2PSRA

Human psoriasin (s100a7) ca2+ and zn2+ bound form (crystal form ii)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
96
structure length
96
Chain Sequence
SNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ef-hand protein
molecule keywords PSORIASIN
publication title Zinc-binding site of an S100 protein revealed. Two crystal structures of Ca2+-bound human psoriasin (S100A7) in the Zn2+-loaded and Zn2+-free states.
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 1998-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2psrA00
2LC5A 4I5LB 1TCOB 1B8LA 2M8UA 1YX8A 5D69A 1SL7A 3A4UB 1M63B 2LVVA 3OX6A 2L2EA 2BE4A 3BOWA 4WQ2A 4YGCB 1KK8B 1A75B 1TIZA 1ZUZA 2KAXA 3ICBA 4GGFC 2M49B 2GGMA 1NCXA 3E3RA 2MLEC 3CGAA 3TDZA 3KO0A 3CS1A 4HRGA 1J7OA 1QLSA 1TOPA 1SW8A 4NDDA 1E8AA 4NDCA 1SK6D 2LMTA 1Y1UA 1UUSA 1PULA 4YGAA 3EK4A 2GV5A 2LLSA 1NCZA 2BKIB 4MVFA 2JU0A 4YI8A 1F8HA 2LM5A 1GJYA 1TN4A 4YGEB 2O60A 4MZJA 1B8CA 5AANA 2OTGB 1XK4A 4OCIA 4USLA 4CLNA 4D1EA 4QJ5B 2H61A 3SIBA 1KWOB 2M97A 2DOQA 3PSRA 4YBHB 4C0LA 1BODA 1PK0D 1M31A 1BR1B 1G4YR 1SR6B 3KHEA 2K0JA 4GPLB 4AOMA 1FBVA 2K8MB 1MWNA 5HLOA 1KFXL 2HETA 1YRUB 3PN7B 4PHMA 1CLMA 1ODBA 1TNPA 1DVIA 4PE7A 3IQOA 4C0JA 2JTZA 1LXFC 2JT3A 4YGBB 2PVBA 4Q04A 1A29A 1AHRA 1QJTA 1J1DA 1OMDA 2E6WA 1NUBA 1TTXA 5TNCA 1Y1XA 3D0YA 5I2QA 1UHJA 2A4JA 1GGWA 2CCMA 3VROA 3CR2A 3SG5A 1QVIZ 2GGZA 1R6PA 2PSRA 2ZFDA 3O6BA 3TZ1A 1K2HA 1JFKA 1LINA 1QASA 2WCEA 1BJFA 1AK8A 5AFPA 1J7PA 1K95A 1OE9B 3BOWB 3FS7A 4OR9B 2ZNEA 1DT7B 1DJWA 1Q80A 4HRHA 3TS5C 1FW4A 1ZMZA 1L2OC 2I2RE 2NLNA 1S26D 3WHTB 1UP5A 1IQ3A 2MJWB 2LAPA 1SY9A 4M2QA 3FWBA 2KBMA 3AAKA 2JRFA 5K89A 1FPWA 1L7ZA 3LL8B 5ER4X 5KTYA 3KF9A 1HT9A 5HKZA 2LLTA 1KQMB 1J55A 3IF7A 1DJXA 4HSZA 2E30A 2JXLA 2BL0B 1V1FA 5HLVA 3NSIA 1DJZA 1JF2A 2ISDA 5B8IB 1SCMB 5CSFA 2CNPA 1NP8A 3SG7A 5KU1A 1IG5A 2MAZA 4I5JA 1TNQA 4ORCB 1WRZA 4PE1A 3SG3A 5BPJA 4MSPA 1WDCB 2JXCA 2OS8B 4GGNA 1TRFA 2SASA 2TN4A 2BCBA 1YR5A 1RJVA 2KQ6A 5KSZA 2KGBC 1AVSA 2L5XB 3CZTX 3JVTC 4F0ZB 4M2OA 1JFJA 4JWQA 3PM8A 3JTDB 5DKRA 2Y1MA 2BBNA 2NCPA 3D0YB 1G33A 2ZNDA 3DVKA 3ZWHA 5CSNA 2H2KA 1WY9A 1UHKA 1CDMA 1CB1A 4ICBA 1R2UA 2JOJA 4DIRA 4A4BA 1DTLA 1RECA 3DD4A 3I5GB 3DVMA 4GGFA 1CDNA 4PCWA 2LE9B 1KFUS 1QLKA 4MZLA 3LK1A 1S1EA 3PLFB 2Y1NA 5DKNA 2PMYA 3VRQA 3RM1A 1IJ5A 1NX2A 1BU3A 2LVIA 2M7LA 1PALA 3AAJA 2Y5IA 1LKJA 1XFVO 1AUIB 2KNEA 2R2IA 2LP2A 3I5IB 4MRXA 1SRAA 2KQYA 1UURA 2OTGC 1OZSA 1F54A 4DCKA 5ER5A 1QTXA 1B1GA 2P6BB 3QRXA 2KI4B 3CR4X 1KQVA 2CBLA 2F2PA 2F2OA 5F6TA 1IRJA 2EGDA 4JPZB 4MBEA 1NX3A 1SNLA 2LVKA 1DMOA 1JF0A 2LMVA 2MBXA 1KCYA 3DVJA 3PN7C 1GQMA 3ZNIA 1B7TZ 2K7OA 2PRUA 4QJ4B 1MUXA 4AQIA 2ZRTA 1N65A 1A4PA 1EJ3A 2SCPA 1U5IA 3PATA 1J7RA 2Q4UA 3VRRA 2AUCA 1AJ5A 1BT6A 1CDLA 1KK7Z 2WOSA 1LA0A 2KYFA 1CFPA 1J1EA 1HQVA 4PHKA 1WLMA 2ZRSA 2BCAA 1YRTB 3FWCA 3EKJA 1G8IA 4L9MA 3AKAA 2LLUA 4NDBA 2KFHA 2LMUA 1K96A 1QV1A 1XA5A 3FIAA 1BR4B 1PVAA 2JT8A 2FJUB 1RFJA 3CWGA 4TNCA 3RLZA 1MR8A 2O5GA 1DJYA 1F55A 4CFQA 1XFXO 4GFTA 4P5OE 1BOCA 1FI6A 2LHLA 3GK1A 1QV0A 1CDPA 1N2DA 2PALA 1KQMC 2Q91A 1F4QA 4WRIA 2M7NA 2MA2A 3GK2A 1Y1AA 1QVIY 2F8PA 2B1UA 3EVVA 5G08A 1X02A 3PFVA 5IBWA 1QATA 4BY5A 4PALA 5FYXA 1Y6WA 1M39A 2F3ZA 3AKBA 3TDUA 2BKHB 1B8RA 3KPXA 4E68A 2LVJA 4JQ0D 4PDZA 4YI9A 1PSRA 4ORBB 1Y0VH 1YUTA 1RTP1 1DGUA 1QX7A 2G9BA 3OB1B 2M3WA 2QPTA 1XYDA 3I5HC 5D7FA 4YRUA 2IS9A 2EC6B 1S6CA 2KGRA 1PVBA 2CXJA 4GAOA 4QJ3B 2K2AA 4PE4A 1NPQA 1PRWA 1OZOA 1B47A 4UPGA 1JUOA 2ZKMX 1U5IB 2JC2A 1M46A 1RROA 3DVEA 3C1VA 1NYAA 3WXAA 1BLQA 1H4BA 2OPOA 1D1OA 1WLZA 2M1KB 1K8UA 1WRKA 3NXAA 2KYCA 1ZACA 2LUXA 5GQQC 2LP3A 1PSBA 3TUYC 2LNKA 1KSOA 1K93D 2JNFA 1MQ1A 1YTZC 3DF0A 4MEWA 2KFGA 2FCEA 5I8NA 4I5NB 2PASA 3SG6A 1LA3A 1BMOA 1C7VA 3PALA 2HF5A 1QX5B 2LCPA 3OHMB 1ZOTB 1SYMA 3BYAA 1K94A 1F4OA 3TS5B 5J3XA 1L2OB 1KK8C 4NQGA 1DF0A 1XFZO 4XJKA 1S36A 4GUKA 2COLB 1YURA 2I7AA 4N1FA 2F3YA 3SIAA 1AJ4A 2LHIA 4BY4A 1CFFA 1A2XA 2KDHA 4CIDA 1C7WA 2EHBA 5CSIA 1JSAA 1TCFA 3VRPA 3NSOA 1MXEA 4IL1A 2JULA 1BG1A 1ALWA 1K9KA 4HREE 2D8NA 1IGVA 2F33A 3EVRA 4OV2A 1W7IB 4P2YB 3HX4A 3OX5A 2K7DA 3O78A 2WNDA 2KHNA 3O4YA 3TDIA 2MLFC 1S5GZ 1SPYA 2NXQA 3HCMA 2HQ8A 5PALA 1QXPA 1DJGA 3SJSA 1KWOC 4CPVA 4FQOA 2LANA 1XO5A 2CTNA 1S5GY 1UHNA 2M0RA 2MHHA 2V53A 1H8BA 5AXIA 2LV7A 1ALVA 1SR6C 1UHIA 1OOJA 1KFUL 2JPTA 4OKHA 3JVTB 1EG3A 1SMGA 5HKYA 1ZFSA 2KAVA 3BXKA 1XFYO 1JC2A 3LK0A 1FI5A 3EK7A 4DUQA 1C07A 4U8DA 1B7TY 2K7BA 4C0KA 2NZ0A 2JZIA 1MHOA 5CSJA 1JBAA 2K2FA 3EVUA 2JWWA 3M0WA 1N0YA 2KBIA 3DF0B 3I5FB 1M45A 1YUUA 1IH0A 1KFXS 2RGIA 3VGOA 1KK7Y 3F45A 1RWYA 1DJHA 1UHHA 3WNXB 1XFUO 2JT0A 3H4SE 1SCVA 4OVNF 1DF0B 1NX1A 4XJKB 1EXRA 1CMGA 1OSAA 2MRDA 4GNKB 1S3PA 3SG2A 2ZN8A 4MRYA 1DJIA 1WRLA 4R1EA 2I18A 5JJGA 2HQWA 1SBJA 2JTTA 2M29A 1CMFA 1CNPA 1NX0A 1S6JA 2EC6C 2LUCA 3BQ3A 3SG4A 2I94A 3CR5X 1TNXA 1DGVA 4ORAB 1SL8A 1UWOA 5JOLA 2BL0C 4ETOA 5HYDA 1YX7A 2ZN9A 2BCXA 4AQJA 2BECA 3GOFA 1S6IA 1XK4C 3NSLA 2L51A 1QIVA 1RK9A 4N5XA 1SCMC 2CT9A 2H61C 4WQ3A 2VRGA 4M2PA 2BBMA 2M9GA 1K90D 4CFRA 2KAYA 1JWDA 4A4CA 5AERA 1OMRA 2BE6A 3VRNA 3GK4X 3D10A 4XYNA 1V1GA 1CKKA 1WDCC 1IKUA 2OS8C 1IJ6A 1EG4A 4MLWA 1F71A 3K21A 1F70A 2AMIA 3JTDC 2Y4QA 1QIWA 4I5KA 1J7QA 2L4HA 1NWDA 3BUWB 3MSEB 1YVHA 1B9AA 1XVJA 1LVCD 1YVLA 2KFFA 4YGDB 1OMVA 1EH2A 2KI6C 2L0PA 5DKQA 1A03A 1IWQA 1A75A 3A8RA 1AP4A 3I5GC 2L50A 1CTRA 2FOTA 2M1UA 2WORA 3LCPC 3NSKA 4MN0A 5CPVA 1CFCA 4GBAA 4ZCUA 1EL4A 1TNWA 4ZCVA 1QX2A 3IQQA 1XFWO 1SKTA 5AEQA 3BUNB 5I2OA 1CLLA 4MZKA 3I5IC 3BUOB 1K9PA 1K9UA 1FF1A 3BUMB 2JNXA 3O2PA 3CTNA 2G2BA 4PHNA 2L4IA 2L98A 1NSHA 2KI4C 3I5HB 1KSMA 1CLBA 5HKWA 1CM4A 1CM1A 4FTGA 4PE0A 1NCYA 2HPSA 1CFDA 1NIWA 2AAOA 2KSPA 3EK8A 4N1GA 2WCFA 5I2LA 3OP0A 1GGZA 1B4CA 1SL9A 2WC8A 2QACA 1BF5A 1MF8B 2K61A 3LLEA 2NCOA 1OQPA 2JQ6A 3CLNA 2FCDA 1QS7A 1MXLC 2WCBA 2K7CA 2KOTA 4DS7A 3WHUB 3I5FC 3BUXB 3KEVA 3TUYB 1VRKA 1IQ5A 2KI6D 3EKHA 1YUSA 3OB2B 4DRWA 4PHJA 1W7JB
chains in the Genus database with same CATH superfamily
2LC5A 4I5LB 1TCOB 3D75A 1B8LA 2M8UA 1YX8A 1W9ZA 3CDNA 1SL7A 3BFHA 3IVTA 5D69A 3A4UB 1M63B 2K60A 2LVVA 3OX6A 2L2EA 2BE4A 3BOWA 4WQ2A 4YGCB 3S0BA 1KK8B 1A75B 1TIZA 1ZUZA 2KAXA 3ICBA 4GGFC 2M49B 2GGMA 1NCXA 3E3RA 3SS3A 5FI7A 2MLEC 3CGAA 3TDZA 3KO0A 3CS1A 3Q8IA 3R1VA 4HRGA 1J7OA 1OOFA 3QMEA 1QLSA 1TOPA 1SW8A 4NDDA 1E8AA 4NDCA 1SK6D 2LMTA 1Y1UA 3R1OA 1SSEB 1UUSA 1PULA 4YGAA 3EK4A 2GV5A 2LLSA 1NCZA 2BKIB 4MVFA 2JU0A 4YI8A 1F8HA 2LM5A 1GJYA 1TN4A 4YGEB 2O60A 4MZJA 1B8CA 5AANA 2OTGB 1XK4A 4OCIA 4USLA 4CLNA 4D1EA 4QJ5B 2H61A 3SIBA 1KWOB 2M97A 2DOQA 3PSRA 4YBHB 4C0LA 1BODA 1PK0D 1M31A 1BR1B 1G4YR 1SR6B 3KHEA 2K0JA 4GPLB 4AOMA 1FBVA 2K8MB 1MWNA 5HLOA 1KFXL 2HETA 1YRUB 3PN7B 4PHMA 1CLMA 1ODBA 1TNPA 1DVIA 4PE7A 3IQOA 4C0JA 2JTZA 1LXFC 2JT3A 4YGBB 2PVBA 4Q04A 1A29A 1AHRA 1QJTA 2KLEA 1J1DA 1OMDA 2E6WA 1NUBA 1TTXA 3L4LA 3N7HA 5TNCA 3VB1A 1Y1XA 3D0YA 5I2QA 1UHJA 2A4JA 1GGWA 2CCMA 3VROA 3CR2A 3D77A 3SG5A 1QVIZ 3DY9A 2GGZA 1R6PA 1OOGA 4FQTA 2PSRA 2ZFDA 3O6BA 3TZ1A 1K2HA 1JFKA 1LINA 1QASA 2WCEA 1BJFA 5HL1A 1AK8A 5AFPA 1J7PA 1K95A 1OE9B 3BOWB 3FS7A 4OR9B 2ZNEA 1DT7B 2P71A 1DJWA 1Q80A 4HRHA 3TS5C 1FW4A 1ZMZA 1L2OC 2I2RE 2NLNA 1S26D 3V2LA 1UP5A 3WHTB 1IQ3A 2MJWB 2LAPA 1SY9A 4M2QA 4OZDA 3FWBA 2KBMA 3AAKA 2JRFA 5K89A 1FPWA 1L7ZA 1DQEA 3LL8B 5ER4X 5KTYA 3KF9A 1HT9A 5HKZA 2LLTA 1KQMB 1J55A 3IF7A 1DJXA 4HSZA 2E30A 2JXLA 2BL0B 1V1FA 3CYZA 5HLVA 3NSIA 1DJZA 3FE8A 1JF2A 2ISDA 5B8IB 1SCMB 5CSFA 2CNPA 1NP8A 3SG7A 5KU1A 1IG5A 2MAZA 2WC5A 4I5JA 2WCJA 1TNQA 4ORCB 1WRZA 4PE1A 3SG3A 5BPJA 4MSPA 1WDCB 2JXCA 4IJ7A 1C3ZA 2OS8B 1TRFA 2SASA 3L47A 4GGNA 2TN4A 2BCBA 1YR5A 1RJVA 2KQ6A 5KSZA 2KGBC 1GM0A 1AVSA 2L5XB 3CZTX 3JVTC 4F0ZB 4M2OA 1JFJA 4JWQA 3PM8A 3JTDB 5DKRA 2Y1MA 1DC1A 2BBNA 2NCPA 3D0YB 3B88A 1G33A 2ZNDA 3DVKA 3ZWHA 1DELA 2H2KA 5CSNA 1WY9A 1UHKA 1CDMA 1CB1A 4ICBA 1R2UA 2JOJA 4DIRA 3PM2A 4A4BA 1DTLA 1RECA 3DD4A 3I5GB 3DVMA 4GGFA 1CDNA 3B6XA 4PCWA 2YGUA 2LE9B 1KFUS 1QLKA 4MZLA 3CZ0A 1S1EA 3BJHA 3LK1A 3PLFB 2Y1NA 5DKNA 2PMYA 3D76A 3VRQA 3RM1A 1IJ5A 1NX2A 1BU3A 2LVIA 2M7LA 1PALA 3AAJA 2WC6A 1LKJA 2Y5IA 1XFVO 1AUIB 2ERBA 2KNEA 2LP2A 2R2IA 3FE9A 3I5IB 4MRXA 1SRAA 2KQYA 1UURA 2OTGC 1OZSA 1F54A 4DCKA 5ER5A 1QTXA 1B1GA 2P6BB 2QEHA 3QRXA 2KI4B 1OOIX 3CR4X 1KQVA 2CBLA 2F2PA 2F2OA 5F6TA 1IRJA 2EGDA 4JPZB 4MBEA 1NX3A 1SNLA 2LVKA 1DMOA 1JF0A 2LMVA 2MBXA 1KCYA 2H8VA 3DVJA 3PN7C 1GQMA 3ZNIA 1B7TZ 2K7OA 2PRUA 2WCKA 4QJ4B 1MUXA 3B7AA 4AQIA 2KLDA 2ZRTA 3CZ2A 1N65A 1A4PA 1EJ3A 2SCPA 1U5IA 3B86A 1J7RA 3PATA 1XFRA 2Q4UA 2AUCA 3VRRA 3S0GA 1AJ5A 1BT6A 1CDLA 1KK7Z 2WOSA 1LA0A 2KYFA 1CFPA 1J1EA 1HQVA 4PHKA 1WLMA 3CABA 2ZRSA 2BCAA 1YRTB 3FWCA 3EKJA 1G8IA 3NHIA 3DXLA 4L9MA 3AKAA 2LLUA 4NDBA 2KFHA 2LMUA 1K96A 1QV1A 1XA5A 2PYQA 3FIAA 1BR4B 1PVAA 1P28A 2JT8A 3OGNA 2FJUB 1RFJA 3CWGA 4TNCA 3RLZA 3S0AA 1MR8A 2O5GA 1DJYA 1F55A 4CFQA 1XFXO 4GFTA 4P5OE 1BOCA 1FI6A 3UO9A 2LHLA 3R72A 3GK1A 1QV0A 1CDPA 1Z4HA 1N2DA 2PALA 1TWOA 1KQMC 2Q91A 1F4QA 4WRIA 2M7NA 2MA2A 3GK2A 1Y1AA 1QVIY 2F8PA 2B1UA 2L5YA 3EVVA 5G08A 1X02A 3PFVA 5IBWA 1QATA 4BY5A 4PALA 5FYXA 1Y6WA 1M39A 2F3ZA 2JPOA 3AKBA 3D73A 3TDUA 2BKHB 1B8RA 3KPXA 4E68A 2LVJA 4JQ0D 4PDZA 4YI9A 1PSRA 2GTEA 2PQLA 4ORBB 1Y0VH 1YUTA 3S0DA 1RTP1 1DGUA 1QX7A 2G9BA 3OB1B 2M3WA 2QPTA 1XYDA 3I5HC 5D7FA 4YRUA 2IS9A 1OW4A 2EC6B 1S6CA 2KGRA 1PVBA 1T14A 2CXJA 4GAOA 4QJ3B 2K2AA 4PT1A 1DEKA 4JKTA 4PE4A 1NPQA 1PRWA 1OZOA 1B47A 4UPGA 1JUOA 2ZKMX 1U5IB 2JC2A 1M46A 1C3YA 1RROA 3DVEA 3C1VA 1NYAA 3WXAA 1BLQA 1H4BA 2OPOA 1D1OA 3K1EA 1WLZA 4KYNA 2M1KB 1K8UA 1WRKA 3D78A 3NXAA 2KYCA 1ZACA 3SS4A 2LUXA 5GQQC 3R1PA 2LP3A 1PSBA 3TUYC 2LNKA 1QWVA 1KSOA 1K93D 2JNFA 1MQ1A 1YTZC 3DF0A 3L4AA 2KFGA 2FCEA 4MEWA 3S0EA 4I5NB 2PASA 3SG6A 1LA3A 1BMOA 5I8NA 1C7VA 3PALA 2HF5A 1QX5B 2LCPA 3OHMB 1ZOTB 1SYMA 2KPHA 3BYAA 1K94A 1F4OA 3TS5B 5J3XA 1L2OB 1KK8C 4NQGA 5FI2A 5I94A 1DF0A 1XFZO 4XJKA 1S36A 4GUKA 2COLB 1YURA 2I7AA 4N1FA 2F3YA 3SIAA 1AJ4A 2LHIA 4BY4A 1CFFA 1A2XA 2KDHA 4CIDA 1C7WA 2EHBA 5CSIA 1JSAA 1TCFA 3VRPA 3NSOA 1MXEA 2WCHA 2JULA 4IL1A 1ALWA 1K9KA 4HREE 1BG1A 2P70A 2D8NA 1IGVA 2F33A 3EVRA 4JD9A 4OV2A 2BNXA 1W7IB 4P2YB 3HX4A 3OX5A 3NGVA 2K7DA 3O78A 2WNDA 2KHNA 3O4YA 3TDIA 2MLFC 1S5GZ 1OOHA 1SPYA 2NXQA 3HCMA 2HQ8A 5PALA 1QXPA 1DJGA 3SJSA 1KWOC 4CPVA 4FQOA 2LANA 1XO5A 2CTNA 1S5GY 1UHNA 2M0RA 2MHHA 2V53A 1H8BA 2WCLA 5AXIA 2LV7A 1ALVA 3BFBA 1SR6C 1UHIA 1OOJA 1KFUL 2JPTA 4OKHA 3JVTB 1EG3A 1SMGA 5HKYA 1ZFSA 2QEOA 2KAVA 3BXKA 1XFYO 1JC2A 3LK0A 1FI5A 3EK7A 4DUQA 1C07A 4U8DA 1B7TY 2K7BA 5FI6A 4C0KA 2NZ0A 2JZIA 1MHOA 5CSJA 1JBAA 2K2FA 3EVUA 2JWWA 3M0WA 1N0YA 2KBIA 1IIOA 3DF0B 3I5FB 1M45A 1YUUA 3CZ1A 1KFXS 2RGIA 3VGOA 1IH0A 1KK7Y 3F45A 1RWYA 1DJHA 1UHHA 3WNXB 1XFUO 2JT0A 3H4SE 1SCVA 4OVNF 3PJIA 1DF0B 1NX1A 4XJKB 1EXRA 1CMGA 1OSAA 2MRDA 4INWA 4GNKB 1S3PA 4INXA 3SG2A 3FE6A 2ZN8A 4MRYA 1DJIA 1WRLA 4R1EA 2I18A 5JJGA 2HQWA 1SBJA 2JTTA 2M29A 2FJYA 1CMFA 3DYEA 1CNPA 1NX0A 1S6JA 2EC6C 2LUCA 3BQ3A 3SG4A 2I94A 3CR5X 1TNXA 1DGVA 4ORAB 1SL8A 1UWOA 5JOLA 2BL0C 4ETOA 5HYDA 1YX7A 2ZN9A 2BCXA 1TUZA 2BECA 3O4XA 3GOFA 4AQJA 1S6IA 1XK4C 3NSLA 2L51A 1QIVA 1RK9A 4N5XA 1SCMC 2CT9A 2H61C 4WQ3A 2VRGA 4M2PA 2BBMA 2M9GA 1K90D 4CFRA 2BAPA 2KAYA 4A4CA 1JWDA 5AERA 1OMRA 2BE6A 3VRNA 3GK4X 3D10A 5DICA 3EG5B 4XYNA 1V1GA 5EL2A 1CKKA 1WDCC 1IKUA 2OS8C 1IJ6A 1EG4A 4MLWA 1F71A 2QEVA 3K21A 1F70A 2AMIA 3JTDC 2Y4QA 1QIWA 4I5KA 1J7QA 2L4HA 1NWDA 3BUWB 3NHTA 3MSEB 1YVHA 1B9AA 1XVJA 1LVCD 1YVLA 1Z2CB 2KFFA 4YGDB 1OMVA 1EH2A 2KI6C 2L0PA 5DKQA 1A03A 4F7FA 1IWQA 1A75A 3A8RA 5D3OA 3I5GC 1AP4A 2L50A 1CTRA 2FOTA 2M1UA 2WORA 3LCPC 3NSKA 4MN0A 5CPVA 2WCMA 4GBAA 1CFCA 4ZCUA 1EL4A 1TNWA 4ZCVA 1QX2A 3BFAA 3IQQA 1XFWO 1SKTA 3RZSA 5AEQA 3BUNB 5I2OA 1CLLA 4MZKA 3I5IC 3BUOB 1K9PA 1K9UA 2QDIA 1FF1A 3BUMB 3D74A 2JNXA 3O2PA 3CTNA 2G2BA 4PHNA 2L4IA 2L98A 1NSHA 2KI4C 3I5HB 1KSMA 1CLBA 5HKWA 1CM4A 1CM1A 1LS8A 3UNWA 4FTGA 4PE0A 1NCYA 2HPSA 1CFDA 1NIWA 2AAOA 2KSPA 2L2CA 1TUJA 3EK8A 2WCFA 4N1GA 5I2LA 3OP0A 1GGZA 1B4CA 1ORGA 1SL9A 2WC8A 2QACA 3DZTA 1BF5A 1MF8B 2K61A 3B87A 3LLEA 2NCOA 1OQPA 2JQ6A 3S0FA 3CLNA 2FCDA 1QS7A 1MXLC 2WCBA 2K7CA 2KOTA 4DS7A 3WHUB 3I5FC 3BUXB 3KEVA 3OBVA 3TUYB 1VRKA 1IQ5A 2KI6D 3EKHA 2QEBA 1YUSA 3OB2B 4DRWA 4PHJA 1W7JB 3SS5A
chains in the Genus database with same CATH topology
2LC5A 4I5LB 1TCOB 1B8LA 2M8UA 1YX8A 5D69A 1SL7A 3A4UB 1M63B 2LVVA 3OX6A 2L2EA 2BE4A 3BOWA 4WQ2A 4YGCB 1KK8B 1A75B 1TIZA 1ZUZA 2KAXA 3ICBA 4GGFC 2M49B 2GGMA 1NCXA 3E3RA 2MLEC 3CGAA 3TDZA 3KO0A 3CS1A 4HRGA 1J7OA 1QLSA 1TOPA 1SW8A 4NDDA 1E8AA 4NDCA 1SK6D 2LMTA 1Y1UA 1UUSA 1PULA 4YGAA 3EK4A 2GV5A 2LLSA 1NCZA 2BKIB 4MVFA 2JU0A 4YI8A 1F8HA 2LM5A 1GJYA 1TN4A 4YGEB 2O60A 4MZJA 1B8CA 5AANA 2OTGB 1XK4A 4OCIA 4USLA 4CLNA 4D1EA 4QJ5B 2H61A 3SIBA 1KWOB 2M97A 2DOQA 3PSRA 4YBHB 4C0LA 1BODA 1PK0D 1M31A 1BR1B 1G4YR 1SR6B 3KHEA 2K0JA 4GPLB 4AOMA 1FBVA 2K8MB 1MWNA 5HLOA 1KFXL 2HETA 1YRUB 3PN7B 4PHMA 1CLMA 1ODBA 1TNPA 1DVIA 4PE7A 3IQOA 4C0JA 2JTZA 1LXFC 2JT3A 4YGBB 2PVBA 4Q04A 1A29A 1AHRA 1QJTA 1J1DA 1OMDA 2E6WA 1NUBA 1TTXA 5TNCA 1Y1XA 3D0YA 5I2QA 1UHJA 2A4JA 1GGWA 2CCMA 3VROA 3CR2A 3SG5A 1QVIZ 2GGZA 1R6PA 2PSRA 2ZFDA 3O6BA 3TZ1A 1K2HA 1JFKA 1LINA 1QASA 2WCEA 1BJFA 1AK8A 5AFPA 1J7PA 1K95A 1OE9B 3BOWB 3FS7A 4OR9B 2ZNEA 1DT7B 1DJWA 1Q80A 4HRHA 3TS5C 1FW4A 1ZMZA 1L2OC 2I2RE 2NLNA 1S26D 3WHTB 1UP5A 1IQ3A 2MJWB 2LAPA 1SY9A 4M2QA 3FWBA 2KBMA 3AAKA 2JRFA 5K89A 1FPWA 1L7ZA 3LL8B 5ER4X 5KTYA 3KF9A 1HT9A 5HKZA 2LLTA 1KQMB 1J55A 3IF7A 1DJXA 4HSZA 2E30A 2JXLA 2BL0B 1V1FA 5HLVA 3NSIA 1DJZA 1JF2A 2ISDA 5B8IB 1SCMB 5CSFA 2CNPA 1NP8A 3SG7A 5KU1A 1IG5A 2MAZA 4I5JA 1TNQA 4ORCB 1WRZA 4PE1A 3SG3A 5BPJA 4MSPA 1WDCB 2JXCA 2OS8B 4GGNA 1TRFA 2SASA 2TN4A 2BCBA 1YR5A 1RJVA 2KQ6A 5KSZA 2KGBC 1AVSA 2L5XB 3CZTX 3JVTC 4F0ZB 4M2OA 1JFJA 4JWQA 3PM8A 3JTDB 5DKRA 2Y1MA 2BBNA 2NCPA 3D0YB 1G33A 2ZNDA 3DVKA 3ZWHA 5CSNA 2H2KA 1WY9A 1UHKA 1CDMA 1CB1A 4ICBA 1R2UA 2JOJA 4DIRA 4A4BA 1DTLA 1RECA 3DD4A 3I5GB 3DVMA 4GGFA 1CDNA 4PCWA 2LE9B 1KFUS 1QLKA 4MZLA 3LK1A 1S1EA 3PLFB 2Y1NA 5DKNA 2PMYA 3VRQA 3RM1A 1IJ5A 1NX2A 1BU3A 2LVIA 2M7LA 1PALA 3AAJA 2Y5IA 1LKJA 1XFVO 1AUIB 2KNEA 2R2IA 2LP2A 3I5IB 4MRXA 1SRAA 2KQYA 1UURA 2OTGC 1OZSA 1F54A 4DCKA 5ER5A 1QTXA 1B1GA 2P6BB 3QRXA 2KI4B 3CR4X 1KQVA 2CBLA 2F2PA 2F2OA 5F6TA 1IRJA 2EGDA 4JPZB 4MBEA 1NX3A 1SNLA 2LVKA 1DMOA 1JF0A 2LMVA 2MBXA 1KCYA 3DVJA 3PN7C 1GQMA 3ZNIA 1B7TZ 2K7OA 2PRUA 4QJ4B 1MUXA 4AQIA 2ZRTA 1N65A 1A4PA 1EJ3A 2SCPA 1U5IA 3PATA 1J7RA 2Q4UA 3VRRA 2AUCA 1AJ5A 1BT6A 1CDLA 1KK7Z 2WOSA 1LA0A 2KYFA 1CFPA 1J1EA 1HQVA 4PHKA 1WLMA 2ZRSA 2BCAA 1YRTB 3FWCA 3EKJA 1G8IA 4L9MA 3AKAA 2LLUA 4NDBA 2KFHA 2LMUA 1K96A 1QV1A 1XA5A 3FIAA 1BR4B 1PVAA 2JT8A 2FJUB 1RFJA 3CWGA 4TNCA 3RLZA 1MR8A 2O5GA 1DJYA 1F55A 4CFQA 1XFXO 4GFTA 4P5OE 1BOCA 1FI6A 2LHLA 3GK1A 1QV0A 1CDPA 1N2DA 2PALA 1KQMC 2Q91A 1F4QA 4WRIA 2M7NA 2MA2A 3GK2A 1Y1AA 1QVIY 2F8PA 2B1UA 3EVVA 5G08A 1X02A 3PFVA 5IBWA 1QATA 4BY5A 4PALA 5FYXA 1Y6WA 1M39A 2F3ZA 3AKBA 3TDUA 2BKHB 1B8RA 3KPXA 4E68A 2LVJA 4JQ0D 4PDZA 4YI9A 1PSRA 4ORBB 1Y0VH 1YUTA 1RTP1 1DGUA 1QX7A 2G9BA 3OB1B 2M3WA 2QPTA 1XYDA 3I5HC 5D7FA 4YRUA 2IS9A 2EC6B 1S6CA 2KGRA 1PVBA 2CXJA 4GAOA 4QJ3B 2K2AA 4PE4A 1NPQA 1PRWA 1OZOA 1B47A 4UPGA 1JUOA 2ZKMX 1U5IB 2JC2A 1M46A 1RROA 3DVEA 3C1VA 1NYAA 3WXAA 1BLQA 1H4BA 2OPOA 1D1OA 1WLZA 2M1KB 1K8UA 1WRKA 3NXAA 2KYCA 1ZACA 2LUXA 5GQQC 2LP3A 1PSBA 3TUYC 2LNKA 1KSOA 1K93D 2JNFA 1MQ1A 1YTZC 3DF0A 4MEWA 2KFGA 2FCEA 5I8NA 4I5NB 2PASA 3SG6A 1LA3A 1BMOA 1C7VA 3PALA 2HF5A 1QX5B 2LCPA 3OHMB 1ZOTB 1SYMA 3BYAA 1K94A 1F4OA 3TS5B 5J3XA 1L2OB 1KK8C 4NQGA 1DF0A 1XFZO 4XJKA 1S36A 4GUKA 2COLB 1YURA 2I7AA 4N1FA 2F3YA 3SIAA 1AJ4A 2LHIA 4BY4A 1CFFA 1A2XA 2KDHA 4CIDA 1C7WA 2EHBA 5CSIA 1JSAA 1TCFA 3VRPA 3NSOA 1MXEA 4IL1A 2JULA 1BG1A 1ALWA 1K9KA 4HREE 2D8NA 1IGVA 2F33A 3EVRA 4OV2A 1W7IB 4P2YB 3HX4A 3OX5A 2K7DA 3O78A 2WNDA 2KHNA 3O4YA 3TDIA 2MLFC 1S5GZ 1SPYA 2NXQA 3HCMA 2HQ8A 5PALA 1QXPA 1DJGA 3SJSA 1KWOC 4CPVA 4FQOA 2LANA 1XO5A 2CTNA 1S5GY 1UHNA 2M0RA 2MHHA 2V53A 1H8BA 5AXIA 2LV7A 1ALVA 1SR6C 1UHIA 1OOJA 1KFUL 2JPTA 4OKHA 3JVTB 1EG3A 1SMGA 5HKYA 1ZFSA 2KAVA 3BXKA 1XFYO 1JC2A 3LK0A 1FI5A 3EK7A 4DUQA 1C07A 4U8DA 1B7TY 2K7BA 4C0KA 2NZ0A 2JZIA 1MHOA 5CSJA 1JBAA 2K2FA 3EVUA 2JWWA 3M0WA 1N0YA 2KBIA 3DF0B 3I5FB 1M45A 1YUUA 1IH0A 1KFXS 2RGIA 3VGOA 1KK7Y 3F45A 1RWYA 1DJHA 1UHHA 3WNXB 1XFUO 2JT0A 3H4SE 1SCVA 4OVNF 1DF0B 1NX1A 4XJKB 1EXRA 1CMGA 1OSAA 2MRDA 4GNKB 1S3PA 3SG2A 2ZN8A 4MRYA 1DJIA 1WRLA 4R1EA 2I18A 5JJGA 2HQWA 1SBJA 2JTTA 2M29A 1CMFA 1CNPA 1NX0A 1S6JA 2EC6C 2LUCA 3BQ3A 3SG4A 2I94A 3CR5X 1TNXA 1DGVA 4ORAB 1SL8A 1UWOA 5JOLA 2BL0C 4ETOA 5HYDA 1YX7A 2ZN9A 2BCXA 4AQJA 2BECA 3GOFA 1S6IA 1XK4C 3NSLA 2L51A 1QIVA 1RK9A 4N5XA 1SCMC 2CT9A 2H61C 4WQ3A 2VRGA 4M2PA 2BBMA 2M9GA 1K90D 4CFRA 2KAYA 1JWDA 4A4CA 5AERA 1OMRA 2BE6A 3VRNA 3GK4X 3D10A 4XYNA 1V1GA 1CKKA 1WDCC 1IKUA 2OS8C 1IJ6A 1EG4A 4MLWA 1F71A 3K21A 1F70A 2AMIA 3JTDC 2Y4QA 1QIWA 4I5KA 1J7QA 2L4HA 1NWDA 3BUWB 3MSEB 1YVHA 1B9AA 1XVJA 1LVCD 1YVLA 2KFFA 4YGDB 1OMVA 1EH2A 2KI6C 2L0PA 5DKQA 1A03A 1IWQA 1A75A 3A8RA 1AP4A 3I5GC 2L50A 1CTRA 2FOTA 2M1UA 2WORA 3LCPC 3NSKA 4MN0A 5CPVA 1CFCA 4GBAA 4ZCUA 1EL4A 1TNWA 4ZCVA 1QX2A 3IQQA 1XFWO 1SKTA 5AEQA 3BUNB 5I2OA 1CLLA 4MZKA 3I5IC 3BUOB 1K9PA 1K9UA 1FF1A 3BUMB 2JNXA 3O2PA 3CTNA 2G2BA 4PHNA 2L4IA 2L98A 1NSHA 2KI4C 3I5HB 1KSMA 1CLBA 5HKWA 1CM4A 1CM1A 4FTGA 4PE0A 1NCYA 2HPSA 1CFDA 1NIWA 2AAOA 2KSPA 3EK8A 4N1GA 2WCFA 5I2LA 3OP0A 1GGZA 1B4CA 1SL9A 2WC8A 2QACA 1BF5A 1MF8B 2K61A 3LLEA 2NCOA 1OQPA 2JQ6A 3CLNA 2FCDA 1QS7A 1MXLC 2WCBA 2K7CA 2KOTA 4DS7A 3WHUB 3I5FC 3BUXB 3KEVA 3TUYB 1VRKA 1IQ5A 2KI6D 3EKHA 1YUSA 3OB2B 4DRWA 4PHJA 1W7JB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LC5 A;  4I5L B;  1TCO B;  1B8L A;  2M8U A;  1YX8 A;  5D69 A;  1SL7 A;  3A4U B;  1M63 B;  2LVV A;  3OX6 A;  2L2E A;  2BE4 A;  3BOW A;  4WQ2 A;  4YGC B;  1KK8 B;  1A75 B;  1TIZ A;  1ZUZ A;  2KAX A;  3ICB A;  4GGF C;  2M49 B;  2GGM A;  1NCX A;  3E3R A;  2MLE C;  3CGA A;  3TDZ A;  3KO0 A;  3CS1 A;  4HRG A;  1J7O A;  1QLS A;  1TOP A;  1SW8 A;  4NDD A;  1E8A A;  4NDC A;  1SK6 D;  2LMT A;  1Y1U A;  1UUS A;  1PUL A;  4YGA A;  3EK4 A;  2GV5 A;  2LLS A;  1NCZ A;  2BKI B;  4MVF A;  2JU0 A;  4YI8 A;  1F8H A;  2LM5 A;  1GJY A;  1TN4 A;  4YGE B;  2O60 A;  4MZJ A;  1B8C A;  5AAN A;  2OTG B;  1XK4 A;  4OCI A;  4USL A;  4CLN A;  4D1E A;  4QJ5 B;  2H61 A;  3SIB A;  1KWO B;  2M97 A;  2DOQ A;  3PSR A;  4YBH B;  4C0L A;  1BOD A;  1PK0 D;  1M31 A;  1BR1 B;  1G4Y R;  1SR6 B;  3KHE A;  2K0J A;  4GPL B;  4AOM A;  1FBV A;  2K8M B;  1MWN A;  5HLO A;  1KFX L;  2HET A;  1YRU B;  3PN7 B;  4PHM A;  1CLM A;  1ODB A;  1TNP A;  1DVI A;  4PE7 A;  3IQO A;  4C0J A;  2JTZ A;  1LXF C;  2JT3 A;  4YGB B;  2PVB A;  4Q04 A;  1A29 A;  1AHR A;  1QJT A;  1J1D A;  1OMD A;  2E6W A;  1NUB A;  1TTX A;  5TNC A;  1Y1X A;  3D0Y A;  5I2Q A;  1UHJ A;  2A4J A;  1GGW A;  2CCM A;  3VRO A;  3CR2 A;  3SG5 A;  1QVI Z;  2GGZ A;  1R6P A;  2PSR A;  2ZFD A;  3O6B A;  3TZ1 A;  1K2H A;  1JFK A;  1LIN A;  1QAS A;  2WCE A;  1BJF A;  1AK8 A;  5AFP A;  1J7P A;  1K95 A;  1OE9 B;  3BOW B;  3FS7 A;  4OR9 B;  2ZNE A;  1DT7 B;  1DJW A;  1Q80 A;  4HRH A;  3TS5 C;  1FW4 A;  1ZMZ A;  1L2O C;  2I2R E;  2NLN A;  1S26 D;  3WHT B;  1UP5 A;  1IQ3 A;  2MJW B;  2LAP A;  1SY9 A;  4M2Q A;  3FWB A;  2KBM A;  3AAK A;  2JRF A;  5K89 A;  1FPW A;  1L7Z A;  3LL8 B;  5ER4 X;  5KTY A;  3KF9 A;  1HT9 A;  5HKZ A;  2LLT A;  1KQM B;  1J55 A;  3IF7 A;  1DJX A;  4HSZ A;  2E30 A;  2JXL A;  2BL0 B;  1V1F A;  5HLV A;  3NSI A;  1DJZ A;  1JF2 A;  2ISD A;  5B8I B;  1SCM B;  5CSF A;  2CNP A;  1NP8 A;  3SG7 A;  5KU1 A;  1IG5 A;  2MAZ A;  4I5J A;  1TNQ A;  4ORC B;  1WRZ A;  4PE1 A;  3SG3 A;  5BPJ A;  4MSP A;  1WDC B;  2JXC A;  2OS8 B;  4GGN A;  1TRF A;  2SAS A;  2TN4 A;  2BCB A;  1YR5 A;  1RJV A;  2KQ6 A;  5KSZ A;  2KGB C;  1AVS A;  2L5X B;  3CZT X;  3JVT C;  4F0Z B;  4M2O A;  1JFJ A;  4JWQ A;  3PM8 A;  3JTD B;  5DKR A;  2Y1M A;  2BBN A;  2NCP A;  3D0Y B;  1G33 A;  2ZND A;  3DVK A;  3ZWH A;  5CSN A;  2H2K A;  1WY9 A;  1UHK A;  1CDM A;  1CB1 A;  4ICB A;  1R2U A;  2JOJ A;  4DIR A;  4A4B A;  1DTL A;  1REC A;  3DD4 A;  3I5G B;  3DVM A;  4GGF A;  1CDN A;  4PCW A;  2LE9 B;  1KFU S;  1QLK A;  4MZL A;  3LK1 A;  1S1E A;  3PLF B;  2Y1N A;  5DKN A;  2PMY A;  3VRQ A;  3RM1 A;  1IJ5 A;  1NX2 A;  1BU3 A;  2LVI A;  2M7L A;  1PAL A;  3AAJ A;  2Y5I A;  1LKJ A;  1XFV O;  1AUI B;  2KNE A;  2R2I A;  2LP2 A;  3I5I B;  4MRX A;  1SRA A;  2KQY A;  1UUR A;  2OTG C;  1OZS A;  1F54 A;  4DCK A;  5ER5 A;  1QTX A;  1B1G A;  2P6B B;  3QRX A;  2KI4 B;  3CR4 X;  1KQV A;  2CBL A;  2F2P A;  2F2O A;  5F6T A;  1IRJ A;  2EGD A;  4JPZ B;  4MBE A;  1NX3 A;  1SNL A;  2LVK A;  1DMO A;  1JF0 A;  2LMV A;  2MBX A;  1KCY A;  3DVJ A;  3PN7 C;  1GQM A;  3ZNI A;  1B7T Z;  2K7O A;  2PRU A;  4QJ4 B;  1MUX A;  4AQI A;  2ZRT A;  1N65 A;  1A4P A;  1EJ3 A;  2SCP A;  1U5I A;  3PAT A;  1J7R A;  2Q4U A;  3VRR A;  2AUC A;  1AJ5 A;  1BT6 A;  1CDL A;  1KK7 Z;  2WOS A;  1LA0 A;  2KYF A;  1CFP A;  1J1E A;  1HQV A;  4PHK A;  1WLM A;  2ZRS A;  2BCA A;  1YRT B;  3FWC A;  3EKJ A;  1G8I A;  4L9M A;  3AKA A;  2LLU A;  4NDB A;  2KFH A;  2LMU A;  1K96 A;  1QV1 A;  1XA5 A;  3FIA A;  1BR4 B;  1PVA A;  2JT8 A;  2FJU B;  1RFJ A;  3CWG A;  4TNC A;  3RLZ A;  1MR8 A;  2O5G A;  1DJY A;  1F55 A;  4CFQ A;  1XFX O;  4GFT A;  4P5O E;  1BOC A;  1FI6 A;  2LHL A;  3GK1 A;  1QV0 A;  1CDP A;  1N2D A;  2PAL A;  1KQM C;  2Q91 A;  1F4Q A;  4WRI A;  2M7N A;  2MA2 A;  3GK2 A;  1Y1A A;  1QVI Y;  2F8P A;  2B1U A;  3EVV A;  5G08 A;  1X02 A;  3PFV A;  5IBW A;  1QAT A;  4BY5 A;  4PAL A;  5FYX A;  1Y6W A;  1M39 A;  2F3Z A;  3AKB A;  3TDU A;  2BKH B;  1B8R A;  3KPX A;  4E68 A;  2LVJ A;  4JQ0 D;  4PDZ A;  4YI9 A;  1PSR A;  4ORB B;  1Y0V H;  1YUT A;  1RTP 1;  1DGU A;  1QX7 A;  2G9B A;  3OB1 B;  2M3W A;  2QPT A;  1XYD A;  3I5H C;  5D7F A;  4YRU A;  2IS9 A;  2EC6 B;  1S6C A;  2KGR A;  1PVB A;  2CXJ A;  4GAO A;  4QJ3 B;  2K2A A;  4PE4 A;  1NPQ A;  1PRW A;  1OZO A;  1B47 A;  4UPG A;  1JUO A;  2ZKM X;  1U5I B;  2JC2 A;  1M46 A;  1RRO A;  3DVE A;  3C1V A;  1NYA A;  3WXA A;  1BLQ A;  1H4B A;  2OPO A;  1D1O A;  1WLZ A;  2M1K B;  1K8U A;  1WRK A;  3NXA A;  2KYC A;  1ZAC A;  2LUX A;  5GQQ C;  2LP3 A;  1PSB A;  3TUY C;  2LNK A;  1KSO A;  1K93 D;  2JNF A;  1MQ1 A;  1YTZ C;  3DF0 A;  4MEW A;  2KFG A;  2FCE A;  5I8N A;  4I5N B;  2PAS A;  3SG6 A;  1LA3 A;  1BMO A;  1C7V A;  3PAL A;  2HF5 A;  1QX5 B;  2LCP A;  3OHM B;  1ZOT B;  1SYM A;  3BYA A;  1K94 A;  1F4O A;  3TS5 B;  5J3X A;  1L2O B;  1KK8 C;  4NQG A;  1DF0 A;  1XFZ O;  4XJK A;  1S36 A;  4GUK A;  2COL B;  1YUR A;  2I7A A;  4N1F A;  2F3Y A;  3SIA A;  1AJ4 A;  2LHI A;  4BY4 A;  1CFF A;  1A2X A;  2KDH A;  4CID A;  1C7W A;  2EHB A;  5CSI A;  1JSA A;  1TCF A;  3VRP A;  3NSO A;  1MXE A;  4IL1 A;  2JUL A;  1BG1 A;  1ALW A;  1K9K A;  4HRE E;  2D8N A;  1IGV A;  2F33 A;  3EVR A;  4OV2 A;  1W7I B;  4P2Y B;  3HX4 A;  3OX5 A;  2K7D A;  3O78 A;  2WND A;  2KHN A;  3O4Y A;  3TDI A;  2MLF C;  1S5G Z;  1SPY A;  2NXQ A;  3HCM A;  2HQ8 A;  5PAL A;  1QXP A;  1DJG A;  3SJS A;  1KWO C;  4CPV A;  4FQO A;  2LAN A;  1XO5 A;  2CTN A;  1S5G Y;  1UHN A;  2M0R A;  2MHH A;  2V53 A;  1H8B A;  5AXI A;  2LV7 A;  1ALV A;  1SR6 C;  1UHI A;  1OOJ A;  1KFU L;  2JPT A;  4OKH A;  3JVT B;  1EG3 A;  1SMG A;  5HKY A;  1ZFS A;  2KAV A;  3BXK A;  1XFY O;  1JC2 A;  3LK0 A;  1FI5 A;  3EK7 A;  4DUQ A;  1C07 A;  4U8D A;  1B7T Y;  2K7B A;  4C0K A;  2NZ0 A;  2JZI A;  1MHO A;  5CSJ A;  1JBA A;  2K2F A;  3EVU A;  2JWW A;  3M0W A;  1N0Y A;  2KBI A;  3DF0 B;  3I5F B;  1M45 A;  1YUU A;  1IH0 A;  1KFX S;  2RGI A;  3VGO A;  1KK7 Y;  3F45 A;  1RWY A;  1DJH A;  1UHH A;  3WNX B;  1XFU O;  2JT0 A;  3H4S E;  1SCV A;  4OVN F;  1DF0 B;  1NX1 A;  4XJK B;  1EXR A;  1CMG A;  1OSA A;  2MRD A;  4GNK B;  1S3P A;  3SG2 A;  2ZN8 A;  4MRY A;  1DJI A;  1WRL A;  4R1E A;  2I18 A;  5JJG A;  2HQW A;  1SBJ A;  2JTT A;  2M29 A;  1CMF A;  1CNP A;  1NX0 A;  1S6J A;  2EC6 C;  2LUC A;  3BQ3 A;  3SG4 A;  2I94 A;  3CR5 X;  1TNX A;  1DGV A;  4ORA B;  1SL8 A;  1UWO A;  5JOL A;  2BL0 C;  4ETO A;  5HYD A;  1YX7 A;  2ZN9 A;  2BCX A;  4AQJ A;  2BEC A;  3GOF A;  1S6I A;  1XK4 C;  3NSL A;  2L51 A;  1QIV A;  1RK9 A;  4N5X A;  1SCM C;  2CT9 A;  2H61 C;  4WQ3 A;  2VRG A;  4M2P A;  2BBM A;  2M9G A;  1K90 D;  4CFR A;  2KAY A;  1JWD A;  4A4C A;  5AER A;  1OMR A;  2BE6 A;  3VRN A;  3GK4 X;  3D10 A;  4XYN A;  1V1G A;  1CKK A;  1WDC C;  1IKU A;  2OS8 C;  1IJ6 A;  1EG4 A;  4MLW A;  1F71 A;  3K21 A;  1F70 A;  2AMI A;  3JTD C;  2Y4Q A;  1QIW A;  4I5K A;  1J7Q A;  2L4H A;  1NWD A;  3BUW B;  3MSE B;  1YVH A;  1B9A A;  1XVJ A;  1LVC D;  1YVL A;  2KFF A;  4YGD B;  1OMV A;  1EH2 A;  2KI6 C;  2L0P A;  5DKQ A;  1A03 A;  1IWQ A;  1A75 A;  3A8R A;  1AP4 A;  3I5G C;  2L50 A;  1CTR A;  2FOT A;  2M1U A;  2WOR A;  3LCP C;  3NSK A;  4MN0 A;  5CPV A;  1CFC A;  4GBA A;  4ZCU A;  1EL4 A;  1TNW A;  4ZCV A;  1QX2 A;  3IQQ A;  1XFW O;  1SKT A;  5AEQ A;  3BUN B;  5I2O A;  1CLL A;  4MZK A;  3I5I C;  3BUO B;  1K9P A;  1K9U A;  1FF1 A;  3BUM B;  2JNX A;  3O2P A;  3CTN A;  2G2B A;  4PHN A;  2L4I A;  2L98 A;  1NSH A;  2KI4 C;  3I5H B;  1KSM A;  1CLB A;  5HKW A;  1CM4 A;  1CM1 A;  4FTG A;  4PE0 A;  1NCY A;  2HPS A;  1CFD A;  1NIW A;  2AAO A;  2KSP A;  3EK8 A;  4N1G A;  2WCF A;  5I2L A;  3OP0 A;  1GGZ A;  1B4C A;  1SL9 A;  2WC8 A;  2QAC A;  1BF5 A;  1MF8 B;  2K61 A;  3LLE A;  2NCO A;  1OQP A;  2JQ6 A;  3CLN A;  2FCD A;  1QS7 A;  1MXL C;  2WCB A;  2K7C A;  2KOT A;  4DS7 A;  3WHU B;  3I5F C;  3BUX B;  3KEV A;  3TUY B;  1VRK A;  1IQ5 A;  2KI6 D;  3EKH A;  1YUS A;  3OB2 B;  4DRW A;  4PHJ A;  1W7J B; 
#chains in the Genus database with same CATH topology
 2LC5 A;  4I5L B;  1TCO B;  3D75 A;  1B8L A;  2M8U A;  1YX8 A;  1W9Z A;  3CDN A;  1SL7 A;  3BFH A;  3IVT A;  5D69 A;  3A4U B;  1M63 B;  2K60 A;  2LVV A;  3OX6 A;  2L2E A;  2BE4 A;  3BOW A;  4WQ2 A;  4YGC B;  3S0B A;  1KK8 B;  1A75 B;  1TIZ A;  1ZUZ A;  2KAX A;  3ICB A;  4GGF C;  2M49 B;  2GGM A;  1NCX A;  3E3R A;  3SS3 A;  5FI7 A;  2MLE C;  3CGA A;  3TDZ A;  3KO0 A;  3CS1 A;  3Q8I A;  3R1V A;  4HRG A;  1J7O A;  1OOF A;  3QME A;  1QLS A;  1TOP A;  1SW8 A;  4NDD A;  1E8A A;  4NDC A;  1SK6 D;  2LMT A;  1Y1U A;  3R1O A;  1SSE B;  1UUS A;  1PUL A;  4YGA A;  3EK4 A;  2GV5 A;  2LLS A;  1NCZ A;  2BKI B;  4MVF A;  2JU0 A;  4YI8 A;  1F8H A;  2LM5 A;  1GJY A;  1TN4 A;  4YGE B;  2O60 A;  4MZJ A;  1B8C A;  5AAN A;  2OTG B;  1XK4 A;  4OCI A;  4USL A;  4CLN A;  4D1E A;  4QJ5 B;  2H61 A;  3SIB A;  1KWO B;  2M97 A;  2DOQ A;  3PSR A;  4YBH B;  4C0L A;  1BOD A;  1PK0 D;  1M31 A;  1BR1 B;  1G4Y R;  1SR6 B;  3KHE A;  2K0J A;  4GPL B;  4AOM A;  1FBV A;  2K8M B;  1MWN A;  5HLO A;  1KFX L;  2HET A;  1YRU B;  3PN7 B;  4PHM A;  1CLM A;  1ODB A;  1TNP A;  1DVI A;  4PE7 A;  3IQO A;  4C0J A;  2JTZ A;  1LXF C;  2JT3 A;  4YGB B;  2PVB A;  4Q04 A;  1A29 A;  1AHR A;  1QJT A;  2KLE A;  1J1D A;  1OMD A;  2E6W A;  1NUB A;  1TTX A;  3L4L A;  3N7H A;  5TNC A;  3VB1 A;  1Y1X A;  3D0Y A;  5I2Q A;  1UHJ A;  2A4J A;  1GGW A;  2CCM A;  3VRO A;  3CR2 A;  3D77 A;  3SG5 A;  1QVI Z;  3DY9 A;  2GGZ A;  1R6P A;  1OOG A;  4FQT A;  2PSR A;  2ZFD A;  3O6B A;  3TZ1 A;  1K2H A;  1JFK A;  1LIN A;  1QAS A;  2WCE A;  1BJF A;  5HL1 A;  1AK8 A;  5AFP A;  1J7P A;  1K95 A;  1OE9 B;  3BOW B;  3FS7 A;  4OR9 B;  2ZNE A;  1DT7 B;  2P71 A;  1DJW A;  1Q80 A;  4HRH A;  3TS5 C;  1FW4 A;  1ZMZ A;  1L2O C;  2I2R E;  2NLN A;  1S26 D;  3V2L A;  1UP5 A;  3WHT B;  1IQ3 A;  2MJW B;  2LAP A;  1SY9 A;  4M2Q A;  4OZD A;  3FWB A;  2KBM A;  3AAK A;  2JRF A;  5K89 A;  1FPW A;  1L7Z A;  1DQE A;  3LL8 B;  5ER4 X;  5KTY A;  3KF9 A;  1HT9 A;  5HKZ A;  2LLT A;  1KQM B;  1J55 A;  3IF7 A;  1DJX A;  4HSZ A;  2E30 A;  2JXL A;  2BL0 B;  1V1F A;  3CYZ A;  5HLV A;  3NSI A;  1DJZ A;  3FE8 A;  1JF2 A;  2ISD A;  5B8I B;  1SCM B;  5CSF A;  2CNP A;  1NP8 A;  3SG7 A;  5KU1 A;  1IG5 A;  2MAZ A;  2WC5 A;  4I5J A;  2WCJ A;  1TNQ A;  4ORC B;  1WRZ A;  4PE1 A;  3SG3 A;  5BPJ A;  4MSP A;  1WDC B;  2JXC A;  4IJ7 A;  1C3Z A;  2OS8 B;  1TRF A;  2SAS A;  3L47 A;  4GGN A;  2TN4 A;  2BCB A;  1YR5 A;  1RJV A;  2KQ6 A;  5KSZ A;  2KGB C;  1GM0 A;  1AVS A;  2L5X B;  3CZT X;  3JVT C;  4F0Z B;  4M2O A;  1JFJ A;  4JWQ A;  3PM8 A;  3JTD B;  5DKR A;  2Y1M A;  1DC1 A;  2BBN A;  2NCP A;  3D0Y B;  3B88 A;  1G33 A;  2ZND A;  3DVK A;  3ZWH A;  1DEL A;  2H2K A;  5CSN A;  1WY9 A;  1UHK A;  1CDM A;  1CB1 A;  4ICB A;  1R2U A;  2JOJ A;  4DIR A;  3PM2 A;  4A4B A;  1DTL A;  1REC A;  3DD4 A;  3I5G B;  3DVM A;  4GGF A;  1CDN A;  3B6X A;  4PCW A;  2YGU A;  2LE9 B;  1KFU S;  1QLK A;  4MZL A;  3CZ0 A;  1S1E A;  3BJH A;  3LK1 A;  3PLF B;  2Y1N A;  5DKN A;  2PMY A;  3D76 A;  3VRQ A;  3RM1 A;  1IJ5 A;  1NX2 A;  1BU3 A;  2LVI A;  2M7L A;  1PAL A;  3AAJ A;  2WC6 A;  1LKJ A;  2Y5I A;  1XFV O;  1AUI B;  2ERB A;  2KNE A;  2LP2 A;  2R2I A;  3FE9 A;  3I5I B;  4MRX A;  1SRA A;  2KQY A;  1UUR A;  2OTG C;  1OZS A;  1F54 A;  4DCK A;  5ER5 A;  1QTX A;  1B1G A;  2P6B B;  2QEH A;  3QRX A;  2KI4 B;  1OOI X;  3CR4 X;  1KQV A;  2CBL A;  2F2P A;  2F2O A;  5F6T A;  1IRJ A;  2EGD A;  4JPZ B;  4MBE A;  1NX3 A;  1SNL A;  2LVK A;  1DMO A;  1JF0 A;  2LMV A;  2MBX A;  1KCY A;  2H8V A;  3DVJ A;  3PN7 C;  1GQM A;  3ZNI A;  1B7T Z;  2K7O A;  2PRU A;  2WCK A;  4QJ4 B;  1MUX A;  3B7A A;  4AQI A;  2KLD A;  2ZRT A;  3CZ2 A;  1N65 A;  1A4P A;  1EJ3 A;  2SCP A;  1U5I A;  3B86 A;  1J7R A;  3PAT A;  1XFR A;  2Q4U A;  2AUC A;  3VRR A;  3S0G A;  1AJ5 A;  1BT6 A;  1CDL A;  1KK7 Z;  2WOS A;  1LA0 A;  2KYF A;  1CFP A;  1J1E A;  1HQV A;  4PHK A;  1WLM A;  3CAB A;  2ZRS A;  2BCA A;  1YRT B;  3FWC A;  3EKJ A;  1G8I A;  3NHI A;  3DXL A;  4L9M A;  3AKA A;  2LLU A;  4NDB A;  2KFH A;  2LMU A;  1K96 A;  1QV1 A;  1XA5 A;  2PYQ A;  3FIA A;  1BR4 B;  1PVA A;  1P28 A;  2JT8 A;  3OGN A;  2FJU B;  1RFJ A;  3CWG A;  4TNC A;  3RLZ A;  3S0A A;  1MR8 A;  2O5G A;  1DJY A;  1F55 A;  4CFQ A;  1XFX O;  4GFT A;  4P5O E;  1BOC A;  1FI6 A;  3UO9 A;  2LHL A;  3R72 A;  3GK1 A;  1QV0 A;  1CDP A;  1Z4H A;  1N2D A;  2PAL A;  1TWO A;  1KQM C;  2Q91 A;  1F4Q A;  4WRI A;  2M7N A;  2MA2 A;  3GK2 A;  1Y1A A;  1QVI Y;  2F8P A;  2B1U A;  2L5Y A;  3EVV A;  5G08 A;  1X02 A;  3PFV A;  5IBW A;  1QAT A;  4BY5 A;  4PAL A;  5FYX A;  1Y6W A;  1M39 A;  2F3Z A;  2JPO A;  3AKB A;  3D73 A;  3TDU A;  2BKH B;  1B8R A;  3KPX A;  4E68 A;  2LVJ A;  4JQ0 D;  4PDZ A;  4YI9 A;  1PSR A;  2GTE A;  2PQL A;  4ORB B;  1Y0V H;  1YUT A;  3S0D A;  1RTP 1;  1DGU A;  1QX7 A;  2G9B A;  3OB1 B;  2M3W A;  2QPT A;  1XYD A;  3I5H C;  5D7F A;  4YRU A;  2IS9 A;  1OW4 A;  2EC6 B;  1S6C A;  2KGR A;  1PVB A;  1T14 A;  2CXJ A;  4GAO A;  4QJ3 B;  2K2A A;  4PT1 A;  1DEK A;  4JKT A;  4PE4 A;  1NPQ A;  1PRW A;  1OZO A;  1B47 A;  4UPG A;  1JUO A;  2ZKM X;  1U5I B;  2JC2 A;  1M46 A;  1C3Y A;  1RRO A;  3DVE A;  3C1V A;  1NYA A;  3WXA A;  1BLQ A;  1H4B A;  2OPO A;  1D1O A;  3K1E A;  1WLZ A;  4KYN A;  2M1K B;  1K8U A;  1WRK A;  3D78 A;  3NXA A;  2KYC A;  1ZAC A;  3SS4 A;  2LUX A;  5GQQ C;  3R1P A;  2LP3 A;  1PSB A;  3TUY C;  2LNK A;  1QWV A;  1KSO A;  1K93 D;  2JNF A;  1MQ1 A;  1YTZ C;  3DF0 A;  3L4A A;  2KFG A;  2FCE A;  4MEW A;  3S0E A;  4I5N B;  2PAS A;  3SG6 A;  1LA3 A;  1BMO A;  5I8N A;  1C7V A;  3PAL A;  2HF5 A;  1QX5 B;  2LCP A;  3OHM B;  1ZOT B;  1SYM A;  2KPH A;  3BYA A;  1K94 A;  1F4O A;  3TS5 B;  5J3X A;  1L2O B;  1KK8 C;  4NQG A;  5FI2 A;  5I94 A;  1DF0 A;  1XFZ O;  4XJK A;  1S36 A;  4GUK A;  2COL B;  1YUR A;  2I7A A;  4N1F A;  2F3Y A;  3SIA A;  1AJ4 A;  2LHI A;  4BY4 A;  1CFF A;  1A2X A;  2KDH A;  4CID A;  1C7W A;  2EHB A;  5CSI A;  1JSA A;  1TCF A;  3VRP A;  3NSO A;  1MXE A;  2WCH A;  2JUL A;  4IL1 A;  1ALW A;  1K9K A;  4HRE E;  1BG1 A;  2P70 A;  2D8N A;  1IGV A;  2F33 A;  3EVR A;  4JD9 A;  4OV2 A;  2BNX A;  1W7I B;  4P2Y B;  3HX4 A;  3OX5 A;  3NGV A;  2K7D A;  3O78 A;  2WND A;  2KHN A;  3O4Y A;  3TDI A;  2MLF C;  1S5G Z;  1OOH A;  1SPY A;  2NXQ A;  3HCM A;  2HQ8 A;  5PAL A;  1QXP A;  1DJG A;  3SJS A;  1KWO C;  4CPV A;  4FQO A;  2LAN A;  1XO5 A;  2CTN A;  1S5G Y;  1UHN A;  2M0R A;  2MHH A;  2V53 A;  1H8B A;  2WCL A;  5AXI A;  2LV7 A;  1ALV A;  3BFB A;  1SR6 C;  1UHI A;  1OOJ A;  1KFU L;  2JPT A;  4OKH A;  3JVT B;  1EG3 A;  1SMG A;  5HKY A;  1ZFS A;  2QEO A;  2KAV A;  3BXK A;  1XFY O;  1JC2 A;  3LK0 A;  1FI5 A;  3EK7 A;  4DUQ A;  1C07 A;  4U8D A;  1B7T Y;  2K7B A;  5FI6 A;  4C0K A;  2NZ0 A;  2JZI A;  1MHO A;  5CSJ A;  1JBA A;  2K2F A;  3EVU A;  2JWW A;  3M0W A;  1N0Y A;  2KBI A;  1IIO A;  3DF0 B;  3I5F B;  1M45 A;  1YUU A;  3CZ1 A;  1KFX S;  2RGI A;  3VGO A;  1IH0 A;  1KK7 Y;  3F45 A;  1RWY A;  1DJH A;  1UHH A;  3WNX B;  1XFU O;  2JT0 A;  3H4S E;  1SCV A;  4OVN F;  3PJI A;  1DF0 B;  1NX1 A;  4XJK B;  1EXR A;  1CMG A;  1OSA A;  2MRD A;  4INW A;  4GNK B;  1S3P A;  4INX A;  3SG2 A;  3FE6 A;  2ZN8 A;  4MRY A;  1DJI A;  1WRL A;  4R1E A;  2I18 A;  5JJG A;  2HQW A;  1SBJ A;  2JTT A;  2M29 A;  2FJY A;  1CMF A;  3DYE A;  1CNP A;  1NX0 A;  1S6J A;  2EC6 C;  2LUC A;  3BQ3 A;  3SG4 A;  2I94 A;  3CR5 X;  1TNX A;  1DGV A;  4ORA B;  1SL8 A;  1UWO A;  5JOL A;  2BL0 C;  4ETO A;  5HYD A;  1YX7 A;  2ZN9 A;  2BCX A;  1TUZ A;  2BEC A;  3O4X A;  3GOF A;  4AQJ A;  1S6I A;  1XK4 C;  3NSL A;  2L51 A;  1QIV A;  1RK9 A;  4N5X A;  1SCM C;  2CT9 A;  2H61 C;  4WQ3 A;  2VRG A;  4M2P A;  2BBM A;  2M9G A;  1K90 D;  4CFR A;  2BAP A;  2KAY A;  4A4C A;  1JWD A;  5AER A;  1OMR A;  2BE6 A;  3VRN A;  3GK4 X;  3D10 A;  5DIC A;  3EG5 B;  4XYN A;  1V1G A;  5EL2 A;  1CKK A;  1WDC C;  1IKU A;  2OS8 C;  1IJ6 A;  1EG4 A;  4MLW A;  1F71 A;  2QEV A;  3K21 A;  1F70 A;  2AMI A;  3JTD C;  2Y4Q A;  1QIW A;  4I5K A;  1J7Q A;  2L4H A;  1NWD A;  3BUW B;  3NHT A;  3MSE B;  1YVH A;  1B9A A;  1XVJ A;  1LVC D;  1YVL A;  1Z2C B;  2KFF A;  4YGD B;  1OMV A;  1EH2 A;  2KI6 C;  2L0P A;  5DKQ A;  1A03 A;  4F7F A;  1IWQ A;  1A75 A;  3A8R A;  5D3O A;  3I5G C;  1AP4 A;  2L50 A;  1CTR A;  2FOT A;  2M1U A;  2WOR A;  3LCP C;  3NSK A;  4MN0 A;  5CPV A;  2WCM A;  4GBA A;  1CFC A;  4ZCU A;  1EL4 A;  1TNW A;  4ZCV A;  1QX2 A;  3BFA A;  3IQQ A;  1XFW O;  1SKT A;  3RZS A;  5AEQ A;  3BUN B;  5I2O A;  1CLL A;  4MZK A;  3I5I C;  3BUO B;  1K9P A;  1K9U A;  2QDI A;  1FF1 A;  3BUM B;  3D74 A;  2JNX A;  3O2P A;  3CTN A;  2G2B A;  4PHN A;  2L4I A;  2L98 A;  1NSH A;  2KI4 C;  3I5H B;  1KSM A;  1CLB A;  5HKW A;  1CM4 A;  1CM1 A;  1LS8 A;  3UNW A;  4FTG A;  4PE0 A;  1NCY A;  2HPS A;  1CFD A;  1NIW A;  2AAO A;  2KSP A;  2L2C A;  1TUJ A;  3EK8 A;  2WCF A;  4N1G A;  5I2L A;  3OP0 A;  1GGZ A;  1B4C A;  1ORG A;  1SL9 A;  2WC8 A;  2QAC A;  3DZT A;  1BF5 A;  1MF8 B;  2K61 A;  3B87 A;  3LLE A;  2NCO A;  1OQP A;  2JQ6 A;  3S0F A;  3CLN A;  2FCD A;  1QS7 A;  1MXL C;  2WCB A;  2K7C A;  2KOT A;  4DS7 A;  3WHU B;  3I5F C;  3BUX B;  3KEV A;  3OBV A;  3TUY B;  1VRK A;  1IQ5 A;  2KI6 D;  3EKH A;  2QEB A;  1YUS A;  3OB2 B;  4DRW A;  4PHJ A;  1W7J B;  3SS5 A; 
#chains in the Genus database with same CATH homology
 2LC5 A;  4I5L B;  1TCO B;  1B8L A;  2M8U A;  1YX8 A;  5D69 A;  1SL7 A;  3A4U B;  1M63 B;  2LVV A;  3OX6 A;  2L2E A;  2BE4 A;  3BOW A;  4WQ2 A;  4YGC B;  1KK8 B;  1A75 B;  1TIZ A;  1ZUZ A;  2KAX A;  3ICB A;  4GGF C;  2M49 B;  2GGM A;  1NCX A;  3E3R A;  2MLE C;  3CGA A;  3TDZ A;  3KO0 A;  3CS1 A;  4HRG A;  1J7O A;  1QLS A;  1TOP A;  1SW8 A;  4NDD A;  1E8A A;  4NDC A;  1SK6 D;  2LMT A;  1Y1U A;  1UUS A;  1PUL A;  4YGA A;  3EK4 A;  2GV5 A;  2LLS A;  1NCZ A;  2BKI B;  4MVF A;  2JU0 A;  4YI8 A;  1F8H A;  2LM5 A;  1GJY A;  1TN4 A;  4YGE B;  2O60 A;  4MZJ A;  1B8C A;  5AAN A;  2OTG B;  1XK4 A;  4OCI A;  4USL A;  4CLN A;  4D1E A;  4QJ5 B;  2H61 A;  3SIB A;  1KWO B;  2M97 A;  2DOQ A;  3PSR A;  4YBH B;  4C0L A;  1BOD A;  1PK0 D;  1M31 A;  1BR1 B;  1G4Y R;  1SR6 B;  3KHE A;  2K0J A;  4GPL B;  4AOM A;  1FBV A;  2K8M B;  1MWN A;  5HLO A;  1KFX L;  2HET A;  1YRU B;  3PN7 B;  4PHM A;  1CLM A;  1ODB A;  1TNP A;  1DVI A;  4PE7 A;  3IQO A;  4C0J A;  2JTZ A;  1LXF C;  2JT3 A;  4YGB B;  2PVB A;  4Q04 A;  1A29 A;  1AHR A;  1QJT A;  1J1D A;  1OMD A;  2E6W A;  1NUB A;  1TTX A;  5TNC A;  1Y1X A;  3D0Y A;  5I2Q A;  1UHJ A;  2A4J A;  1GGW A;  2CCM A;  3VRO A;  3CR2 A;  3SG5 A;  1QVI Z;  2GGZ A;  1R6P A;  2PSR A;  2ZFD A;  3O6B A;  3TZ1 A;  1K2H A;  1JFK A;  1LIN A;  1QAS A;  2WCE A;  1BJF A;  1AK8 A;  5AFP A;  1J7P A;  1K95 A;  1OE9 B;  3BOW B;  3FS7 A;  4OR9 B;  2ZNE A;  1DT7 B;  1DJW A;  1Q80 A;  4HRH A;  3TS5 C;  1FW4 A;  1ZMZ A;  1L2O C;  2I2R E;  2NLN A;  1S26 D;  3WHT B;  1UP5 A;  1IQ3 A;  2MJW B;  2LAP A;  1SY9 A;  4M2Q A;  3FWB A;  2KBM A;  3AAK A;  2JRF A;  5K89 A;  1FPW A;  1L7Z A;  3LL8 B;  5ER4 X;  5KTY A;  3KF9 A;  1HT9 A;  5HKZ A;  2LLT A;  1KQM B;  1J55 A;  3IF7 A;  1DJX A;  4HSZ A;  2E30 A;  2JXL A;  2BL0 B;  1V1F A;  5HLV A;  3NSI A;  1DJZ A;  1JF2 A;  2ISD A;  5B8I B;  1SCM B;  5CSF A;  2CNP A;  1NP8 A;  3SG7 A;  5KU1 A;  1IG5 A;  2MAZ A;  4I5J A;  1TNQ A;  4ORC B;  1WRZ A;  4PE1 A;  3SG3 A;  5BPJ A;  4MSP A;  1WDC B;  2JXC A;  2OS8 B;  4GGN A;  1TRF A;  2SAS A;  2TN4 A;  2BCB A;  1YR5 A;  1RJV A;  2KQ6 A;  5KSZ A;  2KGB C;  1AVS A;  2L5X B;  3CZT X;  3JVT C;  4F0Z B;  4M2O A;  1JFJ A;  4JWQ A;  3PM8 A;  3JTD B;  5DKR A;  2Y1M A;  2BBN A;  2NCP A;  3D0Y B;  1G33 A;  2ZND A;  3DVK A;  3ZWH A;  5CSN A;  2H2K A;  1WY9 A;  1UHK A;  1CDM A;  1CB1 A;  4ICB A;  1R2U A;  2JOJ A;  4DIR A;  4A4B A;  1DTL A;  1REC A;  3DD4 A;  3I5G B;  3DVM A;  4GGF A;  1CDN A;  4PCW A;  2LE9 B;  1KFU S;  1QLK A;  4MZL A;  3LK1 A;  1S1E A;  3PLF B;  2Y1N A;  5DKN A;  2PMY A;  3VRQ A;  3RM1 A;  1IJ5 A;  1NX2 A;  1BU3 A;  2LVI A;  2M7L A;  1PAL A;  3AAJ A;  2Y5I A;  1LKJ A;  1XFV O;  1AUI B;  2KNE A;  2R2I A;  2LP2 A;  3I5I B;  4MRX A;  1SRA A;  2KQY A;  1UUR A;  2OTG C;  1OZS A;  1F54 A;  4DCK A;  5ER5 A;  1QTX A;  1B1G A;  2P6B B;  3QRX A;  2KI4 B;  3CR4 X;  1KQV A;  2CBL A;  2F2P A;  2F2O A;  5F6T A;  1IRJ A;  2EGD A;  4JPZ B;  4MBE A;  1NX3 A;  1SNL A;  2LVK A;  1DMO A;  1JF0 A;  2LMV A;  2MBX A;  1KCY A;  3DVJ A;  3PN7 C;  1GQM A;  3ZNI A;  1B7T Z;  2K7O A;  2PRU A;  4QJ4 B;  1MUX A;  4AQI A;  2ZRT A;  1N65 A;  1A4P A;  1EJ3 A;  2SCP A;  1U5I A;  3PAT A;  1J7R A;  2Q4U A;  3VRR A;  2AUC A;  1AJ5 A;  1BT6 A;  1CDL A;  1KK7 Z;  2WOS A;  1LA0 A;  2KYF A;  1CFP A;  1J1E A;  1HQV A;  4PHK A;  1WLM A;  2ZRS A;  2BCA A;  1YRT B;  3FWC A;  3EKJ A;  1G8I A;  4L9M A;  3AKA A;  2LLU A;  4NDB A;  2KFH A;  2LMU A;  1K96 A;  1QV1 A;  1XA5 A;  3FIA A;  1BR4 B;  1PVA A;  2JT8 A;  2FJU B;  1RFJ A;  3CWG A;  4TNC A;  3RLZ A;  1MR8 A;  2O5G A;  1DJY A;  1F55 A;  4CFQ A;  1XFX O;  4GFT A;  4P5O E;  1BOC A;  1FI6 A;  2LHL A;  3GK1 A;  1QV0 A;  1CDP A;  1N2D A;  2PAL A;  1KQM C;  2Q91 A;  1F4Q A;  4WRI A;  2M7N A;  2MA2 A;  3GK2 A;  1Y1A A;  1QVI Y;  2F8P A;  2B1U A;  3EVV A;  5G08 A;  1X02 A;  3PFV A;  5IBW A;  1QAT A;  4BY5 A;  4PAL A;  5FYX A;  1Y6W A;  1M39 A;  2F3Z A;  3AKB A;  3TDU A;  2BKH B;  1B8R A;  3KPX A;  4E68 A;  2LVJ A;  4JQ0 D;  4PDZ A;  4YI9 A;  1PSR A;  4ORB B;  1Y0V H;  1YUT A;  1RTP 1;  1DGU A;  1QX7 A;  2G9B A;  3OB1 B;  2M3W A;  2QPT A;  1XYD A;  3I5H C;  5D7F A;  4YRU A;  2IS9 A;  2EC6 B;  1S6C A;  2KGR A;  1PVB A;  2CXJ A;  4GAO A;  4QJ3 B;  2K2A A;  4PE4 A;  1NPQ A;  1PRW A;  1OZO A;  1B47 A;  4UPG A;  1JUO A;  2ZKM X;  1U5I B;  2JC2 A;  1M46 A;  1RRO A;  3DVE A;  3C1V A;  1NYA A;  3WXA A;  1BLQ A;  1H4B A;  2OPO A;  1D1O A;  1WLZ A;  2M1K B;  1K8U A;  1WRK A;  3NXA A;  2KYC A;  1ZAC A;  2LUX A;  5GQQ C;  2LP3 A;  1PSB A;  3TUY C;  2LNK A;  1KSO A;  1K93 D;  2JNF A;  1MQ1 A;  1YTZ C;  3DF0 A;  4MEW A;  2KFG A;  2FCE A;  5I8N A;  4I5N B;  2PAS A;  3SG6 A;  1LA3 A;  1BMO A;  1C7V A;  3PAL A;  2HF5 A;  1QX5 B;  2LCP A;  3OHM B;  1ZOT B;  1SYM A;  3BYA A;  1K94 A;  1F4O A;  3TS5 B;  5J3X A;  1L2O B;  1KK8 C;  4NQG A;  1DF0 A;  1XFZ O;  4XJK A;  1S36 A;  4GUK A;  2COL B;  1YUR A;  2I7A A;  4N1F A;  2F3Y A;  3SIA A;  1AJ4 A;  2LHI A;  4BY4 A;  1CFF A;  1A2X A;  2KDH A;  4CID A;  1C7W A;  2EHB A;  5CSI A;  1JSA A;  1TCF A;  3VRP A;  3NSO A;  1MXE A;  4IL1 A;  2JUL A;  1BG1 A;  1ALW A;  1K9K A;  4HRE E;  2D8N A;  1IGV A;  2F33 A;  3EVR A;  4OV2 A;  1W7I B;  4P2Y B;  3HX4 A;  3OX5 A;  2K7D A;  3O78 A;  2WND A;  2KHN A;  3O4Y A;  3TDI A;  2MLF C;  1S5G Z;  1SPY A;  2NXQ A;  3HCM A;  2HQ8 A;  5PAL A;  1QXP A;  1DJG A;  3SJS A;  1KWO C;  4CPV A;  4FQO A;  2LAN A;  1XO5 A;  2CTN A;  1S5G Y;  1UHN A;  2M0R A;  2MHH A;  2V53 A;  1H8B A;  5AXI A;  2LV7 A;  1ALV A;  1SR6 C;  1UHI A;  1OOJ A;  1KFU L;  2JPT A;  4OKH A;  3JVT B;  1EG3 A;  1SMG A;  5HKY A;  1ZFS A;  2KAV A;  3BXK A;  1XFY O;  1JC2 A;  3LK0 A;  1FI5 A;  3EK7 A;  4DUQ A;  1C07 A;  4U8D A;  1B7T Y;  2K7B A;  4C0K A;  2NZ0 A;  2JZI A;  1MHO A;  5CSJ A;  1JBA A;  2K2F A;  3EVU A;  2JWW A;  3M0W A;  1N0Y A;  2KBI A;  3DF0 B;  3I5F B;  1M45 A;  1YUU A;  1IH0 A;  1KFX S;  2RGI A;  3VGO A;  1KK7 Y;  3F45 A;  1RWY A;  1DJH A;  1UHH A;  3WNX B;  1XFU O;  2JT0 A;  3H4S E;  1SCV A;  4OVN F;  1DF0 B;  1NX1 A;  4XJK B;  1EXR A;  1CMG A;  1OSA A;  2MRD A;  4GNK B;  1S3P A;  3SG2 A;  2ZN8 A;  4MRY A;  1DJI A;  1WRL A;  4R1E A;  2I18 A;  5JJG A;  2HQW A;  1SBJ A;  2JTT A;  2M29 A;  1CMF A;  1CNP A;  1NX0 A;  1S6J A;  2EC6 C;  2LUC A;  3BQ3 A;  3SG4 A;  2I94 A;  3CR5 X;  1TNX A;  1DGV A;  4ORA B;  1SL8 A;  1UWO A;  5JOL A;  2BL0 C;  4ETO A;  5HYD A;  1YX7 A;  2ZN9 A;  2BCX A;  4AQJ A;  2BEC A;  3GOF A;  1S6I A;  1XK4 C;  3NSL A;  2L51 A;  1QIV A;  1RK9 A;  4N5X A;  1SCM C;  2CT9 A;  2H61 C;  4WQ3 A;  2VRG A;  4M2P A;  2BBM A;  2M9G A;  1K90 D;  4CFR A;  2KAY A;  1JWD A;  4A4C A;  5AER A;  1OMR A;  2BE6 A;  3VRN A;  3GK4 X;  3D10 A;  4XYN A;  1V1G A;  1CKK A;  1WDC C;  1IKU A;  2OS8 C;  1IJ6 A;  1EG4 A;  4MLW A;  1F71 A;  3K21 A;  1F70 A;  2AMI A;  3JTD C;  2Y4Q A;  1QIW A;  4I5K A;  1J7Q A;  2L4H A;  1NWD A;  3BUW B;  3MSE B;  1YVH A;  1B9A A;  1XVJ A;  1LVC D;  1YVL A;  2KFF A;  4YGD B;  1OMV A;  1EH2 A;  2KI6 C;  2L0P A;  5DKQ A;  1A03 A;  1IWQ A;  1A75 A;  3A8R A;  1AP4 A;  3I5G C;  2L50 A;  1CTR A;  2FOT A;  2M1U A;  2WOR A;  3LCP C;  3NSK A;  4MN0 A;  5CPV A;  1CFC A;  4GBA A;  4ZCU A;  1EL4 A;  1TNW A;  4ZCV A;  1QX2 A;  3IQQ A;  1XFW O;  1SKT A;  5AEQ A;  3BUN B;  5I2O A;  1CLL A;  4MZK A;  3I5I C;  3BUO B;  1K9P A;  1K9U A;  1FF1 A;  3BUM B;  2JNX A;  3O2P A;  3CTN A;  2G2B A;  4PHN A;  2L4I A;  2L98 A;  1NSH A;  2KI4 C;  3I5H B;  1KSM A;  1CLB A;  5HKW A;  1CM4 A;  1CM1 A;  4FTG A;  4PE0 A;  1NCY A;  2HPS A;  1CFD A;  1NIW A;  2AAO A;  2KSP A;  3EK8 A;  4N1G A;  2WCF A;  5I2L A;  3OP0 A;  1GGZ A;  1B4C A;  1SL9 A;  2WC8 A;  2QAC A;  1BF5 A;  1MF8 B;  2K61 A;  3LLE A;  2NCO A;  1OQP A;  2JQ6 A;  3CLN A;  2FCD A;  1QS7 A;  1MXL C;  2WCB A;  2K7C A;  2KOT A;  4DS7 A;  3WHU B;  3I5F C;  3BUX B;  3KEV A;  3TUY B;  1VRK A;  1IQ5 A;  2KI6 D;  3EKH A;  1YUS A;  3OB2 B;  4DRW A;  4PHJ A;  1W7J B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...