1QLKA

Solution structure of ca(2+)-loaded rat s100b (betabeta) nmr, 20 structures
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
92
structure length
92
Chain Sequence
MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDEDGDGECDFQEFMAFVSMVTTACHEFFEHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Calcium-binding
molecule keywords S-100 PROTEIN
publication title Solution structure of calcium-bound rat S100B(betabeta) as determined by nuclear magnetic resonance spectroscopy,.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 24
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1qlkA00
5F6TA 3EVVA 2JWWA 3I5FB 4OV2A 3KPXA 1XK4C 2L51A 3AKBA 3ZNIA 1ZUZA 2KFHA 2OPOA 2Y1MA 4MRYA 4C0KA 1S5GZ 1WLZA 4MLWA 5ER5A 1XA5A 3I5IC 2KAVA 1E8AA 1OQPA 3DF0B 5CSJA 4PDZA 1EJ3A 2G9BA 4NDBA 1Y0VH 5KSZA 3CLNA 2JNFA 2K7CA 3PN7C 3ZWHA 1BJFA 2AAOA 4CIDA 1SR6B 4NDCA 1QVIY 3CR5X 4GNKB 2I94A 3PATA 1FI6A 1K2HA 5JJGA 4WQ2A 3FS7A 1SBJA 1S26D 1TNXA 2F2PA 5D7FA 4ORCB 2WC8A 1IWQA 2DOQA 3VRPA 1ODBA 1K95A 4NQGA 1QX5B 3EK4A 2HQWA 2M3WA 1IGVA 2PSRA 4YGDB 1TNPA 3TUYC 1F4OA 2F3ZA 1W7IB 2CCMA 1DF0A 1ZFSA 2ZRSA 1CMFA 3GOFA 3LK1A 3CZTX 5I2LA 1XFYO 1U5IB 2BCXA 1Y1UA 4PE7A 4N1FA 3AAJA 1IG5A 2M29A 2R2IA 1LKJA 1K9UA 1GJYA 3F45A 1CLLA 1OMRA 1MUXA 1ZOTB 1OZSA 1DJIA 2H61A 1QLSA 4MZJA 3KF9A 1KFXS 2M7NA 1OMVA 4DCKA 2K7DA 3NSLA 2AMIA 2ZNDA 3I5GB 3PALA 1CFCA 1J7QA 4C0JA 4JQ0D 1OSAA 2NCOA 5DKRA 5HLOA 1MQ1A 2LUCA 1S6JA 1YR5A 1DGUA 1TCFA 2ZN9A 2KNEA 1B7TY 1DF0B 1SCVA 1MXLC 2OTGC 1NCXA 1FI5A 1SCMC 4BY4A 2JPTA 4MZLA 2V53A 2PRUA 5CSFA 4FTGA 4MSPA 2JXCA 1CMGA 1B47A 1AJ4A 1OE9B 1S5GY 3DVMA 4HSZA 1NX3A 4A4CA 1QVIZ 1A75B 1R2UA 4XJKA 1CB1A 2HETA 5JOLA 2AUCA 3SIAA 2OTGB 2M49B 1SCMB 1FF1A 3VRRA 3DD4A 2KI6D 3CTNA 3JTDC 3VRQA 5I2OA 1Q80A 4GGNA 3AKAA 4ORAB 3RLZA 1F8HA 2KHNA 1PULA 1DMOA 4I5NB 1LA3A 5DKQA 3WHUB 1X02A 3JTDB 4CLNA 1KK8C 1OMDA 2CBLA 5BPJA 2JXLA 4QJ5B 1IQ5A 5AFPA 1TTXA 3JVTC 3EK7A 2IS9A 4L9MA 5I8NA 3BQ3A 1S6IA 3EVRA 1CDLA 3LL8B 2HPSA 1KK8B 1FBVA 4AQIA 2HF5A 4M2OA 1YX7A 2JT3A 2NXQA 3A4UB 3K21A 1YTZC 3JVTB 3AAKA 5KTYA 3VGOA 1LXFC 1QX7A 2BL0B 3SG5A 1BU3A 2M8UA 2LVVA 2LE9B 4XJKB 1BR1B 1F71A 1QIWA 1J55A 3ICBA 4IL1A 2BCAA 4QJ3B 3SIBA 2EGDA 2G2BA 5AXIA 1C07A 5K89A 4M2PA 1YVLA 2ZN8A 1UHIA 2BE6A 2LVKA 3IQQA 4P5OE 3SG6A 3O78A 1B7TZ 1HT9A 1ZACA 2BKHB 2KYFA 4I5KA 1K9PA 4OVNF 1J1DA 2WCEA 5HKZA 3A8RA 1DGVA 1XVJA 1KSMA 2NLNA 2M1UA 1NWDA 2JRFA 3BUWB 1J7PA 2LLUA 4D1EA 2Y5IA 3WHTB 3BUXB 3IF7A 5ER4X 2BKIB 1CNPA 2LHLA 2LLTA 4HRGA 4I5JA 2BECA 3CR2A 2LMUA 3OB1B 1A29A 1AHRA 1PK0D 2KDHA 1QX2A 1SL8A 3I5IB 5CSIA 2D8NA 4ZCUA 2GGMA 1JF0A 4GFTA 2KI6C 1K9KA 3PN7B 4UPGA 5HLVA 4CFQA 4E68A 1UURA 1ZMZA 1OZOA 3EKHA 1H4BA 2ZFDA 1G8IA 2BE4A 4NDDA 2E6WA 3D0YA 2MAZA 1IJ6A 4YBHB 5CSNA 1MXEA 1TRFA 3C1VA 1KQMC 1M46A 1D1OA 1YX8A 2LAPA 2LVJA 2I7AA 1R6PA 1MHOA 2GGZA 1DJYA 2O5GA 4GGFA 4GBAA 2FOTA 1QIVA 1SY9A 1IJ5A 3TS5C 3DVEA 2I2RE 5TNCA 5J3XA 3TUYB 1BR4B 4XYNA 3GK4X 3PSRA 3VROA 3OP0A 1QLKA 1NSHA 1DJWA 4U8DA 2L98A 2KOTA 2K8MB 1RROA 2L4HA 4I5LB 1F4QA 1PVAA 1A2XA 4HREE 2MLEC 2BCBA 1XFZO 1OOJA 2O60A 1YUSA 1B4CA 3SJSA 4DIRA 3SG7A 1KFXL 1A03A 4MEWA 3CWGA 1CFFA 1C7VA 1SW8A 1IKUA 1LVCD 4OCIA 1LINA 2KGBC 1K90D 2SASA 3HX4A 4OR9B 1BF5A 4YGCB 1QTXA 4FQOA 1JFKA 1UP5A 2HQ8A 2LV7A 2B1UA 1K8UA 2M0RA 1F70A 4QJ4B 3I5HC 2NZ0A 2LMTA 3BOWA 1BOCA 4MBEA 4P2YB 2JT8A 2KAXA 2JOJA 1NX0A 2H61C 1GGWA 1GGZA 2F2OA 2CTNA 4MVFA 4AOMA 3I5HB 2FJUB 4YGBB 5DKNA 1B8RA 1TNQA 2JT0A 4YI9A 4YGAA 1L7ZA 1QV1A 2K61A 1Y6WA 4ETOA 1B1GA 1JBAA 2F8PA 5AANA 1KWOC 1MWNA 1TIZA 4AQJA 2KI4C 2ZNEA 2K0JA 1WDCC 2CNPA 2LUXA 4HRHA 2CXJA 4PE4A 1WLMA 1K96A 1RECA 2LHIA 2NCPA 3BXKA 5KU1A 2CT9A 1BMOA 1J1EA 1VRKA 3BUMB 1SKTA 1V1FA 1C7WA 1YUTA 1CDMA 3IQOA 1KFUS 2KI4B 1L2OC 1M63B 3GK1A 4JWQA 1W7JB 1K93D 1NCYA 2BBNA 2KFFA 2M97A 2LP2A 1WRZA 3FWBA 3MSEB 2K7BA 3BOWB 2FCDA 3NSKA 2F3YA 2ISDA 1IH0A 1SL7A 2LM5A 3TZ1A 5D69A 2MBXA 2MJWB 2K2FA 2KBMA 1ALVA 1GQMA 2PVBA 5B8IB 1L2OB 1BODA 1M31A 1JF2A 2JNXA 1CDNA 1CFDA 4PALA 2GV5A 5HYDA 4N5XA 4PHMA 1CFPA 3HCMA 3TDIA 1J7RA 1YRTB 3NXAA 1NX1A 4MZKA 3DF0A 3PLFB 4GAOA 1RFJA 2P6BB 2EC6C 4WQ3A 1CM4A 1PRWA 1YVHA 2KAYA 1DJHA 3O6BA 1Y1XA 1RWYA 1DJZA 1K94A 1MF8B 3KHEA 1A4PA 2COLB 2L0PA 2EC6B 1BT6A 1G33A 4WRIA 1G4YR 3I5FC 2JZIA 1NPQA 2M1KB 2PMYA 1KSOA 3PFVA 4N1GA 1CM1A 3OB2B 4Q04A 4R1EA 1AUIB 3NSOA 1CLBA 1QASA 1NIWA 3LLEA 1UHHA 4JPZB 3NSIA 3SG4A 3O2PA 2LANA 1AJ5A 4A4BA 3GK2A 1U5IA 1QATA 1N2DA 2LMVA 2PALA 2M9GA 1PVBA 3D10A 1YURA 1QJTA 2LNKA 1SR6C 3BYAA 2SCPA 5G08A 1KK7Z 1AVSA 3FWCA 4DUQA 2WCFA 2L50A 2MRDA 3TDUA 2KGRA 1JFJA 1WRLA 2H2KA 1DJGA 1DVIA 2LVIA 2KFGA 2TN4A 1AP4A 3WXAA 1KQMB 1NYAA 1J7OA 4F0ZB 3SG2A 3LCPC 1B8CA 1F54A 1V1GA 3CS1A 3VRNA 2BBMA 2RGIA 1NX2A 3TS5B 1EG3A 2JTTA 3OX5A 3RM1A 1H8BA 1N65A 3OX6A 1NP8A 1SNLA 2WCBA 1JC2A 1SK6D 2JC2A 2A4JA 1RJVA 1XFVO 2MLFC 2K7OA 1TNWA 2KBIA 1UHKA 3BUNB 3O4YA 4M2QA 5I2QA 3PM8A 1FPWA 2FCEA 4DRWA 4PCWA 1CKKA 1TCOB 1XFXO 1MR8A 1Y1AA 3H4SE 4CFRA 3WNXB 1JUOA 2JTZA 1EG4A 4GGFC 3D0YB 1A75A 2LC5A 1NCZA 2OS8C 1B8LA 3I5GC 1M45A 1ALWA 3CGAA 2M7LA 1B9AA 1XYDA 2WNDA 2WORA 2OS8B 3EKJA 1UUSA 4USLA 3OHMB 1SYMA 4ZCVA 1DJXA 2EHBA 1HQVA 1WY9A 1S36A 4TNCA 2MHHA 1BG1A 2L2EA 4GUKA 1XO5A 1WRKA 5AERA 3CR4X 2PASA 1LA0A 1QV0A 2LLSA 1EXRA 3DVJA 3KO0A 3E3RA 1AK8A 4PE1A 1JWDA 1UHJA 4YI8A 1RK9A 4BY5A 2ZRTA 2Y4QA 5HKYA 2KSPA 2Y1NA 1NUBA 4MN0A 1EH2A 3FIAA 1TN4A 1SMGA 1UWOA 5CPVA 3DVKA 4GPLB 2VRGA 4MRXA 1CTRA 1KCYA 1SRAA 1KWOB 2I18A 1M39A 1KK7Y 1DT7B 2ZKMX 4OKHA 3EK8A 3EVUA 4ORBB 1WDCB 4YGEB 2JULA 2KYCA 2QPTA 2E30A 3M0WA 2JU0A 4PHNA 1KFUL 5AEQA 4DS7A 2F33A 1YRUB 2MA2A 1QXPA 1YUUA 3KEVA 5GQQC 5IBWA 3BUOB 1PSBA 2KQ6A 2K2AA 2L5XB 3LK0A 5HKWA 4YRUA 1SPYA 1UHNA 4ICBA 1TOPA 3QRXA 1DTLA 1XK4A 1FW4A 1S6CA 2BL0C 2JQ6A 4PHKA 1IQ3A 1BLQA 1CLMA 1PSRA 2KQYA 2QACA 1XFWO 1F55A 5FYXA 2LCPA 1S1EA 1SL9A 2Q4UA 1RTP1 1XFUO 3SG3A 3TDZA 5PALA 4CPVA 1JSAA 2WOSA 2Q91A 1IRJA 4C0LA 1QS7A 1EL4A 1PALA 2LP3A 1KQVA 1N0YA 1CDPA 4PHJA 2L4IA 1S3PA 4PE0A
chains in the Genus database with same CATH superfamily
5F6TA 3EVVA 2JWWA 3I5FB 4OV2A 3KPXA 1XK4C 2L51A 3AKBA 3ZNIA 1ZUZA 2KFHA 2OPOA 2Y1MA 4MRYA 4C0KA 1S5GZ 1WLZA 4MLWA 5ER5A 1XA5A 2GTEA 3I5IC 2KAVA 1E8AA 1OQPA 3DF0B 5CSJA 4PDZA 1EJ3A 2G9BA 4NDBA 1Y0VH 5KSZA 3CLNA 2JNFA 2K7CA 3PN7C 3R1OA 3ZWHA 5D3OA 1GM0A 1BJFA 2AAOA 4CIDA 1SR6B 4NDCA 1QVIY 3CR5X 1OW4A 4GNKB 2I94A 1OOGA 3PATA 1C3YA 1FI6A 1K2HA 5JJGA 1QWVA 4WQ2A 3FS7A 1SBJA 1S26D 1TNXA 2F2PA 5D7FA 4ORCB 2WC8A 1IWQA 2DOQA 3VRPA 1ODBA 1K95A 4NQGA 1QX5B 3EK4A 2HQWA 2M3WA 1IGVA 2PSRA 4YGDB 1TNPA 3TUYC 1F4OA 2F3ZA 3SS3A 1W7IB 2CCMA 1DF0A 1C3ZA 1ZFSA 2ZRSA 1CMFA 3GOFA 1ORGA 3LK1A 3CZTX 3S0EA 5I2LA 1XFYO 1U5IB 3DY9A 2BCXA 1Y1UA 4PE7A 4N1FA 3AAJA 1IG5A 2M29A 2R2IA 1LKJA 1K9UA 1GJYA 3F45A 1CLLA 4OZDA 1OMRA 3BFHA 3CABA 1MUXA 1ZOTB 1OZSA 1DJIA 2H61A 1QLSA 4MZJA 3KF9A 1KFXS 2M7NA 1OMVA 4DCKA 2K7DA 4IJ7A 1DELA 3NSLA 2AMIA 2ZNDA 1IIOA 3I5GB 3PALA 1CFCA 1LS8A 3R72A 1J7QA 4C0JA 1SSEB 3S0GA 4JQ0D 1OSAA 2NCOA 5DKRA 5HLOA 1MQ1A 3IVTA 2LUCA 1S6JA 1DEKA 1YR5A 2QEHA 1DGUA 1TCFA 3DYEA 2ZN9A 1TUJA 1B7TY 2KNEA 1DF0B 1SCVA 3EG5B 3OGNA 1MXLC 2OTGC 2QDIA 1NCXA 1FI5A 1SCMC 4BY4A 2JPTA 4MZLA 2V53A 2PRUA 5CSFA 4FTGA 4MSPA 3CZ0A 2JXCA 1CMGA 1B47A 1AJ4A 1OE9B 1S5GY 3DVMA 4HSZA 3D74A 3S0AA 1NX3A 3D73A 1QVIZ 4A4CA 1A75B 1R2UA 4XJKA 1CB1A 2HETA 5JOLA 2AUCA 3SIAA 2OTGB 2M49B 1SCMB 1FF1A 3VRRA 3DD4A 2KI6D 3CTNA 3JTDC 3VRQA 5I2OA 1Q80A 4GGNA 3AKAA 4ORAB 2YGUA 3RLZA 1F8HA 2KHNA 1PULA 3NHTA 1DMOA 4I5NB 1LA3A 5DKQA 3D77A 3WHUB 1X02A 3JTDB 4CLNA 1KK8C 1OMDA 2CBLA 5BPJA 2JXLA 4QJ5B 1IQ5A 5AFPA 1TTXA 3JVTC 3EK7A 2IS9A 4L9MA 5I8NA 3BQ3A 1S6IA 3EVRA 1CDLA 3LL8B 2HPSA 1KK8B 1FBVA 4AQIA 2HF5A 4M2OA 1YX7A 2JT3A 2NXQA 3A4UB 3D76A 3K21A 1YTZC 3JVTB 1DC1A 3AAKA 5KTYA 3VGOA 2QEOA 1LXFC 1QX7A 2BL0B 3SG5A 1BU3A 2M8UA 2LVVA 2LE9B 4XJKB 1BR1B 1Z4HA 3S0BA 1F71A 1QIWA 1J55A 3ICBA 3PJIA 4IL1A 2BCAA 4QJ3B 3SIBA 2EGDA 2G2BA 3L47A 3S0FA 5AXIA 1C07A 5K89A 4M2PA 1P28A 1YVLA 2ZN8A 1UHIA 2KPHA 3B7AA 2BE6A 2LVKA 3IQQA 4P5OE 3SG6A 3O78A 1B7TZ 1HT9A 1TWOA 1ZACA 2BKHB 2KYFA 4I5KA 1K9PA 4OVNF 1J1DA 2WCEA 5HKZA 3A8RA 2KLEA 1DGVA 1XVJA 1KSMA 2NLNA 2M1UA 1NWDA 2JRFA 4PT1A 3BUWB 1J7PA 2LLUA 3QMEA 4D1EA 2Y5IA 3WHTB 3BUXB 3IF7A 5ER4X 2BKIB 1T14A 1CNPA 2LHLA 2LLTA 4HRGA 4I5JA 2BECA 3CR2A 2LMUA 3OB1B 1A29A 1AHRA 1PK0D 2KDHA 1QX2A 1SL8A 3I5IB 5CSIA 2D8NA 4ZCUA 2GGMA 1JF0A 4JD9A 4GFTA 2KI6C 1K9KA 3PN7B 4UPGA 5HLVA 4CFQA 4E68A 1UURA 1ZMZA 1OZOA 3EKHA 1H4BA 2ZFDA 1G8IA 2BE4A 2JPOA 2E6WA 3FE9A 3D0YA 4NDDA 2MAZA 1IJ6A 4YBHB 5CSNA 1MXEA 1TRFA 3C1VA 1KQMC 1M46A 1D1OA 1Z2CB 1YX8A 2LAPA 2LVJA 2I7AA 1R6PA 1MHOA 2GGZA 1DJYA 2O5GA 4GGFA 4INXA 4GBAA 2FOTA 1QIVA 1SY9A 1IJ5A 3TS5C 3DVEA 2I2RE 5TNCA 5J3XA 3TUYB 1BR4B 4XYNA 2L2CA 3GK4X 3PSRA 3VROA 5EL2A 3OP0A 1QLKA 1NSHA 1DJWA 4U8DA 2L98A 2KOTA 2K8MB 1RROA 2L4HA 4I5LB 1F4QA 1PVAA 1A2XA 4HREE 2MLEC 2BAPA 2BCBA 1XFZO 1OOJA 2O60A 1YUSA 1B4CA 3SJSA 1OOIX 4DIRA 3SG7A 1KFXL 1A03A 4MEWA 3CWGA 1CFFA 1C7VA 1SW8A 1IKUA 1LVCD 4OCIA 1LINA 2KGBC 1K90D 2SASA 3HX4A 4OR9B 1BF5A 4YGCB 3NHIA 3R1PA 1QTXA 4FQOA 1JFKA 1TUZA 1UP5A 2HQ8A 2LV7A 3SS4A 4F7FA 2B1UA 1K8UA 2M0RA 3UNWA 1F70A 4QJ4B 3I5HC 2NZ0A 2LMTA 3BOWA 1BOCA 4MBEA 4P2YB 1XFRA 2JT8A 2KAXA 2JOJA 1NX0A 2H61C 1GGWA 1GGZA 2F2OA 1OOHA 3D75A 2CTNA 4MVFA 4AOMA 3I5HB 2FJUB 4YGBB 3L4LA 5DKNA 1B8RA 1TNQA 2JT0A 3DXLA 4YI9A 4YGAA 1L7ZA 1QV1A 2K61A 2WCHA 1Y6WA 4ETOA 1B1GA 1JBAA 5I94A 2F8PA 5AANA 3B88A 1KWOC 1MWNA 4INWA 1TIZA 3S0DA 2KI4C 4AQJA 2ZNEA 2K0JA 1WDCC 2CNPA 2LUXA 3K1EA 2CXJA 4HRHA 1WLMA 2L5YA 1K96A 1RECA 2LHIA 2NCPA 3BXKA 4PE4A 5KU1A 2CT9A 1BMOA 1J1EA 1VRKA 3BUMB 1SKTA 1V1FA 3CZ1A 1C7WA 1YUTA 1CDMA 2FJYA 1KFUS 3IQOA 2KI4B 1L2OC 1M63B 3GK1A 4JWQA 1W7JB 1K93D 1NCYA 2BBNA 2KFFA 2M97A 2LP2A 1WRZA 3FWBA 3MSEB 2K7BA 5DICA 2QEBA 2FCDA 3BOWB 2F3YA 3NSKA 2ISDA 1IH0A 1SL7A 2LM5A 3TZ1A 5D69A 4KYNA 2MBXA 2MJWB 2K2FA 2KBMA 1ALVA 1GQMA 2PVBA 3FE8A 5FI2A 1L2OB 2KLDA 5B8IB 1BODA 1M31A 1JF2A 2JNXA 2WC5A 1CDNA 1CFDA 4PALA 2GV5A 5HYDA 4N5XA 4PHMA 1CFPA 3HCMA 3TDIA 1J7RA 1YRTB 3NXAA 5HL1A 1NX1A 4MZKA 3UO9A 3DF0A 3PLFB 4GAOA 1RFJA 2P6BB 1OOFA 2EC6C 4WQ3A 1CM4A 5FI7A 1PRWA 1YVHA 2KAYA 2P71A 1DJHA 2WC6A 3O6BA 2PQLA 1Y1XA 1RWYA 1DJZA 1K94A 1MF8B 3KHEA 1A4PA 2COLB 2L0PA 2EC6B 1BT6A 1G33A 4WRIA 1G4YR 3I5FC 2JZIA 1NPQA 2M1KB 2PMYA 1KSOA 3PFVA 4N1GA 1CM1A 3OB2B 4Q04A 4R1EA 1AUIB 3NSOA 1CLBA 1QASA 1NIWA 3LLEA 1UHHA 4JPZB 2H8VA 3NSIA 3SG4A 3O2PA 2LANA 1AJ5A 4A4BA 3GK2A 1U5IA 1QATA 1N2DA 2WCLA 2LMVA 2PALA 2M9GA 1PVBA 3D10A 1YURA 1QJTA 2LNKA 1SR6C 3NGVA 3BYAA 2SCPA 5G08A 1KK7Z 1AVSA 3FWCA 4DUQA 2WCFA 1DQEA 2L50A 2MRDA 3TDUA 2KGRA 1JFJA 3BFBA 1WRLA 2H2KA 1DJGA 1DVIA 2LVIA 2KFGA 2TN4A 3CDNA 3BFAA 3WXAA 1KQMB 1NYAA 1AP4A 1J7OA 3Q8IA 4F0ZB 3SG2A 3LCPC 1B8CA 1F54A 1V1GA 3CS1A 1W9ZA 3VRNA 2BBMA 3SS5A 2RGIA 1NX2A 2WCKA 3TS5B 1EG3A 2JTTA 3OX5A 3RM1A 1H8BA 3CZ2A 1N65A 3OX6A 1NP8A 1SNLA 2WCBA 1JC2A 1SK6D 2JC2A 2A4JA 1RJVA 1XFVO 2MLFC 2K7OA 1TNWA 2KBIA 1UHKA 3BUNB 3O4YA 4M2QA 5I2QA 3RZSA 3PM8A 2QEVA 1FPWA 2FCEA 4DRWA 3FE6A 3L4AA 4PCWA 1CKKA 1TCOB 1XFXO 1MR8A 3R1VA 1Y1AA 3H4SE 4CFRA 3WNXB 1JUOA 2JTZA 3PM2A 1EG4A 4GGFC 3D0YB 1A75A 2LC5A 1NCZA 2OS8C 1B8LA 3I5GC 3O4XA 1M45A 1ALWA 3CGAA 2M7LA 1B9AA 4FQTA 1XYDA 2WNDA 2WORA 2OS8B 3EKJA 1UUSA 3D78A 4USLA 3OHMB 1SYMA 4ZCVA 2WCMA 3V2LA 1DJXA 2EHBA 1HQVA 1WY9A 1S36A 4TNCA 2MHHA 1BG1A 2L2EA 4GUKA 3N7HA 1XO5A 1WRKA 5AERA 3CR4X 2PASA 3OBVA 1LA0A 1QV0A 2LLSA 3B6XA 3B86A 1EXRA 3VB1A 2PYQA 3DVJA 3KO0A 3E3RA 3DZTA 1AK8A 4PE1A 1JWDA 1UHJA 4YI8A 1RK9A 4BY5A 2ZRTA 2Y4QA 5HKYA 2KSPA 2Y1NA 1NUBA 4MN0A 2BNXA 1EH2A 3FIAA 1TN4A 1SMGA 1UWOA 2ERBA 5CPVA 3DVKA 4GPLB 2VRGA 4MRXA 1CTRA 5FI6A 1SRAA 1KCYA 1KWOB 2I18A 1M39A 1KK7Y 1DT7B 2ZKMX 4OKHA 3EK8A 3EVUA 4ORBB 1WDCB 4YGEB 2JULA 2KYCA 3CYZA 2QPTA 2E30A 3M0WA 2JU0A 4PHNA 1KFUL 2WCJA 5AEQA 4DS7A 2F33A 1YRUB 2MA2A 1QXPA 1YUUA 3KEVA 5GQQC 2K60A 5IBWA 3BUOB 1PSBA 2KQ6A 2P70A 2K2AA 2L5XB 3LK0A 5HKWA 4YRUA 1SPYA 1UHNA 4ICBA 1TOPA 3QRXA 4JKTA 1DTLA 1XK4A 1FW4A 1S6CA 2BL0C 2JQ6A 4PHKA 1IQ3A 1BLQA 1CLMA 1PSRA 2KQYA 2QACA 1XFWO 1F55A 5FYXA 2LCPA 1S1EA 1SL9A 2Q4UA 1RTP1 1XFUO 3SG3A 3TDZA 5PALA 4CPVA 1JSAA 2WOSA 2Q91A 3BJHA 1IRJA 4C0LA 1QS7A 1EL4A 1PALA 2LP3A 1KQVA 1N0YA 1CDPA 4PHJA 2L4IA 3B87A 1S3PA 4PE0A
chains in the Genus database with same CATH topology
5F6TA 3EVVA 2JWWA 3I5FB 4OV2A 3KPXA 1XK4C 2L51A 3AKBA 3ZNIA 1ZUZA 2KFHA 2OPOA 2Y1MA 4MRYA 4C0KA 1S5GZ 1WLZA 4MLWA 5ER5A 1XA5A 3I5IC 2KAVA 1E8AA 1OQPA 3DF0B 5CSJA 4PDZA 1EJ3A 2G9BA 4NDBA 1Y0VH 5KSZA 3CLNA 2JNFA 2K7CA 3PN7C 3ZWHA 1BJFA 2AAOA 4CIDA 1SR6B 4NDCA 1QVIY 3CR5X 4GNKB 2I94A 3PATA 1FI6A 1K2HA 5JJGA 4WQ2A 3FS7A 1SBJA 1S26D 1TNXA 2F2PA 5D7FA 4ORCB 2WC8A 1IWQA 2DOQA 3VRPA 1ODBA 1K95A 4NQGA 1QX5B 3EK4A 2HQWA 2M3WA 1IGVA 2PSRA 4YGDB 1TNPA 3TUYC 1F4OA 2F3ZA 1W7IB 2CCMA 1DF0A 1ZFSA 2ZRSA 1CMFA 3GOFA 3LK1A 3CZTX 5I2LA 1XFYO 1U5IB 2BCXA 1Y1UA 4PE7A 4N1FA 3AAJA 1IG5A 2M29A 2R2IA 1LKJA 1K9UA 1GJYA 3F45A 1CLLA 1OMRA 1MUXA 1ZOTB 1OZSA 1DJIA 2H61A 1QLSA 4MZJA 3KF9A 1KFXS 2M7NA 1OMVA 4DCKA 2K7DA 3NSLA 2AMIA 2ZNDA 3I5GB 3PALA 1CFCA 1J7QA 4C0JA 4JQ0D 1OSAA 2NCOA 5DKRA 5HLOA 1MQ1A 2LUCA 1S6JA 1YR5A 1DGUA 1TCFA 2ZN9A 2KNEA 1B7TY 1DF0B 1SCVA 1MXLC 2OTGC 1NCXA 1FI5A 1SCMC 4BY4A 2JPTA 4MZLA 2V53A 2PRUA 5CSFA 4FTGA 4MSPA 2JXCA 1CMGA 1B47A 1AJ4A 1OE9B 1S5GY 3DVMA 4HSZA 1NX3A 4A4CA 1QVIZ 1A75B 1R2UA 4XJKA 1CB1A 2HETA 5JOLA 2AUCA 3SIAA 2OTGB 2M49B 1SCMB 1FF1A 3VRRA 3DD4A 2KI6D 3CTNA 3JTDC 3VRQA 5I2OA 1Q80A 4GGNA 3AKAA 4ORAB 3RLZA 1F8HA 2KHNA 1PULA 1DMOA 4I5NB 1LA3A 5DKQA 3WHUB 1X02A 3JTDB 4CLNA 1KK8C 1OMDA 2CBLA 5BPJA 2JXLA 4QJ5B 1IQ5A 5AFPA 1TTXA 3JVTC 3EK7A 2IS9A 4L9MA 5I8NA 3BQ3A 1S6IA 3EVRA 1CDLA 3LL8B 2HPSA 1KK8B 1FBVA 4AQIA 2HF5A 4M2OA 1YX7A 2JT3A 2NXQA 3A4UB 3K21A 1YTZC 3JVTB 3AAKA 5KTYA 3VGOA 1LXFC 1QX7A 2BL0B 3SG5A 1BU3A 2M8UA 2LVVA 2LE9B 4XJKB 1BR1B 1F71A 1QIWA 1J55A 3ICBA 4IL1A 2BCAA 4QJ3B 3SIBA 2EGDA 2G2BA 5AXIA 1C07A 5K89A 4M2PA 1YVLA 2ZN8A 1UHIA 2BE6A 2LVKA 3IQQA 4P5OE 3SG6A 3O78A 1B7TZ 1HT9A 1ZACA 2BKHB 2KYFA 4I5KA 1K9PA 4OVNF 1J1DA 2WCEA 5HKZA 3A8RA 1DGVA 1XVJA 1KSMA 2NLNA 2M1UA 1NWDA 2JRFA 3BUWB 1J7PA 2LLUA 4D1EA 2Y5IA 3WHTB 3BUXB 3IF7A 5ER4X 2BKIB 1CNPA 2LHLA 2LLTA 4HRGA 4I5JA 2BECA 3CR2A 2LMUA 3OB1B 1A29A 1AHRA 1PK0D 2KDHA 1QX2A 1SL8A 3I5IB 5CSIA 2D8NA 4ZCUA 2GGMA 1JF0A 4GFTA 2KI6C 1K9KA 3PN7B 4UPGA 5HLVA 4CFQA 4E68A 1UURA 1ZMZA 1OZOA 3EKHA 1H4BA 2ZFDA 1G8IA 2BE4A 4NDDA 2E6WA 3D0YA 2MAZA 1IJ6A 4YBHB 5CSNA 1MXEA 1TRFA 3C1VA 1KQMC 1M46A 1D1OA 1YX8A 2LAPA 2LVJA 2I7AA 1R6PA 1MHOA 2GGZA 1DJYA 2O5GA 4GGFA 4GBAA 2FOTA 1QIVA 1SY9A 1IJ5A 3TS5C 3DVEA 2I2RE 5TNCA 5J3XA 3TUYB 1BR4B 4XYNA 3GK4X 3PSRA 3VROA 3OP0A 1QLKA 1NSHA 1DJWA 4U8DA 2L98A 2KOTA 2K8MB 1RROA 2L4HA 4I5LB 1F4QA 1PVAA 1A2XA 4HREE 2MLEC 2BCBA 1XFZO 1OOJA 2O60A 1YUSA 1B4CA 3SJSA 4DIRA 3SG7A 1KFXL 1A03A 4MEWA 3CWGA 1CFFA 1C7VA 1SW8A 1IKUA 1LVCD 4OCIA 1LINA 2KGBC 1K90D 2SASA 3HX4A 4OR9B 1BF5A 4YGCB 1QTXA 4FQOA 1JFKA 1UP5A 2HQ8A 2LV7A 2B1UA 1K8UA 2M0RA 1F70A 4QJ4B 3I5HC 2NZ0A 2LMTA 3BOWA 1BOCA 4MBEA 4P2YB 2JT8A 2KAXA 2JOJA 1NX0A 2H61C 1GGWA 1GGZA 2F2OA 2CTNA 4MVFA 4AOMA 3I5HB 2FJUB 4YGBB 5DKNA 1B8RA 1TNQA 2JT0A 4YI9A 4YGAA 1L7ZA 1QV1A 2K61A 1Y6WA 4ETOA 1B1GA 1JBAA 2F8PA 5AANA 1KWOC 1MWNA 1TIZA 4AQJA 2KI4C 2ZNEA 2K0JA 1WDCC 2CNPA 2LUXA 4HRHA 2CXJA 4PE4A 1WLMA 1K96A 1RECA 2LHIA 2NCPA 3BXKA 5KU1A 2CT9A 1BMOA 1J1EA 1VRKA 3BUMB 1SKTA 1V1FA 1C7WA 1YUTA 1CDMA 3IQOA 1KFUS 2KI4B 1L2OC 1M63B 3GK1A 4JWQA 1W7JB 1K93D 1NCYA 2BBNA 2KFFA 2M97A 2LP2A 1WRZA 3FWBA 3MSEB 2K7BA 3BOWB 2FCDA 3NSKA 2F3YA 2ISDA 1IH0A 1SL7A 2LM5A 3TZ1A 5D69A 2MBXA 2MJWB 2K2FA 2KBMA 1ALVA 1GQMA 2PVBA 5B8IB 1L2OB 1BODA 1M31A 1JF2A 2JNXA 1CDNA 1CFDA 4PALA 2GV5A 5HYDA 4N5XA 4PHMA 1CFPA 3HCMA 3TDIA 1J7RA 1YRTB 3NXAA 1NX1A 4MZKA 3DF0A 3PLFB 4GAOA 1RFJA 2P6BB 2EC6C 4WQ3A 1CM4A 1PRWA 1YVHA 2KAYA 1DJHA 3O6BA 1Y1XA 1RWYA 1DJZA 1K94A 1MF8B 3KHEA 1A4PA 2COLB 2L0PA 2EC6B 1BT6A 1G33A 4WRIA 1G4YR 3I5FC 2JZIA 1NPQA 2M1KB 2PMYA 1KSOA 3PFVA 4N1GA 1CM1A 3OB2B 4Q04A 4R1EA 1AUIB 3NSOA 1CLBA 1QASA 1NIWA 3LLEA 1UHHA 4JPZB 3NSIA 3SG4A 3O2PA 2LANA 1AJ5A 4A4BA 3GK2A 1U5IA 1QATA 1N2DA 2LMVA 2PALA 2M9GA 1PVBA 3D10A 1YURA 1QJTA 2LNKA 1SR6C 3BYAA 2SCPA 5G08A 1KK7Z 1AVSA 3FWCA 4DUQA 2WCFA 2L50A 2MRDA 3TDUA 2KGRA 1JFJA 1WRLA 2H2KA 1DJGA 1DVIA 2LVIA 2KFGA 2TN4A 1AP4A 3WXAA 1KQMB 1NYAA 1J7OA 4F0ZB 3SG2A 3LCPC 1B8CA 1F54A 1V1GA 3CS1A 3VRNA 2BBMA 2RGIA 1NX2A 3TS5B 1EG3A 2JTTA 3OX5A 3RM1A 1H8BA 1N65A 3OX6A 1NP8A 1SNLA 2WCBA 1JC2A 1SK6D 2JC2A 2A4JA 1RJVA 1XFVO 2MLFC 2K7OA 1TNWA 2KBIA 1UHKA 3BUNB 3O4YA 4M2QA 5I2QA 3PM8A 1FPWA 2FCEA 4DRWA 4PCWA 1CKKA 1TCOB 1XFXO 1MR8A 1Y1AA 3H4SE 4CFRA 3WNXB 1JUOA 2JTZA 1EG4A 4GGFC 3D0YB 1A75A 2LC5A 1NCZA 2OS8C 1B8LA 3I5GC 1M45A 1ALWA 3CGAA 2M7LA 1B9AA 1XYDA 2WNDA 2WORA 2OS8B 3EKJA 1UUSA 4USLA 3OHMB 1SYMA 4ZCVA 1DJXA 2EHBA 1HQVA 1WY9A 1S36A 4TNCA 2MHHA 1BG1A 2L2EA 4GUKA 1XO5A 1WRKA 5AERA 3CR4X 2PASA 1LA0A 1QV0A 2LLSA 1EXRA 3DVJA 3KO0A 3E3RA 1AK8A 4PE1A 1JWDA 1UHJA 4YI8A 1RK9A 4BY5A 2ZRTA 2Y4QA 5HKYA 2KSPA 2Y1NA 1NUBA 4MN0A 1EH2A 3FIAA 1TN4A 1SMGA 1UWOA 5CPVA 3DVKA 4GPLB 2VRGA 4MRXA 1CTRA 1KCYA 1SRAA 1KWOB 2I18A 1M39A 1KK7Y 1DT7B 2ZKMX 4OKHA 3EK8A 3EVUA 4ORBB 1WDCB 4YGEB 2JULA 2KYCA 2QPTA 2E30A 3M0WA 2JU0A 4PHNA 1KFUL 5AEQA 4DS7A 2F33A 1YRUB 2MA2A 1QXPA 1YUUA 3KEVA 5GQQC 5IBWA 3BUOB 1PSBA 2KQ6A 2K2AA 2L5XB 3LK0A 5HKWA 4YRUA 1SPYA 1UHNA 4ICBA 1TOPA 3QRXA 1DTLA 1XK4A 1FW4A 1S6CA 2BL0C 2JQ6A 4PHKA 1IQ3A 1BLQA 1CLMA 1PSRA 2KQYA 2QACA 1XFWO 1F55A 5FYXA 2LCPA 1S1EA 1SL9A 2Q4UA 1RTP1 1XFUO 3SG3A 3TDZA 5PALA 4CPVA 1JSAA 2WOSA 2Q91A 1IRJA 4C0LA 1QS7A 1EL4A 1PALA 2LP3A 1KQVA 1N0YA 1CDPA 4PHJA 2L4IA 1S3PA 4PE0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F6T A;  3EVV A;  2JWW A;  3I5F B;  4OV2 A;  3KPX A;  1XK4 C;  2L51 A;  3AKB A;  3ZNI A;  1ZUZ A;  2KFH A;  2OPO A;  2Y1M A;  4MRY A;  4C0K A;  1S5G Z;  1WLZ A;  4MLW A;  5ER5 A;  1XA5 A;  3I5I C;  2KAV A;  1E8A A;  1OQP A;  3DF0 B;  5CSJ A;  4PDZ A;  1EJ3 A;  2G9B A;  4NDB A;  1Y0V H;  5KSZ A;  3CLN A;  2JNF A;  2K7C A;  3PN7 C;  3ZWH A;  1BJF A;  2AAO A;  4CID A;  1SR6 B;  4NDC A;  1QVI Y;  3CR5 X;  4GNK B;  2I94 A;  3PAT A;  1FI6 A;  1K2H A;  5JJG A;  4WQ2 A;  3FS7 A;  1SBJ A;  1S26 D;  1TNX A;  2F2P A;  5D7F A;  4ORC B;  2WC8 A;  1IWQ A;  2DOQ A;  3VRP A;  1ODB A;  1K95 A;  4NQG A;  1QX5 B;  3EK4 A;  2HQW A;  2M3W A;  1IGV A;  2PSR A;  4YGD B;  1TNP A;  3TUY C;  1F4O A;  2F3Z A;  1W7I B;  2CCM A;  1DF0 A;  1ZFS A;  2ZRS A;  1CMF A;  3GOF A;  3LK1 A;  3CZT X;  5I2L A;  1XFY O;  1U5I B;  2BCX A;  1Y1U A;  4PE7 A;  4N1F A;  3AAJ A;  1IG5 A;  2M29 A;  2R2I A;  1LKJ A;  1K9U A;  1GJY A;  3F45 A;  1CLL A;  1OMR A;  1MUX A;  1ZOT B;  1OZS A;  1DJI A;  2H61 A;  1QLS A;  4MZJ A;  3KF9 A;  1KFX S;  2M7N A;  1OMV A;  4DCK A;  2K7D A;  3NSL A;  2AMI A;  2ZND A;  3I5G B;  3PAL A;  1CFC A;  1J7Q A;  4C0J A;  4JQ0 D;  1OSA A;  2NCO A;  5DKR A;  5HLO A;  1MQ1 A;  2LUC A;  1S6J A;  1YR5 A;  1DGU A;  1TCF A;  2ZN9 A;  2KNE A;  1B7T Y;  1DF0 B;  1SCV A;  1MXL C;  2OTG C;  1NCX A;  1FI5 A;  1SCM C;  4BY4 A;  2JPT A;  4MZL A;  2V53 A;  2PRU A;  5CSF A;  4FTG A;  4MSP A;  2JXC A;  1CMG A;  1B47 A;  1AJ4 A;  1OE9 B;  1S5G Y;  3DVM A;  4HSZ A;  1NX3 A;  4A4C A;  1QVI Z;  1A75 B;  1R2U A;  4XJK A;  1CB1 A;  2HET A;  5JOL A;  2AUC A;  3SIA A;  2OTG B;  2M49 B;  1SCM B;  1FF1 A;  3VRR A;  3DD4 A;  2KI6 D;  3CTN A;  3JTD C;  3VRQ A;  5I2O A;  1Q80 A;  4GGN A;  3AKA A;  4ORA B;  3RLZ A;  1F8H A;  2KHN A;  1PUL A;  1DMO A;  4I5N B;  1LA3 A;  5DKQ A;  3WHU B;  1X02 A;  3JTD B;  4CLN A;  1KK8 C;  1OMD A;  2CBL A;  5BPJ A;  2JXL A;  4QJ5 B;  1IQ5 A;  5AFP A;  1TTX A;  3JVT C;  3EK7 A;  2IS9 A;  4L9M A;  5I8N A;  3BQ3 A;  1S6I A;  3EVR A;  1CDL A;  3LL8 B;  2HPS A;  1KK8 B;  1FBV A;  4AQI A;  2HF5 A;  4M2O A;  1YX7 A;  2JT3 A;  2NXQ A;  3A4U B;  3K21 A;  1YTZ C;  3JVT B;  3AAK A;  5KTY A;  3VGO A;  1LXF C;  1QX7 A;  2BL0 B;  3SG5 A;  1BU3 A;  2M8U A;  2LVV A;  2LE9 B;  4XJK B;  1BR1 B;  1F71 A;  1QIW A;  1J55 A;  3ICB A;  4IL1 A;  2BCA A;  4QJ3 B;  3SIB A;  2EGD A;  2G2B A;  5AXI A;  1C07 A;  5K89 A;  4M2P A;  1YVL A;  2ZN8 A;  1UHI A;  2BE6 A;  2LVK A;  3IQQ A;  4P5O E;  3SG6 A;  3O78 A;  1B7T Z;  1HT9 A;  1ZAC A;  2BKH B;  2KYF A;  4I5K A;  1K9P A;  4OVN F;  1J1D A;  2WCE A;  5HKZ A;  3A8R A;  1DGV A;  1XVJ A;  1KSM A;  2NLN A;  2M1U A;  1NWD A;  2JRF A;  3BUW B;  1J7P A;  2LLU A;  4D1E A;  2Y5I A;  3WHT B;  3BUX B;  3IF7 A;  5ER4 X;  2BKI B;  1CNP A;  2LHL A;  2LLT A;  4HRG A;  4I5J A;  2BEC A;  3CR2 A;  2LMU A;  3OB1 B;  1A29 A;  1AHR A;  1PK0 D;  2KDH A;  1QX2 A;  1SL8 A;  3I5I B;  5CSI A;  2D8N A;  4ZCU A;  2GGM A;  1JF0 A;  4GFT A;  2KI6 C;  1K9K A;  3PN7 B;  4UPG A;  5HLV A;  4CFQ A;  4E68 A;  1UUR A;  1ZMZ A;  1OZO A;  3EKH A;  1H4B A;  2ZFD A;  1G8I A;  2BE4 A;  4NDD A;  2E6W A;  3D0Y A;  2MAZ A;  1IJ6 A;  4YBH B;  5CSN A;  1MXE A;  1TRF A;  3C1V A;  1KQM C;  1M46 A;  1D1O A;  1YX8 A;  2LAP A;  2LVJ A;  2I7A A;  1R6P A;  1MHO A;  2GGZ A;  1DJY A;  2O5G A;  4GGF A;  4GBA A;  2FOT A;  1QIV A;  1SY9 A;  1IJ5 A;  3TS5 C;  3DVE A;  2I2R E;  5TNC A;  5J3X A;  3TUY B;  1BR4 B;  4XYN A;  3GK4 X;  3PSR A;  3VRO A;  3OP0 A;  1QLK A;  1NSH A;  1DJW A;  4U8D A;  2L98 A;  2KOT A;  2K8M B;  1RRO A;  2L4H A;  4I5L B;  1F4Q A;  1PVA A;  1A2X A;  4HRE E;  2MLE C;  2BCB A;  1XFZ O;  1OOJ A;  2O60 A;  1YUS A;  1B4C A;  3SJS A;  4DIR A;  3SG7 A;  1KFX L;  1A03 A;  4MEW A;  3CWG A;  1CFF A;  1C7V A;  1SW8 A;  1IKU A;  1LVC D;  4OCI A;  1LIN A;  2KGB C;  1K90 D;  2SAS A;  3HX4 A;  4OR9 B;  1BF5 A;  4YGC B;  1QTX A;  4FQO A;  1JFK A;  1UP5 A;  2HQ8 A;  2LV7 A;  2B1U A;  1K8U A;  2M0R A;  1F70 A;  4QJ4 B;  3I5H C;  2NZ0 A;  2LMT A;  3BOW A;  1BOC A;  4MBE A;  4P2Y B;  2JT8 A;  2KAX A;  2JOJ A;  1NX0 A;  2H61 C;  1GGW A;  1GGZ A;  2F2O A;  2CTN A;  4MVF A;  4AOM A;  3I5H B;  2FJU B;  4YGB B;  5DKN A;  1B8R A;  1TNQ A;  2JT0 A;  4YI9 A;  4YGA A;  1L7Z A;  1QV1 A;  2K61 A;  1Y6W A;  4ETO A;  1B1G A;  1JBA A;  2F8P A;  5AAN A;  1KWO C;  1MWN A;  1TIZ A;  4AQJ A;  2KI4 C;  2ZNE A;  2K0J A;  1WDC C;  2CNP A;  2LUX A;  4HRH A;  2CXJ A;  4PE4 A;  1WLM A;  1K96 A;  1REC A;  2LHI A;  2NCP A;  3BXK A;  5KU1 A;  2CT9 A;  1BMO A;  1J1E A;  1VRK A;  3BUM B;  1SKT A;  1V1F A;  1C7W A;  1YUT A;  1CDM A;  3IQO A;  1KFU S;  2KI4 B;  1L2O C;  1M63 B;  3GK1 A;  4JWQ A;  1W7J B;  1K93 D;  1NCY A;  2BBN A;  2KFF A;  2M97 A;  2LP2 A;  1WRZ A;  3FWB A;  3MSE B;  2K7B A;  3BOW B;  2FCD A;  3NSK A;  2F3Y A;  2ISD A;  1IH0 A;  1SL7 A;  2LM5 A;  3TZ1 A;  5D69 A;  2MBX A;  2MJW B;  2K2F A;  2KBM A;  1ALV A;  1GQM A;  2PVB A;  5B8I B;  1L2O B;  1BOD A;  1M31 A;  1JF2 A;  2JNX A;  1CDN A;  1CFD A;  4PAL A;  2GV5 A;  5HYD A;  4N5X A;  4PHM A;  1CFP A;  3HCM A;  3TDI A;  1J7R A;  1YRT B;  3NXA A;  1NX1 A;  4MZK A;  3DF0 A;  3PLF B;  4GAO A;  1RFJ A;  2P6B B;  2EC6 C;  4WQ3 A;  1CM4 A;  1PRW A;  1YVH A;  2KAY A;  1DJH A;  3O6B A;  1Y1X A;  1RWY A;  1DJZ A;  1K94 A;  1MF8 B;  3KHE A;  1A4P A;  2COL B;  2L0P A;  2EC6 B;  1BT6 A;  1G33 A;  4WRI A;  1G4Y R;  3I5F C;  2JZI A;  1NPQ A;  2M1K B;  2PMY A;  1KSO A;  3PFV A;  4N1G A;  1CM1 A;  3OB2 B;  4Q04 A;  4R1E A;  1AUI B;  3NSO A;  1CLB A;  1QAS A;  1NIW A;  3LLE A;  1UHH A;  4JPZ B;  3NSI A;  3SG4 A;  3O2P A;  2LAN A;  1AJ5 A;  4A4B A;  3GK2 A;  1U5I A;  1QAT A;  1N2D A;  2LMV A;  2PAL A;  2M9G A;  1PVB A;  3D10 A;  1YUR A;  1QJT A;  2LNK A;  1SR6 C;  3BYA A;  2SCP A;  5G08 A;  1KK7 Z;  1AVS A;  3FWC A;  4DUQ A;  2WCF A;  2L50 A;  2MRD A;  3TDU A;  2KGR A;  1JFJ A;  1WRL A;  2H2K A;  1DJG A;  1DVI A;  2LVI A;  2KFG A;  2TN4 A;  1AP4 A;  3WXA A;  1KQM B;  1NYA A;  1J7O A;  4F0Z B;  3SG2 A;  3LCP C;  1B8C A;  1F54 A;  1V1G A;  3CS1 A;  3VRN A;  2BBM A;  2RGI A;  1NX2 A;  3TS5 B;  1EG3 A;  2JTT A;  3OX5 A;  3RM1 A;  1H8B A;  1N65 A;  3OX6 A;  1NP8 A;  1SNL A;  2WCB A;  1JC2 A;  1SK6 D;  2JC2 A;  2A4J A;  1RJV A;  1XFV O;  2MLF C;  2K7O A;  1TNW A;  2KBI A;  1UHK A;  3BUN B;  3O4Y A;  4M2Q A;  5I2Q A;  3PM8 A;  1FPW A;  2FCE A;  4DRW A;  4PCW A;  1CKK A;  1TCO B;  1XFX O;  1MR8 A;  1Y1A A;  3H4S E;  4CFR A;  3WNX B;  1JUO A;  2JTZ A;  1EG4 A;  4GGF C;  3D0Y B;  1A75 A;  2LC5 A;  1NCZ A;  2OS8 C;  1B8L A;  3I5G C;  1M45 A;  1ALW A;  3CGA A;  2M7L A;  1B9A A;  1XYD A;  2WND A;  2WOR A;  2OS8 B;  3EKJ A;  1UUS A;  4USL A;  3OHM B;  1SYM A;  4ZCV A;  1DJX A;  2EHB A;  1HQV A;  1WY9 A;  1S36 A;  4TNC A;  2MHH A;  1BG1 A;  2L2E A;  4GUK A;  1XO5 A;  1WRK A;  5AER A;  3CR4 X;  2PAS A;  1LA0 A;  1QV0 A;  2LLS A;  1EXR A;  3DVJ A;  3KO0 A;  3E3R A;  1AK8 A;  4PE1 A;  1JWD A;  1UHJ A;  4YI8 A;  1RK9 A;  4BY5 A;  2ZRT A;  2Y4Q A;  5HKY A;  2KSP A;  2Y1N A;  1NUB A;  4MN0 A;  1EH2 A;  3FIA A;  1TN4 A;  1SMG A;  1UWO A;  5CPV A;  3DVK A;  4GPL B;  2VRG A;  4MRX A;  1CTR A;  1KCY A;  1SRA A;  1KWO B;  2I18 A;  1M39 A;  1KK7 Y;  1DT7 B;  2ZKM X;  4OKH A;  3EK8 A;  3EVU A;  4ORB B;  1WDC B;  4YGE B;  2JUL A;  2KYC A;  2QPT A;  2E30 A;  3M0W A;  2JU0 A;  4PHN A;  1KFU L;  5AEQ A;  4DS7 A;  2F33 A;  1YRU B;  2MA2 A;  1QXP A;  1YUU A;  3KEV A;  5GQQ C;  5IBW A;  3BUO B;  1PSB A;  2KQ6 A;  2K2A A;  2L5X B;  3LK0 A;  5HKW A;  4YRU A;  1SPY A;  1UHN A;  4ICB A;  1TOP A;  3QRX A;  1DTL A;  1XK4 A;  1FW4 A;  1S6C A;  2BL0 C;  2JQ6 A;  4PHK A;  1IQ3 A;  1BLQ A;  1CLM A;  1PSR A;  2KQY A;  2QAC A;  1XFW O;  1F55 A;  5FYX A;  2LCP A;  1S1E A;  1SL9 A;  2Q4U A;  1RTP 1;  1XFU O;  3SG3 A;  3TDZ A;  5PAL A;  4CPV A;  1JSA A;  2WOS A;  2Q91 A;  1IRJ A;  4C0L A;  1QS7 A;  1EL4 A;  1PAL A;  2LP3 A;  1KQV A;  1N0Y A;  1CDP A;  4PHJ A;  2L4I A;  1S3P A;  4PE0 A; 
#chains in the Genus database with same CATH topology
 5F6T A;  3EVV A;  2JWW A;  3I5F B;  4OV2 A;  3KPX A;  1XK4 C;  2L51 A;  3AKB A;  3ZNI A;  1ZUZ A;  2KFH A;  2OPO A;  2Y1M A;  4MRY A;  4C0K A;  1S5G Z;  1WLZ A;  4MLW A;  5ER5 A;  1XA5 A;  2GTE A;  3I5I C;  2KAV A;  1E8A A;  1OQP A;  3DF0 B;  5CSJ A;  4PDZ A;  1EJ3 A;  2G9B A;  4NDB A;  1Y0V H;  5KSZ A;  3CLN A;  2JNF A;  2K7C A;  3PN7 C;  3R1O A;  3ZWH A;  5D3O A;  1GM0 A;  1BJF A;  2AAO A;  4CID A;  1SR6 B;  4NDC A;  1QVI Y;  3CR5 X;  1OW4 A;  4GNK B;  2I94 A;  1OOG A;  3PAT A;  1C3Y A;  1FI6 A;  1K2H A;  5JJG A;  1QWV A;  4WQ2 A;  3FS7 A;  1SBJ A;  1S26 D;  1TNX A;  2F2P A;  5D7F A;  4ORC B;  2WC8 A;  1IWQ A;  2DOQ A;  3VRP A;  1ODB A;  1K95 A;  4NQG A;  1QX5 B;  3EK4 A;  2HQW A;  2M3W A;  1IGV A;  2PSR A;  4YGD B;  1TNP A;  3TUY C;  1F4O A;  2F3Z A;  3SS3 A;  1W7I B;  2CCM A;  1DF0 A;  1C3Z A;  1ZFS A;  2ZRS A;  1CMF A;  3GOF A;  1ORG A;  3LK1 A;  3CZT X;  3S0E A;  5I2L A;  1XFY O;  1U5I B;  3DY9 A;  2BCX A;  1Y1U A;  4PE7 A;  4N1F A;  3AAJ A;  1IG5 A;  2M29 A;  2R2I A;  1LKJ A;  1K9U A;  1GJY A;  3F45 A;  1CLL A;  4OZD A;  1OMR A;  3BFH A;  3CAB A;  1MUX A;  1ZOT B;  1OZS A;  1DJI A;  2H61 A;  1QLS A;  4MZJ A;  3KF9 A;  1KFX S;  2M7N A;  1OMV A;  4DCK A;  2K7D A;  4IJ7 A;  1DEL A;  3NSL A;  2AMI A;  2ZND A;  1IIO A;  3I5G B;  3PAL A;  1CFC A;  1LS8 A;  3R72 A;  1J7Q A;  4C0J A;  1SSE B;  3S0G A;  4JQ0 D;  1OSA A;  2NCO A;  5DKR A;  5HLO A;  1MQ1 A;  3IVT A;  2LUC A;  1S6J A;  1DEK A;  1YR5 A;  2QEH A;  1DGU A;  1TCF A;  3DYE A;  2ZN9 A;  1TUJ A;  1B7T Y;  2KNE A;  1DF0 B;  1SCV A;  3EG5 B;  3OGN A;  1MXL C;  2OTG C;  2QDI A;  1NCX A;  1FI5 A;  1SCM C;  4BY4 A;  2JPT A;  4MZL A;  2V53 A;  2PRU A;  5CSF A;  4FTG A;  4MSP A;  3CZ0 A;  2JXC A;  1CMG A;  1B47 A;  1AJ4 A;  1OE9 B;  1S5G Y;  3DVM A;  4HSZ A;  3D74 A;  3S0A A;  1NX3 A;  3D73 A;  1QVI Z;  4A4C A;  1A75 B;  1R2U A;  4XJK A;  1CB1 A;  2HET A;  5JOL A;  2AUC A;  3SIA A;  2OTG B;  2M49 B;  1SCM B;  1FF1 A;  3VRR A;  3DD4 A;  2KI6 D;  3CTN A;  3JTD C;  3VRQ A;  5I2O A;  1Q80 A;  4GGN A;  3AKA A;  4ORA B;  2YGU A;  3RLZ A;  1F8H A;  2KHN A;  1PUL A;  3NHT A;  1DMO A;  4I5N B;  1LA3 A;  5DKQ A;  3D77 A;  3WHU B;  1X02 A;  3JTD B;  4CLN A;  1KK8 C;  1OMD A;  2CBL A;  5BPJ A;  2JXL A;  4QJ5 B;  1IQ5 A;  5AFP A;  1TTX A;  3JVT C;  3EK7 A;  2IS9 A;  4L9M A;  5I8N A;  3BQ3 A;  1S6I A;  3EVR A;  1CDL A;  3LL8 B;  2HPS A;  1KK8 B;  1FBV A;  4AQI A;  2HF5 A;  4M2O A;  1YX7 A;  2JT3 A;  2NXQ A;  3A4U B;  3D76 A;  3K21 A;  1YTZ C;  3JVT B;  1DC1 A;  3AAK A;  5KTY A;  3VGO A;  2QEO A;  1LXF C;  1QX7 A;  2BL0 B;  3SG5 A;  1BU3 A;  2M8U A;  2LVV A;  2LE9 B;  4XJK B;  1BR1 B;  1Z4H A;  3S0B A;  1F71 A;  1QIW A;  1J55 A;  3ICB A;  3PJI A;  4IL1 A;  2BCA A;  4QJ3 B;  3SIB A;  2EGD A;  2G2B A;  3L47 A;  3S0F A;  5AXI A;  1C07 A;  5K89 A;  4M2P A;  1P28 A;  1YVL A;  2ZN8 A;  1UHI A;  2KPH A;  3B7A A;  2BE6 A;  2LVK A;  3IQQ A;  4P5O E;  3SG6 A;  3O78 A;  1B7T Z;  1HT9 A;  1TWO A;  1ZAC A;  2BKH B;  2KYF A;  4I5K A;  1K9P A;  4OVN F;  1J1D A;  2WCE A;  5HKZ A;  3A8R A;  2KLE A;  1DGV A;  1XVJ A;  1KSM A;  2NLN A;  2M1U A;  1NWD A;  2JRF A;  4PT1 A;  3BUW B;  1J7P A;  2LLU A;  3QME A;  4D1E A;  2Y5I A;  3WHT B;  3BUX B;  3IF7 A;  5ER4 X;  2BKI B;  1T14 A;  1CNP A;  2LHL A;  2LLT A;  4HRG A;  4I5J A;  2BEC A;  3CR2 A;  2LMU A;  3OB1 B;  1A29 A;  1AHR A;  1PK0 D;  2KDH A;  1QX2 A;  1SL8 A;  3I5I B;  5CSI A;  2D8N A;  4ZCU A;  2GGM A;  1JF0 A;  4JD9 A;  4GFT A;  2KI6 C;  1K9K A;  3PN7 B;  4UPG A;  5HLV A;  4CFQ A;  4E68 A;  1UUR A;  1ZMZ A;  1OZO A;  3EKH A;  1H4B A;  2ZFD A;  1G8I A;  2BE4 A;  2JPO A;  2E6W A;  3FE9 A;  3D0Y A;  4NDD A;  2MAZ A;  1IJ6 A;  4YBH B;  5CSN A;  1MXE A;  1TRF A;  3C1V A;  1KQM C;  1M46 A;  1D1O A;  1Z2C B;  1YX8 A;  2LAP A;  2LVJ A;  2I7A A;  1R6P A;  1MHO A;  2GGZ A;  1DJY A;  2O5G A;  4GGF A;  4INX A;  4GBA A;  2FOT A;  1QIV A;  1SY9 A;  1IJ5 A;  3TS5 C;  3DVE A;  2I2R E;  5TNC A;  5J3X A;  3TUY B;  1BR4 B;  4XYN A;  2L2C A;  3GK4 X;  3PSR A;  3VRO A;  5EL2 A;  3OP0 A;  1QLK A;  1NSH A;  1DJW A;  4U8D A;  2L98 A;  2KOT A;  2K8M B;  1RRO A;  2L4H A;  4I5L B;  1F4Q A;  1PVA A;  1A2X A;  4HRE E;  2MLE C;  2BAP A;  2BCB A;  1XFZ O;  1OOJ A;  2O60 A;  1YUS A;  1B4C A;  3SJS A;  1OOI X;  4DIR A;  3SG7 A;  1KFX L;  1A03 A;  4MEW A;  3CWG A;  1CFF A;  1C7V A;  1SW8 A;  1IKU A;  1LVC D;  4OCI A;  1LIN A;  2KGB C;  1K90 D;  2SAS A;  3HX4 A;  4OR9 B;  1BF5 A;  4YGC B;  3NHI A;  3R1P A;  1QTX A;  4FQO A;  1JFK A;  1TUZ A;  1UP5 A;  2HQ8 A;  2LV7 A;  3SS4 A;  4F7F A;  2B1U A;  1K8U A;  2M0R A;  3UNW A;  1F70 A;  4QJ4 B;  3I5H C;  2NZ0 A;  2LMT A;  3BOW A;  1BOC A;  4MBE A;  4P2Y B;  1XFR A;  2JT8 A;  2KAX A;  2JOJ A;  1NX0 A;  2H61 C;  1GGW A;  1GGZ A;  2F2O A;  1OOH A;  3D75 A;  2CTN A;  4MVF A;  4AOM A;  3I5H B;  2FJU B;  4YGB B;  3L4L A;  5DKN A;  1B8R A;  1TNQ A;  2JT0 A;  3DXL A;  4YI9 A;  4YGA A;  1L7Z A;  1QV1 A;  2K61 A;  2WCH A;  1Y6W A;  4ETO A;  1B1G A;  1JBA A;  5I94 A;  2F8P A;  5AAN A;  3B88 A;  1KWO C;  1MWN A;  4INW A;  1TIZ A;  3S0D A;  2KI4 C;  4AQJ A;  2ZNE A;  2K0J A;  1WDC C;  2CNP A;  2LUX A;  3K1E A;  2CXJ A;  4HRH A;  1WLM A;  2L5Y A;  1K96 A;  1REC A;  2LHI A;  2NCP A;  3BXK A;  4PE4 A;  5KU1 A;  2CT9 A;  1BMO A;  1J1E A;  1VRK A;  3BUM B;  1SKT A;  1V1F A;  3CZ1 A;  1C7W A;  1YUT A;  1CDM A;  2FJY A;  1KFU S;  3IQO A;  2KI4 B;  1L2O C;  1M63 B;  3GK1 A;  4JWQ A;  1W7J B;  1K93 D;  1NCY A;  2BBN A;  2KFF A;  2M97 A;  2LP2 A;  1WRZ A;  3FWB A;  3MSE B;  2K7B A;  5DIC A;  2QEB A;  2FCD A;  3BOW B;  2F3Y A;  3NSK A;  2ISD A;  1IH0 A;  1SL7 A;  2LM5 A;  3TZ1 A;  5D69 A;  4KYN A;  2MBX A;  2MJW B;  2K2F A;  2KBM A;  1ALV A;  1GQM A;  2PVB A;  3FE8 A;  5FI2 A;  1L2O B;  2KLD A;  5B8I B;  1BOD A;  1M31 A;  1JF2 A;  2JNX A;  2WC5 A;  1CDN A;  1CFD A;  4PAL A;  2GV5 A;  5HYD A;  4N5X A;  4PHM A;  1CFP A;  3HCM A;  3TDI A;  1J7R A;  1YRT B;  3NXA A;  5HL1 A;  1NX1 A;  4MZK A;  3UO9 A;  3DF0 A;  3PLF B;  4GAO A;  1RFJ A;  2P6B B;  1OOF A;  2EC6 C;  4WQ3 A;  1CM4 A;  5FI7 A;  1PRW A;  1YVH A;  2KAY A;  2P71 A;  1DJH A;  2WC6 A;  3O6B A;  2PQL A;  1Y1X A;  1RWY A;  1DJZ A;  1K94 A;  1MF8 B;  3KHE A;  1A4P A;  2COL B;  2L0P A;  2EC6 B;  1BT6 A;  1G33 A;  4WRI A;  1G4Y R;  3I5F C;  2JZI A;  1NPQ A;  2M1K B;  2PMY A;  1KSO A;  3PFV A;  4N1G A;  1CM1 A;  3OB2 B;  4Q04 A;  4R1E A;  1AUI B;  3NSO A;  1CLB A;  1QAS A;  1NIW A;  3LLE A;  1UHH A;  4JPZ B;  2H8V A;  3NSI A;  3SG4 A;  3O2P A;  2LAN A;  1AJ5 A;  4A4B A;  3GK2 A;  1U5I A;  1QAT A;  1N2D A;  2WCL A;  2LMV A;  2PAL A;  2M9G A;  1PVB A;  3D10 A;  1YUR A;  1QJT A;  2LNK A;  1SR6 C;  3NGV A;  3BYA A;  2SCP A;  5G08 A;  1KK7 Z;  1AVS A;  3FWC A;  4DUQ A;  2WCF A;  1DQE A;  2L50 A;  2MRD A;  3TDU A;  2KGR A;  1JFJ A;  3BFB A;  1WRL A;  2H2K A;  1DJG A;  1DVI A;  2LVI A;  2KFG A;  2TN4 A;  3CDN A;  3BFA A;  3WXA A;  1KQM B;  1NYA A;  1AP4 A;  1J7O A;  3Q8I A;  4F0Z B;  3SG2 A;  3LCP C;  1B8C A;  1F54 A;  1V1G A;  3CS1 A;  1W9Z A;  3VRN A;  2BBM A;  3SS5 A;  2RGI A;  1NX2 A;  2WCK A;  3TS5 B;  1EG3 A;  2JTT A;  3OX5 A;  3RM1 A;  1H8B A;  3CZ2 A;  1N65 A;  3OX6 A;  1NP8 A;  1SNL A;  2WCB A;  1JC2 A;  1SK6 D;  2JC2 A;  2A4J A;  1RJV A;  1XFV O;  2MLF C;  2K7O A;  1TNW A;  2KBI A;  1UHK A;  3BUN B;  3O4Y A;  4M2Q A;  5I2Q A;  3RZS A;  3PM8 A;  2QEV A;  1FPW A;  2FCE A;  4DRW A;  3FE6 A;  3L4A A;  4PCW A;  1CKK A;  1TCO B;  1XFX O;  1MR8 A;  3R1V A;  1Y1A A;  3H4S E;  4CFR A;  3WNX B;  1JUO A;  2JTZ A;  3PM2 A;  1EG4 A;  4GGF C;  3D0Y B;  1A75 A;  2LC5 A;  1NCZ A;  2OS8 C;  1B8L A;  3I5G C;  3O4X A;  1M45 A;  1ALW A;  3CGA A;  2M7L A;  1B9A A;  4FQT A;  1XYD A;  2WND A;  2WOR A;  2OS8 B;  3EKJ A;  1UUS A;  3D78 A;  4USL A;  3OHM B;  1SYM A;  4ZCV A;  2WCM A;  3V2L A;  1DJX A;  2EHB A;  1HQV A;  1WY9 A;  1S36 A;  4TNC A;  2MHH A;  1BG1 A;  2L2E A;  4GUK A;  3N7H A;  1XO5 A;  1WRK A;  5AER A;  3CR4 X;  2PAS A;  3OBV A;  1LA0 A;  1QV0 A;  2LLS A;  3B6X A;  3B86 A;  1EXR A;  3VB1 A;  2PYQ A;  3DVJ A;  3KO0 A;  3E3R A;  3DZT A;  1AK8 A;  4PE1 A;  1JWD A;  1UHJ A;  4YI8 A;  1RK9 A;  4BY5 A;  2ZRT A;  2Y4Q A;  5HKY A;  2KSP A;  2Y1N A;  1NUB A;  4MN0 A;  2BNX A;  1EH2 A;  3FIA A;  1TN4 A;  1SMG A;  1UWO A;  2ERB A;  5CPV A;  3DVK A;  4GPL B;  2VRG A;  4MRX A;  1CTR A;  5FI6 A;  1SRA A;  1KCY A;  1KWO B;  2I18 A;  1M39 A;  1KK7 Y;  1DT7 B;  2ZKM X;  4OKH A;  3EK8 A;  3EVU A;  4ORB B;  1WDC B;  4YGE B;  2JUL A;  2KYC A;  3CYZ A;  2QPT A;  2E30 A;  3M0W A;  2JU0 A;  4PHN A;  1KFU L;  2WCJ A;  5AEQ A;  4DS7 A;  2F33 A;  1YRU B;  2MA2 A;  1QXP A;  1YUU A;  3KEV A;  5GQQ C;  2K60 A;  5IBW A;  3BUO B;  1PSB A;  2KQ6 A;  2P70 A;  2K2A A;  2L5X B;  3LK0 A;  5HKW A;  4YRU A;  1SPY A;  1UHN A;  4ICB A;  1TOP A;  3QRX A;  4JKT A;  1DTL A;  1XK4 A;  1FW4 A;  1S6C A;  2BL0 C;  2JQ6 A;  4PHK A;  1IQ3 A;  1BLQ A;  1CLM A;  1PSR A;  2KQY A;  2QAC A;  1XFW O;  1F55 A;  5FYX A;  2LCP A;  1S1E A;  1SL9 A;  2Q4U A;  1RTP 1;  1XFU O;  3SG3 A;  3TDZ A;  5PAL A;  4CPV A;  1JSA A;  2WOS A;  2Q91 A;  3BJH A;  1IRJ A;  4C0L A;  1QS7 A;  1EL4 A;  1PAL A;  2LP3 A;  1KQV A;  1N0Y A;  1CDP A;  4PHJ A;  2L4I A;  3B87 A;  1S3P A;  4PE0 A; 
#chains in the Genus database with same CATH homology
 5F6T A;  3EVV A;  2JWW A;  3I5F B;  4OV2 A;  3KPX A;  1XK4 C;  2L51 A;  3AKB A;  3ZNI A;  1ZUZ A;  2KFH A;  2OPO A;  2Y1M A;  4MRY A;  4C0K A;  1S5G Z;  1WLZ A;  4MLW A;  5ER5 A;  1XA5 A;  3I5I C;  2KAV A;  1E8A A;  1OQP A;  3DF0 B;  5CSJ A;  4PDZ A;  1EJ3 A;  2G9B A;  4NDB A;  1Y0V H;  5KSZ A;  3CLN A;  2JNF A;  2K7C A;  3PN7 C;  3ZWH A;  1BJF A;  2AAO A;  4CID A;  1SR6 B;  4NDC A;  1QVI Y;  3CR5 X;  4GNK B;  2I94 A;  3PAT A;  1FI6 A;  1K2H A;  5JJG A;  4WQ2 A;  3FS7 A;  1SBJ A;  1S26 D;  1TNX A;  2F2P A;  5D7F A;  4ORC B;  2WC8 A;  1IWQ A;  2DOQ A;  3VRP A;  1ODB A;  1K95 A;  4NQG A;  1QX5 B;  3EK4 A;  2HQW A;  2M3W A;  1IGV A;  2PSR A;  4YGD B;  1TNP A;  3TUY C;  1F4O A;  2F3Z A;  1W7I B;  2CCM A;  1DF0 A;  1ZFS A;  2ZRS A;  1CMF A;  3GOF A;  3LK1 A;  3CZT X;  5I2L A;  1XFY O;  1U5I B;  2BCX A;  1Y1U A;  4PE7 A;  4N1F A;  3AAJ A;  1IG5 A;  2M29 A;  2R2I A;  1LKJ A;  1K9U A;  1GJY A;  3F45 A;  1CLL A;  1OMR A;  1MUX A;  1ZOT B;  1OZS A;  1DJI A;  2H61 A;  1QLS A;  4MZJ A;  3KF9 A;  1KFX S;  2M7N A;  1OMV A;  4DCK A;  2K7D A;  3NSL A;  2AMI A;  2ZND A;  3I5G B;  3PAL A;  1CFC A;  1J7Q A;  4C0J A;  4JQ0 D;  1OSA A;  2NCO A;  5DKR A;  5HLO A;  1MQ1 A;  2LUC A;  1S6J A;  1YR5 A;  1DGU A;  1TCF A;  2ZN9 A;  2KNE A;  1B7T Y;  1DF0 B;  1SCV A;  1MXL C;  2OTG C;  1NCX A;  1FI5 A;  1SCM C;  4BY4 A;  2JPT A;  4MZL A;  2V53 A;  2PRU A;  5CSF A;  4FTG A;  4MSP A;  2JXC A;  1CMG A;  1B47 A;  1AJ4 A;  1OE9 B;  1S5G Y;  3DVM A;  4HSZ A;  1NX3 A;  4A4C A;  1QVI Z;  1A75 B;  1R2U A;  4XJK A;  1CB1 A;  2HET A;  5JOL A;  2AUC A;  3SIA A;  2OTG B;  2M49 B;  1SCM B;  1FF1 A;  3VRR A;  3DD4 A;  2KI6 D;  3CTN A;  3JTD C;  3VRQ A;  5I2O A;  1Q80 A;  4GGN A;  3AKA A;  4ORA B;  3RLZ A;  1F8H A;  2KHN A;  1PUL A;  1DMO A;  4I5N B;  1LA3 A;  5DKQ A;  3WHU B;  1X02 A;  3JTD B;  4CLN A;  1KK8 C;  1OMD A;  2CBL A;  5BPJ A;  2JXL A;  4QJ5 B;  1IQ5 A;  5AFP A;  1TTX A;  3JVT C;  3EK7 A;  2IS9 A;  4L9M A;  5I8N A;  3BQ3 A;  1S6I A;  3EVR A;  1CDL A;  3LL8 B;  2HPS A;  1KK8 B;  1FBV A;  4AQI A;  2HF5 A;  4M2O A;  1YX7 A;  2JT3 A;  2NXQ A;  3A4U B;  3K21 A;  1YTZ C;  3JVT B;  3AAK A;  5KTY A;  3VGO A;  1LXF C;  1QX7 A;  2BL0 B;  3SG5 A;  1BU3 A;  2M8U A;  2LVV A;  2LE9 B;  4XJK B;  1BR1 B;  1F71 A;  1QIW A;  1J55 A;  3ICB A;  4IL1 A;  2BCA A;  4QJ3 B;  3SIB A;  2EGD A;  2G2B A;  5AXI A;  1C07 A;  5K89 A;  4M2P A;  1YVL A;  2ZN8 A;  1UHI A;  2BE6 A;  2LVK A;  3IQQ A;  4P5O E;  3SG6 A;  3O78 A;  1B7T Z;  1HT9 A;  1ZAC A;  2BKH B;  2KYF A;  4I5K A;  1K9P A;  4OVN F;  1J1D A;  2WCE A;  5HKZ A;  3A8R A;  1DGV A;  1XVJ A;  1KSM A;  2NLN A;  2M1U A;  1NWD A;  2JRF A;  3BUW B;  1J7P A;  2LLU A;  4D1E A;  2Y5I A;  3WHT B;  3BUX B;  3IF7 A;  5ER4 X;  2BKI B;  1CNP A;  2LHL A;  2LLT A;  4HRG A;  4I5J A;  2BEC A;  3CR2 A;  2LMU A;  3OB1 B;  1A29 A;  1AHR A;  1PK0 D;  2KDH A;  1QX2 A;  1SL8 A;  3I5I B;  5CSI A;  2D8N A;  4ZCU A;  2GGM A;  1JF0 A;  4GFT A;  2KI6 C;  1K9K A;  3PN7 B;  4UPG A;  5HLV A;  4CFQ A;  4E68 A;  1UUR A;  1ZMZ A;  1OZO A;  3EKH A;  1H4B A;  2ZFD A;  1G8I A;  2BE4 A;  4NDD A;  2E6W A;  3D0Y A;  2MAZ A;  1IJ6 A;  4YBH B;  5CSN A;  1MXE A;  1TRF A;  3C1V A;  1KQM C;  1M46 A;  1D1O A;  1YX8 A;  2LAP A;  2LVJ A;  2I7A A;  1R6P A;  1MHO A;  2GGZ A;  1DJY A;  2O5G A;  4GGF A;  4GBA A;  2FOT A;  1QIV A;  1SY9 A;  1IJ5 A;  3TS5 C;  3DVE A;  2I2R E;  5TNC A;  5J3X A;  3TUY B;  1BR4 B;  4XYN A;  3GK4 X;  3PSR A;  3VRO A;  3OP0 A;  1QLK A;  1NSH A;  1DJW A;  4U8D A;  2L98 A;  2KOT A;  2K8M B;  1RRO A;  2L4H A;  4I5L B;  1F4Q A;  1PVA A;  1A2X A;  4HRE E;  2MLE C;  2BCB A;  1XFZ O;  1OOJ A;  2O60 A;  1YUS A;  1B4C A;  3SJS A;  4DIR A;  3SG7 A;  1KFX L;  1A03 A;  4MEW A;  3CWG A;  1CFF A;  1C7V A;  1SW8 A;  1IKU A;  1LVC D;  4OCI A;  1LIN A;  2KGB C;  1K90 D;  2SAS A;  3HX4 A;  4OR9 B;  1BF5 A;  4YGC B;  1QTX A;  4FQO A;  1JFK A;  1UP5 A;  2HQ8 A;  2LV7 A;  2B1U A;  1K8U A;  2M0R A;  1F70 A;  4QJ4 B;  3I5H C;  2NZ0 A;  2LMT A;  3BOW A;  1BOC A;  4MBE A;  4P2Y B;  2JT8 A;  2KAX A;  2JOJ A;  1NX0 A;  2H61 C;  1GGW A;  1GGZ A;  2F2O A;  2CTN A;  4MVF A;  4AOM A;  3I5H B;  2FJU B;  4YGB B;  5DKN A;  1B8R A;  1TNQ A;  2JT0 A;  4YI9 A;  4YGA A;  1L7Z A;  1QV1 A;  2K61 A;  1Y6W A;  4ETO A;  1B1G A;  1JBA A;  2F8P A;  5AAN A;  1KWO C;  1MWN A;  1TIZ A;  4AQJ A;  2KI4 C;  2ZNE A;  2K0J A;  1WDC C;  2CNP A;  2LUX A;  4HRH A;  2CXJ A;  4PE4 A;  1WLM A;  1K96 A;  1REC A;  2LHI A;  2NCP A;  3BXK A;  5KU1 A;  2CT9 A;  1BMO A;  1J1E A;  1VRK A;  3BUM B;  1SKT A;  1V1F A;  1C7W A;  1YUT A;  1CDM A;  3IQO A;  1KFU S;  2KI4 B;  1L2O C;  1M63 B;  3GK1 A;  4JWQ A;  1W7J B;  1K93 D;  1NCY A;  2BBN A;  2KFF A;  2M97 A;  2LP2 A;  1WRZ A;  3FWB A;  3MSE B;  2K7B A;  3BOW B;  2FCD A;  3NSK A;  2F3Y A;  2ISD A;  1IH0 A;  1SL7 A;  2LM5 A;  3TZ1 A;  5D69 A;  2MBX A;  2MJW B;  2K2F A;  2KBM A;  1ALV A;  1GQM A;  2PVB A;  5B8I B;  1L2O B;  1BOD A;  1M31 A;  1JF2 A;  2JNX A;  1CDN A;  1CFD A;  4PAL A;  2GV5 A;  5HYD A;  4N5X A;  4PHM A;  1CFP A;  3HCM A;  3TDI A;  1J7R A;  1YRT B;  3NXA A;  1NX1 A;  4MZK A;  3DF0 A;  3PLF B;  4GAO A;  1RFJ A;  2P6B B;  2EC6 C;  4WQ3 A;  1CM4 A;  1PRW A;  1YVH A;  2KAY A;  1DJH A;  3O6B A;  1Y1X A;  1RWY A;  1DJZ A;  1K94 A;  1MF8 B;  3KHE A;  1A4P A;  2COL B;  2L0P A;  2EC6 B;  1BT6 A;  1G33 A;  4WRI A;  1G4Y R;  3I5F C;  2JZI A;  1NPQ A;  2M1K B;  2PMY A;  1KSO A;  3PFV A;  4N1G A;  1CM1 A;  3OB2 B;  4Q04 A;  4R1E A;  1AUI B;  3NSO A;  1CLB A;  1QAS A;  1NIW A;  3LLE A;  1UHH A;  4JPZ B;  3NSI A;  3SG4 A;  3O2P A;  2LAN A;  1AJ5 A;  4A4B A;  3GK2 A;  1U5I A;  1QAT A;  1N2D A;  2LMV A;  2PAL A;  2M9G A;  1PVB A;  3D10 A;  1YUR A;  1QJT A;  2LNK A;  1SR6 C;  3BYA A;  2SCP A;  5G08 A;  1KK7 Z;  1AVS A;  3FWC A;  4DUQ A;  2WCF A;  2L50 A;  2MRD A;  3TDU A;  2KGR A;  1JFJ A;  1WRL A;  2H2K A;  1DJG A;  1DVI A;  2LVI A;  2KFG A;  2TN4 A;  1AP4 A;  3WXA A;  1KQM B;  1NYA A;  1J7O A;  4F0Z B;  3SG2 A;  3LCP C;  1B8C A;  1F54 A;  1V1G A;  3CS1 A;  3VRN A;  2BBM A;  2RGI A;  1NX2 A;  3TS5 B;  1EG3 A;  2JTT A;  3OX5 A;  3RM1 A;  1H8B A;  1N65 A;  3OX6 A;  1NP8 A;  1SNL A;  2WCB A;  1JC2 A;  1SK6 D;  2JC2 A;  2A4J A;  1RJV A;  1XFV O;  2MLF C;  2K7O A;  1TNW A;  2KBI A;  1UHK A;  3BUN B;  3O4Y A;  4M2Q A;  5I2Q A;  3PM8 A;  1FPW A;  2FCE A;  4DRW A;  4PCW A;  1CKK A;  1TCO B;  1XFX O;  1MR8 A;  1Y1A A;  3H4S E;  4CFR A;  3WNX B;  1JUO A;  2JTZ A;  1EG4 A;  4GGF C;  3D0Y B;  1A75 A;  2LC5 A;  1NCZ A;  2OS8 C;  1B8L A;  3I5G C;  1M45 A;  1ALW A;  3CGA A;  2M7L A;  1B9A A;  1XYD A;  2WND A;  2WOR A;  2OS8 B;  3EKJ A;  1UUS A;  4USL A;  3OHM B;  1SYM A;  4ZCV A;  1DJX A;  2EHB A;  1HQV A;  1WY9 A;  1S36 A;  4TNC A;  2MHH A;  1BG1 A;  2L2E A;  4GUK A;  1XO5 A;  1WRK A;  5AER A;  3CR4 X;  2PAS A;  1LA0 A;  1QV0 A;  2LLS A;  1EXR A;  3DVJ A;  3KO0 A;  3E3R A;  1AK8 A;  4PE1 A;  1JWD A;  1UHJ A;  4YI8 A;  1RK9 A;  4BY5 A;  2ZRT A;  2Y4Q A;  5HKY A;  2KSP A;  2Y1N A;  1NUB A;  4MN0 A;  1EH2 A;  3FIA A;  1TN4 A;  1SMG A;  1UWO A;  5CPV A;  3DVK A;  4GPL B;  2VRG A;  4MRX A;  1CTR A;  1KCY A;  1SRA A;  1KWO B;  2I18 A;  1M39 A;  1KK7 Y;  1DT7 B;  2ZKM X;  4OKH A;  3EK8 A;  3EVU A;  4ORB B;  1WDC B;  4YGE B;  2JUL A;  2KYC A;  2QPT A;  2E30 A;  3M0W A;  2JU0 A;  4PHN A;  1KFU L;  5AEQ A;  4DS7 A;  2F33 A;  1YRU B;  2MA2 A;  1QXP A;  1YUU A;  3KEV A;  5GQQ C;  5IBW A;  3BUO B;  1PSB A;  2KQ6 A;  2K2A A;  2L5X B;  3LK0 A;  5HKW A;  4YRU A;  1SPY A;  1UHN A;  4ICB A;  1TOP A;  3QRX A;  1DTL A;  1XK4 A;  1FW4 A;  1S6C A;  2BL0 C;  2JQ6 A;  4PHK A;  1IQ3 A;  1BLQ A;  1CLM A;  1PSR A;  2KQY A;  2QAC A;  1XFW O;  1F55 A;  5FYX A;  2LCP A;  1S1E A;  1SL9 A;  2Q4U A;  1RTP 1;  1XFU O;  3SG3 A;  3TDZ A;  5PAL A;  4CPV A;  1JSA A;  2WOS A;  2Q91 A;  1IRJ A;  4C0L A;  1QS7 A;  1EL4 A;  1PAL A;  2LP3 A;  1KQV A;  1N0Y A;  1CDP A;  4PHJ A;  2L4I A;  1S3P A;  4PE0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...