2G2BA

Nmr structure of the human allograft inflammatory factor 1
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
150
structure length
150
Chain Sequence
GPLESQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Allograft inflammatory factor 1
publication title NMR structure of the human allograft inflammatory factor 1
rcsb
source organism Homo sapiens
total genus 38
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2006-02-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2g2bA01
1MXLC 3I5GB 2LNKA 4MZKA 3EK8A 1UHJA 2OS8C 3WHUB 4YBHB 3DVMA 5GQQC 2MA2A 2L5XB 2PALA 2M7LA 5HLOA 4I5JA 2K7BA 2LUCA 1N65A 3TDZA 5IBWA 1CKKA 1K95A 4NDCA 1NX1A 1WRKA 1K9KA 1RK9A 2NZ0A 5K89A 1TOPA 1M63B 1YVLA 1CLLA 3HCMA 3F45A 2KHNA 3VROA 1XFUO 1IH0A 1C7VA 2F3YA 1F4QA 3BQ3A 1LVCD 2L2EA 4OVNF 1OMVA 3C1VA 3KPXA 1PVBA 1S1EA 2Y4QA 2ZFDA 1HQVA 1QJTA 1OOJA 1DVIA 1S26D 4JQ0D 1NCZA 3CTNA 2MBXA 2OTGC 1RTP1 1A4PA 1JWDA 2KNEA 1UUSA 5G08A 3BUWB 1K96A 2OTGB 4P2YB 4PE7A 3PFVA 5KU1A 5KTYA 1F71A 3TUYB 4UPGA 2KBMA 1J7RA 1PVAA 1DJXA 4D1EA 1AP4A 1SCMB 2K2AA 1GGZA 4MBEA 3SG7A 1L7ZA 1SY9A 2LLUA 2ZKMX 4GBAA 1S6CA 4XJKA 1KFUL 1WY9A 2BCXA 2WCFA 2KFHA 1OSAA 4PHNA 2DOQA 3E3RA 4YRUA 2PRUA 3KO0A 1A75A 1KFXL 2NLNA 2BCBA 4E68A 3I5HB 1IWQA 1BODA 1B8RA 2KAYA 1S6JA 4QJ4B 3PATA 2JZIA 1SR6C 4IL1A 1YX8A 2LMVA 3I5IC 2MRDA 3IQOA 4Q04A 1M39A 2K7CA 2BBNA 2EC6C 1AJ5A 1OMRA 3I5FC 2F8PA 1CDMA 1V1FA 1DGUA 2CT9A 3O78A 5JJGA 3DVEA 2LANA 3OB1B 1Y1UA 1SRAA 2KGBC 3A4UB 3I5FB 4WQ2A 1CMFA 2P6BB 1QLSA 1B8LA 2LVVA 1IQ3A 1LA0A 1BU3A 2PVBA 2BE4A 1CDNA 1EG3A 1SKTA 4MZLA 2LLSA 1ALVA 1X02A 4XJKB 3WXAA 1M31A 1RROA 1C07A 2L51A 3CZTX 1K9PA 1WRZA 1SL8A 1J7QA 2JTZA 4ORCB 2BE6A 3LLEA 3OX6A 4I5LB 1A03A 1FPWA 2KYCA 2K61A 1A75B 3D0YA 5HKYA 1A29A 1JFKA 4N1GA 1TTXA 3PLFB 3HX4A 3CR2A 2CTNA 2QPTA 3AAKA 2O5GA 3GK2A 1RFJA 2K7DA 4MRXA 3KHEA 1BMOA 3BUOB 4A4CA 5BPJA 3PSRA 2F2OA 4CPVA 1XFYO 1NYAA 5TNCA 2KGRA 2M29A 5D7FA 1BR1B 2CXJA 1KWOB 1OQPA 4CLNA 4CFQA 1AJ4A 1QX5B 2LUXA 1A2XA 2HETA 3CR4X 1RJVA 1DJHA 2F33A 1CFFA 4DIRA 1MF8B 4C0JA 3QRXA 1NP8A 1NSHA 2LHLA 4MRYA 3AAJA 1UHNA 2JU0A 4I5KA 1QV0A 3K21A 1OZOA 4FQOA 3D0YB 4MLWA 1SK6D 2O60A 2I2RE 3TS5B 2VRGA 2L98A 2LAPA 4AQJA 4GUKA 1J55A 2WOSA 1Y1AA 2KBIA 5AEQA 1F8HA 1TCOB 4NDBA 2JQ6A 5HLVA 3FS7A 1DGVA 1J1EA 1KSMA 3BOWA 3NSIA 2KFFA 4MSPA 3M0WA 2Y1NA 2LP3A 1YUUA 1H8BA 2GGMA 2KI6C 1YX7A 3AKAA 3NXAA 1CM1A 1D1OA 1FF1A 1M46A 1UWOA 3BUXB 2M7NA 2KDHA 1EG4A 1TIZA 2PMYA 1J1DA 2KSPA 4OR9B 4YGCB 2KOTA 2G9BA 2WNDA 1AHRA 4PE1A 1TRFA 2FCEA 1BR4B 3WHTB 1V1GA 5HYDA 3SG4A 2AUCA 1OE9B 1G8IA 1CFPA 2ZRTA 4A4BA 3FWBA 3TUYC 1R2UA 5CSJA 2FJUB 3A8RA 1Q80A 2KI4B 4TNCA 2PASA 1S3PA 1SCMC 1B9AA 2KQ6A 4I5NB 1DMOA 1KK8B 2RGIA 4QJ5B 1EH2A 3EVUA 4N5XA 4WRIA 4ZCUA 1YRUB 1CM4A 2OPOA 1MWNA 4HSZA 1DJIA 3BOWB 1SL9A 2I94A 2TN4A 1QATA 4DCKA 1G4YR 2WORA 2EHBA 1N2DA 1IGVA 1B4CA 1F55A 4XYNA 3I5HC 1LXFC 2COLB 4JPZB 2LCPA 2JT8A 1SMGA 2MJWB 3CGAA 1XFZO 1LINA 1YR5A 1UURA 3DVJA 1TNWA 3RLZA 1CB1A 3ZWHA 2KAXA 5DKQA 2M49B 3BXKA 2ISDA 3VRPA 1LKJA 1JC2A 1B47A 2KAVA 3EK4A 2Y5IA 4PHKA 5FYXA 1QXPA 3O2PA 2BKHB 1NCYA 2JTTA 2FOTA 4DUQA 4YGDB 1SW8A 1PRWA 1QX2A 1XFWO 2HPSA 4PHMA 3BYAA 1WDCB 4DRWA 2CCMA 2SASA 1Y6WA 2AAOA 1G33A 1PALA 1WLZA 1FI5A 1XYDA 1QS7A 2LMUA 3TZ1A 4OKHA 1Y1XA 1BLQA 1PSBA 4GPLB 3LL8B 2V53A 3LK0A 1F4OA 2D8NA 2L4HA 3SIBA 3EKHA 1K90D 3KEVA 5DKNA 4ICBA 1EL4A 1QTXA 2K2FA 5CSFA 1R6PA 3LCPC 1ODBA 2JRFA 1K94A 1IJ6A 2K0JA 2LM5A 3JVTB 1XVJA 2M8UA 2ZN9A 2E30A 1NCXA 1U5IA 1B8CA 4FTGA 3AKBA 1F70A 1W7IB 4ORBB 1KWOC 3CR5X 3EVVA 2GGZA 4YGEB 1JUOA 1IJ5A 1SPYA 1LA3A 1IG5A 2L0PA 2FCDA 3IF7A 1MUXA 1TCFA 4R1EA 3SG2A 4WQ3A 3VRNA 1DF0B 2JNXA 2LP2A 2NCOA 3RM1A 1BT6A 3DVKA 2M97A 1WRLA 1HT9A 1QVIY 3H4SE 1IQ5A 3SG3A 3OX5A 1GQMA 2MLEC 1RWYA 4NQGA 2KYFA 2JULA 1ALWA 1K2HA 1L2OC 2MAZA 1E8AA 2QACA 3GK4X 4HRHA 3TS5C 2BL0B 1OMDA 2HQWA 1PSRA 1ZMZA 1L2OB 2LV7A 1CDPA 1BG1A 2H61A 1YVHA 1CMGA 4N1FA 2K8MB 1U5IB 1AUIB 3VRQA 5KSZA 1BOCA 2JXLA 1JF2A 1PK0D 1FI6A 1QIWA 2A4JA 1CLMA 1QX7A 3PM8A 1VRKA 2BECA 2LVIA 1C7WA 5PALA 1M45A 3OB2B 1KCYA 2JC2A 4C0LA 1CTRA 3LK1A 1QVIZ 2MHHA 3ICBA 2L50A 5ER5A 4GGNA 1SNLA 5I2LA 2K7OA 5CSNA 2LVJA 4NDDA 4PDZA 4PE4A 2OS8B 2SCPA 4YI9A 4P5OE 2JT3A 2Q91A 1NX2A 5JOLA 2NCPA 1KQMC 2KI4C 1AVSA 1CFDA 2JPTA 5D69A 1B7TY 1PULA 5AXIA 1UP5A 4M2PA 1KK8C 1KQMB 2JOJA 4CFRA 2H61C 1NWDA 2IS9A 1MHOA 1DJZA 3CWGA 2NXQA 5I8NA 4PALA 4GFTA 2BBMA 2LHIA 3VGOA 3WNXB 1AK8A 3GOFA 5CSIA 1TN4A 4AOMA 4AQIA 5I2OA 1QLKA 2E6WA 5AERA 2JXCA 4U8DA 1FBVA 3SJSA 1N0YA 4YGAA 1ZUZA 1YURA 4PCWA 1ZFSA 4MZJA 1MQ1A 1W7JB 1IRJA 1SYMA 2M9GA 3DF0A 1IKUA 1WLMA 4ZCVA 5HKZA 5AANA 1H4BA 2G2BA 2F3ZA 2M1KB 2ZRSA 5I2QA 1YRTB 1EXRA 1B7TZ 2Q4UA 4M2OA 1QV1A 2AMIA 2MLFC 1SL7A 3BUNB 1MXEA 1Y0VH 4M2QA 1GJYA 3BUMB 5ER4X 2LC5A 1NUBA 2Y1MA 5J3XA 1UHIA 1XFVO 2HQ8A 1UHKA 4MVFA 4HRGA 1WDCC 1J7OA 1YTZC 2KFGA 2BCAA 3FWCA 1YUSA 4BY4A 4BY5A 1K8UA 4PHJA 4OV2A 1QIVA 4GNKB 1DF0A 4JWQA 4USLA 5CPVA 1XK4A 3TDUA 1SBJA 2ZN8A 1SR6B 1BJFA 3D10A 4ETOA 4YI8A 1CFCA 3I5IB 1TNXA 1UHHA 1EJ3A 2LLTA 2KQYA 2KI6D 2F2PA 1JBAA 3DF0B 1JFJA 2EC6B 1XA5A 4YGBB 2M3WA 3OP0A 3VRRA 4CIDA 2H2KA 2JT0A 3JVTC 3O4YA 5F6TA 1B1GA 1NX0A 2CBLA 2PSRA 1TNPA 3TDIA 3SG6A 1JSAA 3ZNIA 1DJGA 1K93D 2I18A 1DJYA 1MR8A 4GAOA 1NX3A 3O6BA 1DT7B 3NSOA 4PE0A 1GGWA 1CDLA 2M0RA 1K9UA 5B8IB 1QASA 1SCVA 2HF5A 3JTDC 1XO5A 1F54A 2LMTA 1DTLA 1ZOTB 2ZNEA 1KK7Y 2ZNDA 4GGFA 4QJ3B 4OCIA 3JTDB 1XFXO 1XK4C 1S5GY 3DD4A 4ORAB 5DKRA 4C0KA 2JNFA 4HREE 2R2IA 3IQQA 3SG5A 2I7AA 1S36A 3FIAA 3KF9A 3EKJA 2BL0C 2M1UA 1OZSA 1CLBA 1KQVA 2WCEA 4DS7A 4F0ZB 3EK7A 2BKIB 3EVRA 2LE9B 2CNPA 4L9MA 1RECA 2EGDA 1NIWA 3SIAA 1FW4A 2JWWA 2L4IA 2WC8A 3NSKA 3PALA 3CLNA 5HKWA 1J7PA 1TNQA 1CNPA 3CS1A 1KSOA 1BF5A 3MSEB 1JF0A 3NSLA 1KFUS 2LVKA 1YUTA 1DJWA 3GK1A 1KK7Z 4GGFC 1NPQA 5AFPA 1S6IA 3OHMB 1S5GZ 3PN7C 4MN0A 4MEWA 2WCBA 3I5GC 2B1UA 1KFXS 1ZACA 2GV5A 3PN7B
chains in the Genus database with same CATH superfamily
2KLEA 1MXLC 3I5GB 2LNKA 4MZKA 3EK8A 1UHJA 2OS8C 3WHUB 1DEKA 3DVMA 4YBHB 5GQQC 2MA2A 2L5XB 2PALA 3DXLA 2M7LA 5HLOA 4I5JA 2K7BA 2LUCA 1N65A 3TDZA 5IBWA 3N7HA 1CKKA 1K95A 4NDCA 1NX1A 1WRKA 1K9KA 4F7FA 1RK9A 2NZ0A 5K89A 1TOPA 1M63B 2WCLA 1YVLA 1CLLA 3HCMA 3F45A 2KHNA 3VROA 3S0AA 1XFUO 2WCJA 1IH0A 1OW4A 1C7VA 2F3YA 1F4QA 3BQ3A 1LVCD 2L2EA 4OVNF 1TUJA 1OMVA 3QMEA 2QEVA 3C1VA 3KPXA 1PVBA 1S1EA 2Y4QA 2ZFDA 1HQVA 1QJTA 3K1EA 1OOJA 1DVIA 1S26D 4JQ0D 1NCZA 3CTNA 2MBXA 1OOFA 2OTGC 1RTP1 1A4PA 1JWDA 1DQEA 2KNEA 3NGVA 1UUSA 5G08A 3BUWB 1K96A 2OTGB 4P2YB 4PE7A 3PFVA 5KU1A 5KTYA 1F71A 3TUYB 4UPGA 2KBMA 1J7RA 1PVAA 1DJXA 4D1EA 1AP4A 1SCMB 2K2AA 2WCMA 1SSEB 3UNWA 1GGZA 3OGNA 4MBEA 3SG7A 1L7ZA 1SY9A 2LLUA 2ZKMX 4GBAA 1S6CA 1QWVA 4XJKA 1C3YA 1KFUL 1WY9A 1DC1A 2BCXA 2WCFA 2KFHA 1OSAA 3CDNA 4PHNA 2DOQA 3E3RA 3FE9A 4YRUA 2PRUA 1Z4HA 3KO0A 1A75A 1KFXL 2NLNA 2BCBA 4E68A 2P70A 3I5HB 1IWQA 5HL1A 1BODA 1B8RA 2KAYA 1S6JA 2L5YA 4QJ4B 3PATA 2JZIA 1SR6C 4IL1A 2QDIA 1YX8A 2LMVA 3D78A 3I5IC 2MRDA 4PT1A 3IQOA 2WCKA 4INWA 1M39A 4Q04A 2K7CA 2BBNA 2EC6C 1AJ5A 1OMRA 3I5FC 2F8PA 1CDMA 1V1FA 1DGUA 2CT9A 3O78A 5JJGA 3DVEA 2LANA 3OB1B 1Y1UA 1SRAA 2KGBC 3A4UB 3I5FB 4WQ2A 1CMFA 2P6BB 1QLSA 1B8LA 2LVVA 1IQ3A 1LA0A 1BU3A 2PVBA 2YGUA 2BE4A 1CDNA 1EG3A 1SKTA 1T14A 4MZLA 3CZ1A 2LLSA 1ALVA 1X02A 4XJKB 3WXAA 1M31A 1RROA 1C07A 2L51A 5EL2A 3CZTX 3S0FA 1K9PA 1WRZA 1SL8A 1J7QA 2JTZA 4ORCB 2BE6A 3LLEA 3OX6A 4I5LB 1A03A 1FPWA 2KYCA 2K61A 1A75B 3D0YA 5HKYA 1A29A 3R1VA 1JFKA 4N1GA 1TTXA 3PLFB 3HX4A 3NHIA 3CR2A 4JKTA 3B6XA 2CTNA 2QPTA 3AAKA 2O5GA 3GK2A 3L47A 1RFJA 2K7DA 4MRXA 3KHEA 1BMOA 3BUOB 4A4CA 4INXA 5BPJA 3PSRA 2F2OA 4CPVA 1XFYO 1NYAA 5TNCA 2KGRA 2M29A 5D7FA 1BR1B 2CXJA 1KWOB 1OQPA 2PYQA 4CLNA 4CFQA 1AJ4A 1QX5B 3EG5B 2LUXA 1A2XA 2HETA 3CR4X 1RJVA 1DJHA 2F33A 1CFFA 4DIRA 1MF8B 4C0JA 3QRXA 3S0GA 1NP8A 1NSHA 2LHLA 4MRYA 3AAJA 1UHNA 2JU0A 4I5KA 1QV0A 3K21A 1OZOA 4FQOA 3D0YB 4MLWA 1SK6D 2O60A 3SS4A 2I2RE 3TS5B 2VRGA 2L98A 2LAPA 4IJ7A 4GUKA 1J55A 4AQJA 2WOSA 3S0BA 1Y1AA 2KBIA 5AEQA 1F8HA 1TCOB 4NDBA 3RZSA 2JQ6A 5HLVA 3FS7A 1DGVA 1J1EA 1KSMA 3BOWA 3NSIA 2KFFA 4MSPA 3M0WA 2Y1NA 2LP3A 1YUUA 4FQTA 1H8BA 2GGMA 2KI6C 1YX7A 3AKAA 3NXAA 2L2CA 1CM1A 1D1OA 1FF1A 1M46A 1UWOA 3BUXB 2M7NA 2KDHA 1EG4A 1TIZA 2PMYA 1J1DA 2KSPA 4OR9B 4YGCB 3L4LA 2KOTA 2G9BA 2WNDA 1AHRA 4PE1A 1TRFA 2FCEA 1BR4B 2P71A 3WHTB 1V1GA 2FJYA 3SG4A 2AUCA 1OE9B 1G8IA 5HYDA 4OZDA 1CFPA 2ZRTA 4A4BA 3FWBA 3TUYC 1R2UA 5CSJA 2FJUB 3A8RA 2BAPA 1Q80A 2KI4B 3FE8A 4TNCA 2PASA 1S3PA 1SCMC 1B9AA 2KQ6A 4I5NB 1DMOA 1KK8B 2RGIA 1DELA 4QJ5B 1EH2A 3EVUA 4N5XA 4WRIA 4ZCUA 1YRUB 1CM4A 2OPOA 1MWNA 4HSZA 1DJIA 3BOWB 1SL9A 2I94A 2TN4A 1QATA 3BFAA 4DCKA 1G4YR 2WORA 2EHBA 2H8VA 1N2DA 5DICA 1IGVA 2PQLA 1B4CA 1F55A 4XYNA 3S0EA 3I5HC 1LXFC 2COLB 4JPZB 2LCPA 2JT8A 1SMGA 2MJWB 3CGAA 1XFZO 1LINA 1YR5A 1UURA 3DVJA 1TNWA 3RLZA 3D74A 1CB1A 3ZWHA 2KAXA 5DKQA 2M49B 3BXKA 2ISDA 3VRPA 1LKJA 1JC2A 1B47A 2KAVA 3EK4A 2Y5IA 4PHKA 5FYXA 1QXPA 3O2PA 3CYZA 2BKHB 1NCYA 2JTTA 2FOTA 4DUQA 4YGDB 1SW8A 1PRWA 1QX2A 1XFWO 2HPSA 4PHMA 3D76A 3BYAA 1WDCB 3R1OA 4DRWA 2CCMA 2SASA 1Y6WA 2AAOA 1G33A 1PALA 1WLZA 1FI5A 1XYDA 1QS7A 2LMUA 3TZ1A 4OKHA 1Y1XA 1BLQA 1PSBA 4GPLB 3LL8B 2V53A 3LK0A 1F4OA 2D8NA 2L4HA 3SIBA 3EKHA 1K90D 3KEVA 1OOHA 5DKNA 4ICBA 1EL4A 3VB1A 1QTXA 2K2FA 5CSFA 1R6PA 3BFHA 3CZ0A 3LCPC 1ODBA 2JRFA 2KLDA 1K94A 1IJ6A 2K0JA 2LM5A 3JVTB 1XVJA 3NHTA 2M8UA 2ZN9A 2E30A 1NCXA 1U5IA 1B8CA 4FTGA 3AKBA 1F70A 1W7IB 4ORBB 5FI7A 1KWOC 3CR5X 3EVVA 2GGZA 4YGEB 1JUOA 1IJ5A 1SPYA 1LA3A 1IG5A 2L0PA 2FCDA 2QEHA 3IF7A 1MUXA 1TCFA 4R1EA 3SG2A 4WQ3A 3VRNA 1DF0B 2JNXA 2LP2A 2NCOA 3RM1A 3D77A 1BT6A 3DVKA 2M97A 1WRLA 3BJHA 1HT9A 1OOGA 1QVIY 1IQ5A 3H4SE 3SG3A 3OX5A 1GQMA 3FE6A 2MLEC 1RWYA 4NQGA 2KYFA 2JULA 2WC5A 1ALWA 1K2HA 1L2OC 2MAZA 1E8AA 2QACA 3GK4X 4HRHA 3TS5C 2BL0B 1OMDA 2HQWA 1PSRA 1ZMZA 1L2OB 2LV7A 3B87A 5I94A 1CDPA 4KYNA 1BG1A 2H61A 1YVHA 1CMGA 4N1FA 2K8MB 1U5IB 1AUIB 1W9ZA 3PM2A 3VRQA 5KSZA 1BOCA 2JXLA 1JF2A 1PK0D 1FI6A 1QIWA 2A4JA 1CLMA 1ORGA 1QX7A 3PM8A 1VRKA 2BECA 2LVIA 1C7WA 5PALA 1M45A 3OB2B 1KCYA 2JC2A 4C0LA 1CTRA 3LK1A 1QVIZ 3DZTA 5D3OA 1Z2CB 2MHHA 3ICBA 2L50A 5ER5A 4GGNA 1SNLA 5I2LA 2K7OA 5CSNA 2LVJA 3O4XA 4NDDA 4PDZA 4PE4A 1TWOA 2OS8B 2SCPA 3OBVA 4YI9A 4P5OE 2JT3A 2Q91A 1NX2A 5JOLA 2NCPA 1KQMC 2KI4C 1AVSA 1CFDA 2JPTA 3CZ2A 5D69A 1B7TY 1PULA 5AXIA 1UP5A 2QEOA 2GTEA 3SS3A 4M2PA 1KK8C 1KQMB 2JOJA 4CFRA 2H61C 1NWDA 2BNXA 2IS9A 1MHOA 3BFBA 3D75A 5FI6A 1DJZA 3CWGA 2NXQA 5I8NA 4PALA 3PJIA 4GFTA 2BBMA 2LHIA 3VGOA 3WNXB 1AK8A 2KPHA 3GOFA 5CSIA 1TN4A 4AOMA 4AQIA 5I2OA 1QLKA 2E6WA 5AERA 2JXCA 4U8DA 1FBVA 3SJSA 1N0YA 4YGAA 1ZUZA 1YURA 3Q8IA 1ZFSA 2QEBA 4MZJA 1MQ1A 1W7JB 4PCWA 1IRJA 1SYMA 2M9GA 3DY9A 3DF0A 1IKUA 1WLMA 3S0DA 4ZCVA 5HKZA 5AANA 1H4BA 1XFRA 2G2BA 2F3ZA 2M1KB 2ZRSA 3SS5A 1YRTB 5I2QA 1EXRA 1B7TZ 2Q4UA 4M2OA 1QV1A 2AMIA 2MLFC 1SL7A 3BUNB 1MXEA 1Y0VH 1TUZA 4M2QA 1GJYA 3BUMB 5ER4X 3UO9A 2LC5A 1NUBA 2Y1MA 5J3XA 1UHIA 1XFVO 2HQ8A 1C3ZA 1UHKA 4MVFA 4HRGA 1WDCC 1J7OA 1YTZC 2KFGA 2BCAA 3FWCA 1YUSA 4BY4A 4BY5A 1K8UA 3IVTA 3CABA 4OV2A 1QIVA 4PHJA 4GNKB 1DF0A 4JWQA 4USLA 5CPVA 1XK4A 3TDUA 1SBJA 2ZN8A 1SR6B 1BJFA 3D10A 1OOIX 4ETOA 4YI8A 1CFCA 3I5IB 1TNXA 1UHHA 1EJ3A 2LLTA 3B7AA 2KQYA 2KI6D 2F2PA 1JBAA 3DF0B 1JFJA 2EC6B 1XA5A 4YGBB 2M3WA 3OP0A 2JPOA 3VRRA 4CIDA 2H2KA 2JT0A 3JVTC 3O4YA 5F6TA 1B1GA 1NX0A 2CBLA 2PSRA 1TNPA 1IIOA 3TDIA 3SG6A 1JSAA 3ZNIA 1DJGA 1K93D 2I18A 1DJYA 1MR8A 4GAOA 1NX3A 3O6BA 1DT7B 3NSOA 4PE0A 1GGWA 1CDLA 2M0RA 1K9UA 3V2LA 3B86A 1QASA 1SCVA 5B8IB 2HF5A 3JTDC 1XO5A 1F54A 2LMTA 1DTLA 1ZOTB 2ZNEA 1KK7Y 2ZNDA 4GGFA 4QJ3B 4OCIA 3JTDB 1XFXO 1XK4C 1S5GY 2WC6A 3DD4A 4ORAB 5DKRA 4C0KA 2JNFA 1P28A 4HREE 2R2IA 3IQQA 3SG5A 2I7AA 1S36A 3FIAA 3KF9A 3EKJA 2BL0C 2M1UA 1OZSA 1CLBA 1KQVA 2ERBA 2WCEA 4DS7A 3L4AA 3EK7A 2BKIB 3EVRA 4F0ZB 2LE9B 2CNPA 4L9MA 1RECA 2EGDA 1NIWA 3SIAA 1FW4A 2JWWA 2L4IA 2WC8A 1LS8A 3NSKA 3PALA 2WCHA 3CLNA 5HKWA 1J7PA 1TNQA 1CNPA 1GM0A 3CS1A 1KSOA 1BF5A 3R72A 3B88A 3MSEB 4JD9A 1JF0A 3NSLA 5FI2A 1KFUS 2K60A 2LVKA 1YUTA 1DJWA 3GK1A 1KK7Z 4GGFC 1NPQA 3R1PA 5AFPA 1S6IA 3OHMB 1S5GZ 3PN7C 4MN0A 4MEWA 2WCBA 3D73A 3DYEA 3I5GC 2B1UA 1KFXS 1ZACA 2GV5A 3PN7B
chains in the Genus database with same CATH topology
1MXLC 3I5GB 2LNKA 4MZKA 3EK8A 1UHJA 2OS8C 3WHUB 4YBHB 3DVMA 5GQQC 2MA2A 2L5XB 2PALA 2M7LA 5HLOA 4I5JA 2K7BA 2LUCA 1N65A 3TDZA 5IBWA 1CKKA 1K95A 4NDCA 1NX1A 1WRKA 1K9KA 1RK9A 2NZ0A 5K89A 1TOPA 1M63B 1YVLA 1CLLA 3HCMA 3F45A 2KHNA 3VROA 1XFUO 1IH0A 1C7VA 2F3YA 1F4QA 3BQ3A 1LVCD 2L2EA 4OVNF 1OMVA 3C1VA 3KPXA 1PVBA 1S1EA 2Y4QA 2ZFDA 1HQVA 1QJTA 1OOJA 1DVIA 1S26D 4JQ0D 1NCZA 3CTNA 2MBXA 2OTGC 1RTP1 1A4PA 1JWDA 2KNEA 1UUSA 5G08A 3BUWB 1K96A 2OTGB 4P2YB 4PE7A 3PFVA 5KU1A 5KTYA 1F71A 3TUYB 4UPGA 2KBMA 1J7RA 1PVAA 1DJXA 4D1EA 1AP4A 1SCMB 2K2AA 1GGZA 4MBEA 3SG7A 1L7ZA 1SY9A 2LLUA 2ZKMX 4GBAA 1S6CA 4XJKA 1KFUL 1WY9A 2BCXA 2WCFA 2KFHA 1OSAA 4PHNA 2DOQA 3E3RA 4YRUA 2PRUA 3KO0A 1A75A 1KFXL 2NLNA 2BCBA 4E68A 3I5HB 1IWQA 1BODA 1B8RA 2KAYA 1S6JA 4QJ4B 3PATA 2JZIA 1SR6C 4IL1A 1YX8A 2LMVA 3I5IC 2MRDA 3IQOA 4Q04A 1M39A 2K7CA 2BBNA 2EC6C 1AJ5A 1OMRA 3I5FC 2F8PA 1CDMA 1V1FA 1DGUA 2CT9A 3O78A 5JJGA 3DVEA 2LANA 3OB1B 1Y1UA 1SRAA 2KGBC 3A4UB 3I5FB 4WQ2A 1CMFA 2P6BB 1QLSA 1B8LA 2LVVA 1IQ3A 1LA0A 1BU3A 2PVBA 2BE4A 1CDNA 1EG3A 1SKTA 4MZLA 2LLSA 1ALVA 1X02A 4XJKB 3WXAA 1M31A 1RROA 1C07A 2L51A 3CZTX 1K9PA 1WRZA 1SL8A 1J7QA 2JTZA 4ORCB 2BE6A 3LLEA 3OX6A 4I5LB 1A03A 1FPWA 2KYCA 2K61A 1A75B 3D0YA 5HKYA 1A29A 1JFKA 4N1GA 1TTXA 3PLFB 3HX4A 3CR2A 2CTNA 2QPTA 3AAKA 2O5GA 3GK2A 1RFJA 2K7DA 4MRXA 3KHEA 1BMOA 3BUOB 4A4CA 5BPJA 3PSRA 2F2OA 4CPVA 1XFYO 1NYAA 5TNCA 2KGRA 2M29A 5D7FA 1BR1B 2CXJA 1KWOB 1OQPA 4CLNA 4CFQA 1AJ4A 1QX5B 2LUXA 1A2XA 2HETA 3CR4X 1RJVA 1DJHA 2F33A 1CFFA 4DIRA 1MF8B 4C0JA 3QRXA 1NP8A 1NSHA 2LHLA 4MRYA 3AAJA 1UHNA 2JU0A 4I5KA 1QV0A 3K21A 1OZOA 4FQOA 3D0YB 4MLWA 1SK6D 2O60A 2I2RE 3TS5B 2VRGA 2L98A 2LAPA 4AQJA 4GUKA 1J55A 2WOSA 1Y1AA 2KBIA 5AEQA 1F8HA 1TCOB 4NDBA 2JQ6A 5HLVA 3FS7A 1DGVA 1J1EA 1KSMA 3BOWA 3NSIA 2KFFA 4MSPA 3M0WA 2Y1NA 2LP3A 1YUUA 1H8BA 2GGMA 2KI6C 1YX7A 3AKAA 3NXAA 1CM1A 1D1OA 1FF1A 1M46A 1UWOA 3BUXB 2M7NA 2KDHA 1EG4A 1TIZA 2PMYA 1J1DA 2KSPA 4OR9B 4YGCB 2KOTA 2G9BA 2WNDA 1AHRA 4PE1A 1TRFA 2FCEA 1BR4B 3WHTB 1V1GA 5HYDA 3SG4A 2AUCA 1OE9B 1G8IA 1CFPA 2ZRTA 4A4BA 3FWBA 3TUYC 1R2UA 5CSJA 2FJUB 3A8RA 1Q80A 2KI4B 4TNCA 2PASA 1S3PA 1SCMC 1B9AA 2KQ6A 4I5NB 1DMOA 1KK8B 2RGIA 4QJ5B 1EH2A 3EVUA 4N5XA 4WRIA 4ZCUA 1YRUB 1CM4A 2OPOA 1MWNA 4HSZA 1DJIA 3BOWB 1SL9A 2I94A 2TN4A 1QATA 4DCKA 1G4YR 2WORA 2EHBA 1N2DA 1IGVA 1B4CA 1F55A 4XYNA 3I5HC 1LXFC 2COLB 4JPZB 2LCPA 2JT8A 1SMGA 2MJWB 3CGAA 1XFZO 1LINA 1YR5A 1UURA 3DVJA 1TNWA 3RLZA 1CB1A 3ZWHA 2KAXA 5DKQA 2M49B 3BXKA 2ISDA 3VRPA 1LKJA 1JC2A 1B47A 2KAVA 3EK4A 2Y5IA 4PHKA 5FYXA 1QXPA 3O2PA 2BKHB 1NCYA 2JTTA 2FOTA 4DUQA 4YGDB 1SW8A 1PRWA 1QX2A 1XFWO 2HPSA 4PHMA 3BYAA 1WDCB 4DRWA 2CCMA 2SASA 1Y6WA 2AAOA 1G33A 1PALA 1WLZA 1FI5A 1XYDA 1QS7A 2LMUA 3TZ1A 4OKHA 1Y1XA 1BLQA 1PSBA 4GPLB 3LL8B 2V53A 3LK0A 1F4OA 2D8NA 2L4HA 3SIBA 3EKHA 1K90D 3KEVA 5DKNA 4ICBA 1EL4A 1QTXA 2K2FA 5CSFA 1R6PA 3LCPC 1ODBA 2JRFA 1K94A 1IJ6A 2K0JA 2LM5A 3JVTB 1XVJA 2M8UA 2ZN9A 2E30A 1NCXA 1U5IA 1B8CA 4FTGA 3AKBA 1F70A 1W7IB 4ORBB 1KWOC 3CR5X 3EVVA 2GGZA 4YGEB 1JUOA 1IJ5A 1SPYA 1LA3A 1IG5A 2L0PA 2FCDA 3IF7A 1MUXA 1TCFA 4R1EA 3SG2A 4WQ3A 3VRNA 1DF0B 2JNXA 2LP2A 2NCOA 3RM1A 1BT6A 3DVKA 2M97A 1WRLA 1HT9A 1QVIY 3H4SE 1IQ5A 3SG3A 3OX5A 1GQMA 2MLEC 1RWYA 4NQGA 2KYFA 2JULA 1ALWA 1K2HA 1L2OC 2MAZA 1E8AA 2QACA 3GK4X 4HRHA 3TS5C 2BL0B 1OMDA 2HQWA 1PSRA 1ZMZA 1L2OB 2LV7A 1CDPA 1BG1A 2H61A 1YVHA 1CMGA 4N1FA 2K8MB 1U5IB 1AUIB 3VRQA 5KSZA 1BOCA 2JXLA 1JF2A 1PK0D 1FI6A 1QIWA 2A4JA 1CLMA 1QX7A 3PM8A 1VRKA 2BECA 2LVIA 1C7WA 5PALA 1M45A 3OB2B 1KCYA 2JC2A 4C0LA 1CTRA 3LK1A 1QVIZ 2MHHA 3ICBA 2L50A 5ER5A 4GGNA 1SNLA 5I2LA 2K7OA 5CSNA 2LVJA 4NDDA 4PDZA 4PE4A 2OS8B 2SCPA 4YI9A 4P5OE 2JT3A 2Q91A 1NX2A 5JOLA 2NCPA 1KQMC 2KI4C 1AVSA 1CFDA 2JPTA 5D69A 1B7TY 1PULA 5AXIA 1UP5A 4M2PA 1KK8C 1KQMB 2JOJA 4CFRA 2H61C 1NWDA 2IS9A 1MHOA 1DJZA 3CWGA 2NXQA 5I8NA 4PALA 4GFTA 2BBMA 2LHIA 3VGOA 3WNXB 1AK8A 3GOFA 5CSIA 1TN4A 4AOMA 4AQIA 5I2OA 1QLKA 2E6WA 5AERA 2JXCA 4U8DA 1FBVA 3SJSA 1N0YA 4YGAA 1ZUZA 1YURA 4PCWA 1ZFSA 4MZJA 1MQ1A 1W7JB 1IRJA 1SYMA 2M9GA 3DF0A 1IKUA 1WLMA 4ZCVA 5HKZA 5AANA 1H4BA 2G2BA 2F3ZA 2M1KB 2ZRSA 5I2QA 1YRTB 1EXRA 1B7TZ 2Q4UA 4M2OA 1QV1A 2AMIA 2MLFC 1SL7A 3BUNB 1MXEA 1Y0VH 4M2QA 1GJYA 3BUMB 5ER4X 2LC5A 1NUBA 2Y1MA 5J3XA 1UHIA 1XFVO 2HQ8A 1UHKA 4MVFA 4HRGA 1WDCC 1J7OA 1YTZC 2KFGA 2BCAA 3FWCA 1YUSA 4BY4A 4BY5A 1K8UA 4PHJA 4OV2A 1QIVA 4GNKB 1DF0A 4JWQA 4USLA 5CPVA 1XK4A 3TDUA 1SBJA 2ZN8A 1SR6B 1BJFA 3D10A 4ETOA 4YI8A 1CFCA 3I5IB 1TNXA 1UHHA 1EJ3A 2LLTA 2KQYA 2KI6D 2F2PA 1JBAA 3DF0B 1JFJA 2EC6B 1XA5A 4YGBB 2M3WA 3OP0A 3VRRA 4CIDA 2H2KA 2JT0A 3JVTC 3O4YA 5F6TA 1B1GA 1NX0A 2CBLA 2PSRA 1TNPA 3TDIA 3SG6A 1JSAA 3ZNIA 1DJGA 1K93D 2I18A 1DJYA 1MR8A 4GAOA 1NX3A 3O6BA 1DT7B 3NSOA 4PE0A 1GGWA 1CDLA 2M0RA 1K9UA 5B8IB 1QASA 1SCVA 2HF5A 3JTDC 1XO5A 1F54A 2LMTA 1DTLA 1ZOTB 2ZNEA 1KK7Y 2ZNDA 4GGFA 4QJ3B 4OCIA 3JTDB 1XFXO 1XK4C 1S5GY 3DD4A 4ORAB 5DKRA 4C0KA 2JNFA 4HREE 2R2IA 3IQQA 3SG5A 2I7AA 1S36A 3FIAA 3KF9A 3EKJA 2BL0C 2M1UA 1OZSA 1CLBA 1KQVA 2WCEA 4DS7A 4F0ZB 3EK7A 2BKIB 3EVRA 2LE9B 2CNPA 4L9MA 1RECA 2EGDA 1NIWA 3SIAA 1FW4A 2JWWA 2L4IA 2WC8A 3NSKA 3PALA 3CLNA 5HKWA 1J7PA 1TNQA 1CNPA 3CS1A 1KSOA 1BF5A 3MSEB 1JF0A 3NSLA 1KFUS 2LVKA 1YUTA 1DJWA 3GK1A 1KK7Z 4GGFC 1NPQA 5AFPA 1S6IA 3OHMB 1S5GZ 3PN7C 4MN0A 4MEWA 2WCBA 3I5GC 2B1UA 1KFXS 1ZACA 2GV5A 3PN7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MXL C;  3I5G B;  2LNK A;  4MZK A;  3EK8 A;  1UHJ A;  2OS8 C;  3WHU B;  4YBH B;  3DVM A;  5GQQ C;  2MA2 A;  2L5X B;  2PAL A;  2M7L A;  5HLO A;  4I5J A;  2K7B A;  2LUC A;  1N65 A;  3TDZ A;  5IBW A;  1CKK A;  1K95 A;  4NDC A;  1NX1 A;  1WRK A;  1K9K A;  1RK9 A;  2NZ0 A;  5K89 A;  1TOP A;  1M63 B;  1YVL A;  1CLL A;  3HCM A;  3F45 A;  2KHN A;  3VRO A;  1XFU O;  1IH0 A;  1C7V A;  2F3Y A;  1F4Q A;  3BQ3 A;  1LVC D;  2L2E A;  4OVN F;  1OMV A;  3C1V A;  3KPX A;  1PVB A;  1S1E A;  2Y4Q A;  2ZFD A;  1HQV A;  1QJT A;  1OOJ A;  1DVI A;  1S26 D;  4JQ0 D;  1NCZ A;  3CTN A;  2MBX A;  2OTG C;  1RTP 1;  1A4P A;  1JWD A;  2KNE A;  1UUS A;  5G08 A;  3BUW B;  1K96 A;  2OTG B;  4P2Y B;  4PE7 A;  3PFV A;  5KU1 A;  5KTY A;  1F71 A;  3TUY B;  4UPG A;  2KBM A;  1J7R A;  1PVA A;  1DJX A;  4D1E A;  1AP4 A;  1SCM B;  2K2A A;  1GGZ A;  4MBE A;  3SG7 A;  1L7Z A;  1SY9 A;  2LLU A;  2ZKM X;  4GBA A;  1S6C A;  4XJK A;  1KFU L;  1WY9 A;  2BCX A;  2WCF A;  2KFH A;  1OSA A;  4PHN A;  2DOQ A;  3E3R A;  4YRU A;  2PRU A;  3KO0 A;  1A75 A;  1KFX L;  2NLN A;  2BCB A;  4E68 A;  3I5H B;  1IWQ A;  1BOD A;  1B8R A;  2KAY A;  1S6J A;  4QJ4 B;  3PAT A;  2JZI A;  1SR6 C;  4IL1 A;  1YX8 A;  2LMV A;  3I5I C;  2MRD A;  3IQO A;  4Q04 A;  1M39 A;  2K7C A;  2BBN A;  2EC6 C;  1AJ5 A;  1OMR A;  3I5F C;  2F8P A;  1CDM A;  1V1F A;  1DGU A;  2CT9 A;  3O78 A;  5JJG A;  3DVE A;  2LAN A;  3OB1 B;  1Y1U A;  1SRA A;  2KGB C;  3A4U B;  3I5F B;  4WQ2 A;  1CMF A;  2P6B B;  1QLS A;  1B8L A;  2LVV A;  1IQ3 A;  1LA0 A;  1BU3 A;  2PVB A;  2BE4 A;  1CDN A;  1EG3 A;  1SKT A;  4MZL A;  2LLS A;  1ALV A;  1X02 A;  4XJK B;  3WXA A;  1M31 A;  1RRO A;  1C07 A;  2L51 A;  3CZT X;  1K9P A;  1WRZ A;  1SL8 A;  1J7Q A;  2JTZ A;  4ORC B;  2BE6 A;  3LLE A;  3OX6 A;  4I5L B;  1A03 A;  1FPW A;  2KYC A;  2K61 A;  1A75 B;  3D0Y A;  5HKY A;  1A29 A;  1JFK A;  4N1G A;  1TTX A;  3PLF B;  3HX4 A;  3CR2 A;  2CTN A;  2QPT A;  3AAK A;  2O5G A;  3GK2 A;  1RFJ A;  2K7D A;  4MRX A;  3KHE A;  1BMO A;  3BUO B;  4A4C A;  5BPJ A;  3PSR A;  2F2O A;  4CPV A;  1XFY O;  1NYA A;  5TNC A;  2KGR A;  2M29 A;  5D7F A;  1BR1 B;  2CXJ A;  1KWO B;  1OQP A;  4CLN A;  4CFQ A;  1AJ4 A;  1QX5 B;  2LUX A;  1A2X A;  2HET A;  3CR4 X;  1RJV A;  1DJH A;  2F33 A;  1CFF A;  4DIR A;  1MF8 B;  4C0J A;  3QRX A;  1NP8 A;  1NSH A;  2LHL A;  4MRY A;  3AAJ A;  1UHN A;  2JU0 A;  4I5K A;  1QV0 A;  3K21 A;  1OZO A;  4FQO A;  3D0Y B;  4MLW A;  1SK6 D;  2O60 A;  2I2R E;  3TS5 B;  2VRG A;  2L98 A;  2LAP A;  4AQJ A;  4GUK A;  1J55 A;  2WOS A;  1Y1A A;  2KBI A;  5AEQ A;  1F8H A;  1TCO B;  4NDB A;  2JQ6 A;  5HLV A;  3FS7 A;  1DGV A;  1J1E A;  1KSM A;  3BOW A;  3NSI A;  2KFF A;  4MSP A;  3M0W A;  2Y1N A;  2LP3 A;  1YUU A;  1H8B A;  2GGM A;  2KI6 C;  1YX7 A;  3AKA A;  3NXA A;  1CM1 A;  1D1O A;  1FF1 A;  1M46 A;  1UWO A;  3BUX B;  2M7N A;  2KDH A;  1EG4 A;  1TIZ A;  2PMY A;  1J1D A;  2KSP A;  4OR9 B;  4YGC B;  2KOT A;  2G9B A;  2WND A;  1AHR A;  4PE1 A;  1TRF A;  2FCE A;  1BR4 B;  3WHT B;  1V1G A;  5HYD A;  3SG4 A;  2AUC A;  1OE9 B;  1G8I A;  1CFP A;  2ZRT A;  4A4B A;  3FWB A;  3TUY C;  1R2U A;  5CSJ A;  2FJU B;  3A8R A;  1Q80 A;  2KI4 B;  4TNC A;  2PAS A;  1S3P A;  1SCM C;  1B9A A;  2KQ6 A;  4I5N B;  1DMO A;  1KK8 B;  2RGI A;  4QJ5 B;  1EH2 A;  3EVU A;  4N5X A;  4WRI A;  4ZCU A;  1YRU B;  1CM4 A;  2OPO A;  1MWN A;  4HSZ A;  1DJI A;  3BOW B;  1SL9 A;  2I94 A;  2TN4 A;  1QAT A;  4DCK A;  1G4Y R;  2WOR A;  2EHB A;  1N2D A;  1IGV A;  1B4C A;  1F55 A;  4XYN A;  3I5H C;  1LXF C;  2COL B;  4JPZ B;  2LCP A;  2JT8 A;  1SMG A;  2MJW B;  3CGA A;  1XFZ O;  1LIN A;  1YR5 A;  1UUR A;  3DVJ A;  1TNW A;  3RLZ A;  1CB1 A;  3ZWH A;  2KAX A;  5DKQ A;  2M49 B;  3BXK A;  2ISD A;  3VRP A;  1LKJ A;  1JC2 A;  1B47 A;  2KAV A;  3EK4 A;  2Y5I A;  4PHK A;  5FYX A;  1QXP A;  3O2P A;  2BKH B;  1NCY A;  2JTT A;  2FOT A;  4DUQ A;  4YGD B;  1SW8 A;  1PRW A;  1QX2 A;  1XFW O;  2HPS A;  4PHM A;  3BYA A;  1WDC B;  4DRW A;  2CCM A;  2SAS A;  1Y6W A;  2AAO A;  1G33 A;  1PAL A;  1WLZ A;  1FI5 A;  1XYD A;  1QS7 A;  2LMU A;  3TZ1 A;  4OKH A;  1Y1X A;  1BLQ A;  1PSB A;  4GPL B;  3LL8 B;  2V53 A;  3LK0 A;  1F4O A;  2D8N A;  2L4H A;  3SIB A;  3EKH A;  1K90 D;  3KEV A;  5DKN A;  4ICB A;  1EL4 A;  1QTX A;  2K2F A;  5CSF A;  1R6P A;  3LCP C;  1ODB A;  2JRF A;  1K94 A;  1IJ6 A;  2K0J A;  2LM5 A;  3JVT B;  1XVJ A;  2M8U A;  2ZN9 A;  2E30 A;  1NCX A;  1U5I A;  1B8C A;  4FTG A;  3AKB A;  1F70 A;  1W7I B;  4ORB B;  1KWO C;  3CR5 X;  3EVV A;  2GGZ A;  4YGE B;  1JUO A;  1IJ5 A;  1SPY A;  1LA3 A;  1IG5 A;  2L0P A;  2FCD A;  3IF7 A;  1MUX A;  1TCF A;  4R1E A;  3SG2 A;  4WQ3 A;  3VRN A;  1DF0 B;  2JNX A;  2LP2 A;  2NCO A;  3RM1 A;  1BT6 A;  3DVK A;  2M97 A;  1WRL A;  1HT9 A;  1QVI Y;  3H4S E;  1IQ5 A;  3SG3 A;  3OX5 A;  1GQM A;  2MLE C;  1RWY A;  4NQG A;  2KYF A;  2JUL A;  1ALW A;  1K2H A;  1L2O C;  2MAZ A;  1E8A A;  2QAC A;  3GK4 X;  4HRH A;  3TS5 C;  2BL0 B;  1OMD A;  2HQW A;  1PSR A;  1ZMZ A;  1L2O B;  2LV7 A;  1CDP A;  1BG1 A;  2H61 A;  1YVH A;  1CMG A;  4N1F A;  2K8M B;  1U5I B;  1AUI B;  3VRQ A;  5KSZ A;  1BOC A;  2JXL A;  1JF2 A;  1PK0 D;  1FI6 A;  1QIW A;  2A4J A;  1CLM A;  1QX7 A;  3PM8 A;  1VRK A;  2BEC A;  2LVI A;  1C7W A;  5PAL A;  1M45 A;  3OB2 B;  1KCY A;  2JC2 A;  4C0L A;  1CTR A;  3LK1 A;  1QVI Z;  2MHH A;  3ICB A;  2L50 A;  5ER5 A;  4GGN A;  1SNL A;  5I2L A;  2K7O A;  5CSN A;  2LVJ A;  4NDD A;  4PDZ A;  4PE4 A;  2OS8 B;  2SCP A;  4YI9 A;  4P5O E;  2JT3 A;  2Q91 A;  1NX2 A;  5JOL A;  2NCP A;  1KQM C;  2KI4 C;  1AVS A;  1CFD A;  2JPT A;  5D69 A;  1B7T Y;  1PUL A;  5AXI A;  1UP5 A;  4M2P A;  1KK8 C;  1KQM B;  2JOJ A;  4CFR A;  2H61 C;  1NWD A;  2IS9 A;  1MHO A;  1DJZ A;  3CWG A;  2NXQ A;  5I8N A;  4PAL A;  4GFT A;  2BBM A;  2LHI A;  3VGO A;  3WNX B;  1AK8 A;  3GOF A;  5CSI A;  1TN4 A;  4AOM A;  4AQI A;  5I2O A;  1QLK A;  2E6W A;  5AER A;  2JXC A;  4U8D A;  1FBV A;  3SJS A;  1N0Y A;  4YGA A;  1ZUZ A;  1YUR A;  4PCW A;  1ZFS A;  4MZJ A;  1MQ1 A;  1W7J B;  1IRJ A;  1SYM A;  2M9G A;  3DF0 A;  1IKU A;  1WLM A;  4ZCV A;  5HKZ A;  5AAN A;  1H4B A;  2G2B A;  2F3Z A;  2M1K B;  2ZRS A;  5I2Q A;  1YRT B;  1EXR A;  1B7T Z;  2Q4U A;  4M2O A;  1QV1 A;  2AMI A;  2MLF C;  1SL7 A;  3BUN B;  1MXE A;  1Y0V H;  4M2Q A;  1GJY A;  3BUM B;  5ER4 X;  2LC5 A;  1NUB A;  2Y1M A;  5J3X A;  1UHI A;  1XFV O;  2HQ8 A;  1UHK A;  4MVF A;  4HRG A;  1WDC C;  1J7O A;  1YTZ C;  2KFG A;  2BCA A;  3FWC A;  1YUS A;  4BY4 A;  4BY5 A;  1K8U A;  4PHJ A;  4OV2 A;  1QIV A;  4GNK B;  1DF0 A;  4JWQ A;  4USL A;  5CPV A;  1XK4 A;  3TDU A;  1SBJ A;  2ZN8 A;  1SR6 B;  1BJF A;  3D10 A;  4ETO A;  4YI8 A;  1CFC A;  3I5I B;  1TNX A;  1UHH A;  1EJ3 A;  2LLT A;  2KQY A;  2KI6 D;  2F2P A;  1JBA A;  3DF0 B;  1JFJ A;  2EC6 B;  1XA5 A;  4YGB B;  2M3W A;  3OP0 A;  3VRR A;  4CID A;  2H2K A;  2JT0 A;  3JVT C;  3O4Y A;  5F6T A;  1B1G A;  1NX0 A;  2CBL A;  2PSR A;  1TNP A;  3TDI A;  3SG6 A;  1JSA A;  3ZNI A;  1DJG A;  1K93 D;  2I18 A;  1DJY A;  1MR8 A;  4GAO A;  1NX3 A;  3O6B A;  1DT7 B;  3NSO A;  4PE0 A;  1GGW A;  1CDL A;  2M0R A;  1K9U A;  5B8I B;  1QAS A;  1SCV A;  2HF5 A;  3JTD C;  1XO5 A;  1F54 A;  2LMT A;  1DTL A;  1ZOT B;  2ZNE A;  1KK7 Y;  2ZND A;  4GGF A;  4QJ3 B;  4OCI A;  3JTD B;  1XFX O;  1XK4 C;  1S5G Y;  3DD4 A;  4ORA B;  5DKR A;  4C0K A;  2JNF A;  4HRE E;  2R2I A;  3IQQ A;  3SG5 A;  2I7A A;  1S36 A;  3FIA A;  3KF9 A;  3EKJ A;  2BL0 C;  2M1U A;  1OZS A;  1CLB A;  1KQV A;  2WCE A;  4DS7 A;  4F0Z B;  3EK7 A;  2BKI B;  3EVR A;  2LE9 B;  2CNP A;  4L9M A;  1REC A;  2EGD A;  1NIW A;  3SIA A;  1FW4 A;  2JWW A;  2L4I A;  2WC8 A;  3NSK A;  3PAL A;  3CLN A;  5HKW A;  1J7P A;  1TNQ A;  1CNP A;  3CS1 A;  1KSO A;  1BF5 A;  3MSE B;  1JF0 A;  3NSL A;  1KFU S;  2LVK A;  1YUT A;  1DJW A;  3GK1 A;  1KK7 Z;  4GGF C;  1NPQ A;  5AFP A;  1S6I A;  3OHM B;  1S5G Z;  3PN7 C;  4MN0 A;  4MEW A;  2WCB A;  3I5G C;  2B1U A;  1KFX S;  1ZAC A;  2GV5 A;  3PN7 B; 
#chains in the Genus database with same CATH topology
 2KLE A;  1MXL C;  3I5G B;  2LNK A;  4MZK A;  3EK8 A;  1UHJ A;  2OS8 C;  3WHU B;  1DEK A;  3DVM A;  4YBH B;  5GQQ C;  2MA2 A;  2L5X B;  2PAL A;  3DXL A;  2M7L A;  5HLO A;  4I5J A;  2K7B A;  2LUC A;  1N65 A;  3TDZ A;  5IBW A;  3N7H A;  1CKK A;  1K95 A;  4NDC A;  1NX1 A;  1WRK A;  1K9K A;  4F7F A;  1RK9 A;  2NZ0 A;  5K89 A;  1TOP A;  1M63 B;  2WCL A;  1YVL A;  1CLL A;  3HCM A;  3F45 A;  2KHN A;  3VRO A;  3S0A A;  1XFU O;  2WCJ A;  1IH0 A;  1OW4 A;  1C7V A;  2F3Y A;  1F4Q A;  3BQ3 A;  1LVC D;  2L2E A;  4OVN F;  1TUJ A;  1OMV A;  3QME A;  2QEV A;  3C1V A;  3KPX A;  1PVB A;  1S1E A;  2Y4Q A;  2ZFD A;  1HQV A;  1QJT A;  3K1E A;  1OOJ A;  1DVI A;  1S26 D;  4JQ0 D;  1NCZ A;  3CTN A;  2MBX A;  1OOF A;  2OTG C;  1RTP 1;  1A4P A;  1JWD A;  1DQE A;  2KNE A;  3NGV A;  1UUS A;  5G08 A;  3BUW B;  1K96 A;  2OTG B;  4P2Y B;  4PE7 A;  3PFV A;  5KU1 A;  5KTY A;  1F71 A;  3TUY B;  4UPG A;  2KBM A;  1J7R A;  1PVA A;  1DJX A;  4D1E A;  1AP4 A;  1SCM B;  2K2A A;  2WCM A;  1SSE B;  3UNW A;  1GGZ A;  3OGN A;  4MBE A;  3SG7 A;  1L7Z A;  1SY9 A;  2LLU A;  2ZKM X;  4GBA A;  1S6C A;  1QWV A;  4XJK A;  1C3Y A;  1KFU L;  1WY9 A;  1DC1 A;  2BCX A;  2WCF A;  2KFH A;  1OSA A;  3CDN A;  4PHN A;  2DOQ A;  3E3R A;  3FE9 A;  4YRU A;  2PRU A;  1Z4H A;  3KO0 A;  1A75 A;  1KFX L;  2NLN A;  2BCB A;  4E68 A;  2P70 A;  3I5H B;  1IWQ A;  5HL1 A;  1BOD A;  1B8R A;  2KAY A;  1S6J A;  2L5Y A;  4QJ4 B;  3PAT A;  2JZI A;  1SR6 C;  4IL1 A;  2QDI A;  1YX8 A;  2LMV A;  3D78 A;  3I5I C;  2MRD A;  4PT1 A;  3IQO A;  2WCK A;  4INW A;  1M39 A;  4Q04 A;  2K7C A;  2BBN A;  2EC6 C;  1AJ5 A;  1OMR A;  3I5F C;  2F8P A;  1CDM A;  1V1F A;  1DGU A;  2CT9 A;  3O78 A;  5JJG A;  3DVE A;  2LAN A;  3OB1 B;  1Y1U A;  1SRA A;  2KGB C;  3A4U B;  3I5F B;  4WQ2 A;  1CMF A;  2P6B B;  1QLS A;  1B8L A;  2LVV A;  1IQ3 A;  1LA0 A;  1BU3 A;  2PVB A;  2YGU A;  2BE4 A;  1CDN A;  1EG3 A;  1SKT A;  1T14 A;  4MZL A;  3CZ1 A;  2LLS A;  1ALV A;  1X02 A;  4XJK B;  3WXA A;  1M31 A;  1RRO A;  1C07 A;  2L51 A;  5EL2 A;  3CZT X;  3S0F A;  1K9P A;  1WRZ A;  1SL8 A;  1J7Q A;  2JTZ A;  4ORC B;  2BE6 A;  3LLE A;  3OX6 A;  4I5L B;  1A03 A;  1FPW A;  2KYC A;  2K61 A;  1A75 B;  3D0Y A;  5HKY A;  1A29 A;  3R1V A;  1JFK A;  4N1G A;  1TTX A;  3PLF B;  3HX4 A;  3NHI A;  3CR2 A;  4JKT A;  3B6X A;  2CTN A;  2QPT A;  3AAK A;  2O5G A;  3GK2 A;  3L47 A;  1RFJ A;  2K7D A;  4MRX A;  3KHE A;  1BMO A;  3BUO B;  4A4C A;  4INX A;  5BPJ A;  3PSR A;  2F2O A;  4CPV A;  1XFY O;  1NYA A;  5TNC A;  2KGR A;  2M29 A;  5D7F A;  1BR1 B;  2CXJ A;  1KWO B;  1OQP A;  2PYQ A;  4CLN A;  4CFQ A;  1AJ4 A;  1QX5 B;  3EG5 B;  2LUX A;  1A2X A;  2HET A;  3CR4 X;  1RJV A;  1DJH A;  2F33 A;  1CFF A;  4DIR A;  1MF8 B;  4C0J A;  3QRX A;  3S0G A;  1NP8 A;  1NSH A;  2LHL A;  4MRY A;  3AAJ A;  1UHN A;  2JU0 A;  4I5K A;  1QV0 A;  3K21 A;  1OZO A;  4FQO A;  3D0Y B;  4MLW A;  1SK6 D;  2O60 A;  3SS4 A;  2I2R E;  3TS5 B;  2VRG A;  2L98 A;  2LAP A;  4IJ7 A;  4GUK A;  1J55 A;  4AQJ A;  2WOS A;  3S0B A;  1Y1A A;  2KBI A;  5AEQ A;  1F8H A;  1TCO B;  4NDB A;  3RZS A;  2JQ6 A;  5HLV A;  3FS7 A;  1DGV A;  1J1E A;  1KSM A;  3BOW A;  3NSI A;  2KFF A;  4MSP A;  3M0W A;  2Y1N A;  2LP3 A;  1YUU A;  4FQT A;  1H8B A;  2GGM A;  2KI6 C;  1YX7 A;  3AKA A;  3NXA A;  2L2C A;  1CM1 A;  1D1O A;  1FF1 A;  1M46 A;  1UWO A;  3BUX B;  2M7N A;  2KDH A;  1EG4 A;  1TIZ A;  2PMY A;  1J1D A;  2KSP A;  4OR9 B;  4YGC B;  3L4L A;  2KOT A;  2G9B A;  2WND A;  1AHR A;  4PE1 A;  1TRF A;  2FCE A;  1BR4 B;  2P71 A;  3WHT B;  1V1G A;  2FJY A;  3SG4 A;  2AUC A;  1OE9 B;  1G8I A;  5HYD A;  4OZD A;  1CFP A;  2ZRT A;  4A4B A;  3FWB A;  3TUY C;  1R2U A;  5CSJ A;  2FJU B;  3A8R A;  2BAP A;  1Q80 A;  2KI4 B;  3FE8 A;  4TNC A;  2PAS A;  1S3P A;  1SCM C;  1B9A A;  2KQ6 A;  4I5N B;  1DMO A;  1KK8 B;  2RGI A;  1DEL A;  4QJ5 B;  1EH2 A;  3EVU A;  4N5X A;  4WRI A;  4ZCU A;  1YRU B;  1CM4 A;  2OPO A;  1MWN A;  4HSZ A;  1DJI A;  3BOW B;  1SL9 A;  2I94 A;  2TN4 A;  1QAT A;  3BFA A;  4DCK A;  1G4Y R;  2WOR A;  2EHB A;  2H8V A;  1N2D A;  5DIC A;  1IGV A;  2PQL A;  1B4C A;  1F55 A;  4XYN A;  3S0E A;  3I5H C;  1LXF C;  2COL B;  4JPZ B;  2LCP A;  2JT8 A;  1SMG A;  2MJW B;  3CGA A;  1XFZ O;  1LIN A;  1YR5 A;  1UUR A;  3DVJ A;  1TNW A;  3RLZ A;  3D74 A;  1CB1 A;  3ZWH A;  2KAX A;  5DKQ A;  2M49 B;  3BXK A;  2ISD A;  3VRP A;  1LKJ A;  1JC2 A;  1B47 A;  2KAV A;  3EK4 A;  2Y5I A;  4PHK A;  5FYX A;  1QXP A;  3O2P A;  3CYZ A;  2BKH B;  1NCY A;  2JTT A;  2FOT A;  4DUQ A;  4YGD B;  1SW8 A;  1PRW A;  1QX2 A;  1XFW O;  2HPS A;  4PHM A;  3D76 A;  3BYA A;  1WDC B;  3R1O A;  4DRW A;  2CCM A;  2SAS A;  1Y6W A;  2AAO A;  1G33 A;  1PAL A;  1WLZ A;  1FI5 A;  1XYD A;  1QS7 A;  2LMU A;  3TZ1 A;  4OKH A;  1Y1X A;  1BLQ A;  1PSB A;  4GPL B;  3LL8 B;  2V53 A;  3LK0 A;  1F4O A;  2D8N A;  2L4H A;  3SIB A;  3EKH A;  1K90 D;  3KEV A;  1OOH A;  5DKN A;  4ICB A;  1EL4 A;  3VB1 A;  1QTX A;  2K2F A;  5CSF A;  1R6P A;  3BFH A;  3CZ0 A;  3LCP C;  1ODB A;  2JRF A;  2KLD A;  1K94 A;  1IJ6 A;  2K0J A;  2LM5 A;  3JVT B;  1XVJ A;  3NHT A;  2M8U A;  2ZN9 A;  2E30 A;  1NCX A;  1U5I A;  1B8C A;  4FTG A;  3AKB A;  1F70 A;  1W7I B;  4ORB B;  5FI7 A;  1KWO C;  3CR5 X;  3EVV A;  2GGZ A;  4YGE B;  1JUO A;  1IJ5 A;  1SPY A;  1LA3 A;  1IG5 A;  2L0P A;  2FCD A;  2QEH A;  3IF7 A;  1MUX A;  1TCF A;  4R1E A;  3SG2 A;  4WQ3 A;  3VRN A;  1DF0 B;  2JNX A;  2LP2 A;  2NCO A;  3RM1 A;  3D77 A;  1BT6 A;  3DVK A;  2M97 A;  1WRL A;  3BJH A;  1HT9 A;  1OOG A;  1QVI Y;  1IQ5 A;  3H4S E;  3SG3 A;  3OX5 A;  1GQM A;  3FE6 A;  2MLE C;  1RWY A;  4NQG A;  2KYF A;  2JUL A;  2WC5 A;  1ALW A;  1K2H A;  1L2O C;  2MAZ A;  1E8A A;  2QAC A;  3GK4 X;  4HRH A;  3TS5 C;  2BL0 B;  1OMD A;  2HQW A;  1PSR A;  1ZMZ A;  1L2O B;  2LV7 A;  3B87 A;  5I94 A;  1CDP A;  4KYN A;  1BG1 A;  2H61 A;  1YVH A;  1CMG A;  4N1F A;  2K8M B;  1U5I B;  1AUI B;  1W9Z A;  3PM2 A;  3VRQ A;  5KSZ A;  1BOC A;  2JXL A;  1JF2 A;  1PK0 D;  1FI6 A;  1QIW A;  2A4J A;  1CLM A;  1ORG A;  1QX7 A;  3PM8 A;  1VRK A;  2BEC A;  2LVI A;  1C7W A;  5PAL A;  1M45 A;  3OB2 B;  1KCY A;  2JC2 A;  4C0L A;  1CTR A;  3LK1 A;  1QVI Z;  3DZT A;  5D3O A;  1Z2C B;  2MHH A;  3ICB A;  2L50 A;  5ER5 A;  4GGN A;  1SNL A;  5I2L A;  2K7O A;  5CSN A;  2LVJ A;  3O4X A;  4NDD A;  4PDZ A;  4PE4 A;  1TWO A;  2OS8 B;  2SCP A;  3OBV A;  4YI9 A;  4P5O E;  2JT3 A;  2Q91 A;  1NX2 A;  5JOL A;  2NCP A;  1KQM C;  2KI4 C;  1AVS A;  1CFD A;  2JPT A;  3CZ2 A;  5D69 A;  1B7T Y;  1PUL A;  5AXI A;  1UP5 A;  2QEO A;  2GTE A;  3SS3 A;  4M2P A;  1KK8 C;  1KQM B;  2JOJ A;  4CFR A;  2H61 C;  1NWD A;  2BNX A;  2IS9 A;  1MHO A;  3BFB A;  3D75 A;  5FI6 A;  1DJZ A;  3CWG A;  2NXQ A;  5I8N A;  4PAL A;  3PJI A;  4GFT A;  2BBM A;  2LHI A;  3VGO A;  3WNX B;  1AK8 A;  2KPH A;  3GOF A;  5CSI A;  1TN4 A;  4AOM A;  4AQI A;  5I2O A;  1QLK A;  2E6W A;  5AER A;  2JXC A;  4U8D A;  1FBV A;  3SJS A;  1N0Y A;  4YGA A;  1ZUZ A;  1YUR A;  3Q8I A;  1ZFS A;  2QEB A;  4MZJ A;  1MQ1 A;  1W7J B;  4PCW A;  1IRJ A;  1SYM A;  2M9G A;  3DY9 A;  3DF0 A;  1IKU A;  1WLM A;  3S0D A;  4ZCV A;  5HKZ A;  5AAN A;  1H4B A;  1XFR A;  2G2B A;  2F3Z A;  2M1K B;  2ZRS A;  3SS5 A;  1YRT B;  5I2Q A;  1EXR A;  1B7T Z;  2Q4U A;  4M2O A;  1QV1 A;  2AMI A;  2MLF C;  1SL7 A;  3BUN B;  1MXE A;  1Y0V H;  1TUZ A;  4M2Q A;  1GJY A;  3BUM B;  5ER4 X;  3UO9 A;  2LC5 A;  1NUB A;  2Y1M A;  5J3X A;  1UHI A;  1XFV O;  2HQ8 A;  1C3Z A;  1UHK A;  4MVF A;  4HRG A;  1WDC C;  1J7O A;  1YTZ C;  2KFG A;  2BCA A;  3FWC A;  1YUS A;  4BY4 A;  4BY5 A;  1K8U A;  3IVT A;  3CAB A;  4OV2 A;  1QIV A;  4PHJ A;  4GNK B;  1DF0 A;  4JWQ A;  4USL A;  5CPV A;  1XK4 A;  3TDU A;  1SBJ A;  2ZN8 A;  1SR6 B;  1BJF A;  3D10 A;  1OOI X;  4ETO A;  4YI8 A;  1CFC A;  3I5I B;  1TNX A;  1UHH A;  1EJ3 A;  2LLT A;  3B7A A;  2KQY A;  2KI6 D;  2F2P A;  1JBA A;  3DF0 B;  1JFJ A;  2EC6 B;  1XA5 A;  4YGB B;  2M3W A;  3OP0 A;  2JPO A;  3VRR A;  4CID A;  2H2K A;  2JT0 A;  3JVT C;  3O4Y A;  5F6T A;  1B1G A;  1NX0 A;  2CBL A;  2PSR A;  1TNP A;  1IIO A;  3TDI A;  3SG6 A;  1JSA A;  3ZNI A;  1DJG A;  1K93 D;  2I18 A;  1DJY A;  1MR8 A;  4GAO A;  1NX3 A;  3O6B A;  1DT7 B;  3NSO A;  4PE0 A;  1GGW A;  1CDL A;  2M0R A;  1K9U A;  3V2L A;  3B86 A;  1QAS A;  1SCV A;  5B8I B;  2HF5 A;  3JTD C;  1XO5 A;  1F54 A;  2LMT A;  1DTL A;  1ZOT B;  2ZNE A;  1KK7 Y;  2ZND A;  4GGF A;  4QJ3 B;  4OCI A;  3JTD B;  1XFX O;  1XK4 C;  1S5G Y;  2WC6 A;  3DD4 A;  4ORA B;  5DKR A;  4C0K A;  2JNF A;  1P28 A;  4HRE E;  2R2I A;  3IQQ A;  3SG5 A;  2I7A A;  1S36 A;  3FIA A;  3KF9 A;  3EKJ A;  2BL0 C;  2M1U A;  1OZS A;  1CLB A;  1KQV A;  2ERB A;  2WCE A;  4DS7 A;  3L4A A;  3EK7 A;  2BKI B;  3EVR A;  4F0Z B;  2LE9 B;  2CNP A;  4L9M A;  1REC A;  2EGD A;  1NIW A;  3SIA A;  1FW4 A;  2JWW A;  2L4I A;  2WC8 A;  1LS8 A;  3NSK A;  3PAL A;  2WCH A;  3CLN A;  5HKW A;  1J7P A;  1TNQ A;  1CNP A;  1GM0 A;  3CS1 A;  1KSO A;  1BF5 A;  3R72 A;  3B88 A;  3MSE B;  4JD9 A;  1JF0 A;  3NSL A;  5FI2 A;  1KFU S;  2K60 A;  2LVK A;  1YUT A;  1DJW A;  3GK1 A;  1KK7 Z;  4GGF C;  1NPQ A;  3R1P A;  5AFP A;  1S6I A;  3OHM B;  1S5G Z;  3PN7 C;  4MN0 A;  4MEW A;  2WCB A;  3D73 A;  3DYE A;  3I5G C;  2B1U A;  1KFX S;  1ZAC A;  2GV5 A;  3PN7 B; 
#chains in the Genus database with same CATH homology
 1MXL C;  3I5G B;  2LNK A;  4MZK A;  3EK8 A;  1UHJ A;  2OS8 C;  3WHU B;  4YBH B;  3DVM A;  5GQQ C;  2MA2 A;  2L5X B;  2PAL A;  2M7L A;  5HLO A;  4I5J A;  2K7B A;  2LUC A;  1N65 A;  3TDZ A;  5IBW A;  1CKK A;  1K95 A;  4NDC A;  1NX1 A;  1WRK A;  1K9K A;  1RK9 A;  2NZ0 A;  5K89 A;  1TOP A;  1M63 B;  1YVL A;  1CLL A;  3HCM A;  3F45 A;  2KHN A;  3VRO A;  1XFU O;  1IH0 A;  1C7V A;  2F3Y A;  1F4Q A;  3BQ3 A;  1LVC D;  2L2E A;  4OVN F;  1OMV A;  3C1V A;  3KPX A;  1PVB A;  1S1E A;  2Y4Q A;  2ZFD A;  1HQV A;  1QJT A;  1OOJ A;  1DVI A;  1S26 D;  4JQ0 D;  1NCZ A;  3CTN A;  2MBX A;  2OTG C;  1RTP 1;  1A4P A;  1JWD A;  2KNE A;  1UUS A;  5G08 A;  3BUW B;  1K96 A;  2OTG B;  4P2Y B;  4PE7 A;  3PFV A;  5KU1 A;  5KTY A;  1F71 A;  3TUY B;  4UPG A;  2KBM A;  1J7R A;  1PVA A;  1DJX A;  4D1E A;  1AP4 A;  1SCM B;  2K2A A;  1GGZ A;  4MBE A;  3SG7 A;  1L7Z A;  1SY9 A;  2LLU A;  2ZKM X;  4GBA A;  1S6C A;  4XJK A;  1KFU L;  1WY9 A;  2BCX A;  2WCF A;  2KFH A;  1OSA A;  4PHN A;  2DOQ A;  3E3R A;  4YRU A;  2PRU A;  3KO0 A;  1A75 A;  1KFX L;  2NLN A;  2BCB A;  4E68 A;  3I5H B;  1IWQ A;  1BOD A;  1B8R A;  2KAY A;  1S6J A;  4QJ4 B;  3PAT A;  2JZI A;  1SR6 C;  4IL1 A;  1YX8 A;  2LMV A;  3I5I C;  2MRD A;  3IQO A;  4Q04 A;  1M39 A;  2K7C A;  2BBN A;  2EC6 C;  1AJ5 A;  1OMR A;  3I5F C;  2F8P A;  1CDM A;  1V1F A;  1DGU A;  2CT9 A;  3O78 A;  5JJG A;  3DVE A;  2LAN A;  3OB1 B;  1Y1U A;  1SRA A;  2KGB C;  3A4U B;  3I5F B;  4WQ2 A;  1CMF A;  2P6B B;  1QLS A;  1B8L A;  2LVV A;  1IQ3 A;  1LA0 A;  1BU3 A;  2PVB A;  2BE4 A;  1CDN A;  1EG3 A;  1SKT A;  4MZL A;  2LLS A;  1ALV A;  1X02 A;  4XJK B;  3WXA A;  1M31 A;  1RRO A;  1C07 A;  2L51 A;  3CZT X;  1K9P A;  1WRZ A;  1SL8 A;  1J7Q A;  2JTZ A;  4ORC B;  2BE6 A;  3LLE A;  3OX6 A;  4I5L B;  1A03 A;  1FPW A;  2KYC A;  2K61 A;  1A75 B;  3D0Y A;  5HKY A;  1A29 A;  1JFK A;  4N1G A;  1TTX A;  3PLF B;  3HX4 A;  3CR2 A;  2CTN A;  2QPT A;  3AAK A;  2O5G A;  3GK2 A;  1RFJ A;  2K7D A;  4MRX A;  3KHE A;  1BMO A;  3BUO B;  4A4C A;  5BPJ A;  3PSR A;  2F2O A;  4CPV A;  1XFY O;  1NYA A;  5TNC A;  2KGR A;  2M29 A;  5D7F A;  1BR1 B;  2CXJ A;  1KWO B;  1OQP A;  4CLN A;  4CFQ A;  1AJ4 A;  1QX5 B;  2LUX A;  1A2X A;  2HET A;  3CR4 X;  1RJV A;  1DJH A;  2F33 A;  1CFF A;  4DIR A;  1MF8 B;  4C0J A;  3QRX A;  1NP8 A;  1NSH A;  2LHL A;  4MRY A;  3AAJ A;  1UHN A;  2JU0 A;  4I5K A;  1QV0 A;  3K21 A;  1OZO A;  4FQO A;  3D0Y B;  4MLW A;  1SK6 D;  2O60 A;  2I2R E;  3TS5 B;  2VRG A;  2L98 A;  2LAP A;  4AQJ A;  4GUK A;  1J55 A;  2WOS A;  1Y1A A;  2KBI A;  5AEQ A;  1F8H A;  1TCO B;  4NDB A;  2JQ6 A;  5HLV A;  3FS7 A;  1DGV A;  1J1E A;  1KSM A;  3BOW A;  3NSI A;  2KFF A;  4MSP A;  3M0W A;  2Y1N A;  2LP3 A;  1YUU A;  1H8B A;  2GGM A;  2KI6 C;  1YX7 A;  3AKA A;  3NXA A;  1CM1 A;  1D1O A;  1FF1 A;  1M46 A;  1UWO A;  3BUX B;  2M7N A;  2KDH A;  1EG4 A;  1TIZ A;  2PMY A;  1J1D A;  2KSP A;  4OR9 B;  4YGC B;  2KOT A;  2G9B A;  2WND A;  1AHR A;  4PE1 A;  1TRF A;  2FCE A;  1BR4 B;  3WHT B;  1V1G A;  5HYD A;  3SG4 A;  2AUC A;  1OE9 B;  1G8I A;  1CFP A;  2ZRT A;  4A4B A;  3FWB A;  3TUY C;  1R2U A;  5CSJ A;  2FJU B;  3A8R A;  1Q80 A;  2KI4 B;  4TNC A;  2PAS A;  1S3P A;  1SCM C;  1B9A A;  2KQ6 A;  4I5N B;  1DMO A;  1KK8 B;  2RGI A;  4QJ5 B;  1EH2 A;  3EVU A;  4N5X A;  4WRI A;  4ZCU A;  1YRU B;  1CM4 A;  2OPO A;  1MWN A;  4HSZ A;  1DJI A;  3BOW B;  1SL9 A;  2I94 A;  2TN4 A;  1QAT A;  4DCK A;  1G4Y R;  2WOR A;  2EHB A;  1N2D A;  1IGV A;  1B4C A;  1F55 A;  4XYN A;  3I5H C;  1LXF C;  2COL B;  4JPZ B;  2LCP A;  2JT8 A;  1SMG A;  2MJW B;  3CGA A;  1XFZ O;  1LIN A;  1YR5 A;  1UUR A;  3DVJ A;  1TNW A;  3RLZ A;  1CB1 A;  3ZWH A;  2KAX A;  5DKQ A;  2M49 B;  3BXK A;  2ISD A;  3VRP A;  1LKJ A;  1JC2 A;  1B47 A;  2KAV A;  3EK4 A;  2Y5I A;  4PHK A;  5FYX A;  1QXP A;  3O2P A;  2BKH B;  1NCY A;  2JTT A;  2FOT A;  4DUQ A;  4YGD B;  1SW8 A;  1PRW A;  1QX2 A;  1XFW O;  2HPS A;  4PHM A;  3BYA A;  1WDC B;  4DRW A;  2CCM A;  2SAS A;  1Y6W A;  2AAO A;  1G33 A;  1PAL A;  1WLZ A;  1FI5 A;  1XYD A;  1QS7 A;  2LMU A;  3TZ1 A;  4OKH A;  1Y1X A;  1BLQ A;  1PSB A;  4GPL B;  3LL8 B;  2V53 A;  3LK0 A;  1F4O A;  2D8N A;  2L4H A;  3SIB A;  3EKH A;  1K90 D;  3KEV A;  5DKN A;  4ICB A;  1EL4 A;  1QTX A;  2K2F A;  5CSF A;  1R6P A;  3LCP C;  1ODB A;  2JRF A;  1K94 A;  1IJ6 A;  2K0J A;  2LM5 A;  3JVT B;  1XVJ A;  2M8U A;  2ZN9 A;  2E30 A;  1NCX A;  1U5I A;  1B8C A;  4FTG A;  3AKB A;  1F70 A;  1W7I B;  4ORB B;  1KWO C;  3CR5 X;  3EVV A;  2GGZ A;  4YGE B;  1JUO A;  1IJ5 A;  1SPY A;  1LA3 A;  1IG5 A;  2L0P A;  2FCD A;  3IF7 A;  1MUX A;  1TCF A;  4R1E A;  3SG2 A;  4WQ3 A;  3VRN A;  1DF0 B;  2JNX A;  2LP2 A;  2NCO A;  3RM1 A;  1BT6 A;  3DVK A;  2M97 A;  1WRL A;  1HT9 A;  1QVI Y;  3H4S E;  1IQ5 A;  3SG3 A;  3OX5 A;  1GQM A;  2MLE C;  1RWY A;  4NQG A;  2KYF A;  2JUL A;  1ALW A;  1K2H A;  1L2O C;  2MAZ A;  1E8A A;  2QAC A;  3GK4 X;  4HRH A;  3TS5 C;  2BL0 B;  1OMD A;  2HQW A;  1PSR A;  1ZMZ A;  1L2O B;  2LV7 A;  1CDP A;  1BG1 A;  2H61 A;  1YVH A;  1CMG A;  4N1F A;  2K8M B;  1U5I B;  1AUI B;  3VRQ A;  5KSZ A;  1BOC A;  2JXL A;  1JF2 A;  1PK0 D;  1FI6 A;  1QIW A;  2A4J A;  1CLM A;  1QX7 A;  3PM8 A;  1VRK A;  2BEC A;  2LVI A;  1C7W A;  5PAL A;  1M45 A;  3OB2 B;  1KCY A;  2JC2 A;  4C0L A;  1CTR A;  3LK1 A;  1QVI Z;  2MHH A;  3ICB A;  2L50 A;  5ER5 A;  4GGN A;  1SNL A;  5I2L A;  2K7O A;  5CSN A;  2LVJ A;  4NDD A;  4PDZ A;  4PE4 A;  2OS8 B;  2SCP A;  4YI9 A;  4P5O E;  2JT3 A;  2Q91 A;  1NX2 A;  5JOL A;  2NCP A;  1KQM C;  2KI4 C;  1AVS A;  1CFD A;  2JPT A;  5D69 A;  1B7T Y;  1PUL A;  5AXI A;  1UP5 A;  4M2P A;  1KK8 C;  1KQM B;  2JOJ A;  4CFR A;  2H61 C;  1NWD A;  2IS9 A;  1MHO A;  1DJZ A;  3CWG A;  2NXQ A;  5I8N A;  4PAL A;  4GFT A;  2BBM A;  2LHI A;  3VGO A;  3WNX B;  1AK8 A;  3GOF A;  5CSI A;  1TN4 A;  4AOM A;  4AQI A;  5I2O A;  1QLK A;  2E6W A;  5AER A;  2JXC A;  4U8D A;  1FBV A;  3SJS A;  1N0Y A;  4YGA A;  1ZUZ A;  1YUR A;  4PCW A;  1ZFS A;  4MZJ A;  1MQ1 A;  1W7J B;  1IRJ A;  1SYM A;  2M9G A;  3DF0 A;  1IKU A;  1WLM A;  4ZCV A;  5HKZ A;  5AAN A;  1H4B A;  2G2B A;  2F3Z A;  2M1K B;  2ZRS A;  5I2Q A;  1YRT B;  1EXR A;  1B7T Z;  2Q4U A;  4M2O A;  1QV1 A;  2AMI A;  2MLF C;  1SL7 A;  3BUN B;  1MXE A;  1Y0V H;  4M2Q A;  1GJY A;  3BUM B;  5ER4 X;  2LC5 A;  1NUB A;  2Y1M A;  5J3X A;  1UHI A;  1XFV O;  2HQ8 A;  1UHK A;  4MVF A;  4HRG A;  1WDC C;  1J7O A;  1YTZ C;  2KFG A;  2BCA A;  3FWC A;  1YUS A;  4BY4 A;  4BY5 A;  1K8U A;  4PHJ A;  4OV2 A;  1QIV A;  4GNK B;  1DF0 A;  4JWQ A;  4USL A;  5CPV A;  1XK4 A;  3TDU A;  1SBJ A;  2ZN8 A;  1SR6 B;  1BJF A;  3D10 A;  4ETO A;  4YI8 A;  1CFC A;  3I5I B;  1TNX A;  1UHH A;  1EJ3 A;  2LLT A;  2KQY A;  2KI6 D;  2F2P A;  1JBA A;  3DF0 B;  1JFJ A;  2EC6 B;  1XA5 A;  4YGB B;  2M3W A;  3OP0 A;  3VRR A;  4CID A;  2H2K A;  2JT0 A;  3JVT C;  3O4Y A;  5F6T A;  1B1G A;  1NX0 A;  2CBL A;  2PSR A;  1TNP A;  3TDI A;  3SG6 A;  1JSA A;  3ZNI A;  1DJG A;  1K93 D;  2I18 A;  1DJY A;  1MR8 A;  4GAO A;  1NX3 A;  3O6B A;  1DT7 B;  3NSO A;  4PE0 A;  1GGW A;  1CDL A;  2M0R A;  1K9U A;  5B8I B;  1QAS A;  1SCV A;  2HF5 A;  3JTD C;  1XO5 A;  1F54 A;  2LMT A;  1DTL A;  1ZOT B;  2ZNE A;  1KK7 Y;  2ZND A;  4GGF A;  4QJ3 B;  4OCI A;  3JTD B;  1XFX O;  1XK4 C;  1S5G Y;  3DD4 A;  4ORA B;  5DKR A;  4C0K A;  2JNF A;  4HRE E;  2R2I A;  3IQQ A;  3SG5 A;  2I7A A;  1S36 A;  3FIA A;  3KF9 A;  3EKJ A;  2BL0 C;  2M1U A;  1OZS A;  1CLB A;  1KQV A;  2WCE A;  4DS7 A;  4F0Z B;  3EK7 A;  2BKI B;  3EVR A;  2LE9 B;  2CNP A;  4L9M A;  1REC A;  2EGD A;  1NIW A;  3SIA A;  1FW4 A;  2JWW A;  2L4I A;  2WC8 A;  3NSK A;  3PAL A;  3CLN A;  5HKW A;  1J7P A;  1TNQ A;  1CNP A;  3CS1 A;  1KSO A;  1BF5 A;  3MSE B;  1JF0 A;  3NSL A;  1KFU S;  2LVK A;  1YUT A;  1DJW A;  3GK1 A;  1KK7 Z;  4GGF C;  1NPQ A;  5AFP A;  1S6I A;  3OHM B;  1S5G Z;  3PN7 C;  4MN0 A;  4MEW A;  2WCB A;  3I5G C;  2B1U A;  1KFX S;  1ZAC A;  2GV5 A;  3PN7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...