  3TUY C;  1DJG A;  1KSM A;  1QAS A;  3OX5 A;  2K7B A;  4PHM A;  1PSB A;  4JPZ B;  1S6J A;  2BBN A;  2M97 A;  1OQP A;  2AAO A;  3DF0 A;  1JC2 A;  2LCP A;  4XYN A;  1KQM B;  4YGB B;  4YGA A;  4XJK A;  1YRU B;  1SY9 A;  1KK7 Y;  2KHN A;  2LMU A;  3DVJ A;  1DT7 B;  4YI8 A;  2PSR A;  3FS7 A;  2E30 A;  5HLV A;  2OPO A;  2BCA A;  1TTX A;  2FOT A;  1BR4 B;  2ZNE A;  3ICB A;  4GBA A;  4P5O E;  1PVA A;  1QIW A;  1XO5 A;  4N5X A;  4GPL B;  1SK6 D;  4MEW A;  1Q80 A;  2F3Z A;  3OX6 A;  2WOR A;  1YRT B;  4N1G A;  1F4O A;  2KI4 C;  1UWO A;  3BUO B;  2BEC A;  3CTN A;  4IL1 A;  2KQ6 A;  1X02 A;  1TCF A;  3F45 A;  3TDZ A;  1KFU L;  1OMR A;  3CGA A;  2HQW A;  4PE7 A;  4PAL A;  1IKU A;  1F70 A;  1WDC C;  1BLQ A;  1AUI B;  2M1U A;  5JOL A;  1IQ3 A;  1B4C A;  1ZMZ A;  1ZOT B;  1DGU A;  3EKJ A;  3PLF B;  4DS7 A;  1CFD A;  1KSO A;  2SAS A;  3I5F C;  1S6C A;  4NDD A;  3BUN B;  1GJY A;  4GAO A;  1Y0V H;  2HQ8 A;  2ZRT A;  3OB2 B;  5ER4 X;  1KWO C;  4BY4 A;  1KQV A;  1UHH A;  1YUS A;  1E8A A;  3TUY B;  1K9K A;  1B1G A;  1BG1 A;  2MHH A;  4D1E A;  3BOW A;  2KI6 C;  3D0Y A;  2NCO A;  5AXI A;  1QIV A;  1NCZ A;  3WXA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...