4UPGA

X-ray structure of calcium-free human sorcin
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
169
structure length
169
Chain Sequence
QTQDPLYGYFAAVAGQDGQIDADELQRCLTQSGIAGGYKPFNLETCRLMVSMLDRDMSGTMGFNEFKELWAVLNGWRQHFISFDTDRSGTVDPQELQKALTTMGFRLSPQAVNSIAKRYSTNGKITFDDYIACCVKLRALTDSFRRRDTAQQGVVNFPYDDFIQCVMSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords SORCIN
publication title Structural Basis of Sorcin-Mediated Calcium-Dependent Signal Transduction.
pubmed doi rcsb
source organism Homo sapiens
total genus 59
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 2014-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13405 EF-hand_6 EF-hand domain
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4upgA00
4PHNA 3WHTB 5B8IB 2JOJA 2BBNA 1XFVO 2MRDA 3OX6A 2E30A 2Y5IA 1E8AA 2CTNA 4MZJA 4PE0A 1EH2A 4PHMA 1B7TZ 4A4BA 5F6TA 1Y0VH 3TDZA 1LA3A 5HKWA 2K7DA 1UHHA 3WNXB 4ICBA 2AAOA 2MLFC 3PALA 1BOCA 1G33A 1ODBA 2LVKA 3JVTC 1CLBA 1DMOA 2HETA 1GJYA 1WDCB 4OCIA 4MRYA 1S36A 3DVEA 1SK6D 1H8BA 1UUSA 3JTDB 4YGBB 2BCBA 5DKQA 1EG4A 1KQMB 3AKBA 1U5IB 3BYAA 2EC6B 2LP2A 3D0YB 4ORAB 3EVRA 3WXAA 2JULA 1SCMC 1DTLA 1L2OC 3CGAA 2JTZA 1K9UA 4N1GA 1B1GA 4HSZA 1OE9B 1UP5A 1BJFA 1IGVA 1NX2A 2CBLA 3IF7A 1SW8A 3BUOB 2GGZA 1CDLA 1K94A 2NZ0A 2LCPA 2P6BB 2JT3A 2BKHB 1BLQA 1QX2A 3DVJA 2LUXA 5AANA 1AP4A 4GGFC 2I18A 2LV7A 1KK8C 2KGBC 1J7PA 1PK0D 2Y1MA 4P2YB 2KHNA 1B47A 1C07A 1QJTA 3EK8A 1CDPA 1ALVA 2M8UA 3IQOA 1F4QA 3C1VA 3TZ1A 2M9GA 5DKRA 1Y1AA 4I5LB 2K0JA 2WCEA 4MZLA 1LA0A 2PSRA 2BKIB 1XFUO 1EG3A 1ZUZA 2H2KA 2M1KB 3H4SE 1N0YA 2HQ8A 1CDMA 1PALA 2JQ6A 4XJKB 1SMGA 2EHBA 1ZACA 3DF0B 4M2OA 2KI6C 4M2QA 2I2RE 1OSAA 2L5XB 3O2PA 3GK4X 2ISDA 1RFJA 1NX3A 2GGMA 4PHKA 2K2FA 2L51A 1TIZA 2JNXA 2BE4A 2QACA 4NQGA 4OR9B 2CXJA 3OHMB 3O78A 3FIAA 4YGAA 4MN0A 2WC8A 3BOWB 5I8NA 2NCPA 1R6PA 1V1FA 2O60A 3O6BA 5IBWA 4UPGA 4YRUA 1A4PA 2KSPA 1YUTA 2KAYA 2JZIA 4TNCA 1S5GZ 3LLEA 2L98A 1JC2A 1PULA 4C0JA 2M29A 1S6JA 1J55A 2VRGA 2LLSA 2V53A 3LK1A 3M0WA 5I2QA 1A75B 2KQ6A 1QS7A 3TDUA 3KF9A 2WOSA 2CT9A 2LVJA 1OZOA 3EK7A 4M2PA 5CSNA 5BPJA 1MXLC 3EVUA 3OX5A 2M1UA 1J7OA 2NXQA 2ZNDA 2OS8B 1QASA 4E68A 1CNPA 4NDDA 3CTNA 4ETOA 5HKYA 1DGVA 3NSLA 1IG5A 2L4IA 2M97A 3DVMA 3CZTX 4C0LA 1KK7Y 3KEVA 3MSEB 1DJGA 3SG3A 1IJ6A 2M3WA 1LKJA 3CWGA 1KFUS 4FQOA 1UWOA 2MHHA 4OV2A 3D0YA 3FWCA 1SL9A 1M63B 3I5GC 3LL8B 1BR4B 1M46A 2LUCA 4PHJA 2WCBA 3AAJA 2IS9A 2CNPA 4PCWA 2KOTA 4PDZA 4CIDA 1S1EA 1UHNA 2Y1NA 3I5HB 1SNLA 1OMVA 2I7AA 1DJWA 3ICBA 1XA5A 1DJZA 4JPZB 1SYMA 1IQ3A 2JNFA 1YVLA 1G4YR 2KYFA 5KTYA 2HF5A 1NPQA 4MEWA 3VROA 1L2OB 4C0KA 2OTGB 2KNEA 1YUUA 3SIAA 5CSIA 1AHRA 2GV5A 2PRUA 3IQQA 4N5XA 3SG7A 4BY5A 4YI8A 1K95A 1PSRA 3I5IC 2LC5A 1KCYA 2EGDA 3PN7B 4HRHA 1KSOA 3AKAA 4HRGA 2F2OA 1K96A 1RK9A 2I94A 1K2HA 5FYXA 1JSAA 2LMUA 2WORA 1Y1XA 1YTZC 1DF0B 1TNQA 4I5NB 1WRZA 4DUQA 1QVIY 2KBMA 3PATA 2KFFA 4GFTA 2K7OA 3OB2B 4XJKA 3DF0A 1IQ5A 2BL0B 1QX5B 3LCPC 1CFPA 1RWYA 2MJWB 2MAZA 1HQVA 3EKHA 1SBJA 3CLNA 2KGRA 2K7BA 1OQPA 4JQ0D 2KBIA 3KHEA 2B1UA 1YRUB 1TNXA 2KI4B 4D1EA 1CB1A 1MF8B 3OB1B 5AERA 1NCYA 3PSRA 1B4CA 1JF0A 2ZFDA 1R2UA 2JRFA 1QVIZ 2L2EA 2M7NA 1XVJA 5JJGA 3BOWA 3JTDC 2D8NA 1F4OA 2EC6C 3FWBA 1F70A 4MRXA 1CM1A 2M0RA 1RTP1 1SL8A 1W7JB 3I5FB 1N65A 2FJUB 1WRLA 3SJSA 1MWNA 1G8IA 1CLMA 1LINA 1EL4A 3NSKA 3ZWHA 5AXIA 1Y1UA 2LM5A 2MBXA 4Q04A 2TN4A 3BXKA 3ZNIA 1Y6WA 1NCXA 1A75A 2RGIA 4AQIA 5I2LA 2SCPA 2M7LA 1ALWA 4CLNA 4DIRA 5I2OA 3TS5C 1KFXL 1S6IA 2KQYA 2BE6A 2O5GA 4U8DA 1WLZA 5AFPA 2LHLA 1YURA 1K9PA 5KSZA 1JFJA 1B9AA 4MVFA 3DD4A 1CLLA 1YX8A 2ZNEA 3E3RA 3RLZA 4CFRA 1SR6C 4QJ5B 4AOMA 3CR4X 4GPLB 4YGDB 2JTTA 5HYDA 2KAVA 1QV1A 5JOLA 4N1FA 1F54A 1XK4A 1QIWA 2JXLA 5PALA 2ZN9A 4WRIA 1YVHA 2COLB 3BUMB 1L7ZA 1WLMA 2LLTA 1H4BA 1KWOC 1B8LA 2LP3A 1MQ1A 1QX7A 4YBHB 4AQJA 4ORBB 2JU0A 3QRXA 4BY4A 2K2AA 5D69A 1A03A 1NX0A 1MR8A 1TCOB 2L50A 1QV0A 4YGCB 3D10A 1NWDA 1B8CA 1J7RA 1MHOA 1FI5A 1XFXO 4R1EA 4GNKB 3PM8A 4ZCUA 3PLFB 3VRPA 4ORCB 1JUOA 2DOQA 2JC2A 1PVBA 4GAOA 3NSOA 1NIWA 1CMFA 1K93D 1QIVA 3CR5X 2FOTA 1SL7A 2K61A 2ZRSA 1U5IA 3TUYC 2Y4QA 3JVTB 1F8HA 1LXFC 1DJHA 1VRKA 1S6CA 1DF0A 1CM4A 1DJXA 1OMRA 2Q91A 3OP0A 1IJ5A 1KK7Z 1SCVA 1BMOA 1XFZO 2H61A 4IL1A 2L4HA 1DJIA 1A2XA 1KSMA 2PVBA 2OS8C 1SCMB 3KPXA 1IH0A 2Q4UA 1AJ5A 2G9BA 4PALA 1GGZA 4I5KA 3VRNA 2E6WA 1CMGA 3NXAA 2K7CA 2HQWA 2LMTA 2BECA 5CSFA 1KFXS 2JT0A 3HX4A 3BQ3A 4DRWA 1K9KA 1D1OA 1V1GA 2JWWA 1XK4C 2BCAA 1MXEA 5HLOA 1KQVA 1UHIA 3GK2A 4PE4A 1AK8A 2M49B 2ZKMX 3EK4A 5ER5A 1KK8B 3SG5A 5DKNA 1ZOTB 5G08A 3SG2A 2FCDA 1LVCD 2KDHA 3DVKA 1CFCA 1ZFSA 1NX1A 4I5JA 2G2BA 3EVVA 2QPTA 1ZMZA 2ZN8A 2BBMA 1JF2A 2AUCA 3LK0A 1TNWA 1JFKA 1X02A 3I5HC 4GUKA 3SG4A 2ZRTA 2F33A 1BR1B 4CFQA 2NCOA 4QJ4B 4USLA 4OKHA 4GGNA 5J3XA 1AVSA 1WY9A 1TNPA 2OTGC 5D7FA 1NSHA 1IRJA 5CSJA 1WDCC 2KYCA 3CR2A 5HLVA 2LVVA 2PASA 1B8RA 2MLEC 1TCFA 3VGOA 1DGUA 1SY9A 1F55A 3BUNB 1CDNA 1PVAA 2CCMA 3HCMA 4A4CA 1KQMC 3PN7C 1IKUA 2R2IA 3VRRA 3FS7A 5KU1A 1BODA 1FW4A 1M45A 1DJYA 1UHJA 1GQMA 1OMDA 1F71A 3TS5B 4L9MA 1J1DA 2WCFA 1DVIA 1EXRA 3TDIA 4MLWA 2F3ZA 4MSPA 4XYNA 1QLSA 3F45A 2H61C 1XYDA 3K21A 2NLNA 1TN4A 4YGEB 3GOFA 1YR5A 3BUXB 5CPVA 1PSBA 1KFUL 1SR6B 1JWDA 2BL0C 4NDCA 3EKJA 1M39A 3PFVA 2KI4C 1FF1A 3SG6A 2A4JA 1A29A 2LE9B 1KWOB 1SPYA 1CFFA 2KFHA 3WHUB 1QXPA 2LLUA 4PE1A 4YI9A 2JPTA 3RM1A 1BF5A 2KAXA 1FPWA 2HPSA 3BUWB 1WRKA 3KO0A 3GK1A 4DS7A 1YUSA 1S5GY 1RJVA 1K90D 1DT7B 5TNCA 1XFWO 1BU3A 1J1EA 1S3PA 3CS1A 1YRTB 2AMIA 1JBAA 1N2DA 1FBVA 1S26D 3I5FC 3NSIA 1QLKA 1CFDA 1OZSA 5AEQA 4NDBA 2WNDA 2KFGA 2OPOA 1RECA 3A8RA 5K89A 2FCEA 1M31A 1XFYO 1XO5A 1Q80A 4HREE 1UHKA 3AAKA 2F8PA 1NYAA 2L0PA 4OVNF 2JT8A 1BG1A 3TUYB 1AJ4A 5ER4X 2LHIA 2PALA 3I5GB 1FI6A 1QATA 4DCKA 2PMYA 1QTXA 4MZKA 1UURA 2F3YA 3A4UB 4WQ2A 1CKKA 4WQ3A 1HT9A 4P5OE 4PE7A 1C7VA 1W7IB 5HKZA 4F0ZB 1GGWA 2LNKA 1NP8A 2BCXA 1RROA 2LVIA 1EJ3A 2F2PA 3SIBA 1K8UA 1AUIB 2KI6D 4ZCVA 2LANA 1TRFA 4JWQA 1NUBA 2K8MB 2JXCA 2SASA 1TTXA 4GGFA 1BT6A 2LAPA 3I5IB 4CPVA 1OOJA 1B7TY 4GBAA 1YX7A 1PRWA 1TOPA 1IWQA 1J7QA 1SKTA 1CTRA 1MUXA 1SRAA 4FTGA 1NCZA 3VRQA 4MBEA 3O4YA 4QJ3B 1C7WA 5GQQC 2LMVA 2MA2A
chains in the Genus database with same CATH superfamily
4PHNA 3WHTB 5B8IB 3PM2A 2JOJA 1XFRA 2BBNA 1XFVO 2MRDA 3OX6A 2E30A 2Y5IA 1E8AA 2CTNA 1OOHA 4MZJA 3DZTA 4PE0A 1EH2A 4PHMA 1B7TZ 4A4BA 1W9ZA 5F6TA 1Y0VH 3TDZA 1LA3A 5HKWA 2K7DA 4OZDA 1UHHA 3EG5B 2QEHA 3SS5A 3WNXB 1OOIX 4ICBA 2AAOA 2MLFC 3PALA 1BOCA 1G33A 1ODBA 2LVKA 3JVTC 1CLBA 1DMOA 2HETA 1GJYA 1WDCB 4OCIA 4MRYA 1S36A 3DVEA 3S0FA 1SK6D 1H8BA 1UUSA 3JTDB 2QDIA 4YGBB 2BCBA 5DKQA 1EG4A 1KQMB 3AKBA 1U5IB 3BYAA 2EC6B 2LP2A 3D0YB 4ORAB 3EVRA 3WXAA 2JULA 3NHIA 3FE8A 1SCMC 1DTLA 1L2OC 3CGAA 2JTZA 1K9UA 4N1GA 2QEOA 1B1GA 4HSZA 1OE9B 1UP5A 1BJFA 1IGVA 1NX2A 2CBLA 3IF7A 1SW8A 3BUOB 2YGUA 2GGZA 1CDLA 1K94A 2NZ0A 2LCPA 2P6BB 3CDNA 3CZ0A 2JT3A 1QWVA 2BKHB 3L47A 1BLQA 4F7FA 1QX2A 2FJYA 3NHTA 3DVJA 2LUXA 3FE9A 5AANA 1AP4A 4GGFC 2I18A 2LV7A 1KK8C 3V2LA 2KGBC 1J7PA 1PK0D 2Y1MA 4P2YB 2KHNA 1B47A 1C07A 1QJTA 3EK8A 1CDPA 1ALVA 2M8UA 3IQOA 1F4QA 3C1VA 3TZ1A 2M9GA 5DKRA 1Y1AA 4I5LB 2BAPA 5FI2A 3BFAA 2K0JA 2WCEA 4MZLA 1LA0A 1IIOA 2PSRA 1XFUO 1ZUZA 1EG3A 2BKIB 2H2KA 2M1KB 3H4SE 1N0YA 2L2CA 2HQ8A 1CDMA 1PALA 2JQ6A 3BFHA 1SMGA 2EHBA 1ZACA 3DF0B 4M2OA 2KI6C 4M2QA 2I2RE 1OSAA 2L5XB 3O2PA 3GK4X 2ISDA 1RFJA 1NX3A 2GGMA 4PHKA 2K2FA 2L51A 1TIZA 2JNXA 2BE4A 2QACA 4NQGA 4OR9B 2CXJA 3OHMB 5I94A 3O78A 3FIAA 1OOGA 4YGAA 4MN0A 1TUJA 2WC8A 3BOWB 5I8NA 2NCPA 1R6PA 1V1FA 2O60A 3O6BA 5IBWA 4UPGA 4YRUA 1A4PA 2KSPA 1YUTA 2KAYA 2JZIA 4TNCA 1S5GZ 2KLEA 3LLEA 2L98A 1JC2A 1PULA 4C0JA 2M29A 1S6JA 1J55A 2VRGA 2LLSA 2V53A 3LK1A 3M0WA 5I2QA 1A75B 2KQ6A 1QS7A 3TDUA 3KF9A 3OBVA 2WOSA 2CT9A 2LVJA 1OZOA 3EK7A 4M2PA 5CSNA 5BPJA 1MXLC 3EVUA 3D78A 3OX5A 2M1UA 1J7OA 3CZ2A 2NXQA 2ZNDA 2OS8B 1QASA 4E68A 3IVTA 1CNPA 4NDDA 3CTNA 4ETOA 5HKYA 1DGVA 3NSLA 1IG5A 2L4IA 2M97A 3DVMA 3CZTX 4C0LA 1KK7Y 1OW4A 3KEVA 3MSEB 1DQEA 1DJGA 3SG3A 1IJ6A 2M3WA 1LKJA 3B86A 3CWGA 1KFUS 4FQOA 1UWOA 2MHHA 2P70A 4OV2A 3D0YA 3FWCA 1SL9A 1M63B 2KPHA 3PJIA 3I5GC 3LL8B 1BR4B 1M46A 2LUCA 4PHJA 2WCBA 3AAJA 2IS9A 2CNPA 4PCWA 2KOTA 4PDZA 4CIDA 3B6XA 3K1EA 4JKTA 1S1EA 1UHNA 2Y1NA 3I5HB 1SNLA 1OMVA 2I7AA 1DJWA 3ICBA 1XA5A 1DJZA 4JPZB 1SYMA 3D73A 1IQ3A 2JNFA 1YVLA 4XJKB 1G4YR 2KYFA 2WC6A 2HF5A 1NPQA 4MEWA 3VROA 1L2OB 3Q8IA 4C0KA 2OTGB 2KNEA 1YUUA 1Z4HA 3SIAA 1GM0A 5CSIA 1AHRA 2GV5A 2PRUA 3IQQA 4N5XA 3SG7A 4BY5A 4YI8A 1K95A 5FI7A 1PSRA 3I5IC 2LC5A 1KCYA 2EGDA 3S0BA 2PYQA 3PN7B 4HRHA 1KSOA 3AKAA 4HRGA 2F2OA 1K96A 1RK9A 2I94A 1K2HA 5FYXA 1JSAA 2LMUA 2WORA 1Y1XA 1YTZC 1DF0B 1TNQA 4I5NB 1WRZA 4DUQA 3R1VA 3L4AA 1QVIY 2KBMA 3PATA 2KFFA 2WCHA 4GFTA 2K7OA 3OB2B 4XJKA 3DF0A 1IQ5A 2BL0B 1QX5B 3LCPC 1CFPA 1RWYA 2MJWB 2MAZA 1HQVA 3EKHA 1SBJA 3CLNA 2KGRA 2K7BA 1OQPA 4JQ0D 1Z2CB 3B87A 2KBIA 3KHEA 2B1UA 1YRUB 1TNXA 3DXLA 2KI4B 4D1EA 1CB1A 1MF8B 3OB1B 5AERA 1NCYA 3PSRA 1B4CA 1JF0A 2ZFDA 1R2UA 2JRFA 1QVIZ 3R1OA 2L2EA 2M7NA 1XVJA 5JJGA 3BOWA 3JTDC 2D8NA 1F4OA 2EC6C 3FWBA 1F70A 4MRXA 1CM1A 2M0RA 1RTP1 1SL8A 1W7JB 3I5FB 1N65A 2FJUB 1WRLA 3SJSA 1MWNA 1G8IA 1CLMA 1LINA 1EL4A 3NSKA 3ZWHA 1TUZA 5AXIA 1Y1UA 3N7HA 2LM5A 1DC1A 2MBXA 4Q04A 2TN4A 3BXKA 3ZNIA 1Y6WA 1NCXA 1A75A 2QEBA 2RGIA 5I2LA 2SCPA 2M7LA 4AQIA 1ALWA 4CLNA 4DIRA 5I2OA 3TS5C 3VB1A 1KFXL 1S6IA 2KQYA 2BE6A 2O5GA 4U8DA 1WLZA 2GTEA 2WC5A 5AFPA 3R1PA 2LHLA 1YURA 1K9PA 5KSZA 1JFJA 3DY9A 1B9AA 4MVFA 4JD9A 3DD4A 1CLLA 1YX8A 2ZNEA 3E3RA 3RLZA 4CFRA 1SR6C 4QJ5B 4AOMA 3CR4X 4GPLB 4YGDB 2JTTA 5HYDA 2KAVA 1QV1A 5JOLA 5KTYA 4N1FA 1F54A 1XK4A 1QIWA 2JXLA 5PALA 2ZN9A 3L4LA 1YVHA 4WRIA 2COLB 1C3YA 3BUMB 1L7ZA 1WLMA 2LLTA 1H4BA 1KWOC 1B8LA 1LS8A 2LP3A 1MQ1A 1QX7A 4YBHB 4AQJA 4ORBB 2JU0A 3QRXA 4BY4A 2K2AA 5D69A 1A03A 1NX0A 1MR8A 1TCOB 2L50A 1QV0A 4YGCB 1DELA 3D10A 1NWDA 1B8CA 4INWA 1J7RA 1MHOA 1FI5A 1XFXO 4R1EA 4GNKB 2PQLA 3PM8A 4ZCUA 3PLFB 3VRPA 4ORCB 1JUOA 2DOQA 2WCKA 2JC2A 1PVBA 4GAOA 3NSOA 1NIWA 1CMFA 1K93D 1QIVA 3CR5X 2FOTA 1SL7A 2K61A 2ZRSA 1U5IA 3TUYC 2Y4QA 3D74A 3JVTB 2WCMA 1F8HA 1LXFC 3SS4A 1DJHA 1VRKA 1S6CA 1DF0A 1CM4A 1DJXA 1OMRA 2Q91A 3OP0A 1IJ5A 1KK7Z 1SCVA 1BMOA 1XFZO 2H61A 4IL1A 3S0EA 2L4HA 1DJIA 1A2XA 1KSMA 2PVBA 3CZ1A 2OS8C 1SCMB 3KPXA 3O4XA 1IH0A 2Q4UA 1AJ5A 3CYZA 2G9BA 4PALA 1GGZA 2QEVA 4I5KA 3VRNA 2E6WA 1CMGA 3NXAA 3B7AA 2K7CA 3FE6A 2HQWA 2LMTA 2BECA 5CSFA 1KFXS 2JT0A 2WCJA 3BQ3A 3HX4A 4DRWA 1K9KA 1D1OA 1V1GA 2JWWA 1XK4C 2BCAA 1C3ZA 1MXEA 5HLOA 1KQVA 1UHIA 3GK2A 4PE4A 3S0AA 1AK8A 5HL1A 2M49B 2ZKMX 3EK4A 5ER5A 1KK8B 3S0GA 5DKNA 3SG5A 1ZOTB 3UNWA 5G08A 3SG2A 2FCDA 1LVCD 2KDHA 3DVKA 1CFCA 1ZFSA 1NX1A 4I5JA 2G2BA 3EVVA 2QPTA 1ZMZA 2ZN8A 3BJHA 4INXA 2BBMA 2BNXA 1JF2A 2AUCA 3LK0A 3SS3A 1TNWA 1JFKA 1X02A 2KLDA 3I5HC 5D3OA 4GUKA 3SG4A 2ZRTA 2F33A 1BR1B 4CFQA 2NCOA 4QJ4B 2K60A 4OKHA 4USLA 4GGNA 5J3XA 1AVSA 1DEKA 3NGVA 1WY9A 1TNPA 2OTGC 5D7FA 1NSHA 1IRJA 3B88A 5CSJA 1WDCC 2H8VA 2KYCA 3CR2A 5HLVA 2LVVA 2PASA 1B8RA 2MLEC 1TCFA 3VGOA 1DGUA 1SY9A 1F55A 3BUNB 1CDNA 3D76A 1PVAA 2CCMA 3HCMA 4A4CA 1KQMC 3PN7C 1IKUA 2R2IA 3VRRA 3FS7A 5KU1A 1BODA 1FW4A 1M45A 1DJYA 1UHJA 1GQMA 1OMDA 1F71A 3TS5B 5DICA 3RZSA 4L9MA 1J1DA 2WCFA 4IJ7A 1DVIA 1EXRA 3TDIA 4MLWA 2F3ZA 4MSPA 5EL2A 4XYNA 1QLSA 3F45A 2WCLA 2H61C 1XYDA 3K21A 2NLNA 1TN4A 4YGEB 3GOFA 2JPOA 1YR5A 3BUXB 5CPVA 1PSBA 1KFUL 1SR6B 1JWDA 2BL0C 4NDCA 1ORGA 5FI6A 3EKJA 1M39A 3PFVA 3UO9A 2KI4C 1FF1A 3SG6A 2A4JA 1A29A 2LE9B 1KWOB 1SPYA 1CFFA 2KFHA 3WHUB 1QXPA 2LLUA 4PE1A 4YI9A 2JPTA 3RM1A 1BF5A 2KAXA 1FPWA 2HPSA 3BUWB 1WRKA 3KO0A 3GK1A 4DS7A 1YUSA 1S5GY 1RJVA 1K90D 1DT7B 5TNCA 1XFWO 1BU3A 1J1EA 1S3PA 1T14A 3OGNA 3CS1A 1YRTB 2AMIA 1JBAA 3R72A 1N2DA 3D77A 1FBVA 1S26D 3I5FC 3NSIA 1QLKA 1CFDA 1OZSA 5AEQA 3D75A 4NDBA 1OOFA 2WNDA 2KFGA 2OPOA 1RECA 3A8RA 5K89A 2FCEA 1M31A 1XFYO 1XO5A 1Q80A 4HREE 1UHKA 1SSEB 3AAKA 2F8PA 1NYAA 3DYEA 2L0PA 4OVNF 2JT8A 1BG1A 3TUYB 1AJ4A 5ER4X 2LHIA 2PALA 3I5GB 1FI6A 1QATA 4DCKA 2PMYA 1QTXA 1P28A 4MZKA 1UURA 2F3YA 3A4UB 3BFBA 3QMEA 2P71A 4WQ2A 1CKKA 4WQ3A 1HT9A 4P5OE 4PE7A 1C7VA 1W7IB 5HKZA 4F0ZB 1GGWA 2LNKA 1NP8A 2L5YA 2BCXA 1RROA 2LVIA 1EJ3A 2F2PA 4FQTA 3SIBA 1K8UA 1AUIB 2KI6D 4ZCVA 2LANA 1TRFA 4JWQA 1NUBA 1TWOA 2JXCA 2K8MB 1TTXA 2SASA 4GGFA 1BT6A 2LAPA 3I5IB 4CPVA 1OOJA 1B7TY 4GBAA 1YX7A 1PRWA 1TOPA 1IWQA 1J7QA 1SKTA 1CTRA 1MUXA 1SRAA 4FTGA 2ERBA 3CABA 1NCZA 3VRQA 4MBEA 3S0DA 3O4YA 4PT1A 4QJ3B 1C7WA 4KYNA 5GQQC 2LMVA 2MA2A
chains in the Genus database with same CATH topology
4PHNA 3WHTB 5B8IB 2JOJA 2BBNA 1XFVO 2MRDA 3OX6A 2E30A 2Y5IA 1E8AA 2CTNA 4MZJA 4PE0A 1EH2A 4PHMA 1B7TZ 4A4BA 5F6TA 1Y0VH 3TDZA 1LA3A 5HKWA 2K7DA 1UHHA 3WNXB 4ICBA 2AAOA 2MLFC 3PALA 1BOCA 1G33A 1ODBA 2LVKA 3JVTC 1CLBA 1DMOA 2HETA 1GJYA 1WDCB 4OCIA 4MRYA 1S36A 3DVEA 1SK6D 1H8BA 1UUSA 3JTDB 4YGBB 2BCBA 5DKQA 1EG4A 1KQMB 3AKBA 1U5IB 3BYAA 2EC6B 2LP2A 3D0YB 4ORAB 3EVRA 3WXAA 2JULA 1SCMC 1DTLA 1L2OC 3CGAA 2JTZA 1K9UA 4N1GA 1B1GA 4HSZA 1OE9B 1UP5A 1BJFA 1IGVA 1NX2A 2CBLA 3IF7A 1SW8A 3BUOB 2GGZA 1CDLA 1K94A 2NZ0A 2LCPA 2P6BB 2JT3A 2BKHB 1BLQA 1QX2A 3DVJA 2LUXA 5AANA 1AP4A 4GGFC 2I18A 2LV7A 1KK8C 2KGBC 1J7PA 1PK0D 2Y1MA 4P2YB 2KHNA 1B47A 1C07A 1QJTA 3EK8A 1CDPA 1ALVA 2M8UA 3IQOA 1F4QA 3C1VA 3TZ1A 2M9GA 5DKRA 1Y1AA 4I5LB 2K0JA 2WCEA 4MZLA 1LA0A 2PSRA 2BKIB 1XFUO 1EG3A 1ZUZA 2H2KA 2M1KB 3H4SE 1N0YA 2HQ8A 1CDMA 1PALA 2JQ6A 4XJKB 1SMGA 2EHBA 1ZACA 3DF0B 4M2OA 2KI6C 4M2QA 2I2RE 1OSAA 2L5XB 3O2PA 3GK4X 2ISDA 1RFJA 1NX3A 2GGMA 4PHKA 2K2FA 2L51A 1TIZA 2JNXA 2BE4A 2QACA 4NQGA 4OR9B 2CXJA 3OHMB 3O78A 3FIAA 4YGAA 4MN0A 2WC8A 3BOWB 5I8NA 2NCPA 1R6PA 1V1FA 2O60A 3O6BA 5IBWA 4UPGA 4YRUA 1A4PA 2KSPA 1YUTA 2KAYA 2JZIA 4TNCA 1S5GZ 3LLEA 2L98A 1JC2A 1PULA 4C0JA 2M29A 1S6JA 1J55A 2VRGA 2LLSA 2V53A 3LK1A 3M0WA 5I2QA 1A75B 2KQ6A 1QS7A 3TDUA 3KF9A 2WOSA 2CT9A 2LVJA 1OZOA 3EK7A 4M2PA 5CSNA 5BPJA 1MXLC 3EVUA 3OX5A 2M1UA 1J7OA 2NXQA 2ZNDA 2OS8B 1QASA 4E68A 1CNPA 4NDDA 3CTNA 4ETOA 5HKYA 1DGVA 3NSLA 1IG5A 2L4IA 2M97A 3DVMA 3CZTX 4C0LA 1KK7Y 3KEVA 3MSEB 1DJGA 3SG3A 1IJ6A 2M3WA 1LKJA 3CWGA 1KFUS 4FQOA 1UWOA 2MHHA 4OV2A 3D0YA 3FWCA 1SL9A 1M63B 3I5GC 3LL8B 1BR4B 1M46A 2LUCA 4PHJA 2WCBA 3AAJA 2IS9A 2CNPA 4PCWA 2KOTA 4PDZA 4CIDA 1S1EA 1UHNA 2Y1NA 3I5HB 1SNLA 1OMVA 2I7AA 1DJWA 3ICBA 1XA5A 1DJZA 4JPZB 1SYMA 1IQ3A 2JNFA 1YVLA 1G4YR 2KYFA 5KTYA 2HF5A 1NPQA 4MEWA 3VROA 1L2OB 4C0KA 2OTGB 2KNEA 1YUUA 3SIAA 5CSIA 1AHRA 2GV5A 2PRUA 3IQQA 4N5XA 3SG7A 4BY5A 4YI8A 1K95A 1PSRA 3I5IC 2LC5A 1KCYA 2EGDA 3PN7B 4HRHA 1KSOA 3AKAA 4HRGA 2F2OA 1K96A 1RK9A 2I94A 1K2HA 5FYXA 1JSAA 2LMUA 2WORA 1Y1XA 1YTZC 1DF0B 1TNQA 4I5NB 1WRZA 4DUQA 1QVIY 2KBMA 3PATA 2KFFA 4GFTA 2K7OA 3OB2B 4XJKA 3DF0A 1IQ5A 2BL0B 1QX5B 3LCPC 1CFPA 1RWYA 2MJWB 2MAZA 1HQVA 3EKHA 1SBJA 3CLNA 2KGRA 2K7BA 1OQPA 4JQ0D 2KBIA 3KHEA 2B1UA 1YRUB 1TNXA 2KI4B 4D1EA 1CB1A 1MF8B 3OB1B 5AERA 1NCYA 3PSRA 1B4CA 1JF0A 2ZFDA 1R2UA 2JRFA 1QVIZ 2L2EA 2M7NA 1XVJA 5JJGA 3BOWA 3JTDC 2D8NA 1F4OA 2EC6C 3FWBA 1F70A 4MRXA 1CM1A 2M0RA 1RTP1 1SL8A 1W7JB 3I5FB 1N65A 2FJUB 1WRLA 3SJSA 1MWNA 1G8IA 1CLMA 1LINA 1EL4A 3NSKA 3ZWHA 5AXIA 1Y1UA 2LM5A 2MBXA 4Q04A 2TN4A 3BXKA 3ZNIA 1Y6WA 1NCXA 1A75A 2RGIA 4AQIA 5I2LA 2SCPA 2M7LA 1ALWA 4CLNA 4DIRA 5I2OA 3TS5C 1KFXL 1S6IA 2KQYA 2BE6A 2O5GA 4U8DA 1WLZA 5AFPA 2LHLA 1YURA 1K9PA 5KSZA 1JFJA 1B9AA 4MVFA 3DD4A 1CLLA 1YX8A 2ZNEA 3E3RA 3RLZA 4CFRA 1SR6C 4QJ5B 4AOMA 3CR4X 4GPLB 4YGDB 2JTTA 5HYDA 2KAVA 1QV1A 5JOLA 4N1FA 1F54A 1XK4A 1QIWA 2JXLA 5PALA 2ZN9A 4WRIA 1YVHA 2COLB 3BUMB 1L7ZA 1WLMA 2LLTA 1H4BA 1KWOC 1B8LA 2LP3A 1MQ1A 1QX7A 4YBHB 4AQJA 4ORBB 2JU0A 3QRXA 4BY4A 2K2AA 5D69A 1A03A 1NX0A 1MR8A 1TCOB 2L50A 1QV0A 4YGCB 3D10A 1NWDA 1B8CA 1J7RA 1MHOA 1FI5A 1XFXO 4R1EA 4GNKB 3PM8A 4ZCUA 3PLFB 3VRPA 4ORCB 1JUOA 2DOQA 2JC2A 1PVBA 4GAOA 3NSOA 1NIWA 1CMFA 1K93D 1QIVA 3CR5X 2FOTA 1SL7A 2K61A 2ZRSA 1U5IA 3TUYC 2Y4QA 3JVTB 1F8HA 1LXFC 1DJHA 1VRKA 1S6CA 1DF0A 1CM4A 1DJXA 1OMRA 2Q91A 3OP0A 1IJ5A 1KK7Z 1SCVA 1BMOA 1XFZO 2H61A 4IL1A 2L4HA 1DJIA 1A2XA 1KSMA 2PVBA 2OS8C 1SCMB 3KPXA 1IH0A 2Q4UA 1AJ5A 2G9BA 4PALA 1GGZA 4I5KA 3VRNA 2E6WA 1CMGA 3NXAA 2K7CA 2HQWA 2LMTA 2BECA 5CSFA 1KFXS 2JT0A 3HX4A 3BQ3A 4DRWA 1K9KA 1D1OA 1V1GA 2JWWA 1XK4C 2BCAA 1MXEA 5HLOA 1KQVA 1UHIA 3GK2A 4PE4A 1AK8A 2M49B 2ZKMX 3EK4A 5ER5A 1KK8B 3SG5A 5DKNA 1ZOTB 5G08A 3SG2A 2FCDA 1LVCD 2KDHA 3DVKA 1CFCA 1ZFSA 1NX1A 4I5JA 2G2BA 3EVVA 2QPTA 1ZMZA 2ZN8A 2BBMA 1JF2A 2AUCA 3LK0A 1TNWA 1JFKA 1X02A 3I5HC 4GUKA 3SG4A 2ZRTA 2F33A 1BR1B 4CFQA 2NCOA 4QJ4B 4USLA 4OKHA 4GGNA 5J3XA 1AVSA 1WY9A 1TNPA 2OTGC 5D7FA 1NSHA 1IRJA 5CSJA 1WDCC 2KYCA 3CR2A 5HLVA 2LVVA 2PASA 1B8RA 2MLEC 1TCFA 3VGOA 1DGUA 1SY9A 1F55A 3BUNB 1CDNA 1PVAA 2CCMA 3HCMA 4A4CA 1KQMC 3PN7C 1IKUA 2R2IA 3VRRA 3FS7A 5KU1A 1BODA 1FW4A 1M45A 1DJYA 1UHJA 1GQMA 1OMDA 1F71A 3TS5B 4L9MA 1J1DA 2WCFA 1DVIA 1EXRA 3TDIA 4MLWA 2F3ZA 4MSPA 4XYNA 1QLSA 3F45A 2H61C 1XYDA 3K21A 2NLNA 1TN4A 4YGEB 3GOFA 1YR5A 3BUXB 5CPVA 1PSBA 1KFUL 1SR6B 1JWDA 2BL0C 4NDCA 3EKJA 1M39A 3PFVA 2KI4C 1FF1A 3SG6A 2A4JA 1A29A 2LE9B 1KWOB 1SPYA 1CFFA 2KFHA 3WHUB 1QXPA 2LLUA 4PE1A 4YI9A 2JPTA 3RM1A 1BF5A 2KAXA 1FPWA 2HPSA 3BUWB 1WRKA 3KO0A 3GK1A 4DS7A 1YUSA 1S5GY 1RJVA 1K90D 1DT7B 5TNCA 1XFWO 1BU3A 1J1EA 1S3PA 3CS1A 1YRTB 2AMIA 1JBAA 1N2DA 1FBVA 1S26D 3I5FC 3NSIA 1QLKA 1CFDA 1OZSA 5AEQA 4NDBA 2WNDA 2KFGA 2OPOA 1RECA 3A8RA 5K89A 2FCEA 1M31A 1XFYO 1XO5A 1Q80A 4HREE 1UHKA 3AAKA 2F8PA 1NYAA 2L0PA 4OVNF 2JT8A 1BG1A 3TUYB 1AJ4A 5ER4X 2LHIA 2PALA 3I5GB 1FI6A 1QATA 4DCKA 2PMYA 1QTXA 4MZKA 1UURA 2F3YA 3A4UB 4WQ2A 1CKKA 4WQ3A 1HT9A 4P5OE 4PE7A 1C7VA 1W7IB 5HKZA 4F0ZB 1GGWA 2LNKA 1NP8A 2BCXA 1RROA 2LVIA 1EJ3A 2F2PA 3SIBA 1K8UA 1AUIB 2KI6D 4ZCVA 2LANA 1TRFA 4JWQA 1NUBA 2K8MB 2JXCA 2SASA 1TTXA 4GGFA 1BT6A 2LAPA 3I5IB 4CPVA 1OOJA 1B7TY 4GBAA 1YX7A 1PRWA 1TOPA 1IWQA 1J7QA 1SKTA 1CTRA 1MUXA 1SRAA 4FTGA 1NCZA 3VRQA 4MBEA 3O4YA 4QJ3B 1C7WA 5GQQC 2LMVA 2MA2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PHN A;  3WHT B;  5B8I B;  2JOJ A;  2BBN A;  1XFV O;  2MRD A;  3OX6 A;  2E30 A;  2Y5I A;  1E8A A;  2CTN A;  4MZJ A;  4PE0 A;  1EH2 A;  4PHM A;  1B7T Z;  4A4B A;  5F6T A;  1Y0V H;  3TDZ A;  1LA3 A;  5HKW A;  2K7D A;  1UHH A;  3WNX B;  4ICB A;  2AAO A;  2MLF C;  3PAL A;  1BOC A;  1G33 A;  1ODB A;  2LVK A;  3JVT C;  1CLB A;  1DMO A;  2HET A;  1GJY A;  1WDC B;  4OCI A;  4MRY A;  1S36 A;  3DVE A;  1SK6 D;  1H8B A;  1UUS A;  3JTD B;  4YGB B;  2BCB A;  5DKQ A;  1EG4 A;  1KQM B;  3AKB A;  1U5I B;  3BYA A;  2EC6 B;  2LP2 A;  3D0Y B;  4ORA B;  3EVR A;  3WXA A;  2JUL A;  1SCM C;  1DTL A;  1L2O C;  3CGA A;  2JTZ A;  1K9U A;  4N1G A;  1B1G A;  4HSZ A;  1OE9 B;  1UP5 A;  1BJF A;  1IGV A;  1NX2 A;  2CBL A;  3IF7 A;  1SW8 A;  3BUO B;  2GGZ A;  1CDL A;  1K94 A;  2NZ0 A;  2LCP A;  2P6B B;  2JT3 A;  2BKH B;  1BLQ A;  1QX2 A;  3DVJ A;  2LUX A;  5AAN A;  1AP4 A;  4GGF C;  2I18 A;  2LV7 A;  1KK8 C;  2KGB C;  1J7P A;  1PK0 D;  2Y1M A;  4P2Y B;  2KHN A;  1B47 A;  1C07 A;  1QJT A;  3EK8 A;  1CDP A;  1ALV A;  2M8U A;  3IQO A;  1F4Q A;  3C1V A;  3TZ1 A;  2M9G A;  5DKR A;  1Y1A A;  4I5L B;  2K0J A;  2WCE A;  4MZL A;  1LA0 A;  2PSR A;  2BKI B;  1XFU O;  1EG3 A;  1ZUZ A;  2H2K A;  2M1K B;  3H4S E;  1N0Y A;  2HQ8 A;  1CDM A;  1PAL A;  2JQ6 A;  4XJK B;  1SMG A;  2EHB A;  1ZAC A;  3DF0 B;  4M2O A;  2KI6 C;  4M2Q A;  2I2R E;  1OSA A;  2L5X B;  3O2P A;  3GK4 X;  2ISD A;  1RFJ A;  1NX3 A;  2GGM A;  4PHK A;  2K2F A;  2L51 A;  1TIZ A;  2JNX A;  2BE4 A;  2QAC A;  4NQG A;  4OR9 B;  2CXJ A;  3OHM B;  3O78 A;  3FIA A;  4YGA A;  4MN0 A;  2WC8 A;  3BOW B;  5I8N A;  2NCP A;  1R6P A;  1V1F A;  2O60 A;  3O6B A;  5IBW A;  4UPG A;  4YRU A;  1A4P A;  2KSP A;  1YUT A;  2KAY A;  2JZI A;  4TNC A;  1S5G Z;  3LLE A;  2L98 A;  1JC2 A;  1PUL A;  4C0J A;  2M29 A;  1S6J A;  1J55 A;  2VRG A;  2LLS A;  2V53 A;  3LK1 A;  3M0W A;  5I2Q A;  1A75 B;  2KQ6 A;  1QS7 A;  3TDU A;  3KF9 A;  2WOS A;  2CT9 A;  2LVJ A;  1OZO A;  3EK7 A;  4M2P A;  5CSN A;  5BPJ A;  1MXL C;  3EVU A;  3OX5 A;  2M1U A;  1J7O A;  2NXQ A;  2ZND A;  2OS8 B;  1QAS A;  4E68 A;  1CNP A;  4NDD A;  3CTN A;  4ETO A;  5HKY A;  1DGV A;  3NSL A;  1IG5 A;  2L4I A;  2M97 A;  3DVM A;  3CZT X;  4C0L A;  1KK7 Y;  3KEV A;  3MSE B;  1DJG A;  3SG3 A;  1IJ6 A;  2M3W A;  1LKJ A;  3CWG A;  1KFU S;  4FQO A;  1UWO A;  2MHH A;  4OV2 A;  3D0Y A;  3FWC A;  1SL9 A;  1M63 B;  3I5G C;  3LL8 B;  1BR4 B;  1M46 A;  2LUC A;  4PHJ A;  2WCB A;  3AAJ A;  2IS9 A;  2CNP A;  4PCW A;  2KOT A;  4PDZ A;  4CID A;  1S1E A;  1UHN A;  2Y1N A;  3I5H B;  1SNL A;  1OMV A;  2I7A A;  1DJW A;  3ICB A;  1XA5 A;  1DJZ A;  4JPZ B;  1SYM A;  1IQ3 A;  2JNF A;  1YVL A;  1G4Y R;  2KYF A;  5KTY A;  2HF5 A;  1NPQ A;  4MEW A;  3VRO A;  1L2O B;  4C0K A;  2OTG B;  2KNE A;  1YUU A;  3SIA A;  5CSI A;  1AHR A;  2GV5 A;  2PRU A;  3IQQ A;  4N5X A;  3SG7 A;  4BY5 A;  4YI8 A;  1K95 A;  1PSR A;  3I5I C;  2LC5 A;  1KCY A;  2EGD A;  3PN7 B;  4HRH A;  1KSO A;  3AKA A;  4HRG A;  2F2O A;  1K96 A;  1RK9 A;  2I94 A;  1K2H A;  5FYX A;  1JSA A;  2LMU A;  2WOR A;  1Y1X A;  1YTZ C;  1DF0 B;  1TNQ A;  4I5N B;  1WRZ A;  4DUQ A;  1QVI Y;  2KBM A;  3PAT A;  2KFF A;  4GFT A;  2K7O A;  3OB2 B;  4XJK A;  3DF0 A;  1IQ5 A;  2BL0 B;  1QX5 B;  3LCP C;  1CFP A;  1RWY A;  2MJW B;  2MAZ A;  1HQV A;  3EKH A;  1SBJ A;  3CLN A;  2KGR A;  2K7B A;  1OQP A;  4JQ0 D;  2KBI A;  3KHE A;  2B1U A;  1YRU B;  1TNX A;  2KI4 B;  4D1E A;  1CB1 A;  1MF8 B;  3OB1 B;  5AER A;  1NCY A;  3PSR A;  1B4C A;  1JF0 A;  2ZFD A;  1R2U A;  2JRF A;  1QVI Z;  2L2E A;  2M7N A;  1XVJ A;  5JJG A;  3BOW A;  3JTD C;  2D8N A;  1F4O A;  2EC6 C;  3FWB A;  1F70 A;  4MRX A;  1CM1 A;  2M0R A;  1RTP 1;  1SL8 A;  1W7J B;  3I5F B;  1N65 A;  2FJU B;  1WRL A;  3SJS A;  1MWN A;  1G8I A;  1CLM A;  1LIN A;  1EL4 A;  3NSK A;  3ZWH A;  5AXI A;  1Y1U A;  2LM5 A;  2MBX A;  4Q04 A;  2TN4 A;  3BXK A;  3ZNI A;  1Y6W A;  1NCX A;  1A75 A;  2RGI A;  4AQI A;  5I2L A;  2SCP A;  2M7L A;  1ALW A;  4CLN A;  4DIR A;  5I2O A;  3TS5 C;  1KFX L;  1S6I A;  2KQY A;  2BE6 A;  2O5G A;  4U8D A;  1WLZ A;  5AFP A;  2LHL A;  1YUR A;  1K9P A;  5KSZ A;  1JFJ A;  1B9A A;  4MVF A;  3DD4 A;  1CLL A;  1YX8 A;  2ZNE A;  3E3R A;  3RLZ A;  4CFR A;  1SR6 C;  4QJ5 B;  4AOM A;  3CR4 X;  4GPL B;  4YGD B;  2JTT A;  5HYD A;  2KAV A;  1QV1 A;  5JOL A;  4N1F A;  1F54 A;  1XK4 A;  1QIW A;  2JXL A;  5PAL A;  2ZN9 A;  4WRI A;  1YVH A;  2COL B;  3BUM B;  1L7Z A;  1WLM A;  2LLT A;  1H4B A;  1KWO C;  1B8L A;  2LP3 A;  1MQ1 A;  1QX7 A;  4YBH B;  4AQJ A;  4ORB B;  2JU0 A;  3QRX A;  4BY4 A;  2K2A A;  5D69 A;  1A03 A;  1NX0 A;  1MR8 A;  1TCO B;  2L50 A;  1QV0 A;  4YGC B;  3D10 A;  1NWD A;  1B8C A;  1J7R A;  1MHO A;  1FI5 A;  1XFX O;  4R1E A;  4GNK B;  3PM8 A;  4ZCU A;  3PLF B;  3VRP A;  4ORC B;  1JUO A;  2DOQ A;  2JC2 A;  1PVB A;  4GAO A;  3NSO A;  1NIW A;  1CMF A;  1K93 D;  1QIV A;  3CR5 X;  2FOT A;  1SL7 A;  2K61 A;  2ZRS A;  1U5I A;  3TUY C;  2Y4Q A;  3JVT B;  1F8H A;  1LXF C;  1DJH A;  1VRK A;  1S6C A;  1DF0 A;  1CM4 A;  1DJX A;  1OMR A;  2Q91 A;  3OP0 A;  1IJ5 A;  1KK7 Z;  1SCV A;  1BMO A;  1XFZ O;  2H61 A;  4IL1 A;  2L4H A;  1DJI A;  1A2X A;  1KSM A;  2PVB A;  2OS8 C;  1SCM B;  3KPX A;  1IH0 A;  2Q4U A;  1AJ5 A;  2G9B A;  4PAL A;  1GGZ A;  4I5K A;  3VRN A;  2E6W A;  1CMG A;  3NXA A;  2K7C A;  2HQW A;  2LMT A;  2BEC A;  5CSF A;  1KFX S;  2JT0 A;  3HX4 A;  3BQ3 A;  4DRW A;  1K9K A;  1D1O A;  1V1G A;  2JWW A;  1XK4 C;  2BCA A;  1MXE A;  5HLO A;  1KQV A;  1UHI A;  3GK2 A;  4PE4 A;  1AK8 A;  2M49 B;  2ZKM X;  3EK4 A;  5ER5 A;  1KK8 B;  3SG5 A;  5DKN A;  1ZOT B;  5G08 A;  3SG2 A;  2FCD A;  1LVC D;  2KDH A;  3DVK A;  1CFC A;  1ZFS A;  1NX1 A;  4I5J A;  2G2B A;  3EVV A;  2QPT A;  1ZMZ A;  2ZN8 A;  2BBM A;  1JF2 A;  2AUC A;  3LK0 A;  1TNW A;  1JFK A;  1X02 A;  3I5H C;  4GUK A;  3SG4 A;  2ZRT A;  2F33 A;  1BR1 B;  4CFQ A;  2NCO A;  4QJ4 B;  4USL A;  4OKH A;  4GGN A;  5J3X A;  1AVS A;  1WY9 A;  1TNP A;  2OTG C;  5D7F A;  1NSH A;  1IRJ A;  5CSJ A;  1WDC C;  2KYC A;  3CR2 A;  5HLV A;  2LVV A;  2PAS A;  1B8R A;  2MLE C;  1TCF A;  3VGO A;  1DGU A;  1SY9 A;  1F55 A;  3BUN B;  1CDN A;  1PVA A;  2CCM A;  3HCM A;  4A4C A;  1KQM C;  3PN7 C;  1IKU A;  2R2I A;  3VRR A;  3FS7 A;  5KU1 A;  1BOD A;  1FW4 A;  1M45 A;  1DJY A;  1UHJ A;  1GQM A;  1OMD A;  1F71 A;  3TS5 B;  4L9M A;  1J1D A;  2WCF A;  1DVI A;  1EXR A;  3TDI A;  4MLW A;  2F3Z A;  4MSP A;  4XYN A;  1QLS A;  3F45 A;  2H61 C;  1XYD A;  3K21 A;  2NLN A;  1TN4 A;  4YGE B;  3GOF A;  1YR5 A;  3BUX B;  5CPV A;  1PSB A;  1KFU L;  1SR6 B;  1JWD A;  2BL0 C;  4NDC A;  3EKJ A;  1M39 A;  3PFV A;  2KI4 C;  1FF1 A;  3SG6 A;  2A4J A;  1A29 A;  2LE9 B;  1KWO B;  1SPY A;  1CFF A;  2KFH A;  3WHU B;  1QXP A;  2LLU A;  4PE1 A;  4YI9 A;  2JPT A;  3RM1 A;  1BF5 A;  2KAX A;  1FPW A;  2HPS A;  3BUW B;  1WRK A;  3KO0 A;  3GK1 A;  4DS7 A;  1YUS A;  1S5G Y;  1RJV A;  1K90 D;  1DT7 B;  5TNC A;  1XFW O;  1BU3 A;  1J1E A;  1S3P A;  3CS1 A;  1YRT B;  2AMI A;  1JBA A;  1N2D A;  1FBV A;  1S26 D;  3I5F C;  3NSI A;  1QLK A;  1CFD A;  1OZS A;  5AEQ A;  4NDB A;  2WND A;  2KFG A;  2OPO A;  1REC A;  3A8R A;  5K89 A;  2FCE A;  1M31 A;  1XFY O;  1XO5 A;  1Q80 A;  4HRE E;  1UHK A;  3AAK A;  2F8P A;  1NYA A;  2L0P A;  4OVN F;  2JT8 A;  1BG1 A;  3TUY B;  1AJ4 A;  5ER4 X;  2LHI A;  2PAL A;  3I5G B;  1FI6 A;  1QAT A;  4DCK A;  2PMY A;  1QTX A;  4MZK A;  1UUR A;  2F3Y A;  3A4U B;  4WQ2 A;  1CKK A;  4WQ3 A;  1HT9 A;  4P5O E;  4PE7 A;  1C7V A;  1W7I B;  5HKZ A;  4F0Z B;  1GGW A;  2LNK A;  1NP8 A;  2BCX A;  1RRO A;  2LVI A;  1EJ3 A;  2F2P A;  3SIB A;  1K8U A;  1AUI B;  2KI6 D;  4ZCV A;  2LAN A;  1TRF A;  4JWQ A;  1NUB A;  2K8M B;  2JXC A;  2SAS A;  1TTX A;  4GGF A;  1BT6 A;  2LAP A;  3I5I B;  4CPV A;  1OOJ A;  1B7T Y;  4GBA A;  1YX7 A;  1PRW A;  1TOP A;  1IWQ A;  1J7Q A;  1SKT A;  1CTR A;  1MUX A;  1SRA A;  4FTG A;  1NCZ A;  3VRQ A;  4MBE A;  3O4Y A;  4QJ3 B;  1C7W A;  5GQQ C;  2LMV A;  2MA2 A; 
#chains in the Genus database with same CATH topology
 4PHN A;  3WHT B;  5B8I B;  3PM2 A;  2JOJ A;  1XFR A;  2BBN A;  1XFV O;  2MRD A;  3OX6 A;  2E30 A;  2Y5I A;  1E8A A;  2CTN A;  1OOH A;  4MZJ A;  3DZT A;  4PE0 A;  1EH2 A;  4PHM A;  1B7T Z;  4A4B A;  1W9Z A;  5F6T A;  1Y0V H;  3TDZ A;  1LA3 A;  5HKW A;  2K7D A;  4OZD A;  1UHH A;  3EG5 B;  2QEH A;  3SS5 A;  3WNX B;  1OOI X;  4ICB A;  2AAO A;  2MLF C;  3PAL A;  1BOC A;  1G33 A;  1ODB A;  2LVK A;  3JVT C;  1CLB A;  1DMO A;  2HET A;  1GJY A;  1WDC B;  4OCI A;  4MRY A;  1S36 A;  3DVE A;  3S0F A;  1SK6 D;  1H8B A;  1UUS A;  3JTD B;  2QDI A;  4YGB B;  2BCB A;  5DKQ A;  1EG4 A;  1KQM B;  3AKB A;  1U5I B;  3BYA A;  2EC6 B;  2LP2 A;  3D0Y B;  4ORA B;  3EVR A;  3WXA A;  2JUL A;  3NHI A;  3FE8 A;  1SCM C;  1DTL A;  1L2O C;  3CGA A;  2JTZ A;  1K9U A;  4N1G A;  2QEO A;  1B1G A;  4HSZ A;  1OE9 B;  1UP5 A;  1BJF A;  1IGV A;  1NX2 A;  2CBL A;  3IF7 A;  1SW8 A;  3BUO B;  2YGU A;  2GGZ A;  1CDL A;  1K94 A;  2NZ0 A;  2LCP A;  2P6B B;  3CDN A;  3CZ0 A;  2JT3 A;  1QWV A;  2BKH B;  3L47 A;  1BLQ A;  4F7F A;  1QX2 A;  2FJY A;  3NHT A;  3DVJ A;  2LUX A;  3FE9 A;  5AAN A;  1AP4 A;  4GGF C;  2I18 A;  2LV7 A;  1KK8 C;  3V2L A;  2KGB C;  1J7P A;  1PK0 D;  2Y1M A;  4P2Y B;  2KHN A;  1B47 A;  1C07 A;  1QJT A;  3EK8 A;  1CDP A;  1ALV A;  2M8U A;  3IQO A;  1F4Q A;  3C1V A;  3TZ1 A;  2M9G A;  5DKR A;  1Y1A A;  4I5L B;  2BAP A;  5FI2 A;  3BFA A;  2K0J A;  2WCE A;  4MZL A;  1LA0 A;  1IIO A;  2PSR A;  1XFU O;  1ZUZ A;  1EG3 A;  2BKI B;  2H2K A;  2M1K B;  3H4S E;  1N0Y A;  2L2C A;  2HQ8 A;  1CDM A;  1PAL A;  2JQ6 A;  3BFH A;  1SMG A;  2EHB A;  1ZAC A;  3DF0 B;  4M2O A;  2KI6 C;  4M2Q A;  2I2R E;  1OSA A;  2L5X B;  3O2P A;  3GK4 X;  2ISD A;  1RFJ A;  1NX3 A;  2GGM A;  4PHK A;  2K2F A;  2L51 A;  1TIZ A;  2JNX A;  2BE4 A;  2QAC A;  4NQG A;  4OR9 B;  2CXJ A;  3OHM B;  5I94 A;  3O78 A;  3FIA A;  1OOG A;  4YGA A;  4MN0 A;  1TUJ A;  2WC8 A;  3BOW B;  5I8N A;  2NCP A;  1R6P A;  1V1F A;  2O60 A;  3O6B A;  5IBW A;  4UPG A;  4YRU A;  1A4P A;  2KSP A;  1YUT A;  2KAY A;  2JZI A;  4TNC A;  1S5G Z;  2KLE A;  3LLE A;  2L98 A;  1JC2 A;  1PUL A;  4C0J A;  2M29 A;  1S6J A;  1J55 A;  2VRG A;  2LLS A;  2V53 A;  3LK1 A;  3M0W A;  5I2Q A;  1A75 B;  2KQ6 A;  1QS7 A;  3TDU A;  3KF9 A;  3OBV A;  2WOS A;  2CT9 A;  2LVJ A;  1OZO A;  3EK7 A;  4M2P A;  5CSN A;  5BPJ A;  1MXL C;  3EVU A;  3D78 A;  3OX5 A;  2M1U A;  1J7O A;  3CZ2 A;  2NXQ A;  2ZND A;  2OS8 B;  1QAS A;  4E68 A;  3IVT A;  1CNP A;  4NDD A;  3CTN A;  4ETO A;  5HKY A;  1DGV A;  3NSL A;  1IG5 A;  2L4I A;  2M97 A;  3DVM A;  3CZT X;  4C0L A;  1KK7 Y;  1OW4 A;  3KEV A;  3MSE B;  1DQE A;  1DJG A;  3SG3 A;  1IJ6 A;  2M3W A;  1LKJ A;  3B86 A;  3CWG A;  1KFU S;  4FQO A;  1UWO A;  2MHH A;  2P70 A;  4OV2 A;  3D0Y A;  3FWC A;  1SL9 A;  1M63 B;  2KPH A;  3PJI A;  3I5G C;  3LL8 B;  1BR4 B;  1M46 A;  2LUC A;  4PHJ A;  2WCB A;  3AAJ A;  2IS9 A;  2CNP A;  4PCW A;  2KOT A;  4PDZ A;  4CID A;  3B6X A;  3K1E A;  4JKT A;  1S1E A;  1UHN A;  2Y1N A;  3I5H B;  1SNL A;  1OMV A;  2I7A A;  1DJW A;  3ICB A;  1XA5 A;  1DJZ A;  4JPZ B;  1SYM A;  3D73 A;  1IQ3 A;  2JNF A;  1YVL A;  4XJK B;  1G4Y R;  2KYF A;  2WC6 A;  2HF5 A;  1NPQ A;  4MEW A;  3VRO A;  1L2O B;  3Q8I A;  4C0K A;  2OTG B;  2KNE A;  1YUU A;  1Z4H A;  3SIA A;  1GM0 A;  5CSI A;  1AHR A;  2GV5 A;  2PRU A;  3IQQ A;  4N5X A;  3SG7 A;  4BY5 A;  4YI8 A;  1K95 A;  5FI7 A;  1PSR A;  3I5I C;  2LC5 A;  1KCY A;  2EGD A;  3S0B A;  2PYQ A;  3PN7 B;  4HRH A;  1KSO A;  3AKA A;  4HRG A;  2F2O A;  1K96 A;  1RK9 A;  2I94 A;  1K2H A;  5FYX A;  1JSA A;  2LMU A;  2WOR A;  1Y1X A;  1YTZ C;  1DF0 B;  1TNQ A;  4I5N B;  1WRZ A;  4DUQ A;  3R1V A;  3L4A A;  1QVI Y;  2KBM A;  3PAT A;  2KFF A;  2WCH A;  4GFT A;  2K7O A;  3OB2 B;  4XJK A;  3DF0 A;  1IQ5 A;  2BL0 B;  1QX5 B;  3LCP C;  1CFP A;  1RWY A;  2MJW B;  2MAZ A;  1HQV A;  3EKH A;  1SBJ A;  3CLN A;  2KGR A;  2K7B A;  1OQP A;  4JQ0 D;  1Z2C B;  3B87 A;  2KBI A;  3KHE A;  2B1U A;  1YRU B;  1TNX A;  3DXL A;  2KI4 B;  4D1E A;  1CB1 A;  1MF8 B;  3OB1 B;  5AER A;  1NCY A;  3PSR A;  1B4C A;  1JF0 A;  2ZFD A;  1R2U A;  2JRF A;  1QVI Z;  3R1O A;  2L2E A;  2M7N A;  1XVJ A;  5JJG A;  3BOW A;  3JTD C;  2D8N A;  1F4O A;  2EC6 C;  3FWB A;  1F70 A;  4MRX A;  1CM1 A;  2M0R A;  1RTP 1;  1SL8 A;  1W7J B;  3I5F B;  1N65 A;  2FJU B;  1WRL A;  3SJS A;  1MWN A;  1G8I A;  1CLM A;  1LIN A;  1EL4 A;  3NSK A;  3ZWH A;  1TUZ A;  5AXI A;  1Y1U A;  3N7H A;  2LM5 A;  1DC1 A;  2MBX A;  4Q04 A;  2TN4 A;  3BXK A;  3ZNI A;  1Y6W A;  1NCX A;  1A75 A;  2QEB A;  2RGI A;  5I2L A;  2SCP A;  2M7L A;  4AQI A;  1ALW A;  4CLN A;  4DIR A;  5I2O A;  3TS5 C;  3VB1 A;  1KFX L;  1S6I A;  2KQY A;  2BE6 A;  2O5G A;  4U8D A;  1WLZ A;  2GTE A;  2WC5 A;  5AFP A;  3R1P A;  2LHL A;  1YUR A;  1K9P A;  5KSZ A;  1JFJ A;  3DY9 A;  1B9A A;  4MVF A;  4JD9 A;  3DD4 A;  1CLL A;  1YX8 A;  2ZNE A;  3E3R A;  3RLZ A;  4CFR A;  1SR6 C;  4QJ5 B;  4AOM A;  3CR4 X;  4GPL B;  4YGD B;  2JTT A;  5HYD A;  2KAV A;  1QV1 A;  5JOL A;  5KTY A;  4N1F A;  1F54 A;  1XK4 A;  1QIW A;  2JXL A;  5PAL A;  2ZN9 A;  3L4L A;  1YVH A;  4WRI A;  2COL B;  1C3Y A;  3BUM B;  1L7Z A;  1WLM A;  2LLT A;  1H4B A;  1KWO C;  1B8L A;  1LS8 A;  2LP3 A;  1MQ1 A;  1QX7 A;  4YBH B;  4AQJ A;  4ORB B;  2JU0 A;  3QRX A;  4BY4 A;  2K2A A;  5D69 A;  1A03 A;  1NX0 A;  1MR8 A;  1TCO B;  2L50 A;  1QV0 A;  4YGC B;  1DEL A;  3D10 A;  1NWD A;  1B8C A;  4INW A;  1J7R A;  1MHO A;  1FI5 A;  1XFX O;  4R1E A;  4GNK B;  2PQL A;  3PM8 A;  4ZCU A;  3PLF B;  3VRP A;  4ORC B;  1JUO A;  2DOQ A;  2WCK A;  2JC2 A;  1PVB A;  4GAO A;  3NSO A;  1NIW A;  1CMF A;  1K93 D;  1QIV A;  3CR5 X;  2FOT A;  1SL7 A;  2K61 A;  2ZRS A;  1U5I A;  3TUY C;  2Y4Q A;  3D74 A;  3JVT B;  2WCM A;  1F8H A;  1LXF C;  3SS4 A;  1DJH A;  1VRK A;  1S6C A;  1DF0 A;  1CM4 A;  1DJX A;  1OMR A;  2Q91 A;  3OP0 A;  1IJ5 A;  1KK7 Z;  1SCV A;  1BMO A;  1XFZ O;  2H61 A;  4IL1 A;  3S0E A;  2L4H A;  1DJI A;  1A2X A;  1KSM A;  2PVB A;  3CZ1 A;  2OS8 C;  1SCM B;  3KPX A;  3O4X A;  1IH0 A;  2Q4U A;  1AJ5 A;  3CYZ A;  2G9B A;  4PAL A;  1GGZ A;  2QEV A;  4I5K A;  3VRN A;  2E6W A;  1CMG A;  3NXA A;  3B7A A;  2K7C A;  3FE6 A;  2HQW A;  2LMT A;  2BEC A;  5CSF A;  1KFX S;  2JT0 A;  2WCJ A;  3BQ3 A;  3HX4 A;  4DRW A;  1K9K A;  1D1O A;  1V1G A;  2JWW A;  1XK4 C;  2BCA A;  1C3Z A;  1MXE A;  5HLO A;  1KQV A;  1UHI A;  3GK2 A;  4PE4 A;  3S0A A;  1AK8 A;  5HL1 A;  2M49 B;  2ZKM X;  3EK4 A;  5ER5 A;  1KK8 B;  3S0G A;  5DKN A;  3SG5 A;  1ZOT B;  3UNW A;  5G08 A;  3SG2 A;  2FCD A;  1LVC D;  2KDH A;  3DVK A;  1CFC A;  1ZFS A;  1NX1 A;  4I5J A;  2G2B A;  3EVV A;  2QPT A;  1ZMZ A;  2ZN8 A;  3BJH A;  4INX A;  2BBM A;  2BNX A;  1JF2 A;  2AUC A;  3LK0 A;  3SS3 A;  1TNW A;  1JFK A;  1X02 A;  2KLD A;  3I5H C;  5D3O A;  4GUK A;  3SG4 A;  2ZRT A;  2F33 A;  1BR1 B;  4CFQ A;  2NCO A;  4QJ4 B;  2K60 A;  4OKH A;  4USL A;  4GGN A;  5J3X A;  1AVS A;  1DEK A;  3NGV A;  1WY9 A;  1TNP A;  2OTG C;  5D7F A;  1NSH A;  1IRJ A;  3B88 A;  5CSJ A;  1WDC C;  2H8V A;  2KYC A;  3CR2 A;  5HLV A;  2LVV A;  2PAS A;  1B8R A;  2MLE C;  1TCF A;  3VGO A;  1DGU A;  1SY9 A;  1F55 A;  3BUN B;  1CDN A;  3D76 A;  1PVA A;  2CCM A;  3HCM A;  4A4C A;  1KQM C;  3PN7 C;  1IKU A;  2R2I A;  3VRR A;  3FS7 A;  5KU1 A;  1BOD A;  1FW4 A;  1M45 A;  1DJY A;  1UHJ A;  1GQM A;  1OMD A;  1F71 A;  3TS5 B;  5DIC A;  3RZS A;  4L9M A;  1J1D A;  2WCF A;  4IJ7 A;  1DVI A;  1EXR A;  3TDI A;  4MLW A;  2F3Z A;  4MSP A;  5EL2 A;  4XYN A;  1QLS A;  3F45 A;  2WCL A;  2H61 C;  1XYD A;  3K21 A;  2NLN A;  1TN4 A;  4YGE B;  3GOF A;  2JPO A;  1YR5 A;  3BUX B;  5CPV A;  1PSB A;  1KFU L;  1SR6 B;  1JWD A;  2BL0 C;  4NDC A;  1ORG A;  5FI6 A;  3EKJ A;  1M39 A;  3PFV A;  3UO9 A;  2KI4 C;  1FF1 A;  3SG6 A;  2A4J A;  1A29 A;  2LE9 B;  1KWO B;  1SPY A;  1CFF A;  2KFH A;  3WHU B;  1QXP A;  2LLU A;  4PE1 A;  4YI9 A;  2JPT A;  3RM1 A;  1BF5 A;  2KAX A;  1FPW A;  2HPS A;  3BUW B;  1WRK A;  3KO0 A;  3GK1 A;  4DS7 A;  1YUS A;  1S5G Y;  1RJV A;  1K90 D;  1DT7 B;  5TNC A;  1XFW O;  1BU3 A;  1J1E A;  1S3P A;  1T14 A;  3OGN A;  3CS1 A;  1YRT B;  2AMI A;  1JBA A;  3R72 A;  1N2D A;  3D77 A;  1FBV A;  1S26 D;  3I5F C;  3NSI A;  1QLK A;  1CFD A;  1OZS A;  5AEQ A;  3D75 A;  4NDB A;  1OOF A;  2WND A;  2KFG A;  2OPO A;  1REC A;  3A8R A;  5K89 A;  2FCE A;  1M31 A;  1XFY O;  1XO5 A;  1Q80 A;  4HRE E;  1UHK A;  1SSE B;  3AAK A;  2F8P A;  1NYA A;  3DYE A;  2L0P A;  4OVN F;  2JT8 A;  1BG1 A;  3TUY B;  1AJ4 A;  5ER4 X;  2LHI A;  2PAL A;  3I5G B;  1FI6 A;  1QAT A;  4DCK A;  2PMY A;  1QTX A;  1P28 A;  4MZK A;  1UUR A;  2F3Y A;  3A4U B;  3BFB A;  3QME A;  2P71 A;  4WQ2 A;  1CKK A;  4WQ3 A;  1HT9 A;  4P5O E;  4PE7 A;  1C7V A;  1W7I B;  5HKZ A;  4F0Z B;  1GGW A;  2LNK A;  1NP8 A;  2L5Y A;  2BCX A;  1RRO A;  2LVI A;  1EJ3 A;  2F2P A;  4FQT A;  3SIB A;  1K8U A;  1AUI B;  2KI6 D;  4ZCV A;  2LAN A;  1TRF A;  4JWQ A;  1NUB A;  1TWO A;  2JXC A;  2K8M B;  1TTX A;  2SAS A;  4GGF A;  1BT6 A;  2LAP A;  3I5I B;  4CPV A;  1OOJ A;  1B7T Y;  4GBA A;  1YX7 A;  1PRW A;  1TOP A;  1IWQ A;  1J7Q A;  1SKT A;  1CTR A;  1MUX A;  1SRA A;  4FTG A;  2ERB A;  3CAB A;  1NCZ A;  3VRQ A;  4MBE A;  3S0D A;  3O4Y A;  4PT1 A;  4QJ3 B;  1C7W A;  4KYN A;  5GQQ C;  2LMV A;  2MA2 A; 
#chains in the Genus database with same CATH homology
 4PHN A;  3WHT B;  5B8I B;  2JOJ A;  2BBN A;  1XFV O;  2MRD A;  3OX6 A;  2E30 A;  2Y5I A;  1E8A A;  2CTN A;  4MZJ A;  4PE0 A;  1EH2 A;  4PHM A;  1B7T Z;  4A4B A;  5F6T A;  1Y0V H;  3TDZ A;  1LA3 A;  5HKW A;  2K7D A;  1UHH A;  3WNX B;  4ICB A;  2AAO A;  2MLF C;  3PAL A;  1BOC A;  1G33 A;  1ODB A;  2LVK A;  3JVT C;  1CLB A;  1DMO A;  2HET A;  1GJY A;  1WDC B;  4OCI A;  4MRY A;  1S36 A;  3DVE A;  1SK6 D;  1H8B A;  1UUS A;  3JTD B;  4YGB B;  2BCB A;  5DKQ A;  1EG4 A;  1KQM B;  3AKB A;  1U5I B;  3BYA A;  2EC6 B;  2LP2 A;  3D0Y B;  4ORA B;  3EVR A;  3WXA A;  2JUL A;  1SCM C;  1DTL A;  1L2O C;  3CGA A;  2JTZ A;  1K9U A;  4N1G A;  1B1G A;  4HSZ A;  1OE9 B;  1UP5 A;  1BJF A;  1IGV A;  1NX2 A;  2CBL A;  3IF7 A;  1SW8 A;  3BUO B;  2GGZ A;  1CDL A;  1K94 A;  2NZ0 A;  2LCP A;  2P6B B;  2JT3 A;  2BKH B;  1BLQ A;  1QX2 A;  3DVJ A;  2LUX A;  5AAN A;  1AP4 A;  4GGF C;  2I18 A;  2LV7 A;  1KK8 C;  2KGB C;  1J7P A;  1PK0 D;  2Y1M A;  4P2Y B;  2KHN A;  1B47 A;  1C07 A;  1QJT A;  3EK8 A;  1CDP A;  1ALV A;  2M8U A;  3IQO A;  1F4Q A;  3C1V A;  3TZ1 A;  2M9G A;  5DKR A;  1Y1A A;  4I5L B;  2K0J A;  2WCE A;  4MZL A;  1LA0 A;  2PSR A;  2BKI B;  1XFU O;  1EG3 A;  1ZUZ A;  2H2K A;  2M1K B;  3H4S E;  1N0Y A;  2HQ8 A;  1CDM A;  1PAL A;  2JQ6 A;  4XJK B;  1SMG A;  2EHB A;  1ZAC A;  3DF0 B;  4M2O A;  2KI6 C;  4M2Q A;  2I2R E;  1OSA A;  2L5X B;  3O2P A;  3GK4 X;  2ISD A;  1RFJ A;  1NX3 A;  2GGM A;  4PHK A;  2K2F A;  2L51 A;  1TIZ A;  2JNX A;  2BE4 A;  2QAC A;  4NQG A;  4OR9 B;  2CXJ A;  3OHM B;  3O78 A;  3FIA A;  4YGA A;  4MN0 A;  2WC8 A;  3BOW B;  5I8N A;  2NCP A;  1R6P A;  1V1F A;  2O60 A;  3O6B A;  5IBW A;  4UPG A;  4YRU A;  1A4P A;  2KSP A;  1YUT A;  2KAY A;  2JZI A;  4TNC A;  1S5G Z;  3LLE A;  2L98 A;  1JC2 A;  1PUL A;  4C0J A;  2M29 A;  1S6J A;  1J55 A;  2VRG A;  2LLS A;  2V53 A;  3LK1 A;  3M0W A;  5I2Q A;  1A75 B;  2KQ6 A;  1QS7 A;  3TDU A;  3KF9 A;  2WOS A;  2CT9 A;  2LVJ A;  1OZO A;  3EK7 A;  4M2P A;  5CSN A;  5BPJ A;  1MXL C;  3EVU A;  3OX5 A;  2M1U A;  1J7O A;  2NXQ A;  2ZND A;  2OS8 B;  1QAS A;  4E68 A;  1CNP A;  4NDD A;  3CTN A;  4ETO A;  5HKY A;  1DGV A;  3NSL A;  1IG5 A;  2L4I A;  2M97 A;  3DVM A;  3CZT X;  4C0L A;  1KK7 Y;  3KEV A;  3MSE B;  1DJG A;  3SG3 A;  1IJ6 A;  2M3W A;  1LKJ A;  3CWG A;  1KFU S;  4FQO A;  1UWO A;  2MHH A;  4OV2 A;  3D0Y A;  3FWC A;  1SL9 A;  1M63 B;  3I5G C;  3LL8 B;  1BR4 B;  1M46 A;  2LUC A;  4PHJ A;  2WCB A;  3AAJ A;  2IS9 A;  2CNP A;  4PCW A;  2KOT A;  4PDZ A;  4CID A;  1S1E A;  1UHN A;  2Y1N A;  3I5H B;  1SNL A;  1OMV A;  2I7A A;  1DJW A;  3ICB A;  1XA5 A;  1DJZ A;  4JPZ B;  1SYM A;  1IQ3 A;  2JNF A;  1YVL A;  1G4Y R;  2KYF A;  5KTY A;  2HF5 A;  1NPQ A;  4MEW A;  3VRO A;  1L2O B;  4C0K A;  2OTG B;  2KNE A;  1YUU A;  3SIA A;  5CSI A;  1AHR A;  2GV5 A;  2PRU A;  3IQQ A;  4N5X A;  3SG7 A;  4BY5 A;  4YI8 A;  1K95 A;  1PSR A;  3I5I C;  2LC5 A;  1KCY A;  2EGD A;  3PN7 B;  4HRH A;  1KSO A;  3AKA A;  4HRG A;  2F2O A;  1K96 A;  1RK9 A;  2I94 A;  1K2H A;  5FYX A;  1JSA A;  2LMU A;  2WOR A;  1Y1X A;  1YTZ C;  1DF0 B;  1TNQ A;  4I5N B;  1WRZ A;  4DUQ A;  1QVI Y;  2KBM A;  3PAT A;  2KFF A;  4GFT A;  2K7O A;  3OB2 B;  4XJK A;  3DF0 A;  1IQ5 A;  2BL0 B;  1QX5 B;  3LCP C;  1CFP A;  1RWY A;  2MJW B;  2MAZ A;  1HQV A;  3EKH A;  1SBJ A;  3CLN A;  2KGR A;  2K7B A;  1OQP A;  4JQ0 D;  2KBI A;  3KHE A;  2B1U A;  1YRU B;  1TNX A;  2KI4 B;  4D1E A;  1CB1 A;  1MF8 B;  3OB1 B;  5AER A;  1NCY A;  3PSR A;  1B4C A;  1JF0 A;  2ZFD A;  1R2U A;  2JRF A;  1QVI Z;  2L2E A;  2M7N A;  1XVJ A;  5JJG A;  3BOW A;  3JTD C;  2D8N A;  1F4O A;  2EC6 C;  3FWB A;  1F70 A;  4MRX A;  1CM1 A;  2M0R A;  1RTP 1;  1SL8 A;  1W7J B;  3I5F B;  1N65 A;  2FJU B;  1WRL A;  3SJS A;  1MWN A;  1G8I A;  1CLM A;  1LIN A;  1EL4 A;  3NSK A;  3ZWH A;  5AXI A;  1Y1U A;  2LM5 A;  2MBX A;  4Q04 A;  2TN4 A;  3BXK A;  3ZNI A;  1Y6W A;  1NCX A;  1A75 A;  2RGI A;  4AQI A;  5I2L A;  2SCP A;  2M7L A;  1ALW A;  4CLN A;  4DIR A;  5I2O A;  3TS5 C;  1KFX L;  1S6I A;  2KQY A;  2BE6 A;  2O5G A;  4U8D A;  1WLZ A;  5AFP A;  2LHL A;  1YUR A;  1K9P A;  5KSZ A;  1JFJ A;  1B9A A;  4MVF A;  3DD4 A;  1CLL A;  1YX8 A;  2ZNE A;  3E3R A;  3RLZ A;  4CFR A;  1SR6 C;  4QJ5 B;  4AOM A;  3CR4 X;  4GPL B;  4YGD B;  2JTT A;  5HYD A;  2KAV A;  1QV1 A;  5JOL A;  4N1F A;  1F54 A;  1XK4 A;  1QIW A;  2JXL A;  5PAL A;  2ZN9 A;  4WRI A;  1YVH A;  2COL B;  3BUM B;  1L7Z A;  1WLM A;  2LLT A;  1H4B A;  1KWO C;  1B8L A;  2LP3 A;  1MQ1 A;  1QX7 A;  4YBH B;  4AQJ A;  4ORB B;  2JU0 A;  3QRX A;  4BY4 A;  2K2A A;  5D69 A;  1A03 A;  1NX0 A;  1MR8 A;  1TCO B;  2L50 A;  1QV0 A;  4YGC B;  3D10 A;  1NWD A;  1B8C A;  1J7R A;  1MHO A;  1FI5 A;  1XFX O;  4R1E A;  4GNK B;  3PM8 A;  4ZCU A;  3PLF B;  3VRP A;  4ORC B;  1JUO A;  2DOQ A;  2JC2 A;  1PVB A;  4GAO A;  3NSO A;  1NIW A;  1CMF A;  1K93 D;  1QIV A;  3CR5 X;  2FOT A;  1SL7 A;  2K61 A;  2ZRS A;  1U5I A;  3TUY C;  2Y4Q A;  3JVT B;  1F8H A;  1LXF C;  1DJH A;  1VRK A;  1S6C A;  1DF0 A;  1CM4 A;  1DJX A;  1OMR A;  2Q91 A;  3OP0 A;  1IJ5 A;  1KK7 Z;  1SCV A;  1BMO A;  1XFZ O;  2H61 A;  4IL1 A;  2L4H A;  1DJI A;  1A2X A;  1KSM A;  2PVB A;  2OS8 C;  1SCM B;  3KPX A;  1IH0 A;  2Q4U A;  1AJ5 A;  2G9B A;  4PAL A;  1GGZ A;  4I5K A;  3VRN A;  2E6W A;  1CMG A;  3NXA A;  2K7C A;  2HQW A;  2LMT A;  2BEC A;  5CSF A;  1KFX S;  2JT0 A;  3HX4 A;  3BQ3 A;  4DRW A;  1K9K A;  1D1O A;  1V1G A;  2JWW A;  1XK4 C;  2BCA A;  1MXE A;  5HLO A;  1KQV A;  1UHI A;  3GK2 A;  4PE4 A;  1AK8 A;  2M49 B;  2ZKM X;  3EK4 A;  5ER5 A;  1KK8 B;  3SG5 A;  5DKN A;  1ZOT B;  5G08 A;  3SG2 A;  2FCD A;  1LVC D;  2KDH A;  3DVK A;  1CFC A;  1ZFS A;  1NX1 A;  4I5J A;  2G2B A;  3EVV A;  2QPT A;  1ZMZ A;  2ZN8 A;  2BBM A;  1JF2 A;  2AUC A;  3LK0 A;  1TNW A;  1JFK A;  1X02 A;  3I5H C;  4GUK A;  3SG4 A;  2ZRT A;  2F33 A;  1BR1 B;  4CFQ A;  2NCO A;  4QJ4 B;  4USL A;  4OKH A;  4GGN A;  5J3X A;  1AVS A;  1WY9 A;  1TNP A;  2OTG C;  5D7F A;  1NSH A;  1IRJ A;  5CSJ A;  1WDC C;  2KYC A;  3CR2 A;  5HLV A;  2LVV A;  2PAS A;  1B8R A;  2MLE C;  1TCF A;  3VGO A;  1DGU A;  1SY9 A;  1F55 A;  3BUN B;  1CDN A;  1PVA A;  2CCM A;  3HCM A;  4A4C A;  1KQM C;  3PN7 C;  1IKU A;  2R2I A;  3VRR A;  3FS7 A;  5KU1 A;  1BOD A;  1FW4 A;  1M45 A;  1DJY A;  1UHJ A;  1GQM A;  1OMD A;  1F71 A;  3TS5 B;  4L9M A;  1J1D A;  2WCF A;  1DVI A;  1EXR A;  3TDI A;  4MLW A;  2F3Z A;  4MSP A;  4XYN A;  1QLS A;  3F45 A;  2H61 C;  1XYD A;  3K21 A;  2NLN A;  1TN4 A;  4YGE B;  3GOF A;  1YR5 A;  3BUX B;  5CPV A;  1PSB A;  1KFU L;  1SR6 B;  1JWD A;  2BL0 C;  4NDC A;  3EKJ A;  1M39 A;  3PFV A;  2KI4 C;  1FF1 A;  3SG6 A;  2A4J A;  1A29 A;  2LE9 B;  1KWO B;  1SPY A;  1CFF A;  2KFH A;  3WHU B;  1QXP A;  2LLU A;  4PE1 A;  4YI9 A;  2JPT A;  3RM1 A;  1BF5 A;  2KAX A;  1FPW A;  2HPS A;  3BUW B;  1WRK A;  3KO0 A;  3GK1 A;  4DS7 A;  1YUS A;  1S5G Y;  1RJV A;  1K90 D;  1DT7 B;  5TNC A;  1XFW O;  1BU3 A;  1J1E A;  1S3P A;  3CS1 A;  1YRT B;  2AMI A;  1JBA A;  1N2D A;  1FBV A;  1S26 D;  3I5F C;  3NSI A;  1QLK A;  1CFD A;  1OZS A;  5AEQ A;  4NDB A;  2WND A;  2KFG A;  2OPO A;  1REC A;  3A8R A;  5K89 A;  2FCE A;  1M31 A;  1XFY O;  1XO5 A;  1Q80 A;  4HRE E;  1UHK A;  3AAK A;  2F8P A;  1NYA A;  2L0P A;  4OVN F;  2JT8 A;  1BG1 A;  3TUY B;  1AJ4 A;  5ER4 X;  2LHI A;  2PAL A;  3I5G B;  1FI6 A;  1QAT A;  4DCK A;  2PMY A;  1QTX A;  4MZK A;  1UUR A;  2F3Y A;  3A4U B;  4WQ2 A;  1CKK A;  4WQ3 A;  1HT9 A;  4P5O E;  4PE7 A;  1C7V A;  1W7I B;  5HKZ A;  4F0Z B;  1GGW A;  2LNK A;  1NP8 A;  2BCX A;  1RRO A;  2LVI A;  1EJ3 A;  2F2P A;  3SIB A;  1K8U A;  1AUI B;  2KI6 D;  4ZCV A;  2LAN A;  1TRF A;  4JWQ A;  1NUB A;  2K8M B;  2JXC A;  2SAS A;  1TTX A;  4GGF A;  1BT6 A;  2LAP A;  3I5I B;  4CPV A;  1OOJ A;  1B7T Y;  4GBA A;  1YX7 A;  1PRW A;  1TOP A;  1IWQ A;  1J7Q A;  1SKT A;  1CTR A;  1MUX A;  1SRA A;  4FTG A;  1NCZ A;  3VRQ A;  4MBE A;  3O4Y A;  4QJ3 B;  1C7W A;  5GQQ C;  2LMV A;  2MA2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...