1ODBA

The crystal structure of human s100a12 - copper complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
91
structure length
91
Chain Sequence
STKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CALGRANULIN C
publication title Structure of the Human S100A12-Copper Complex: Implications for Host-Parasite Defence
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 33
structure length 91
sequence length 91
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2003-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1odbA00
2G9BA 1W7IB 2CCMA 4YGBB 1SKTA 2AUCA 2WORA 1AP4A 1M45A 4PE1A 3VGOA 1A29A 1B8CA 1PULA 1YVLA 2M9GA 1XFVO 1HQVA 2JNXA 2F33A 1K94A 2LHLA 3JVTB 3SG2A 4GUKA 1MXLC 1MWNA 2MHHA 1QX2A 2KNEA 2LVVA 3CS1A 3CZTX 1TIZA 4XJKB 1SL8A 2OPOA 1S1EA 2CBLA 2P6BB 3GK4X 3NSKA 1SBJA 1V1GA 4C0JA 4R1EA 3D10A 2M3WA 1KQMB 4DCKA 1MF8B 1EG4A 1TNWA 1NPQA 3LK1A 1YURA 1WDCC 2CT9A 1MR8A 2KAVA 2K2FA 4CFRA 3WXAA 4NDDA 1F70A 3TDZA 5B8IB 2LMTA 1S5GY 1L2OC 4GGNA 1QV0A 2SASA 2MA2A 2QPTA 1PSRA 1J1DA 1K9KA 5GQQC 2LMVA 4C0LA 1NCZA 1C07A 3F45A 1AHRA 1KWOC 1Y6WA 4DRWA 1NP8A 2JT3A 2FCEA 1B1GA 1M46A 1S6JA 1KFXL 2BKIB 2ZN8A 2JQ6A 1QX5B 1MUXA 2WCEA 1CDMA 1EH2A 1TNQA 1J55A 2GV5A 4M2QA 2BL0B 2M0RA 4HRGA 1YUTA 1CFDA 1J7QA 2L2EA 1XA5A 3DVMA 2JTZA 3OX5A 2L5XB 1QATA 4I5JA 1DJIA 3IQQA 3BOWA 1N0YA 1XK4A 1A03A 4PHKA 1TCOB 1QTXA 1G4YR 3DVKA 4WRIA 2M7NA 2K7OA 3OX6A 1OMVA 3I5GB 4U8DA 5AEQA 4MVFA 3RLZA 2LUXA 1QIVA 4BY5A 2KFFA 4PHMA 3EK7A 1UP5A 1IJ5A 2GGMA 1QV1A 1XFUO 1K96A 4YGCB 2QACA 2OTGB 2Y1MA 4CFQA 3GK1A 1KK7Z 1SR6C 3LL8B 2BCBA 4GPLB 2LP3A 2LVJA 4HSZA 1K9PA 4PE7A 4YRUA 3VRRA 1XVJA 1PVAA 2BCAA 1KK8B 2LLUA 3C1VA 2MLFC 1DJZA 2H61A 2ZFDA 4JPZB 3TS5C 2CXJA 1AK8A 3CTNA 1NX3A 4DIRA 2LLSA 1QLSA 2KOTA 1FW4A 4OCIA 2LV7A 1S6CA 2BECA 1M39A 4ETOA 1JF2A 2NCOA 3BUWB 2PRUA 1XYDA 4HRHA 2OS8B 4MRYA 1J7RA 1CKKA 2PALA 1FI6A 1NX2A 5TNCA 1VRKA 3IQOA 4ORBB 3CR4X 2KAYA 4AQJA 2O60A 1IJ6A 2JWWA 1MXEA 1KFUL 2KAXA 5KTYA 1XFWO 4PHJA 3PN7C 5BPJA 1ALVA 2MJWB 3I5HC 1IKUA 1CDLA 2NLNA 2F2OA 1QS7A 4IL1A 2G2BA 3BQ3A 2RGIA 2WC8A 1C7WA 4GGFA 1NWDA 1B7TY 1A4PA 1B8LA 3CLNA 3TZ1A 2SCPA 1QX7A 3O78A 3SJSA 3OB2B 1JC2A 1OE9B 4YGEB 1DGVA 2JOJA 2I7AA 2WCFA 2KQYA 4MZJA 2CTNA 1TOPA 5CSFA 2JU0A 2KBIA 4PHNA 3I5IB 3SG6A 4WQ2A 2K0JA 4ORAB 1OOJA 1UURA 1J1EA 4I5KA 2BBMA 2K8MB 1JFKA 1OQPA 1XK4C 1AJ5A 1FBVA 1NIWA 1TRFA 2K7CA 2LUCA 5F6TA 1SCVA 1UHKA 2F8PA 5CSIA 1S5GZ 4YI8A 3TUYC 3I5FB 1CLBA 2K7DA 2Q4UA 2NXQA 2WCBA 3RM1A 2KI4B 2R2IA 3A4UB 2M49B 3TDIA 1B4CA 1IRJA 1DF0B 1AUIB 1QVIY 2JXCA 3BUMB 3PM8A 5HKWA 5AERA 3KO0A 2LE9B 1QLKA 3FIAA 3NXAA 5HLOA 5DKQA 3VRQA 1J7PA 2AAOA 5CSJA 4CPVA 4DS7A 2H61C 4NDBA 3VROA 2JRFA 2FCDA 1KFXS 2KSPA 4ZCUA 2LANA 4XJKA 1QXPA 4CLNA 2LM5A 1KQVA 3SG5A 1PVBA 1YVHA 2BKHB 4N1FA 1CMFA 1RFJA 3CR2A 2I2RE 2LAPA 2HF5A 2BE4A 2K7BA 4I5NB 2KGRA 1RJVA 2WOSA 1PK0D 1PSBA 1WDCB 4MSPA 4PE4A 1DGUA 2KFGA 3VRPA 2OTGC 1CDNA 1R2UA 5AXIA 1SNLA 1SYMA 1Y1AA 3O6BA 1CM4A 1ALWA 2EGDA 1IGVA 1BT6A 1SPYA 2WNDA 2JC2A 1L2OB 3NSOA 3SIAA 3CGAA 3KHEA 5CPVA 5I8NA 1QIWA 5KU1A 4GGFC 1CNPA 1RWYA 2KI6C 4YGDB 4USLA 5I2QA 1BMOA 1SW8A 1SCMB 4P2YB 2JNFA 2JT0A 1KWOB 1BR1B 1NCYA 2HPSA 1GGWA 2DOQA 4Q04A 2LCPA 1CM1A 1Y1UA 2JTTA 1TTXA 2MBXA 2Y5IA 1ZUZA 1TN4A 1S26D 3WHUB 1XFYO 2F3YA 1ZACA 3KF9A 4MEWA 4MRXA 1GQMA 5G08A 3VRNA 1LXFC 3TDUA 1OMDA 4AOMA 2LHIA 3PATA 1OZSA 4CIDA 1DJGA 1RECA 5J3XA 4DUQA 4MZLA 4NQGA 1IG5A 2PVBA 1KFUS 2L4HA 3OHMB 4OR9B 4JWQA 1JUOA 4QJ4B 1KSMA 1S3PA 1KSOA 2BCXA 1B7TZ 2LP2A 1XFZO 1IQ5A 1KCYA 1K9UA 1UWOA 5I2OA 1DMOA 1N2DA 1AJ4A 1OSAA 2KYFA 3JVTC 4D1EA 1ZOTB 2D8NA 1OMRA 3WHTB 1F4OA 3HCMA 4OVNF 4GBAA 1MQ1A 3BXKA 1E8AA 3AKBA 1F71A 1WLMA 2ZRSA 2JPTA 3AAJA 2PMYA 2Y4QA 3QRXA 1BJFA 3PSRA 3PFVA 3A8RA 1EXRA 4HREE 1KQMC 1U5IB 2FOTA 2L4IA 4C0KA 3KEVA 3ICBA 4WQ3A 2HETA 1YTZC 2GGZA 4PALA 1SY9A 3WNXB 4OV2A 4MLWA 3LCPC 1LVCD 1UHIA 4YI9A 5DKNA 2EC6B 3FS7A 3SG7A 1BU3A 1S6IA 2EHBA 3O4YA 5JJGA 1K90D 1K93D 1XO5A 2PASA 2ZKMX 1QVIZ 2K61A 1BF5A 2TN4A 1DJYA 2COLB 2B1UA 1YX8A 5HKZA 1CLMA 3DF0B 1NYAA 4N1GA 1TNPA 2F2PA 4MZKA 5I2LA 1C7VA 1WRKA 1JF0A 2JXLA 3PN7B 2H2KA 1Y1XA 5HYDA 3I5HB 1WY9A 2AMIA 4PDZA 2KBMA 1B8RA 3JTDB 3AAKA 1CTRA 1SK6D 3PALA 3O2PA 4M2PA 2Y1NA 1Q80A 3LLEA 1H8BA 2KHNA 3EK8A 2ISDA 1EJ3A 1M63B 1B9AA 1CDPA 1U5IA 3CWGA 1PALA 4OKHA 5JOLA 3ZNIA 4F0ZB 1BR4B 1UHNA 1L7ZA 2LVKA 1UHJA 4TNCA 1NX0A 1S36A 2L0PA 2BL0C 2LVIA 2O5GA 3EK4A 1QASA 4AQIA 2JULA 1NX1A 2HQ8A 4PCWA 4QJ5B 3FWCA 2E30A 4FTGA 1JSAA 1LINA 2F3ZA 2M29A 2HQWA 1LA0A 1RK9A 3FWBA 2L50A 3EVVA 1YRUB 2VRGA 1DVIA 3BOWB 1CFPA 3DF0A 3E3RA 4GFTA 1FI5A 3M0WA 1GGZA 3I5GC 1CFFA 1OZOA 1LKJA 3TUYB 5K89A 5FYXA 5ER4X 1K95A 5HKYA 1F4QA 1MHOA 2ZNEA 1DJXA 1DF0A 2ZN9A 4A4BA 1NSHA 1SCMC 1D1OA 2LC5A 3EKJA 1Y0VH 1CLLA 4GAOA 1N65A 2LNKA 1F54A 2M1UA 3SG4A 1NUBA 2NZ0A 1DJWA 1JBAA 1JFJA 1EG3A 2CNPA 1KK8C 2KFHA 2MLEC 2M7LA 1F55A 1WRZA 1CB1A 2JT8A 1GJYA 1YRTB 2M8UA 2LLTA 2V53A 4JQ0D 5AANA 1ODBA 1RTP1 4M2OA 1DT7B 1SMGA 2L51A 3EKHA 1NCXA 4GNKB 3NSIA 2OS8C 3GK2A 4PE0A 4YBHB 1DTLA 2ZNDA 4UPGA 3OB1B 4N5XA 5DKRA 2I18A 1K8UA 5PALA 5ER5A 2FJUB 1JWDA 1XFXO 4ORCB 1WRLA 3DVEA 3D0YB 3K21A 5D69A 3HX4A 1X02A 1G8IA 1SL9A 1SRAA 1CMGA 2Q91A 3ZWHA 2BBNA 1BOCA 2PSRA 1A2XA 4MBEA 1A75B 1K2HA 3EVUA 3IF7A 1LA3A 3DVJA 3AKAA 4E68A 1IH0A 3OP0A 3SIBA 3BYAA 3GOFA 1BODA 3BUOB 3BUNB 3MSEB 1W7JB 2KQ6A 4A4CA 3DD4A 2ZRTA 2NCPA 4BY4A 3CR5X 1ZMZA 1SL7A 1EL4A 4ICBA 3KPXA 2MRDA 3EVRA 1PRWA 1M31A 1KK7Y 1UHHA 1YUSA 2MAZA 2K2AA 1IWQA 1ZFSA 2BE6A 1SR6B 5CSNA 2KGBC 1CFCA 3SG3A 1QJTA 4I5LB 3NSLA 4YGAA 5IBWA 4L9MA 1FPWA 3PLFB 2EC6C 3I5IC 1UUSA 1YR5A 5HLVA 3TS5B 1F8HA 1FF1A 3D0YA 2E6WA 1AVSA 2M1KB 3BUXB 4P5OE 1RROA 3LK0A 1IQ3A 1BLQA 1BG1A 2KDHA 1A75A 1V1FA 3I5FC 2L98A 2JZIA 2IS9A 4MN0A 1YUUA 1TNXA 2LMUA 5AFPA 1R6PA 4NDCA 2KI4C 1H4BA 2KI6D 2M97A 3H4SE 1B47A 1G33A 1WLZA 3JTDC 4FQOA 1YX7A 4QJ3B 4ZCVA 1TCFA 2I94A 1HT9A 5D7FA 4XYNA 5KSZA 1J7OA 2A4JA 1DJHA 2KYCA
chains in the Genus database with same CATH superfamily
2G9BA 1W7IB 2CCMA 2K60A 1SKTA 2AUCA 2WORA 3FE6A 4YGBB 1AP4A 1M45A 4PE1A 3VGOA 1A29A 1B8CA 4F7FA 1PULA 1YVLA 2M9GA 1XFVO 4PT1A 1HQVA 2JNXA 2F33A 1K94A 2LHLA 3JVTB 3SG2A 4GUKA 1MXLC 1ORGA 1MWNA 2MHHA 1QX2A 2KNEA 2LVVA 3CS1A 3CZTX 1TIZA 3R1OA 1SL8A 2OPOA 4XJKB 1S1EA 2CBLA 2P6BB 1OOGA 3GK4X 3NSKA 1SBJA 1V1GA 4C0JA 3UNWA 4R1EA 3NGVA 3D10A 2M3WA 1KQMB 4DCKA 1MF8B 1EG4A 1TNWA 1NPQA 3LK1A 1DELA 1YURA 1WDCC 2CT9A 1MR8A 2KAVA 2K2FA 4CFRA 4INWA 3BJHA 3WXAA 4NDDA 3D75A 1F70A 3TDZA 5B8IB 2LMTA 1S5GY 1L2OC 4GGNA 1QV0A 2SASA 3BFHA 2MA2A 2QPTA 1PSRA 1J1DA 1K9KA 5GQQC 2LMVA 4C0LA 1NCZA 1C07A 3F45A 1AHRA 1KWOC 1Y6WA 4DRWA 1NP8A 2JT3A 2FCEA 1TWOA 1B1GA 1M46A 1S6JA 1KFXL 2BKIB 2ZN8A 2JQ6A 1QX5B 1MUXA 2WCEA 1CDMA 4OZDA 1EH2A 1TNQA 1J55A 2GV5A 4M2QA 2BL0B 2M0RA 4HRGA 1YUTA 1CFDA 1J7QA 2L2EA 2WCHA 1XA5A 2QDIA 3DVMA 2JTZA 3OX5A 2L5XB 1QATA 4I5JA 1DJIA 3IQQA 3BOWA 1N0YA 1XK4A 1A03A 4PHKA 1TCOB 1QTXA 1G4YR 3DVKA 4WRIA 3NHIA 2M7NA 2K7OA 3OX6A 1OMVA 3I5GB 4U8DA 5AEQA 4MVFA 3RLZA 2LUXA 1QIVA 4BY5A 2KFFA 4PHMA 3EK7A 1UP5A 1IJ5A 2GGMA 1QV1A 1XFUO 3D74A 1K96A 4YGCB 2QACA 2OTGB 2Y1MA 4CFQA 3GK1A 1KK7Z 1SR6C 3LL8B 1T14A 2BCBA 4GPLB 2LP3A 2LVJA 4HSZA 1K9PA 4PE7A 4YRUA 3VRRA 1XVJA 1PVAA 2BCAA 1KK8B 2LLUA 3C1VA 4INXA 5FI6A 3V2LA 2MLFC 1DJZA 2H61A 2ZFDA 4JPZB 3TS5C 2CXJA 1AK8A 3CTNA 1NX3A 4DIRA 3BFAA 3SS3A 2LLSA 1QLSA 2KOTA 1FW4A 4OCIA 3DYEA 3PM2A 2LV7A 3N7HA 1S6CA 2BECA 1M39A 3CABA 4ETOA 1JF2A 2NCOA 3BUWB 2PRUA 2WCKA 1XYDA 4HRHA 2OS8B 4MRYA 1J7RA 3IVTA 1CKKA 1DEKA 2PALA 3D77A 1FI6A 1NX2A 5TNCA 1VRKA 1GM0A 2WC5A 3IQOA 4ORBB 3CR4X 2KAYA 4AQJA 2QEBA 2O60A 1IJ6A 2JWWA 1MXEA 1KFUL 2KAXA 3DZTA 4IJ7A 5KTYA 1XFWO 4PHJA 3PN7C 5BPJA 1ALVA 2MJWB 3I5HC 1IKUA 1CDLA 2NLNA 2F2OA 1QS7A 3BFBA 4IL1A 2G2BA 2WCJA 2RGIA 3BQ3A 2WC8A 1C7WA 4GGFA 1NWDA 1B7TY 1A4PA 1B8LA 2BNXA 3CLNA 3DY9A 3CZ1A 1Z4HA 2SCPA 3TZ1A 1C3YA 1QX7A 3O78A 3SS4A 3S0GA 3SJSA 3OB2B 1JC2A 1OE9B 4YGEB 1DGVA 2JOJA 2I7AA 2WCFA 2KQYA 4MZJA 2CTNA 2KPHA 1TOPA 5CSFA 2JU0A 2KBIA 4PHNA 3I5IB 3SG6A 4WQ2A 2K0JA 4ORAB 1OOJA 1UURA 1J1EA 4I5KA 2BBMA 2K8MB 3L47A 1JFKA 1OQPA 1XK4C 1AJ5A 1FBVA 1NIWA 1TRFA 2K7CA 2LUCA 5F6TA 2PYQA 1SCVA 1UHKA 2F8PA 5CSIA 1S5GZ 4YI8A 3TUYC 3I5FB 3CZ0A 1CLBA 2K7DA 1LS8A 2Q4UA 2NXQA 2WCBA 3RM1A 4KYNA 2H8VA 2KI4B 2R2IA 2JPOA 3A4UB 2M49B 5DICA 3TDIA 1IRJA 1DF0B 1B4CA 1AUIB 5D3OA 1QVIY 2JXCA 3BUMB 3PM8A 5HKWA 3FE9A 5AERA 3KO0A 3EG5B 2LE9B 1QLKA 2GTEA 3FIAA 3NXAA 5DKQA 5HLOA 3VRQA 1J7PA 2AAOA 5CSJA 3CYZA 5I94A 4CPVA 4DS7A 2H61C 4NDBA 3VROA 2JRFA 2FCDA 1KFXS 2KSPA 4ZCUA 2LANA 4XJKA 1QXPA 4CLNA 2LM5A 1KQVA 3SG5A 1PVBA 1YVHA 2BKHB 4N1FA 1CMFA 1RFJA 3CR2A 2I2RE 2LAPA 2HF5A 2BE4A 2K7BA 4I5NB 2KGRA 1RJVA 3S0AA 2WOSA 1PK0D 1OOFA 1PSBA 1WDCB 4MSPA 4PE4A 5HL1A 1DGUA 3B87A 3S0BA 2KFGA 3VRPA 2OTGC 1CDNA 1R2UA 5AXIA 1SNLA 1SYMA 3FE8A 1Y1AA 3O6BA 1CM4A 1ALWA 2EGDA 1IGVA 1BT6A 1SPYA 2WNDA 3R1PA 2JC2A 1L2OB 3NSOA 3SIAA 3CGAA 3KHEA 5CPVA 3L4LA 5I8NA 1QIWA 2FJYA 5KU1A 4GGFC 1CNPA 1RWYA 2KI6C 4YGDB 4USLA 5I2QA 1BMOA 1SW8A 3B6XA 1SCMB 4P2YB 3PJIA 2JNFA 2JT0A 1KWOB 1BR1B 1NCYA 2HPSA 1GGWA 2DOQA 4Q04A 2LCPA 1CM1A 1Y1UA 2JTTA 3QMEA 1TTXA 2MBXA 2Y5IA 1ZUZA 2PQLA 1DC1A 3NHTA 1TN4A 1S26D 3WHUB 1XFYO 2F3YA 1ZACA 3KF9A 4MEWA 4MRXA 1GQMA 5G08A 3VRNA 1LXFC 3TDUA 1OMDA 3K1EA 4AOMA 2LHIA 3PATA 2KLDA 2QEVA 1OZSA 4CIDA 1DJGA 1RECA 5J3XA 4DUQA 4MZLA 4NQGA 1IG5A 2PVBA 1KFUS 2L4HA 3OHMB 4OR9B 4JWQA 1JUOA 4QJ4B 1W9ZA 1KSMA 2P70A 1S3PA 1KSOA 2BCXA 1B7TZ 2LP2A 1XFZO 5FI7A 1IQ5A 1KCYA 1K9UA 1Z2CB 1UWOA 5I2OA 1DMOA 4JKTA 1N2DA 1AJ4A 1OSAA 2ERBA 2KYFA 2L2CA 3JVTC 4D1EA 1ZOTB 2D8NA 1OMRA 3WHTB 1F4OA 1P28A 2WCLA 3HCMA 4OVNF 4GBAA 1MQ1A 3BXKA 1E8AA 3AKBA 1F71A 3S0FA 1WLMA 2ZRSA 2JPTA 3O4XA 3AAJA 3D73A 2PMYA 2Y4QA 3QRXA 1BJFA 3PSRA 1OW4A 3PFVA 3A8RA 1EXRA 4HREE 1KQMC 1U5IB 2FOTA 2L4IA 4C0KA 3KEVA 3ICBA 3OGNA 1QWVA 4WQ3A 2HETA 2YGUA 1YTZC 2GGZA 4PALA 1SY9A 3S0DA 4OV2A 4MLWA 3WNXB 3LCPC 1LVCD 1UHIA 4YI9A 5DKNA 2EC6B 3FS7A 3SG7A 1BU3A 1S6IA 2EHBA 3O4YA 5JJGA 1K90D 1K93D 1XO5A 2PASA 2ZKMX 1QVIZ 2K61A 1BF5A 2TN4A 3D78A 1DJYA 2COLB 2B1UA 1YX8A 5HKZA 1CLMA 3DF0B 1NYAA 4N1GA 1TNPA 2F2PA 4MZKA 5I2LA 1C7VA 1WRKA 1JF0A 2BAPA 2JXLA 3PN7B 3B7AA 2H2KA 1Y1XA 4FQTA 5HYDA 3I5HB 1WY9A 2AMIA 4PDZA 2KBMA 1B8RA 1TUJA 2QEHA 3JTDB 3AAKA 1CTRA 1SK6D 3PALA 3O2PA 4M2PA 2Y1NA 1Q80A 3LLEA 1C3ZA 1H8BA 2KHNA 3EK8A 2ISDA 1EJ3A 1M63B 1B9AA 1CDPA 1U5IA 3CWGA 1PALA 4OKHA 5JOLA 3ZNIA 4F0ZB 1BR4B 1UHNA 1L7ZA 2LVKA 1UHJA 3CZ2A 4TNCA 1NX0A 1S36A 2L0PA 2BL0C 2LVIA 2O5GA 3EK4A 1QASA 4AQIA 2JULA 1NX1A 2HQ8A 4PCWA 1OOIX 4QJ5B 1TUZA 3FWCA 2E30A 2WCMA 4FTGA 1JSAA 1LINA 2F3ZA 2M29A 3R72A 2HQWA 1LA0A 1RK9A 3FWBA 2L50A 3EVVA 1YRUB 2VRGA 1DVIA 3BOWB 1CFPA 3DF0A 3E3RA 4GFTA 4JD9A 1FI5A 3M0WA 1GGZA 3I5GC 1CFFA 1OZOA 1LKJA 3TUYB 5K89A 5FYXA 5ER4X 1K95A 5HKYA 1F4QA 1MHOA 2ZNEA 1DJXA 1DF0A 2ZN9A 2KLEA 4A4BA 1NSHA 1SCMC 1IIOA 1D1OA 2LC5A 3EKJA 1Y0VH 1CLLA 2P71A 4GAOA 1N65A 2LNKA 1F54A 2M1UA 3B86A 3SG4A 1NUBA 2NZ0A 1DJWA 1JBAA 1JFJA 1EG3A 2CNPA 1KK8C 2KFHA 2MLEC 2M7LA 1F55A 1WRZA 1CB1A 2JT8A 1GJYA 1YRTB 2M8UA 2LLTA 2V53A 3UO9A 5EL2A 4JQ0D 3B88A 1DQEA 1ODBA 1RTP1 4M2OA 5AANA 3S0EA 1DT7B 1SMGA 2L51A 1OOHA 3EKHA 1NCXA 4GNKB 3NSIA 2OS8C 3GK2A 4PE0A 4YBHB 1DTLA 2ZNDA 4UPGA 3OB1B 4N5XA 5DKRA 2I18A 1K8UA 5PALA 5ER5A 2FJUB 1JWDA 1XFXO 4ORCB 1WRLA 3DVEA 3D0YB 3K21A 5D69A 3HX4A 3OBVA 1X02A 1G8IA 1SL9A 3D76A 1SRAA 1CMGA 2Q91A 3ZWHA 2BBNA 5FI2A 1BOCA 2PSRA 1A2XA 4MBEA 1A75B 1K2HA 3EVUA 3IF7A 1LA3A 3DVJA 3AKAA 4E68A 1IH0A 3OP0A 3SIBA 3BYAA 3GOFA 1BODA 3VB1A 3BUOB 3BUNB 3MSEB 1W7JB 2KQ6A 4A4CA 3DD4A 2ZRTA 2L5YA 1H4BA 2NCPA 4BY4A 3CR5X 1ZMZA 1SL7A 3L4AA 1EL4A 4ICBA 3KPXA 2MRDA 3EVRA 1PRWA 1M31A 1KK7Y 1UHHA 1YUSA 2MAZA 2K2AA 1IWQA 1ZFSA 2BE6A 1SR6B 5CSNA 2KGBC 1CFCA 3SG3A 3R1VA 1QJTA 4I5LB 3NSLA 4YGAA 5IBWA 4L9MA 1FPWA 1SSEB 3PLFB 2EC6C 3I5IC 1UUSA 1YR5A 5HLVA 3TS5B 1F8HA 1FF1A 3CDNA 3D0YA 2E6WA 1AVSA 2M1KB 3BUXB 4P5OE 2WC6A 1RROA 3DXLA 3LK0A 1IQ3A 3RZSA 1BG1A 1BLQA 2KDHA 1A75A 1V1FA 3I5FC 3Q8IA 2L98A 2JZIA 2IS9A 4MN0A 1YUUA 1TNXA 2LMUA 3SS5A 1R6PA 2QEOA 2KI4C 4NDCA 5AFPA 2KI6D 1XFRA 2M97A 3H4SE 1B47A 1G33A 1WLZA 3JTDC 4FQOA 1YX7A 4QJ3B 4ZCVA 1TCFA 2I94A 1HT9A 5D7FA 4XYNA 5KSZA 1J7OA 2A4JA 1DJHA 2KYCA
chains in the Genus database with same CATH topology
2G9BA 1W7IB 2CCMA 4YGBB 1SKTA 2AUCA 2WORA 1AP4A 1M45A 4PE1A 3VGOA 1A29A 1B8CA 1PULA 1YVLA 2M9GA 1XFVO 1HQVA 2JNXA 2F33A 1K94A 2LHLA 3JVTB 3SG2A 4GUKA 1MXLC 1MWNA 2MHHA 1QX2A 2KNEA 2LVVA 3CS1A 3CZTX 1TIZA 4XJKB 1SL8A 2OPOA 1S1EA 2CBLA 2P6BB 3GK4X 3NSKA 1SBJA 1V1GA 4C0JA 4R1EA 3D10A 2M3WA 1KQMB 4DCKA 1MF8B 1EG4A 1TNWA 1NPQA 3LK1A 1YURA 1WDCC 2CT9A 1MR8A 2KAVA 2K2FA 4CFRA 3WXAA 4NDDA 1F70A 3TDZA 5B8IB 2LMTA 1S5GY 1L2OC 4GGNA 1QV0A 2SASA 2MA2A 2QPTA 1PSRA 1J1DA 1K9KA 5GQQC 2LMVA 4C0LA 1NCZA 1C07A 3F45A 1AHRA 1KWOC 1Y6WA 4DRWA 1NP8A 2JT3A 2FCEA 1B1GA 1M46A 1S6JA 1KFXL 2BKIB 2ZN8A 2JQ6A 1QX5B 1MUXA 2WCEA 1CDMA 1EH2A 1TNQA 1J55A 2GV5A 4M2QA 2BL0B 2M0RA 4HRGA 1YUTA 1CFDA 1J7QA 2L2EA 1XA5A 3DVMA 2JTZA 3OX5A 2L5XB 1QATA 4I5JA 1DJIA 3IQQA 3BOWA 1N0YA 1XK4A 1A03A 4PHKA 1TCOB 1QTXA 1G4YR 3DVKA 4WRIA 2M7NA 2K7OA 3OX6A 1OMVA 3I5GB 4U8DA 5AEQA 4MVFA 3RLZA 2LUXA 1QIVA 4BY5A 2KFFA 4PHMA 3EK7A 1UP5A 1IJ5A 2GGMA 1QV1A 1XFUO 1K96A 4YGCB 2QACA 2OTGB 2Y1MA 4CFQA 3GK1A 1KK7Z 1SR6C 3LL8B 2BCBA 4GPLB 2LP3A 2LVJA 4HSZA 1K9PA 4PE7A 4YRUA 3VRRA 1XVJA 1PVAA 2BCAA 1KK8B 2LLUA 3C1VA 2MLFC 1DJZA 2H61A 2ZFDA 4JPZB 3TS5C 2CXJA 1AK8A 3CTNA 1NX3A 4DIRA 2LLSA 1QLSA 2KOTA 1FW4A 4OCIA 2LV7A 1S6CA 2BECA 1M39A 4ETOA 1JF2A 2NCOA 3BUWB 2PRUA 1XYDA 4HRHA 2OS8B 4MRYA 1J7RA 1CKKA 2PALA 1FI6A 1NX2A 5TNCA 1VRKA 3IQOA 4ORBB 3CR4X 2KAYA 4AQJA 2O60A 1IJ6A 2JWWA 1MXEA 1KFUL 2KAXA 5KTYA 1XFWO 4PHJA 3PN7C 5BPJA 1ALVA 2MJWB 3I5HC 1IKUA 1CDLA 2NLNA 2F2OA 1QS7A 4IL1A 2G2BA 3BQ3A 2RGIA 2WC8A 1C7WA 4GGFA 1NWDA 1B7TY 1A4PA 1B8LA 3CLNA 3TZ1A 2SCPA 1QX7A 3O78A 3SJSA 3OB2B 1JC2A 1OE9B 4YGEB 1DGVA 2JOJA 2I7AA 2WCFA 2KQYA 4MZJA 2CTNA 1TOPA 5CSFA 2JU0A 2KBIA 4PHNA 3I5IB 3SG6A 4WQ2A 2K0JA 4ORAB 1OOJA 1UURA 1J1EA 4I5KA 2BBMA 2K8MB 1JFKA 1OQPA 1XK4C 1AJ5A 1FBVA 1NIWA 1TRFA 2K7CA 2LUCA 5F6TA 1SCVA 1UHKA 2F8PA 5CSIA 1S5GZ 4YI8A 3TUYC 3I5FB 1CLBA 2K7DA 2Q4UA 2NXQA 2WCBA 3RM1A 2KI4B 2R2IA 3A4UB 2M49B 3TDIA 1B4CA 1IRJA 1DF0B 1AUIB 1QVIY 2JXCA 3BUMB 3PM8A 5HKWA 5AERA 3KO0A 2LE9B 1QLKA 3FIAA 3NXAA 5HLOA 5DKQA 3VRQA 1J7PA 2AAOA 5CSJA 4CPVA 4DS7A 2H61C 4NDBA 3VROA 2JRFA 2FCDA 1KFXS 2KSPA 4ZCUA 2LANA 4XJKA 1QXPA 4CLNA 2LM5A 1KQVA 3SG5A 1PVBA 1YVHA 2BKHB 4N1FA 1CMFA 1RFJA 3CR2A 2I2RE 2LAPA 2HF5A 2BE4A 2K7BA 4I5NB 2KGRA 1RJVA 2WOSA 1PK0D 1PSBA 1WDCB 4MSPA 4PE4A 1DGUA 2KFGA 3VRPA 2OTGC 1CDNA 1R2UA 5AXIA 1SNLA 1SYMA 1Y1AA 3O6BA 1CM4A 1ALWA 2EGDA 1IGVA 1BT6A 1SPYA 2WNDA 2JC2A 1L2OB 3NSOA 3SIAA 3CGAA 3KHEA 5CPVA 5I8NA 1QIWA 5KU1A 4GGFC 1CNPA 1RWYA 2KI6C 4YGDB 4USLA 5I2QA 1BMOA 1SW8A 1SCMB 4P2YB 2JNFA 2JT0A 1KWOB 1BR1B 1NCYA 2HPSA 1GGWA 2DOQA 4Q04A 2LCPA 1CM1A 1Y1UA 2JTTA 1TTXA 2MBXA 2Y5IA 1ZUZA 1TN4A 1S26D 3WHUB 1XFYO 2F3YA 1ZACA 3KF9A 4MEWA 4MRXA 1GQMA 5G08A 3VRNA 1LXFC 3TDUA 1OMDA 4AOMA 2LHIA 3PATA 1OZSA 4CIDA 1DJGA 1RECA 5J3XA 4DUQA 4MZLA 4NQGA 1IG5A 2PVBA 1KFUS 2L4HA 3OHMB 4OR9B 4JWQA 1JUOA 4QJ4B 1KSMA 1S3PA 1KSOA 2BCXA 1B7TZ 2LP2A 1XFZO 1IQ5A 1KCYA 1K9UA 1UWOA 5I2OA 1DMOA 1N2DA 1AJ4A 1OSAA 2KYFA 3JVTC 4D1EA 1ZOTB 2D8NA 1OMRA 3WHTB 1F4OA 3HCMA 4OVNF 4GBAA 1MQ1A 3BXKA 1E8AA 3AKBA 1F71A 1WLMA 2ZRSA 2JPTA 3AAJA 2PMYA 2Y4QA 3QRXA 1BJFA 3PSRA 3PFVA 3A8RA 1EXRA 4HREE 1KQMC 1U5IB 2FOTA 2L4IA 4C0KA 3KEVA 3ICBA 4WQ3A 2HETA 1YTZC 2GGZA 4PALA 1SY9A 3WNXB 4OV2A 4MLWA 3LCPC 1LVCD 1UHIA 4YI9A 5DKNA 2EC6B 3FS7A 3SG7A 1BU3A 1S6IA 2EHBA 3O4YA 5JJGA 1K90D 1K93D 1XO5A 2PASA 2ZKMX 1QVIZ 2K61A 1BF5A 2TN4A 1DJYA 2COLB 2B1UA 1YX8A 5HKZA 1CLMA 3DF0B 1NYAA 4N1GA 1TNPA 2F2PA 4MZKA 5I2LA 1C7VA 1WRKA 1JF0A 2JXLA 3PN7B 2H2KA 1Y1XA 5HYDA 3I5HB 1WY9A 2AMIA 4PDZA 2KBMA 1B8RA 3JTDB 3AAKA 1CTRA 1SK6D 3PALA 3O2PA 4M2PA 2Y1NA 1Q80A 3LLEA 1H8BA 2KHNA 3EK8A 2ISDA 1EJ3A 1M63B 1B9AA 1CDPA 1U5IA 3CWGA 1PALA 4OKHA 5JOLA 3ZNIA 4F0ZB 1BR4B 1UHNA 1L7ZA 2LVKA 1UHJA 4TNCA 1NX0A 1S36A 2L0PA 2BL0C 2LVIA 2O5GA 3EK4A 1QASA 4AQIA 2JULA 1NX1A 2HQ8A 4PCWA 4QJ5B 3FWCA 2E30A 4FTGA 1JSAA 1LINA 2F3ZA 2M29A 2HQWA 1LA0A 1RK9A 3FWBA 2L50A 3EVVA 1YRUB 2VRGA 1DVIA 3BOWB 1CFPA 3DF0A 3E3RA 4GFTA 1FI5A 3M0WA 1GGZA 3I5GC 1CFFA 1OZOA 1LKJA 3TUYB 5K89A 5FYXA 5ER4X 1K95A 5HKYA 1F4QA 1MHOA 2ZNEA 1DJXA 1DF0A 2ZN9A 4A4BA 1NSHA 1SCMC 1D1OA 2LC5A 3EKJA 1Y0VH 1CLLA 4GAOA 1N65A 2LNKA 1F54A 2M1UA 3SG4A 1NUBA 2NZ0A 1DJWA 1JBAA 1JFJA 1EG3A 2CNPA 1KK8C 2KFHA 2MLEC 2M7LA 1F55A 1WRZA 1CB1A 2JT8A 1GJYA 1YRTB 2M8UA 2LLTA 2V53A 4JQ0D 5AANA 1ODBA 1RTP1 4M2OA 1DT7B 1SMGA 2L51A 3EKHA 1NCXA 4GNKB 3NSIA 2OS8C 3GK2A 4PE0A 4YBHB 1DTLA 2ZNDA 4UPGA 3OB1B 4N5XA 5DKRA 2I18A 1K8UA 5PALA 5ER5A 2FJUB 1JWDA 1XFXO 4ORCB 1WRLA 3DVEA 3D0YB 3K21A 5D69A 3HX4A 1X02A 1G8IA 1SL9A 1SRAA 1CMGA 2Q91A 3ZWHA 2BBNA 1BOCA 2PSRA 1A2XA 4MBEA 1A75B 1K2HA 3EVUA 3IF7A 1LA3A 3DVJA 3AKAA 4E68A 1IH0A 3OP0A 3SIBA 3BYAA 3GOFA 1BODA 3BUOB 3BUNB 3MSEB 1W7JB 2KQ6A 4A4CA 3DD4A 2ZRTA 2NCPA 4BY4A 3CR5X 1ZMZA 1SL7A 1EL4A 4ICBA 3KPXA 2MRDA 3EVRA 1PRWA 1M31A 1KK7Y 1UHHA 1YUSA 2MAZA 2K2AA 1IWQA 1ZFSA 2BE6A 1SR6B 5CSNA 2KGBC 1CFCA 3SG3A 1QJTA 4I5LB 3NSLA 4YGAA 5IBWA 4L9MA 1FPWA 3PLFB 2EC6C 3I5IC 1UUSA 1YR5A 5HLVA 3TS5B 1F8HA 1FF1A 3D0YA 2E6WA 1AVSA 2M1KB 3BUXB 4P5OE 1RROA 3LK0A 1IQ3A 1BLQA 1BG1A 2KDHA 1A75A 1V1FA 3I5FC 2L98A 2JZIA 2IS9A 4MN0A 1YUUA 1TNXA 2LMUA 5AFPA 1R6PA 4NDCA 2KI4C 1H4BA 2KI6D 2M97A 3H4SE 1B47A 1G33A 1WLZA 3JTDC 4FQOA 1YX7A 4QJ3B 4ZCVA 1TCFA 2I94A 1HT9A 5D7FA 4XYNA 5KSZA 1J7OA 2A4JA 1DJHA 2KYCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G9B A;  1W7I B;  2CCM A;  4YGB B;  1SKT A;  2AUC A;  2WOR A;  1AP4 A;  1M45 A;  4PE1 A;  3VGO A;  1A29 A;  1B8C A;  1PUL A;  1YVL A;  2M9G A;  1XFV O;  1HQV A;  2JNX A;  2F33 A;  1K94 A;  2LHL A;  3JVT B;  3SG2 A;  4GUK A;  1MXL C;  1MWN A;  2MHH A;  1QX2 A;  2KNE A;  2LVV A;  3CS1 A;  3CZT X;  1TIZ A;  4XJK B;  1SL8 A;  2OPO A;  1S1E A;  2CBL A;  2P6B B;  3GK4 X;  3NSK A;  1SBJ A;  1V1G A;  4C0J A;  4R1E A;  3D10 A;  2M3W A;  1KQM B;  4DCK A;  1MF8 B;  1EG4 A;  1TNW A;  1NPQ A;  3LK1 A;  1YUR A;  1WDC C;  2CT9 A;  1MR8 A;  2KAV A;  2K2F A;  4CFR A;  3WXA A;  4NDD A;  1F70 A;  3TDZ A;  5B8I B;  2LMT A;  1S5G Y;  1L2O C;  4GGN A;  1QV0 A;  2SAS A;  2MA2 A;  2QPT A;  1PSR A;  1J1D A;  1K9K A;  5GQQ C;  2LMV A;  4C0L A;  1NCZ A;  1C07 A;  3F45 A;  1AHR A;  1KWO C;  1Y6W A;  4DRW A;  1NP8 A;  2JT3 A;  2FCE A;  1B1G A;  1M46 A;  1S6J A;  1KFX L;  2BKI B;  2ZN8 A;  2JQ6 A;  1QX5 B;  1MUX A;  2WCE A;  1CDM A;  1EH2 A;  1TNQ A;  1J55 A;  2GV5 A;  4M2Q A;  2BL0 B;  2M0R A;  4HRG A;  1YUT A;  1CFD A;  1J7Q A;  2L2E A;  1XA5 A;  3DVM A;  2JTZ A;  3OX5 A;  2L5X B;  1QAT A;  4I5J A;  1DJI A;  3IQQ A;  3BOW A;  1N0Y A;  1XK4 A;  1A03 A;  4PHK A;  1TCO B;  1QTX A;  1G4Y R;  3DVK A;  4WRI A;  2M7N A;  2K7O A;  3OX6 A;  1OMV A;  3I5G B;  4U8D A;  5AEQ A;  4MVF A;  3RLZ A;  2LUX A;  1QIV A;  4BY5 A;  2KFF A;  4PHM A;  3EK7 A;  1UP5 A;  1IJ5 A;  2GGM A;  1QV1 A;  1XFU O;  1K96 A;  4YGC B;  2QAC A;  2OTG B;  2Y1M A;  4CFQ A;  3GK1 A;  1KK7 Z;  1SR6 C;  3LL8 B;  2BCB A;  4GPL B;  2LP3 A;  2LVJ A;  4HSZ A;  1K9P A;  4PE7 A;  4YRU A;  3VRR A;  1XVJ A;  1PVA A;  2BCA A;  1KK8 B;  2LLU A;  3C1V A;  2MLF C;  1DJZ A;  2H61 A;  2ZFD A;  4JPZ B;  3TS5 C;  2CXJ A;  1AK8 A;  3CTN A;  1NX3 A;  4DIR A;  2LLS A;  1QLS A;  2KOT A;  1FW4 A;  4OCI A;  2LV7 A;  1S6C A;  2BEC A;  1M39 A;  4ETO A;  1JF2 A;  2NCO A;  3BUW B;  2PRU A;  1XYD A;  4HRH A;  2OS8 B;  4MRY A;  1J7R A;  1CKK A;  2PAL A;  1FI6 A;  1NX2 A;  5TNC A;  1VRK A;  3IQO A;  4ORB B;  3CR4 X;  2KAY A;  4AQJ A;  2O60 A;  1IJ6 A;  2JWW A;  1MXE A;  1KFU L;  2KAX A;  5KTY A;  1XFW O;  4PHJ A;  3PN7 C;  5BPJ A;  1ALV A;  2MJW B;  3I5H C;  1IKU A;  1CDL A;  2NLN A;  2F2O A;  1QS7 A;  4IL1 A;  2G2B A;  3BQ3 A;  2RGI A;  2WC8 A;  1C7W A;  4GGF A;  1NWD A;  1B7T Y;  1A4P A;  1B8L A;  3CLN A;  3TZ1 A;  2SCP A;  1QX7 A;  3O78 A;  3SJS A;  3OB2 B;  1JC2 A;  1OE9 B;  4YGE B;  1DGV A;  2JOJ A;  2I7A A;  2WCF A;  2KQY A;  4MZJ A;  2CTN A;  1TOP A;  5CSF A;  2JU0 A;  2KBI A;  4PHN A;  3I5I B;  3SG6 A;  4WQ2 A;  2K0J A;  4ORA B;  1OOJ A;  1UUR A;  1J1E A;  4I5K A;  2BBM A;  2K8M B;  1JFK A;  1OQP A;  1XK4 C;  1AJ5 A;  1FBV A;  1NIW A;  1TRF A;  2K7C A;  2LUC A;  5F6T A;  1SCV A;  1UHK A;  2F8P A;  5CSI A;  1S5G Z;  4YI8 A;  3TUY C;  3I5F B;  1CLB A;  2K7D A;  2Q4U A;  2NXQ A;  2WCB A;  3RM1 A;  2KI4 B;  2R2I A;  3A4U B;  2M49 B;  3TDI A;  1B4C A;  1IRJ A;  1DF0 B;  1AUI B;  1QVI Y;  2JXC A;  3BUM B;  3PM8 A;  5HKW A;  5AER A;  3KO0 A;  2LE9 B;  1QLK A;  3FIA A;  3NXA A;  5HLO A;  5DKQ A;  3VRQ A;  1J7P A;  2AAO A;  5CSJ A;  4CPV A;  4DS7 A;  2H61 C;  4NDB A;  3VRO A;  2JRF A;  2FCD A;  1KFX S;  2KSP A;  4ZCU A;  2LAN A;  4XJK A;  1QXP A;  4CLN A;  2LM5 A;  1KQV A;  3SG5 A;  1PVB A;  1YVH A;  2BKH B;  4N1F A;  1CMF A;  1RFJ A;  3CR2 A;  2I2R E;  2LAP A;  2HF5 A;  2BE4 A;  2K7B A;  4I5N B;  2KGR A;  1RJV A;  2WOS A;  1PK0 D;  1PSB A;  1WDC B;  4MSP A;  4PE4 A;  1DGU A;  2KFG A;  3VRP A;  2OTG C;  1CDN A;  1R2U A;  5AXI A;  1SNL A;  1SYM A;  1Y1A A;  3O6B A;  1CM4 A;  1ALW A;  2EGD A;  1IGV A;  1BT6 A;  1SPY A;  2WND A;  2JC2 A;  1L2O B;  3NSO A;  3SIA A;  3CGA A;  3KHE A;  5CPV A;  5I8N A;  1QIW A;  5KU1 A;  4GGF C;  1CNP A;  1RWY A;  2KI6 C;  4YGD B;  4USL A;  5I2Q A;  1BMO A;  1SW8 A;  1SCM B;  4P2Y B;  2JNF A;  2JT0 A;  1KWO B;  1BR1 B;  1NCY A;  2HPS A;  1GGW A;  2DOQ A;  4Q04 A;  2LCP A;  1CM1 A;  1Y1U A;  2JTT A;  1TTX A;  2MBX A;  2Y5I A;  1ZUZ A;  1TN4 A;  1S26 D;  3WHU B;  1XFY O;  2F3Y A;  1ZAC A;  3KF9 A;  4MEW A;  4MRX A;  1GQM A;  5G08 A;  3VRN A;  1LXF C;  3TDU A;  1OMD A;  4AOM A;  2LHI A;  3PAT A;  1OZS A;  4CID A;  1DJG A;  1REC A;  5J3X A;  4DUQ A;  4MZL A;  4NQG A;  1IG5 A;  2PVB A;  1KFU S;  2L4H A;  3OHM B;  4OR9 B;  4JWQ A;  1JUO A;  4QJ4 B;  1KSM A;  1S3P A;  1KSO A;  2BCX A;  1B7T Z;  2LP2 A;  1XFZ O;  1IQ5 A;  1KCY A;  1K9U A;  1UWO A;  5I2O A;  1DMO A;  1N2D A;  1AJ4 A;  1OSA A;  2KYF A;  3JVT C;  4D1E A;  1ZOT B;  2D8N A;  1OMR A;  3WHT B;  1F4O A;  3HCM A;  4OVN F;  4GBA A;  1MQ1 A;  3BXK A;  1E8A A;  3AKB A;  1F71 A;  1WLM A;  2ZRS A;  2JPT A;  3AAJ A;  2PMY A;  2Y4Q A;  3QRX A;  1BJF A;  3PSR A;  3PFV A;  3A8R A;  1EXR A;  4HRE E;  1KQM C;  1U5I B;  2FOT A;  2L4I A;  4C0K A;  3KEV A;  3ICB A;  4WQ3 A;  2HET A;  1YTZ C;  2GGZ A;  4PAL A;  1SY9 A;  3WNX B;  4OV2 A;  4MLW A;  3LCP C;  1LVC D;  1UHI A;  4YI9 A;  5DKN A;  2EC6 B;  3FS7 A;  3SG7 A;  1BU3 A;  1S6I A;  2EHB A;  3O4Y A;  5JJG A;  1K90 D;  1K93 D;  1XO5 A;  2PAS A;  2ZKM X;  1QVI Z;  2K61 A;  1BF5 A;  2TN4 A;  1DJY A;  2COL B;  2B1U A;  1YX8 A;  5HKZ A;  1CLM A;  3DF0 B;  1NYA A;  4N1G A;  1TNP A;  2F2P A;  4MZK A;  5I2L A;  1C7V A;  1WRK A;  1JF0 A;  2JXL A;  3PN7 B;  2H2K A;  1Y1X A;  5HYD A;  3I5H B;  1WY9 A;  2AMI A;  4PDZ A;  2KBM A;  1B8R A;  3JTD B;  3AAK A;  1CTR A;  1SK6 D;  3PAL A;  3O2P A;  4M2P A;  2Y1N A;  1Q80 A;  3LLE A;  1H8B A;  2KHN A;  3EK8 A;  2ISD A;  1EJ3 A;  1M63 B;  1B9A A;  1CDP A;  1U5I A;  3CWG A;  1PAL A;  4OKH A;  5JOL A;  3ZNI A;  4F0Z B;  1BR4 B;  1UHN A;  1L7Z A;  2LVK A;  1UHJ A;  4TNC A;  1NX0 A;  1S36 A;  2L0P A;  2BL0 C;  2LVI A;  2O5G A;  3EK4 A;  1QAS A;  4AQI A;  2JUL A;  1NX1 A;  2HQ8 A;  4PCW A;  4QJ5 B;  3FWC A;  2E30 A;  4FTG A;  1JSA A;  1LIN A;  2F3Z A;  2M29 A;  2HQW A;  1LA0 A;  1RK9 A;  3FWB A;  2L50 A;  3EVV A;  1YRU B;  2VRG A;  1DVI A;  3BOW B;  1CFP A;  3DF0 A;  3E3R A;  4GFT A;  1FI5 A;  3M0W A;  1GGZ A;  3I5G C;  1CFF A;  1OZO A;  1LKJ A;  3TUY B;  5K89 A;  5FYX A;  5ER4 X;  1K95 A;  5HKY A;  1F4Q A;  1MHO A;  2ZNE A;  1DJX A;  1DF0 A;  2ZN9 A;  4A4B A;  1NSH A;  1SCM C;  1D1O A;  2LC5 A;  3EKJ A;  1Y0V H;  1CLL A;  4GAO A;  1N65 A;  2LNK A;  1F54 A;  2M1U A;  3SG4 A;  1NUB A;  2NZ0 A;  1DJW A;  1JBA A;  1JFJ A;  1EG3 A;  2CNP A;  1KK8 C;  2KFH A;  2MLE C;  2M7L A;  1F55 A;  1WRZ A;  1CB1 A;  2JT8 A;  1GJY A;  1YRT B;  2M8U A;  2LLT A;  2V53 A;  4JQ0 D;  5AAN A;  1ODB A;  1RTP 1;  4M2O A;  1DT7 B;  1SMG A;  2L51 A;  3EKH A;  1NCX A;  4GNK B;  3NSI A;  2OS8 C;  3GK2 A;  4PE0 A;  4YBH B;  1DTL A;  2ZND A;  4UPG A;  3OB1 B;  4N5X A;  5DKR A;  2I18 A;  1K8U A;  5PAL A;  5ER5 A;  2FJU B;  1JWD A;  1XFX O;  4ORC B;  1WRL A;  3DVE A;  3D0Y B;  3K21 A;  5D69 A;  3HX4 A;  1X02 A;  1G8I A;  1SL9 A;  1SRA A;  1CMG A;  2Q91 A;  3ZWH A;  2BBN A;  1BOC A;  2PSR A;  1A2X A;  4MBE A;  1A75 B;  1K2H A;  3EVU A;  3IF7 A;  1LA3 A;  3DVJ A;  3AKA A;  4E68 A;  1IH0 A;  3OP0 A;  3SIB A;  3BYA A;  3GOF A;  1BOD A;  3BUO B;  3BUN B;  3MSE B;  1W7J B;  2KQ6 A;  4A4C A;  3DD4 A;  2ZRT A;  2NCP A;  4BY4 A;  3CR5 X;  1ZMZ A;  1SL7 A;  1EL4 A;  4ICB A;  3KPX A;  2MRD A;  3EVR A;  1PRW A;  1M31 A;  1KK7 Y;  1UHH A;  1YUS A;  2MAZ A;  2K2A A;  1IWQ A;  1ZFS A;  2BE6 A;  1SR6 B;  5CSN A;  2KGB C;  1CFC A;  3SG3 A;  1QJT A;  4I5L B;  3NSL A;  4YGA A;  5IBW A;  4L9M A;  1FPW A;  3PLF B;  2EC6 C;  3I5I C;  1UUS A;  1YR5 A;  5HLV A;  3TS5 B;  1F8H A;  1FF1 A;  3D0Y A;  2E6W A;  1AVS A;  2M1K B;  3BUX B;  4P5O E;  1RRO A;  3LK0 A;  1IQ3 A;  1BLQ A;  1BG1 A;  2KDH A;  1A75 A;  1V1F A;  3I5F C;  2L98 A;  2JZI A;  2IS9 A;  4MN0 A;  1YUU A;  1TNX A;  2LMU A;  5AFP A;  1R6P A;  4NDC A;  2KI4 C;  1H4B A;  2KI6 D;  2M97 A;  3H4S E;  1B47 A;  1G33 A;  1WLZ A;  3JTD C;  4FQO A;  1YX7 A;  4QJ3 B;  4ZCV A;  1TCF A;  2I94 A;  1HT9 A;  5D7F A;  4XYN A;  5KSZ A;  1J7O A;  2A4J A;  1DJH A;  2KYC A; 
#chains in the Genus database with same CATH topology
 2G9B A;  1W7I B;  2CCM A;  2K60 A;  1SKT A;  2AUC A;  2WOR A;  3FE6 A;  4YGB B;  1AP4 A;  1M45 A;  4PE1 A;  3VGO A;  1A29 A;  1B8C A;  4F7F A;  1PUL A;  1YVL A;  2M9G A;  1XFV O;  4PT1 A;  1HQV A;  2JNX A;  2F33 A;  1K94 A;  2LHL A;  3JVT B;  3SG2 A;  4GUK A;  1MXL C;  1ORG A;  1MWN A;  2MHH A;  1QX2 A;  2KNE A;  2LVV A;  3CS1 A;  3CZT X;  1TIZ A;  3R1O A;  1SL8 A;  2OPO A;  4XJK B;  1S1E A;  2CBL A;  2P6B B;  1OOG A;  3GK4 X;  3NSK A;  1SBJ A;  1V1G A;  4C0J A;  3UNW A;  4R1E A;  3NGV A;  3D10 A;  2M3W A;  1KQM B;  4DCK A;  1MF8 B;  1EG4 A;  1TNW A;  1NPQ A;  3LK1 A;  1DEL A;  1YUR A;  1WDC C;  2CT9 A;  1MR8 A;  2KAV A;  2K2F A;  4CFR A;  4INW A;  3BJH A;  3WXA A;  4NDD A;  3D75 A;  1F70 A;  3TDZ A;  5B8I B;  2LMT A;  1S5G Y;  1L2O C;  4GGN A;  1QV0 A;  2SAS A;  3BFH A;  2MA2 A;  2QPT A;  1PSR A;  1J1D A;  1K9K A;  5GQQ C;  2LMV A;  4C0L A;  1NCZ A;  1C07 A;  3F45 A;  1AHR A;  1KWO C;  1Y6W A;  4DRW A;  1NP8 A;  2JT3 A;  2FCE A;  1TWO A;  1B1G A;  1M46 A;  1S6J A;  1KFX L;  2BKI B;  2ZN8 A;  2JQ6 A;  1QX5 B;  1MUX A;  2WCE A;  1CDM A;  4OZD A;  1EH2 A;  1TNQ A;  1J55 A;  2GV5 A;  4M2Q A;  2BL0 B;  2M0R A;  4HRG A;  1YUT A;  1CFD A;  1J7Q A;  2L2E A;  2WCH A;  1XA5 A;  2QDI A;  3DVM A;  2JTZ A;  3OX5 A;  2L5X B;  1QAT A;  4I5J A;  1DJI A;  3IQQ A;  3BOW A;  1N0Y A;  1XK4 A;  1A03 A;  4PHK A;  1TCO B;  1QTX A;  1G4Y R;  3DVK A;  4WRI A;  3NHI A;  2M7N A;  2K7O A;  3OX6 A;  1OMV A;  3I5G B;  4U8D A;  5AEQ A;  4MVF A;  3RLZ A;  2LUX A;  1QIV A;  4BY5 A;  2KFF A;  4PHM A;  3EK7 A;  1UP5 A;  1IJ5 A;  2GGM A;  1QV1 A;  1XFU O;  3D74 A;  1K96 A;  4YGC B;  2QAC A;  2OTG B;  2Y1M A;  4CFQ A;  3GK1 A;  1KK7 Z;  1SR6 C;  3LL8 B;  1T14 A;  2BCB A;  4GPL B;  2LP3 A;  2LVJ A;  4HSZ A;  1K9P A;  4PE7 A;  4YRU A;  3VRR A;  1XVJ A;  1PVA A;  2BCA A;  1KK8 B;  2LLU A;  3C1V A;  4INX A;  5FI6 A;  3V2L A;  2MLF C;  1DJZ A;  2H61 A;  2ZFD A;  4JPZ B;  3TS5 C;  2CXJ A;  1AK8 A;  3CTN A;  1NX3 A;  4DIR A;  3BFA A;  3SS3 A;  2LLS A;  1QLS A;  2KOT A;  1FW4 A;  4OCI A;  3DYE A;  3PM2 A;  2LV7 A;  3N7H A;  1S6C A;  2BEC A;  1M39 A;  3CAB A;  4ETO A;  1JF2 A;  2NCO A;  3BUW B;  2PRU A;  2WCK A;  1XYD A;  4HRH A;  2OS8 B;  4MRY A;  1J7R A;  3IVT A;  1CKK A;  1DEK A;  2PAL A;  3D77 A;  1FI6 A;  1NX2 A;  5TNC A;  1VRK A;  1GM0 A;  2WC5 A;  3IQO A;  4ORB B;  3CR4 X;  2KAY A;  4AQJ A;  2QEB A;  2O60 A;  1IJ6 A;  2JWW A;  1MXE A;  1KFU L;  2KAX A;  3DZT A;  4IJ7 A;  5KTY A;  1XFW O;  4PHJ A;  3PN7 C;  5BPJ A;  1ALV A;  2MJW B;  3I5H C;  1IKU A;  1CDL A;  2NLN A;  2F2O A;  1QS7 A;  3BFB A;  4IL1 A;  2G2B A;  2WCJ A;  2RGI A;  3BQ3 A;  2WC8 A;  1C7W A;  4GGF A;  1NWD A;  1B7T Y;  1A4P A;  1B8L A;  2BNX A;  3CLN A;  3DY9 A;  3CZ1 A;  1Z4H A;  2SCP A;  3TZ1 A;  1C3Y A;  1QX7 A;  3O78 A;  3SS4 A;  3S0G A;  3SJS A;  3OB2 B;  1JC2 A;  1OE9 B;  4YGE B;  1DGV A;  2JOJ A;  2I7A A;  2WCF A;  2KQY A;  4MZJ A;  2CTN A;  2KPH A;  1TOP A;  5CSF A;  2JU0 A;  2KBI A;  4PHN A;  3I5I B;  3SG6 A;  4WQ2 A;  2K0J A;  4ORA B;  1OOJ A;  1UUR A;  1J1E A;  4I5K A;  2BBM A;  2K8M B;  3L47 A;  1JFK A;  1OQP A;  1XK4 C;  1AJ5 A;  1FBV A;  1NIW A;  1TRF A;  2K7C A;  2LUC A;  5F6T A;  2PYQ A;  1SCV A;  1UHK A;  2F8P A;  5CSI A;  1S5G Z;  4YI8 A;  3TUY C;  3I5F B;  3CZ0 A;  1CLB A;  2K7D A;  1LS8 A;  2Q4U A;  2NXQ A;  2WCB A;  3RM1 A;  4KYN A;  2H8V A;  2KI4 B;  2R2I A;  2JPO A;  3A4U B;  2M49 B;  5DIC A;  3TDI A;  1IRJ A;  1DF0 B;  1B4C A;  1AUI B;  5D3O A;  1QVI Y;  2JXC A;  3BUM B;  3PM8 A;  5HKW A;  3FE9 A;  5AER A;  3KO0 A;  3EG5 B;  2LE9 B;  1QLK A;  2GTE A;  3FIA A;  3NXA A;  5DKQ A;  5HLO A;  3VRQ A;  1J7P A;  2AAO A;  5CSJ A;  3CYZ A;  5I94 A;  4CPV A;  4DS7 A;  2H61 C;  4NDB A;  3VRO A;  2JRF A;  2FCD A;  1KFX S;  2KSP A;  4ZCU A;  2LAN A;  4XJK A;  1QXP A;  4CLN A;  2LM5 A;  1KQV A;  3SG5 A;  1PVB A;  1YVH A;  2BKH B;  4N1F A;  1CMF A;  1RFJ A;  3CR2 A;  2I2R E;  2LAP A;  2HF5 A;  2BE4 A;  2K7B A;  4I5N B;  2KGR A;  1RJV A;  3S0A A;  2WOS A;  1PK0 D;  1OOF A;  1PSB A;  1WDC B;  4MSP A;  4PE4 A;  5HL1 A;  1DGU A;  3B87 A;  3S0B A;  2KFG A;  3VRP A;  2OTG C;  1CDN A;  1R2U A;  5AXI A;  1SNL A;  1SYM A;  3FE8 A;  1Y1A A;  3O6B A;  1CM4 A;  1ALW A;  2EGD A;  1IGV A;  1BT6 A;  1SPY A;  2WND A;  3R1P A;  2JC2 A;  1L2O B;  3NSO A;  3SIA A;  3CGA A;  3KHE A;  5CPV A;  3L4L A;  5I8N A;  1QIW A;  2FJY A;  5KU1 A;  4GGF C;  1CNP A;  1RWY A;  2KI6 C;  4YGD B;  4USL A;  5I2Q A;  1BMO A;  1SW8 A;  3B6X A;  1SCM B;  4P2Y B;  3PJI A;  2JNF A;  2JT0 A;  1KWO B;  1BR1 B;  1NCY A;  2HPS A;  1GGW A;  2DOQ A;  4Q04 A;  2LCP A;  1CM1 A;  1Y1U A;  2JTT A;  3QME A;  1TTX A;  2MBX A;  2Y5I A;  1ZUZ A;  2PQL A;  1DC1 A;  3NHT A;  1TN4 A;  1S26 D;  3WHU B;  1XFY O;  2F3Y A;  1ZAC A;  3KF9 A;  4MEW A;  4MRX A;  1GQM A;  5G08 A;  3VRN A;  1LXF C;  3TDU A;  1OMD A;  3K1E A;  4AOM A;  2LHI A;  3PAT A;  2KLD A;  2QEV A;  1OZS A;  4CID A;  1DJG A;  1REC A;  5J3X A;  4DUQ A;  4MZL A;  4NQG A;  1IG5 A;  2PVB A;  1KFU S;  2L4H A;  3OHM B;  4OR9 B;  4JWQ A;  1JUO A;  4QJ4 B;  1W9Z A;  1KSM A;  2P70 A;  1S3P A;  1KSO A;  2BCX A;  1B7T Z;  2LP2 A;  1XFZ O;  5FI7 A;  1IQ5 A;  1KCY A;  1K9U A;  1Z2C B;  1UWO A;  5I2O A;  1DMO A;  4JKT A;  1N2D A;  1AJ4 A;  1OSA A;  2ERB A;  2KYF A;  2L2C A;  3JVT C;  4D1E A;  1ZOT B;  2D8N A;  1OMR A;  3WHT B;  1F4O A;  1P28 A;  2WCL A;  3HCM A;  4OVN F;  4GBA A;  1MQ1 A;  3BXK A;  1E8A A;  3AKB A;  1F71 A;  3S0F A;  1WLM A;  2ZRS A;  2JPT A;  3O4X A;  3AAJ A;  3D73 A;  2PMY A;  2Y4Q A;  3QRX A;  1BJF A;  3PSR A;  1OW4 A;  3PFV A;  3A8R A;  1EXR A;  4HRE E;  1KQM C;  1U5I B;  2FOT A;  2L4I A;  4C0K A;  3KEV A;  3ICB A;  3OGN A;  1QWV A;  4WQ3 A;  2HET A;  2YGU A;  1YTZ C;  2GGZ A;  4PAL A;  1SY9 A;  3S0D A;  4OV2 A;  4MLW A;  3WNX B;  3LCP C;  1LVC D;  1UHI A;  4YI9 A;  5DKN A;  2EC6 B;  3FS7 A;  3SG7 A;  1BU3 A;  1S6I A;  2EHB A;  3O4Y A;  5JJG A;  1K90 D;  1K93 D;  1XO5 A;  2PAS A;  2ZKM X;  1QVI Z;  2K61 A;  1BF5 A;  2TN4 A;  3D78 A;  1DJY A;  2COL B;  2B1U A;  1YX8 A;  5HKZ A;  1CLM A;  3DF0 B;  1NYA A;  4N1G A;  1TNP A;  2F2P A;  4MZK A;  5I2L A;  1C7V A;  1WRK A;  1JF0 A;  2BAP A;  2JXL A;  3PN7 B;  3B7A A;  2H2K A;  1Y1X A;  4FQT A;  5HYD A;  3I5H B;  1WY9 A;  2AMI A;  4PDZ A;  2KBM A;  1B8R A;  1TUJ A;  2QEH A;  3JTD B;  3AAK A;  1CTR A;  1SK6 D;  3PAL A;  3O2P A;  4M2P A;  2Y1N A;  1Q80 A;  3LLE A;  1C3Z A;  1H8B A;  2KHN A;  3EK8 A;  2ISD A;  1EJ3 A;  1M63 B;  1B9A A;  1CDP A;  1U5I A;  3CWG A;  1PAL A;  4OKH A;  5JOL A;  3ZNI A;  4F0Z B;  1BR4 B;  1UHN A;  1L7Z A;  2LVK A;  1UHJ A;  3CZ2 A;  4TNC A;  1NX0 A;  1S36 A;  2L0P A;  2BL0 C;  2LVI A;  2O5G A;  3EK4 A;  1QAS A;  4AQI A;  2JUL A;  1NX1 A;  2HQ8 A;  4PCW A;  1OOI X;  4QJ5 B;  1TUZ A;  3FWC A;  2E30 A;  2WCM A;  4FTG A;  1JSA A;  1LIN A;  2F3Z A;  2M29 A;  3R72 A;  2HQW A;  1LA0 A;  1RK9 A;  3FWB A;  2L50 A;  3EVV A;  1YRU B;  2VRG A;  1DVI A;  3BOW B;  1CFP A;  3DF0 A;  3E3R A;  4GFT A;  4JD9 A;  1FI5 A;  3M0W A;  1GGZ A;  3I5G C;  1CFF A;  1OZO A;  1LKJ A;  3TUY B;  5K89 A;  5FYX A;  5ER4 X;  1K95 A;  5HKY A;  1F4Q A;  1MHO A;  2ZNE A;  1DJX A;  1DF0 A;  2ZN9 A;  2KLE A;  4A4B A;  1NSH A;  1SCM C;  1IIO A;  1D1O A;  2LC5 A;  3EKJ A;  1Y0V H;  1CLL A;  2P71 A;  4GAO A;  1N65 A;  2LNK A;  1F54 A;  2M1U A;  3B86 A;  3SG4 A;  1NUB A;  2NZ0 A;  1DJW A;  1JBA A;  1JFJ A;  1EG3 A;  2CNP A;  1KK8 C;  2KFH A;  2MLE C;  2M7L A;  1F55 A;  1WRZ A;  1CB1 A;  2JT8 A;  1GJY A;  1YRT B;  2M8U A;  2LLT A;  2V53 A;  3UO9 A;  5EL2 A;  4JQ0 D;  3B88 A;  1DQE A;  1ODB A;  1RTP 1;  4M2O A;  5AAN A;  3S0E A;  1DT7 B;  1SMG A;  2L51 A;  1OOH A;  3EKH A;  1NCX A;  4GNK B;  3NSI A;  2OS8 C;  3GK2 A;  4PE0 A;  4YBH B;  1DTL A;  2ZND A;  4UPG A;  3OB1 B;  4N5X A;  5DKR A;  2I18 A;  1K8U A;  5PAL A;  5ER5 A;  2FJU B;  1JWD A;  1XFX O;  4ORC B;  1WRL A;  3DVE A;  3D0Y B;  3K21 A;  5D69 A;  3HX4 A;  3OBV A;  1X02 A;  1G8I A;  1SL9 A;  3D76 A;  1SRA A;  1CMG A;  2Q91 A;  3ZWH A;  2BBN A;  5FI2 A;  1BOC A;  2PSR A;  1A2X A;  4MBE A;  1A75 B;  1K2H A;  3EVU A;  3IF7 A;  1LA3 A;  3DVJ A;  3AKA A;  4E68 A;  1IH0 A;  3OP0 A;  3SIB A;  3BYA A;  3GOF A;  1BOD A;  3VB1 A;  3BUO B;  3BUN B;  3MSE B;  1W7J B;  2KQ6 A;  4A4C A;  3DD4 A;  2ZRT A;  2L5Y A;  1H4B A;  2NCP A;  4BY4 A;  3CR5 X;  1ZMZ A;  1SL7 A;  3L4A A;  1EL4 A;  4ICB A;  3KPX A;  2MRD A;  3EVR A;  1PRW A;  1M31 A;  1KK7 Y;  1UHH A;  1YUS A;  2MAZ A;  2K2A A;  1IWQ A;  1ZFS A;  2BE6 A;  1SR6 B;  5CSN A;  2KGB C;  1CFC A;  3SG3 A;  3R1V A;  1QJT A;  4I5L B;  3NSL A;  4YGA A;  5IBW A;  4L9M A;  1FPW A;  1SSE B;  3PLF B;  2EC6 C;  3I5I C;  1UUS A;  1YR5 A;  5HLV A;  3TS5 B;  1F8H A;  1FF1 A;  3CDN A;  3D0Y A;  2E6W A;  1AVS A;  2M1K B;  3BUX B;  4P5O E;  2WC6 A;  1RRO A;  3DXL A;  3LK0 A;  1IQ3 A;  3RZS A;  1BG1 A;  1BLQ A;  2KDH A;  1A75 A;  1V1F A;  3I5F C;  3Q8I A;  2L98 A;  2JZI A;  2IS9 A;  4MN0 A;  1YUU A;  1TNX A;  2LMU A;  3SS5 A;  1R6P A;  2QEO A;  2KI4 C;  4NDC A;  5AFP A;  2KI6 D;  1XFR A;  2M97 A;  3H4S E;  1B47 A;  1G33 A;  1WLZ A;  3JTD C;  4FQO A;  1YX7 A;  4QJ3 B;  4ZCV A;  1TCF A;  2I94 A;  1HT9 A;  5D7F A;  4XYN A;  5KSZ A;  1J7O A;  2A4J A;  1DJH A;  2KYC A; 
#chains in the Genus database with same CATH homology
 2G9B A;  1W7I B;  2CCM A;  4YGB B;  1SKT A;  2AUC A;  2WOR A;  1AP4 A;  1M45 A;  4PE1 A;  3VGO A;  1A29 A;  1B8C A;  1PUL A;  1YVL A;  2M9G A;  1XFV O;  1HQV A;  2JNX A;  2F33 A;  1K94 A;  2LHL A;  3JVT B;  3SG2 A;  4GUK A;  1MXL C;  1MWN A;  2MHH A;  1QX2 A;  2KNE A;  2LVV A;  3CS1 A;  3CZT X;  1TIZ A;  4XJK B;  1SL8 A;  2OPO A;  1S1E A;  2CBL A;  2P6B B;  3GK4 X;  3NSK A;  1SBJ A;  1V1G A;  4C0J A;  4R1E A;  3D10 A;  2M3W A;  1KQM B;  4DCK A;  1MF8 B;  1EG4 A;  1TNW A;  1NPQ A;  3LK1 A;  1YUR A;  1WDC C;  2CT9 A;  1MR8 A;  2KAV A;  2K2F A;  4CFR A;  3WXA A;  4NDD A;  1F70 A;  3TDZ A;  5B8I B;  2LMT A;  1S5G Y;  1L2O C;  4GGN A;  1QV0 A;  2SAS A;  2MA2 A;  2QPT A;  1PSR A;  1J1D A;  1K9K A;  5GQQ C;  2LMV A;  4C0L A;  1NCZ A;  1C07 A;  3F45 A;  1AHR A;  1KWO C;  1Y6W A;  4DRW A;  1NP8 A;  2JT3 A;  2FCE A;  1B1G A;  1M46 A;  1S6J A;  1KFX L;  2BKI B;  2ZN8 A;  2JQ6 A;  1QX5 B;  1MUX A;  2WCE A;  1CDM A;  1EH2 A;  1TNQ A;  1J55 A;  2GV5 A;  4M2Q A;  2BL0 B;  2M0R A;  4HRG A;  1YUT A;  1CFD A;  1J7Q A;  2L2E A;  1XA5 A;  3DVM A;  2JTZ A;  3OX5 A;  2L5X B;  1QAT A;  4I5J A;  1DJI A;  3IQQ A;  3BOW A;  1N0Y A;  1XK4 A;  1A03 A;  4PHK A;  1TCO B;  1QTX A;  1G4Y R;  3DVK A;  4WRI A;  2M7N A;  2K7O A;  3OX6 A;  1OMV A;  3I5G B;  4U8D A;  5AEQ A;  4MVF A;  3RLZ A;  2LUX A;  1QIV A;  4BY5 A;  2KFF A;  4PHM A;  3EK7 A;  1UP5 A;  1IJ5 A;  2GGM A;  1QV1 A;  1XFU O;  1K96 A;  4YGC B;  2QAC A;  2OTG B;  2Y1M A;  4CFQ A;  3GK1 A;  1KK7 Z;  1SR6 C;  3LL8 B;  2BCB A;  4GPL B;  2LP3 A;  2LVJ A;  4HSZ A;  1K9P A;  4PE7 A;  4YRU A;  3VRR A;  1XVJ A;  1PVA A;  2BCA A;  1KK8 B;  2LLU A;  3C1V A;  2MLF C;  1DJZ A;  2H61 A;  2ZFD A;  4JPZ B;  3TS5 C;  2CXJ A;  1AK8 A;  3CTN A;  1NX3 A;  4DIR A;  2LLS A;  1QLS A;  2KOT A;  1FW4 A;  4OCI A;  2LV7 A;  1S6C A;  2BEC A;  1M39 A;  4ETO A;  1JF2 A;  2NCO A;  3BUW B;  2PRU A;  1XYD A;  4HRH A;  2OS8 B;  4MRY A;  1J7R A;  1CKK A;  2PAL A;  1FI6 A;  1NX2 A;  5TNC A;  1VRK A;  3IQO A;  4ORB B;  3CR4 X;  2KAY A;  4AQJ A;  2O60 A;  1IJ6 A;  2JWW A;  1MXE A;  1KFU L;  2KAX A;  5KTY A;  1XFW O;  4PHJ A;  3PN7 C;  5BPJ A;  1ALV A;  2MJW B;  3I5H C;  1IKU A;  1CDL A;  2NLN A;  2F2O A;  1QS7 A;  4IL1 A;  2G2B A;  3BQ3 A;  2RGI A;  2WC8 A;  1C7W A;  4GGF A;  1NWD A;  1B7T Y;  1A4P A;  1B8L A;  3CLN A;  3TZ1 A;  2SCP A;  1QX7 A;  3O78 A;  3SJS A;  3OB2 B;  1JC2 A;  1OE9 B;  4YGE B;  1DGV A;  2JOJ A;  2I7A A;  2WCF A;  2KQY A;  4MZJ A;  2CTN A;  1TOP A;  5CSF A;  2JU0 A;  2KBI A;  4PHN A;  3I5I B;  3SG6 A;  4WQ2 A;  2K0J A;  4ORA B;  1OOJ A;  1UUR A;  1J1E A;  4I5K A;  2BBM A;  2K8M B;  1JFK A;  1OQP A;  1XK4 C;  1AJ5 A;  1FBV A;  1NIW A;  1TRF A;  2K7C A;  2LUC A;  5F6T A;  1SCV A;  1UHK A;  2F8P A;  5CSI A;  1S5G Z;  4YI8 A;  3TUY C;  3I5F B;  1CLB A;  2K7D A;  2Q4U A;  2NXQ A;  2WCB A;  3RM1 A;  2KI4 B;  2R2I A;  3A4U B;  2M49 B;  3TDI A;  1B4C A;  1IRJ A;  1DF0 B;  1AUI B;  1QVI Y;  2JXC A;  3BUM B;  3PM8 A;  5HKW A;  5AER A;  3KO0 A;  2LE9 B;  1QLK A;  3FIA A;  3NXA A;  5HLO A;  5DKQ A;  3VRQ A;  1J7P A;  2AAO A;  5CSJ A;  4CPV A;  4DS7 A;  2H61 C;  4NDB A;  3VRO A;  2JRF A;  2FCD A;  1KFX S;  2KSP A;  4ZCU A;  2LAN A;  4XJK A;  1QXP A;  4CLN A;  2LM5 A;  1KQV A;  3SG5 A;  1PVB A;  1YVH A;  2BKH B;  4N1F A;  1CMF A;  1RFJ A;  3CR2 A;  2I2R E;  2LAP A;  2HF5 A;  2BE4 A;  2K7B A;  4I5N B;  2KGR A;  1RJV A;  2WOS A;  1PK0 D;  1PSB A;  1WDC B;  4MSP A;  4PE4 A;  1DGU A;  2KFG A;  3VRP A;  2OTG C;  1CDN A;  1R2U A;  5AXI A;  1SNL A;  1SYM A;  1Y1A A;  3O6B A;  1CM4 A;  1ALW A;  2EGD A;  1IGV A;  1BT6 A;  1SPY A;  2WND A;  2JC2 A;  1L2O B;  3NSO A;  3SIA A;  3CGA A;  3KHE A;  5CPV A;  5I8N A;  1QIW A;  5KU1 A;  4GGF C;  1CNP A;  1RWY A;  2KI6 C;  4YGD B;  4USL A;  5I2Q A;  1BMO A;  1SW8 A;  1SCM B;  4P2Y B;  2JNF A;  2JT0 A;  1KWO B;  1BR1 B;  1NCY A;  2HPS A;  1GGW A;  2DOQ A;  4Q04 A;  2LCP A;  1CM1 A;  1Y1U A;  2JTT A;  1TTX A;  2MBX A;  2Y5I A;  1ZUZ A;  1TN4 A;  1S26 D;  3WHU B;  1XFY O;  2F3Y A;  1ZAC A;  3KF9 A;  4MEW A;  4MRX A;  1GQM A;  5G08 A;  3VRN A;  1LXF C;  3TDU A;  1OMD A;  4AOM A;  2LHI A;  3PAT A;  1OZS A;  4CID A;  1DJG A;  1REC A;  5J3X A;  4DUQ A;  4MZL A;  4NQG A;  1IG5 A;  2PVB A;  1KFU S;  2L4H A;  3OHM B;  4OR9 B;  4JWQ A;  1JUO A;  4QJ4 B;  1KSM A;  1S3P A;  1KSO A;  2BCX A;  1B7T Z;  2LP2 A;  1XFZ O;  1IQ5 A;  1KCY A;  1K9U A;  1UWO A;  5I2O A;  1DMO A;  1N2D A;  1AJ4 A;  1OSA A;  2KYF A;  3JVT C;  4D1E A;  1ZOT B;  2D8N A;  1OMR A;  3WHT B;  1F4O A;  3HCM A;  4OVN F;  4GBA A;  1MQ1 A;  3BXK A;  1E8A A;  3AKB A;  1F71 A;  1WLM A;  2ZRS A;  2JPT A;  3AAJ A;  2PMY A;  2Y4Q A;  3QRX A;  1BJF A;  3PSR A;  3PFV A;  3A8R A;  1EXR A;  4HRE E;  1KQM C;  1U5I B;  2FOT A;  2L4I A;  4C0K A;  3KEV A;  3ICB A;  4WQ3 A;  2HET A;  1YTZ C;  2GGZ A;  4PAL A;  1SY9 A;  3WNX B;  4OV2 A;  4MLW A;  3LCP C;  1LVC D;  1UHI A;  4YI9 A;  5DKN A;  2EC6 B;  3FS7 A;  3SG7 A;  1BU3 A;  1S6I A;  2EHB A;  3O4Y A;  5JJG A;  1K90 D;  1K93 D;  1XO5 A;  2PAS A;  2ZKM X;  1QVI Z;  2K61 A;  1BF5 A;  2TN4 A;  1DJY A;  2COL B;  2B1U A;  1YX8 A;  5HKZ A;  1CLM A;  3DF0 B;  1NYA A;  4N1G A;  1TNP A;  2F2P A;  4MZK A;  5I2L A;  1C7V A;  1WRK A;  1JF0 A;  2JXL A;  3PN7 B;  2H2K A;  1Y1X A;  5HYD A;  3I5H B;  1WY9 A;  2AMI A;  4PDZ A;  2KBM A;  1B8R A;  3JTD B;  3AAK A;  1CTR A;  1SK6 D;  3PAL A;  3O2P A;  4M2P A;  2Y1N A;  1Q80 A;  3LLE A;  1H8B A;  2KHN A;  3EK8 A;  2ISD A;  1EJ3 A;  1M63 B;  1B9A A;  1CDP A;  1U5I A;  3CWG A;  1PAL A;  4OKH A;  5JOL A;  3ZNI A;  4F0Z B;  1BR4 B;  1UHN A;  1L7Z A;  2LVK A;  1UHJ A;  4TNC A;  1NX0 A;  1S36 A;  2L0P A;  2BL0 C;  2LVI A;  2O5G A;  3EK4 A;  1QAS A;  4AQI A;  2JUL A;  1NX1 A;  2HQ8 A;  4PCW A;  4QJ5 B;  3FWC A;  2E30 A;  4FTG A;  1JSA A;  1LIN A;  2F3Z A;  2M29 A;  2HQW A;  1LA0 A;  1RK9 A;  3FWB A;  2L50 A;  3EVV A;  1YRU B;  2VRG A;  1DVI A;  3BOW B;  1CFP A;  3DF0 A;  3E3R A;  4GFT A;  1FI5 A;  3M0W A;  1GGZ A;  3I5G C;  1CFF A;  1OZO A;  1LKJ A;  3TUY B;  5K89 A;  5FYX A;  5ER4 X;  1K95 A;  5HKY A;  1F4Q A;  1MHO A;  2ZNE A;  1DJX A;  1DF0 A;  2ZN9 A;  4A4B A;  1NSH A;  1SCM C;  1D1O A;  2LC5 A;  3EKJ A;  1Y0V H;  1CLL A;  4GAO A;  1N65 A;  2LNK A;  1F54 A;  2M1U A;  3SG4 A;  1NUB A;  2NZ0 A;  1DJW A;  1JBA A;  1JFJ A;  1EG3 A;  2CNP A;  1KK8 C;  2KFH A;  2MLE C;  2M7L A;  1F55 A;  1WRZ A;  1CB1 A;  2JT8 A;  1GJY A;  1YRT B;  2M8U A;  2LLT A;  2V53 A;  4JQ0 D;  5AAN A;  1ODB A;  1RTP 1;  4M2O A;  1DT7 B;  1SMG A;  2L51 A;  3EKH A;  1NCX A;  4GNK B;  3NSI A;  2OS8 C;  3GK2 A;  4PE0 A;  4YBH B;  1DTL A;  2ZND A;  4UPG A;  3OB1 B;  4N5X A;  5DKR A;  2I18 A;  1K8U A;  5PAL A;  5ER5 A;  2FJU B;  1JWD A;  1XFX O;  4ORC B;  1WRL A;  3DVE A;  3D0Y B;  3K21 A;  5D69 A;  3HX4 A;  1X02 A;  1G8I A;  1SL9 A;  1SRA A;  1CMG A;  2Q91 A;  3ZWH A;  2BBN A;  1BOC A;  2PSR A;  1A2X A;  4MBE A;  1A75 B;  1K2H A;  3EVU A;  3IF7 A;  1LA3 A;  3DVJ A;  3AKA A;  4E68 A;  1IH0 A;  3OP0 A;  3SIB A;  3BYA A;  3GOF A;  1BOD A;  3BUO B;  3BUN B;  3MSE B;  1W7J B;  2KQ6 A;  4A4C A;  3DD4 A;  2ZRT A;  2NCP A;  4BY4 A;  3CR5 X;  1ZMZ A;  1SL7 A;  1EL4 A;  4ICB A;  3KPX A;  2MRD A;  3EVR A;  1PRW A;  1M31 A;  1KK7 Y;  1UHH A;  1YUS A;  2MAZ A;  2K2A A;  1IWQ A;  1ZFS A;  2BE6 A;  1SR6 B;  5CSN A;  2KGB C;  1CFC A;  3SG3 A;  1QJT A;  4I5L B;  3NSL A;  4YGA A;  5IBW A;  4L9M A;  1FPW A;  3PLF B;  2EC6 C;  3I5I C;  1UUS A;  1YR5 A;  5HLV A;  3TS5 B;  1F8H A;  1FF1 A;  3D0Y A;  2E6W A;  1AVS A;  2M1K B;  3BUX B;  4P5O E;  1RRO A;  3LK0 A;  1IQ3 A;  1BLQ A;  1BG1 A;  2KDH A;  1A75 A;  1V1F A;  3I5F C;  2L98 A;  2JZI A;  2IS9 A;  4MN0 A;  1YUU A;  1TNX A;  2LMU A;  5AFP A;  1R6P A;  4NDC A;  2KI4 C;  1H4B A;  2KI6 D;  2M97 A;  3H4S E;  1B47 A;  1G33 A;  1WLZ A;  3JTD C;  4FQO A;  1YX7 A;  4QJ3 B;  4ZCV A;  1TCF A;  2I94 A;  1HT9 A;  5D7F A;  4XYN A;  5KSZ A;  1J7O A;  2A4J A;  1DJH A;  2KYC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...