1QLKA

Solution structure of ca(2+)-loaded rat s100b (betabeta) nmr, 20 structures
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
92
structure length
92
Chain Sequence
MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDEDGDGECDFQEFMAFVSMVTTACHEFFEHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-100 PROTEIN
publication title Solution structure of calcium-bound rat S100B(betabeta) as determined by nuclear magnetic resonance spectroscopy,.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Calcium-binding
total genus 24
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1qlkA00
4BY5A 5BPJA 3TZ1A 1LA0A 3NSKA 3NSOA 4C0JA 1SRAA 1JC2A 3SG7A 1CDMA 2QPTA 5HYDA 3FWBA 4PE7A 3EVVA 3C1VA 1F55A 1MHOA 2IS9A 3KF9A 1AJ4A 2Y1NA 1F4QA 1DJHA 3AAKA 1FPWA 1NX3A 1EJ3A 4U8DA 1JFJA 1TNQA 1LINA 3LK1A 1Y0VH 4XYNA 2JXLA 5I2LA 5ER4X 3SIAA 5K89A 3AKBA 5D69A 1BOCA 1W7JB 2ZNEA 3E3RA 4GNKB 1NSHA 1KFUL 1BT6A 1TNPA 2V53A 1XVJA 1NP8A 1GJYA 5AEQA 1A4PA 2L2EA 2OTGC 2ZN9A 3BXKA 2KBMA 1B1GA 2JT0A 1NWDA 3O4YA 5F6TA 1E8AA 1KFXL 2CXJA 2WCEA 2MHHA 2KYFA 2K8MB 4YRUA 2JT8A 2JNFA 2K7BA 1QLSA 3EK7A 5D7FA 5I2QA 2F2OA 2JNXA 2K61A 1NCYA 3O78A 1OOJA 4PHNA 4QJ5B 2KHNA 2KGRA 1IKUA 4ZCVA 1RECA 2PSRA 1SBJA 1YVLA 2NCPA 2CBLA 2PMYA 4I5LB 1KSMA 1L2OB 4N1FA 2HPSA 2PVBA 3GK1A 2AUCA 5CPVA 1UP5A 2HQ8A 1S6IA 2JTZA 3TUYB 2ZN8A 3PSRA 1ZMZA 3AKAA 3VGOA 5I2OA 2PASA 4CLNA 1UUSA 2LC5A 4I5JA 2BE6A 1YUTA 3DF0A 1QASA 1IGVA 2LVVA 4L9MA 2P6BB 2E30A 1SL8A 1CTRA 2KGBC 1LKJA 1CDLA 4ORCB 2L50A 2NXQA 3EKJA 1S1EA 3CZTX 2E6WA 3I5GC 1UHJA 1KWOB 1WDCB 3WHUB 4NDDA 3VRQA 1F8HA 1QIVA 1J7PA 5DKRA 2FJUB 2K7DA 3GK2A 1JUOA 4MZLA 3RM1A 1NUBA 4YGEB 3IF7A 3PM8A 1JF0A 1JF2A 3SG6A 1MQ1A 1S36A 3JTDB 1RWYA 1YUUA 2KAVA 2LHIA 2NCOA 3SG2A 1SCMB 1IQ3A 4NDCA 1XFUO 2EC6B 2Q4UA 1A2XA 1KK8B 2FCDA 1XFXO 2GV5A 5KU1A 2KI6D 1DF0A 2LVKA 2KI4B 3OHMB 1YRUB 1IJ5A 1Y1AA 2H2KA 1QS7A 5FYXA 4ETOA 1OMRA 2M3WA 1DJXA 4ORAB 4GPLB 2LLUA 2KQYA 3CR2A 1X02A 2HQWA 3I5IB 2NLNA 2SCPA 2F2PA 2F3ZA 2MLFC 2O5GA 3PALA 3BUWB 4A4CA 3D10A 1QVIZ 1F71A 1FBVA 1QATA 4QJ3B 4I5NB 3FS7A 2LCPA 5I8NA 1DJZA 2CCMA 1M46A 2I7AA 1MWNA 1AUIB 5IBWA 2KDHA 1M39A 2M7LA 1FW4A 1SR6B 1QJTA 1UHNA 1TOPA 1V1GA 4MZJA 1BU3A 1XFZO 3PATA 3EVUA 2O60A 3MSEB 2EHBA 1WY9A 4JQ0D 5J3XA 1GGZA 1YVHA 1XK4A 1OZSA 1K94A 2JULA 5PALA 4YGAA 3TDUA 5HKWA 5AERA 3JVTC 1QV1A 3IQOA 1YR5A 1FI5A 3EK8A 3BYAA 2K2AA 5CSNA 1QTXA 1SKTA 1B8LA 1MF8B 1NCXA 3PN7C 3PLFB 1SYMA 2K7OA 4OV2A 1N65A 1PALA 1K2HA 1R2UA 5CSFA 2I18A 1AJ5A 1PRWA 1KQMB 1A75B 1G4YR 4GFTA 4NDBA 1JFKA 2KFHA 3BOWB 1D1OA 1WRZA 1TCOB 2KQ6A 1XFYO 4E68A 1WLMA 3TDIA 3IQQA 5JJGA 3K21A 3I5FC 4TNCA 4JWQA 1WLZA 1MR8A 2GGZA 2KNEA 2LVJA 1TNWA 4CFQA 3DD4A 3H4SE 5CSJA 1TCFA 1Y6WA 5HLVA 1J7RA 1MXEA 2L0PA 3TS5B 3F45A 2BL0C 3DF0B 1QVIY 4DCKA 2M8UA 2LNKA 2M0RA 1B8RA 4PHJA 3FWCA 2VRGA 1UHKA 3M0WA 5DKQA 1QV0A 1YUSA 5GQQC 2LAPA 1Y1XA 3SG5A 4MVFA 2BE4A 4PHKA 1BG1A 1UHIA 1OSAA 2KBIA 2LVIA 1A03A 1YTZC 1C07A 5AFPA 3O6BA 1SNLA 1NIWA 1PVBA 1K9KA 4XJKB 1ZACA 1KFUS 3CR5X 1L7ZA 2WCBA 1CM1A 3NSIA 4M2OA 1EL4A 2WC8A 1YX8A 4YBHB 3RLZA 4HSZA 4PALA 4WRIA 4AOMA 1IWQA 1DMOA 1EH2A 1DF0B 3OX6A 1K96A 4OR9B 4FTGA 4GGFC 2JTTA 1XFVO 4BY4A 1K90D 1B8CA 2JRFA 2LANA 2OS8B 1HT9A 2BCBA 4WQ2A 2LLSA 1KCYA 4GBAA 1BR4B 2ZRTA 1KK7Z 1OMDA 1SPYA 1J1DA 5HLOA 3BUNB 3D0YB 4N1GA 1RROA 1F70A 4UPGA 2JXCA 1A29A 3LCPC 1G8IA 1Q80A 3KPXA 4MN0A 4OCIA 2B1UA 1MXLC 3I5HB 4HRGA 2MA2A 3LK0A 1QX7A 4MRXA 1PVAA 4R1EA 2BBMA 1U5IA 4USLA 1EXRA 1CDNA 2HF5A 1FI6A 1PSBA 1QX2A 3WHTB 4OKHA 1JSAA 3EVRA 1K9PA 3BUOB 3ZNIA 4PE1A 4MBEA 2MAZA 5KTYA 1YRTB 3SG4A 2M29A 3CWGA 1IJ6A 5G08A 4C0LA 1TRFA 1BF5A 1CLLA 5DKNA 1AVSA 2LM5A 1L2OC 1ZUZA 1J7OA 1GQMA 2CT9A 1BODA 1YURA 3CGAA 1SY9A 3TUYC 1DGVA 2D8NA 1ALVA 2LP2A 2JT3A 1S26D 3QRXA 1XA5A 1W7IB 3ZWHA 4MRYA 2PALA 2AAOA 1IRJA 1DJYA 1R6PA 1RTP1 1WRLA 2LUXA 2ZKMX 1DJWA 2OTGB 1CFPA 2KSPA 1K8UA 1J7QA 2KAXA 1CM4A 3GK4X 2Y1MA 2JPTA 1J1EA 1KK7Y 1DJGA 2L4IA 1S5GZ 2BBNA 1NCZA 1TNXA 1LA3A 1DVIA 4ORBB 3BUMB 2COLB 2LMUA 4IL1A 2GGMA 4PE4A 1EG3A 1KWOC 1WDCC 2WORA 1H4BA 1SCVA 3BUXB 1F54A 1SL7A 3TDZA 3JTDC 2H61C 4MSPA 2H61A 2KI6C 2F8PA 2BCXA 1SCMC 4OVNF 1UURA 2KFFA 2EC6C 1KK8C 2MBXA 1NX0A 2M7NA 1CFCA 2RGIA 1CFFA 2PRUA 1F4OA 4AQJA 2DOQA 4PHMA 2KI4C 1CDPA 1HQVA 4C0KA 1S6JA 2KYCA 3DVMA 1C7VA 2MJWB 4N5XA 1OZOA 3OX5A 2CTNA 3CS1A 1OQPA 4GGNA 1CKKA 3I5IC 1KQVA 1AK8A 4QJ4B 2MLEC 3OP0A 1CNPA 5TNCA 2WOSA 4MEWA 3HX4A 2M9GA 2SASA 1XFWO 3EK4A 1DJIA 2BCAA 3KHEA 1GGWA 4GAOA 3CLNA 1Y1UA 2LE9B 2OPOA 2K7CA 2KAYA 4WQ3A 1CLMA 1SR6C 5B8IB 1ALWA 1M63B 1N0YA 3KEVA 3I5GB 3NXAA 2WCFA 2NZ0A 4M2QA 2ZRSA 4YGCB 1K9UA 2I2RE 1NX1A 1U5IB 1JBAA 3EKHA 1M45A 1VRKA 2L4HA 2ZFDA 1S5GY 1RK9A 4D1EA 2LUCA 1N2DA 2M97A 4PCWA 1QX5B 1JWDA 2FCEA 1TN4A 2JOJA 1B7TZ 1NX2A 2BKIB 2Q91A 3VROA 3AAJA 3SIBA 1DT7B 1G33A 4HREE 1KFXS 3DVEA 2LP3A 4GGFA 1KQMC 3ICBA 1DTLA 1A75A 4PDZA 3DVJA 5ER5A 3GOFA 3VRPA 1OE9B 2LMVA 3BOWA 3WNXB 5HKYA 1KSOA 3LL8B 1K95A 2G2BA 2CNPA 3CTNA 1B4CA 1TTXA 1K93D 1NYAA 2JU0A 3VRRA 1UWOA 1ZOTB 4M2PA 4CPVA 3OB2B 2JQ6A 1LXFC 2JC2A 2LMTA 1LVCD 1IH0A 1NPQA 1B47A 1B9AA 4PE0A 3VRNA 3TS5C 1SK6D 3SG3A 2L98A 2F3YA 1DGUA 2LV7A 1PULA 1RJVA 5AANA 1AP4A 4JPZB 5JOLA 4CFRA 1QLKA 4CIDA 1CMGA 1BR1B 1CLBA 1H8BA 2KFGA 4DS7A 2Y4QA 5AXIA 1C7WA 1S3PA 1AHRA 3JVTB 2Y5IA 1M31A 4DUQA 1SMGA 1IG5A 1BMOA 4NQGA 3SJSA 1FF1A 3PN7B 2R2IA 2AMIA 4MLWA 1IQ5A 3A8RA 1EG4A 2EGDA 4XJKA 4ICBA 2KOTA 4AQIA 3KO0A 5CSIA 4DIRA 3OB1B 2ISDA 1XYDA 2K0JA 2ZNDA 2I94A 1QXPA 2HETA 2WNDA 3WXAA 1V1FA 2L51A 1SW8A 2G9BA 3I5FB 1BLQA 1CB1A 1B7TY 2A4JA 2BKHB 3A4UB 1ZFSA 3BQ3A 2L5XB 2OS8C 1CMFA 3HCMA 2QACA 1MUXA 2FOTA 3CR4X 4HRHA 4F0ZB 3O2PA 1ODBA 1RFJA 2JWWA 2MRDA 4I5KA 4P5OE 5KSZA 2K2FA 1YX7A 3FIAA 3D0YA 4A4BA 1TIZA 2BL0B 1S6CA 2M49B 1QIWA 2M1KB 1WRKA 2LHLA 3LLEA 3I5HC 4YI8A 4YI9A 2M1UA 1OMVA 1J55A 5HKZA 4YGDB 1UHHA 4Q04A 3DVKA 4YGBB 2F33A 1PSRA 3NSLA 1PK0D 3PFVA 2BECA 2TN4A 2LLTA 4MZKA 1SL9A 4ZCUA 4GUKA 1XK4C 1XO5A 4FQOA 4P2YB 2JZIA 1CFDA 1BJFA 4DRWA
chains in the Genus database with same CATH superfamily
4BY5A 2L2CA 5BPJA 3TZ1A 1LA0A 3NSKA 3NSOA 4C0JA 1SRAA 1JC2A 3SG7A 1CDMA 2QPTA 1T14A 5HYDA 3FWBA 4PE7A 4IJ7A 3EVVA 3C1VA 1F55A 1MHOA 2IS9A 3DYEA 3KF9A 1AJ4A 2Y1NA 1F4QA 1DJHA 3AAKA 1FPWA 1NX3A 1EJ3A 4U8DA 1JFJA 1TNQA 1LINA 3LK1A 1Y0VH 4XYNA 2JXLA 5I2LA 2GTEA 5ER4X 3SIAA 5K89A 3AKBA 5D69A 1BOCA 1W7JB 2ZNEA 3E3RA 4GNKB 5EL2A 1NSHA 1KFUL 1BT6A 1TNPA 2V53A 1XVJA 1NP8A 1GJYA 5AEQA 1A4PA 2L2EA 2OTGC 2ZN9A 3BXKA 2QEOA 2KBMA 1B1GA 2JT0A 1NWDA 3O4YA 5F6TA 4FQTA 3B86A 1E8AA 1KFXL 2CXJA 2WCEA 2MHHA 2KYFA 2K8MB 3FE8A 4YRUA 2JT8A 2JNFA 2K7BA 1QLSA 3EK7A 5D7FA 5I2QA 2F2OA 2JNXA 2BAPA 2K61A 1NCYA 1SSEB 3FE6A 2KPHA 3O78A 1OOJA 4PHNA 4QJ5B 2P70A 2KHNA 2KGRA 1IKUA 4ZCVA 1RECA 2PSRA 1W9ZA 1SBJA 1YVLA 2NCPA 2CBLA 2PMYA 4I5LB 1KSMA 1L2OB 4N1FA 2HPSA 2PVBA 3GK1A 3S0EA 2AUCA 5CPVA 1UP5A 2HQ8A 1S6IA 2JTZA 2KLEA 3NGVA 3RZSA 3TUYB 2ZN8A 2WCHA 3PSRA 1ZMZA 5FI2A 3AKAA 3VGOA 5I2OA 2PASA 4JKTA 4CLNA 1UUSA 2LC5A 4I5JA 3CZ2A 2BE6A 1YUTA 1TUZA 3DF0A 1QASA 1IGVA 2LVVA 4L9MA 2P6BB 2E30A 1SL8A 1CTRA 2KGBC 1LKJA 1CDLA 4ORCB 2L50A 1GM0A 2NXQA 3EKJA 3CYZA 1S1EA 1DQEA 2E6WA 3CZTX 3I5GC 1UHJA 1KWOB 1WDCB 3WHUB 4NDDA 3VRQA 1F8HA 1QIVA 1J7PA 5DKRA 2FJUB 2K7DA 3GK2A 1JUOA 4MZLA 3RM1A 1NUBA 4YGEB 3IF7A 3PM8A 1JF0A 1JF2A 3SG6A 1MQ1A 1S36A 3JTDB 1RWYA 1YUUA 2KAVA 2LHIA 2NCOA 3SG2A 1SCMB 1IQ3A 4NDCA 1XFUO 2EC6B 2Q4UA 1A2XA 1KK8B 2FCDA 1XFXO 2GV5A 5KU1A 2KI6D 1DF0A 2LVKA 2KI4B 3OHMB 1YRUB 1IJ5A 1Y1AA 2H2KA 1QS7A 5FYXA 4ETOA 1OMRA 2M3WA 1DJXA 4ORAB 4GPLB 2LLUA 2KQYA 3CR2A 3D77A 1X02A 2HQWA 3I5IB 2NLNA 3CABA 2SCPA 2F2PA 2F3ZA 2MLFC 2O5GA 3PALA 3BUWB 4A4CA 3D10A 1QVIZ 1F71A 1FBVA 1QATA 4QJ3B 4I5NB 3FS7A 2LCPA 5I8NA 3D76A 1DEKA 1DJZA 2CCMA 1M46A 2I7AA 1MWNA 1AUIB 1QWVA 2KDHA 5IBWA 1M39A 2M7LA 1FW4A 1SR6B 1QJTA 1UHNA 1TOPA 1V1GA 2QEHA 4MZJA 1BU3A 1XFZO 3PATA 3EVUA 2O60A 3MSEB 2EHBA 1WY9A 4JQ0D 5J3XA 1GGZA 1YVHA 1XK4A 3DY9A 1OZSA 1K94A 2JULA 5PALA 4YGAA 3TDUA 5HKWA 5AERA 3JVTC 1QV1A 3IQOA 1YR5A 1FI5A 1C3YA 3EK8A 3BYAA 2K2AA 5CSNA 1QTXA 1SKTA 1B8LA 1MF8B 1NCXA 3PN7C 3PLFB 1SYMA 1OW4A 2K7OA 1N65A 4OV2A 1PALA 1K2HA 1R2UA 5CSFA 2I18A 1AJ5A 1PRWA 1ORGA 5FI7A 1KQMB 1A75B 1G4YR 4GFTA 4NDBA 1JFKA 2KFHA 3BOWB 1D1OA 1WRZA 1TCOB 2KQ6A 1OOHA 1XFYO 4E68A 1WLMA 3TDIA 3IQQA 5JJGA 3K21A 3I5FC 4TNCA 4JWQA 1WLZA 1MR8A 2GGZA 2KNEA 2LVJA 1TNWA 4CFQA 3D73A 3DD4A 3H4SE 5CSJA 1TCFA 1Y6WA 5HLVA 1J7RA 1MXEA 2L0PA 3TS5B 3F45A 2BL0C 2BNXA 3DF0B 1QVIY 4DCKA 2M8UA 2LNKA 2M0RA 1B8RA 4PHJA 3FWCA 2VRGA 1UHKA 3PM2A 3M0WA 5DKQA 1QV0A 1YUSA 5GQQC 2LAPA 1Y1XA 1LS8A 3SG5A 2YGUA 4MVFA 2BE4A 4PHKA 1BG1A 3EG5B 1Z2CB 1UHIA 1OSAA 2KBIA 2LVIA 1A03A 1YTZC 1C07A 5AFPA 3O6BA 1SNLA 1NIWA 1PVBA 1K9KA 4XJKB 1ZACA 1KFUS 3CR5X 1L7ZA 2WCBA 2JPOA 1CM1A 3NSIA 4M2OA 1EL4A 3B7AA 2WC8A 1YX8A 4YBHB 3RLZA 4HSZA 4PALA 5DICA 4WRIA 4AOMA 1IWQA 1DMOA 1EH2A 1DF0B 3OX6A 1K96A 4OR9B 4FTGA 3PJIA 3QMEA 1Z4HA 2JTTA 1XFVO 4GGFC 4BY4A 1K90D 1B8CA 2JRFA 2LANA 2OS8B 1HT9A 2BCBA 4WQ2A 2LLSA 1KCYA 4GBAA 1BR4B 1TUJA 2ZRTA 1KK7Z 1OMDA 1SPYA 1J1DA 1P28A 5HLOA 3BUNB 3D0YB 4N1GA 1RROA 5HL1A 1F70A 4UPGA 2JXCA 5D3OA 1A29A 3LCPC 1G8IA 1Q80A 3UO9A 3KPXA 4MN0A 4OCIA 2B1UA 1MXLC 3I5HB 4HRGA 2MA2A 3LK0A 1QX7A 4MRXA 1PVAA 4R1EA 2BBMA 2PYQA 1U5IA 4USLA 1EXRA 1CDNA 3SS4A 3BFHA 2HF5A 2H8VA 1FI6A 1PSBA 1QX2A 3WHTB 3D74A 1IIOA 4OKHA 1JSAA 3EVRA 1K9PA 2QEVA 2ERBA 3BUOB 3ZNIA 4PE1A 4MBEA 2MAZA 1XFRA 5KTYA 1YRTB 3SG4A 2FJYA 2M29A 2QEBA 1IJ6A 3CWGA 3OBVA 5G08A 4C0LA 1TRFA 1BF5A 1CLLA 3Q8IA 3DXLA 5DKNA 1AVSA 2LM5A 1L2OC 1ZUZA 1J7OA 1GQMA 3CDNA 2CT9A 1BODA 1OOIX 1YURA 3CGAA 1SY9A 3TUYC 1DGVA 2D8NA 1ALVA 2LP2A 2JT3A 1S26D 5I94A 3QRXA 1XA5A 1W7IB 3ZWHA 4MRYA 2PALA 2AAOA 1IRJA 1DJYA 1R6PA 1RTP1 1WRLA 2LUXA 2ZKMX 1DJWA 2OTGB 3B88A 1CFPA 3SS3A 2KSPA 2QDIA 1K8UA 1J7QA 2KAXA 1CM4A 3GK4X 3N7HA 2Y1MA 2JPTA 3L4AA 3S0FA 1J1EA 1KK7Y 1DJGA 2L4IA 1S5GZ 2BBNA 1NCZA 3D78A 1TNXA 1LA3A 1DVIA 3UNWA 4ORBB 3BUMB 2COLB 2LMUA 3R1VA 4IL1A 2GGMA 4PE4A 1EG3A 1KWOC 1WDCC 3BJHA 3V2LA 2WORA 1H4BA 1SCVA 2WCMA 3BUXB 1F54A 1SL7A 3TDZA 3JTDC 2H61C 4MSPA 2H61A 2KI6C 2F8PA 2BCXA 1SCMC 4OVNF 1UURA 2KFFA 4OZDA 2EC6C 1KK8C 2MBXA 1NX0A 2M7NA 1CFCA 2RGIA 1CFFA 2PRUA 1F4OA 4INXA 2DOQA 4PHMA 1DELA 2KI4C 4AQJA 1CDPA 4F7FA 1HQVA 3CZ1A 4C0KA 2KLDA 1S6JA 2KYCA 3DVMA 1C7VA 2MJWB 4N5XA 1OZOA 1DC1A 3OX5A 2CTNA 3B6XA 1OQPA 3CS1A 3OGNA 3I5IC 3K1EA 4GGNA 1CKKA 1KQVA 2K60A 1AK8A 2WCKA 4QJ4B 2MLEC 2WC5A 3OP0A 5TNCA 1CNPA 2WOSA 3R72A 4MEWA 3HX4A 2M9GA 2SASA 1XFWO 3EK4A 1DJIA 3R1PA 2BCAA 3KHEA 1GGWA 4GAOA 3CLNA 1Y1UA 3S0AA 2LE9B 2OPOA 3BFBA 2K7CA 2KAYA 4WQ3A 1CLMA 1SR6C 5B8IB 1ALWA 1M63B 1N0YA 3KEVA 3I5GB 3NXAA 2WCFA 3L4LA 2NZ0A 4JD9A 4M2QA 2ZRSA 4YGCB 1K9UA 2I2RE 3CZ0A 1NX1A 1U5IB 1OOGA 3IVTA 3S0BA 1JBAA 3EKHA 1M45A 1VRKA 2L4HA 3NHIA 2ZFDA 1S5GY 1RK9A 4D1EA 2LUCA 1N2DA 2M97A 4PCWA 1QX5B 1JWDA 2FCEA 1TN4A 2WCJA 3VB1A 2JOJA 1B7TZ 1NX2A 2BKIB 3O4XA 2Q91A 4PT1A 3AAJA 3SIBA 3VROA 1DT7B 1G33A 4HREE 1KFXS 3DVEA 2LP3A 3FE9A 4GGFA 1KQMC 3ICBA 1DTLA 1TWOA 1A75A 4PDZA 3DVJA 5ER5A 3GOFA 3VRPA 1OE9B 2LMVA 3BOWA 3NHTA 3WNXB 1KSOA 3LL8B 5HKYA 1K95A 2G2BA 2WCLA 2CNPA 3CTNA 1B4CA 1TTXA 1K93D 1NYAA 2JU0A 3VRRA 1UWOA 1ZOTB 2P71A 3L47A 4M2PA 4CPVA 3OB2B 2JQ6A 3S0GA 1LXFC 2JC2A 2LMTA 1LVCD 1IH0A 1NPQA 1B47A 1B9AA 4PE0A 3VRNA 3TS5C 1SK6D 3SG3A 2L98A 2F3YA 1DGUA 2LV7A 1PULA 1RJVA 5AANA 3R1OA 1AP4A 4JPZB 5JOLA 4CFRA 1QLKA 4CIDA 1CMGA 1BR1B 1CLBA 1H8BA 2KFGA 4KYNA 4DS7A 2Y4QA 5AXIA 1C7WA 1S3PA 1AHRA 3JVTB 2Y5IA 1M31A 4DUQA 1SMGA 1IG5A 1BMOA 4NQGA 3SJSA 1FF1A 3PN7B 2R2IA 2AMIA 4MLWA 2WC6A 3B87A 4INWA 1IQ5A 3A8RA 1EG4A 2EGDA 4XJKA 4ICBA 2KOTA 4AQIA 3KO0A 5CSIA 4DIRA 3OB1B 2ISDA 1XYDA 2K0JA 2ZNDA 1C3ZA 2I94A 1QXPA 2HETA 2WNDA 3WXAA 1V1FA 2L51A 1SW8A 2G9BA 3I5FB 1BLQA 1CB1A 1B7TY 2A4JA 2BKHB 3A4UB 1ZFSA 2PQLA 3BQ3A 2L5XB 2OS8C 1CMFA 5FI6A 3HCMA 2QACA 1MUXA 2FOTA 3S0DA 3CR4X 4HRHA 4F0ZB 3O2PA 1ODBA 1RFJA 2JWWA 2MRDA 4I5KA 4P5OE 5KSZA 2K2FA 1YX7A 3FIAA 3D0YA 4A4BA 1TIZA 2BL0B 1S6CA 2M49B 1QIWA 2M1KB 1WRKA 2LHLA 3LLEA 3I5HC 2L5YA 4YI8A 4YI9A 2M1UA 1OOFA 1OMVA 1J55A 5HKZA 4YGDB 1UHHA 4Q04A 3DVKA 4YGBB 2F33A 1PSRA 3NSLA 1PK0D 3PFVA 2BECA 2TN4A 3SS5A 2LLTA 3DZTA 1SL9A 4MZKA 3D75A 4ZCUA 3BFAA 4GUKA 1XK4C 1XO5A 4FQOA 4P2YB 2JZIA 1CFDA 1BJFA 4DRWA
chains in the Genus database with same CATH topology
4BY5A 5BPJA 3TZ1A 1LA0A 3NSKA 3NSOA 4C0JA 1SRAA 1JC2A 3SG7A 1CDMA 2QPTA 5HYDA 3FWBA 4PE7A 3EVVA 3C1VA 1F55A 1MHOA 2IS9A 3KF9A 1AJ4A 2Y1NA 1F4QA 1DJHA 3AAKA 1FPWA 1NX3A 1EJ3A 4U8DA 1JFJA 1TNQA 1LINA 3LK1A 1Y0VH 4XYNA 2JXLA 5I2LA 5ER4X 3SIAA 5K89A 3AKBA 5D69A 1BOCA 1W7JB 2ZNEA 3E3RA 4GNKB 1NSHA 1KFUL 1BT6A 1TNPA 2V53A 1XVJA 1NP8A 1GJYA 5AEQA 1A4PA 2L2EA 2OTGC 2ZN9A 3BXKA 2KBMA 1B1GA 2JT0A 1NWDA 3O4YA 5F6TA 1E8AA 1KFXL 2CXJA 2WCEA 2MHHA 2KYFA 2K8MB 4YRUA 2JT8A 2JNFA 2K7BA 1QLSA 3EK7A 5D7FA 5I2QA 2F2OA 2JNXA 2K61A 1NCYA 3O78A 1OOJA 4PHNA 4QJ5B 2KHNA 2KGRA 1IKUA 4ZCVA 1RECA 2PSRA 1SBJA 1YVLA 2NCPA 2CBLA 2PMYA 4I5LB 1KSMA 1L2OB 4N1FA 2HPSA 2PVBA 3GK1A 2AUCA 5CPVA 1UP5A 2HQ8A 1S6IA 2JTZA 3TUYB 2ZN8A 3PSRA 1ZMZA 3AKAA 3VGOA 5I2OA 2PASA 4CLNA 1UUSA 2LC5A 4I5JA 2BE6A 1YUTA 3DF0A 1QASA 1IGVA 2LVVA 4L9MA 2P6BB 2E30A 1SL8A 1CTRA 2KGBC 1LKJA 1CDLA 4ORCB 2L50A 2NXQA 3EKJA 1S1EA 3CZTX 2E6WA 3I5GC 1UHJA 1KWOB 1WDCB 3WHUB 4NDDA 3VRQA 1F8HA 1QIVA 1J7PA 5DKRA 2FJUB 2K7DA 3GK2A 1JUOA 4MZLA 3RM1A 1NUBA 4YGEB 3IF7A 3PM8A 1JF0A 1JF2A 3SG6A 1MQ1A 1S36A 3JTDB 1RWYA 1YUUA 2KAVA 2LHIA 2NCOA 3SG2A 1SCMB 1IQ3A 4NDCA 1XFUO 2EC6B 2Q4UA 1A2XA 1KK8B 2FCDA 1XFXO 2GV5A 5KU1A 2KI6D 1DF0A 2LVKA 2KI4B 3OHMB 1YRUB 1IJ5A 1Y1AA 2H2KA 1QS7A 5FYXA 4ETOA 1OMRA 2M3WA 1DJXA 4ORAB 4GPLB 2LLUA 2KQYA 3CR2A 1X02A 2HQWA 3I5IB 2NLNA 2SCPA 2F2PA 2F3ZA 2MLFC 2O5GA 3PALA 3BUWB 4A4CA 3D10A 1QVIZ 1F71A 1FBVA 1QATA 4QJ3B 4I5NB 3FS7A 2LCPA 5I8NA 1DJZA 2CCMA 1M46A 2I7AA 1MWNA 1AUIB 5IBWA 2KDHA 1M39A 2M7LA 1FW4A 1SR6B 1QJTA 1UHNA 1TOPA 1V1GA 4MZJA 1BU3A 1XFZO 3PATA 3EVUA 2O60A 3MSEB 2EHBA 1WY9A 4JQ0D 5J3XA 1GGZA 1YVHA 1XK4A 1OZSA 1K94A 2JULA 5PALA 4YGAA 3TDUA 5HKWA 5AERA 3JVTC 1QV1A 3IQOA 1YR5A 1FI5A 3EK8A 3BYAA 2K2AA 5CSNA 1QTXA 1SKTA 1B8LA 1MF8B 1NCXA 3PN7C 3PLFB 1SYMA 2K7OA 4OV2A 1N65A 1PALA 1K2HA 1R2UA 5CSFA 2I18A 1AJ5A 1PRWA 1KQMB 1A75B 1G4YR 4GFTA 4NDBA 1JFKA 2KFHA 3BOWB 1D1OA 1WRZA 1TCOB 2KQ6A 1XFYO 4E68A 1WLMA 3TDIA 3IQQA 5JJGA 3K21A 3I5FC 4TNCA 4JWQA 1WLZA 1MR8A 2GGZA 2KNEA 2LVJA 1TNWA 4CFQA 3DD4A 3H4SE 5CSJA 1TCFA 1Y6WA 5HLVA 1J7RA 1MXEA 2L0PA 3TS5B 3F45A 2BL0C 3DF0B 1QVIY 4DCKA 2M8UA 2LNKA 2M0RA 1B8RA 4PHJA 3FWCA 2VRGA 1UHKA 3M0WA 5DKQA 1QV0A 1YUSA 5GQQC 2LAPA 1Y1XA 3SG5A 4MVFA 2BE4A 4PHKA 1BG1A 1UHIA 1OSAA 2KBIA 2LVIA 1A03A 1YTZC 1C07A 5AFPA 3O6BA 1SNLA 1NIWA 1PVBA 1K9KA 4XJKB 1ZACA 1KFUS 3CR5X 1L7ZA 2WCBA 1CM1A 3NSIA 4M2OA 1EL4A 2WC8A 1YX8A 4YBHB 3RLZA 4HSZA 4PALA 4WRIA 4AOMA 1IWQA 1DMOA 1EH2A 1DF0B 3OX6A 1K96A 4OR9B 4FTGA 4GGFC 2JTTA 1XFVO 4BY4A 1K90D 1B8CA 2JRFA 2LANA 2OS8B 1HT9A 2BCBA 4WQ2A 2LLSA 1KCYA 4GBAA 1BR4B 2ZRTA 1KK7Z 1OMDA 1SPYA 1J1DA 5HLOA 3BUNB 3D0YB 4N1GA 1RROA 1F70A 4UPGA 2JXCA 1A29A 3LCPC 1G8IA 1Q80A 3KPXA 4MN0A 4OCIA 2B1UA 1MXLC 3I5HB 4HRGA 2MA2A 3LK0A 1QX7A 4MRXA 1PVAA 4R1EA 2BBMA 1U5IA 4USLA 1EXRA 1CDNA 2HF5A 1FI6A 1PSBA 1QX2A 3WHTB 4OKHA 1JSAA 3EVRA 1K9PA 3BUOB 3ZNIA 4PE1A 4MBEA 2MAZA 5KTYA 1YRTB 3SG4A 2M29A 3CWGA 1IJ6A 5G08A 4C0LA 1TRFA 1BF5A 1CLLA 5DKNA 1AVSA 2LM5A 1L2OC 1ZUZA 1J7OA 1GQMA 2CT9A 1BODA 1YURA 3CGAA 1SY9A 3TUYC 1DGVA 2D8NA 1ALVA 2LP2A 2JT3A 1S26D 3QRXA 1XA5A 1W7IB 3ZWHA 4MRYA 2PALA 2AAOA 1IRJA 1DJYA 1R6PA 1RTP1 1WRLA 2LUXA 2ZKMX 1DJWA 2OTGB 1CFPA 2KSPA 1K8UA 1J7QA 2KAXA 1CM4A 3GK4X 2Y1MA 2JPTA 1J1EA 1KK7Y 1DJGA 2L4IA 1S5GZ 2BBNA 1NCZA 1TNXA 1LA3A 1DVIA 4ORBB 3BUMB 2COLB 2LMUA 4IL1A 2GGMA 4PE4A 1EG3A 1KWOC 1WDCC 2WORA 1H4BA 1SCVA 3BUXB 1F54A 1SL7A 3TDZA 3JTDC 2H61C 4MSPA 2H61A 2KI6C 2F8PA 2BCXA 1SCMC 4OVNF 1UURA 2KFFA 2EC6C 1KK8C 2MBXA 1NX0A 2M7NA 1CFCA 2RGIA 1CFFA 2PRUA 1F4OA 4AQJA 2DOQA 4PHMA 2KI4C 1CDPA 1HQVA 4C0KA 1S6JA 2KYCA 3DVMA 1C7VA 2MJWB 4N5XA 1OZOA 3OX5A 2CTNA 3CS1A 1OQPA 4GGNA 1CKKA 3I5IC 1KQVA 1AK8A 4QJ4B 2MLEC 3OP0A 1CNPA 5TNCA 2WOSA 4MEWA 3HX4A 2M9GA 2SASA 1XFWO 3EK4A 1DJIA 2BCAA 3KHEA 1GGWA 4GAOA 3CLNA 1Y1UA 2LE9B 2OPOA 2K7CA 2KAYA 4WQ3A 1CLMA 1SR6C 5B8IB 1ALWA 1M63B 1N0YA 3KEVA 3I5GB 3NXAA 2WCFA 2NZ0A 4M2QA 2ZRSA 4YGCB 1K9UA 2I2RE 1NX1A 1U5IB 1JBAA 3EKHA 1M45A 1VRKA 2L4HA 2ZFDA 1S5GY 1RK9A 4D1EA 2LUCA 1N2DA 2M97A 4PCWA 1QX5B 1JWDA 2FCEA 1TN4A 2JOJA 1B7TZ 1NX2A 2BKIB 2Q91A 3VROA 3AAJA 3SIBA 1DT7B 1G33A 4HREE 1KFXS 3DVEA 2LP3A 4GGFA 1KQMC 3ICBA 1DTLA 1A75A 4PDZA 3DVJA 5ER5A 3GOFA 3VRPA 1OE9B 2LMVA 3BOWA 3WNXB 5HKYA 1KSOA 3LL8B 1K95A 2G2BA 2CNPA 3CTNA 1B4CA 1TTXA 1K93D 1NYAA 2JU0A 3VRRA 1UWOA 1ZOTB 4M2PA 4CPVA 3OB2B 2JQ6A 1LXFC 2JC2A 2LMTA 1LVCD 1IH0A 1NPQA 1B47A 1B9AA 4PE0A 3VRNA 3TS5C 1SK6D 3SG3A 2L98A 2F3YA 1DGUA 2LV7A 1PULA 1RJVA 5AANA 1AP4A 4JPZB 5JOLA 4CFRA 1QLKA 4CIDA 1CMGA 1BR1B 1CLBA 1H8BA 2KFGA 4DS7A 2Y4QA 5AXIA 1C7WA 1S3PA 1AHRA 3JVTB 2Y5IA 1M31A 4DUQA 1SMGA 1IG5A 1BMOA 4NQGA 3SJSA 1FF1A 3PN7B 2R2IA 2AMIA 4MLWA 1IQ5A 3A8RA 1EG4A 2EGDA 4XJKA 4ICBA 2KOTA 4AQIA 3KO0A 5CSIA 4DIRA 3OB1B 2ISDA 1XYDA 2K0JA 2ZNDA 2I94A 1QXPA 2HETA 2WNDA 3WXAA 1V1FA 2L51A 1SW8A 2G9BA 3I5FB 1BLQA 1CB1A 1B7TY 2A4JA 2BKHB 3A4UB 1ZFSA 3BQ3A 2L5XB 2OS8C 1CMFA 3HCMA 2QACA 1MUXA 2FOTA 3CR4X 4HRHA 4F0ZB 3O2PA 1ODBA 1RFJA 2JWWA 2MRDA 4I5KA 4P5OE 5KSZA 2K2FA 1YX7A 3FIAA 3D0YA 4A4BA 1TIZA 2BL0B 1S6CA 2M49B 1QIWA 2M1KB 1WRKA 2LHLA 3LLEA 3I5HC 4YI8A 4YI9A 2M1UA 1OMVA 1J55A 5HKZA 4YGDB 1UHHA 4Q04A 3DVKA 4YGBB 2F33A 1PSRA 3NSLA 1PK0D 3PFVA 2BECA 2TN4A 2LLTA 4MZKA 1SL9A 4ZCUA 4GUKA 1XK4C 1XO5A 4FQOA 4P2YB 2JZIA 1CFDA 1BJFA 4DRWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BY5 A;  5BPJ A;  3TZ1 A;  1LA0 A;  3NSK A;  3NSO A;  4C0J A;  1SRA A;  1JC2 A;  3SG7 A;  1CDM A;  2QPT A;  5HYD A;  3FWB A;  4PE7 A;  3EVV A;  3C1V A;  1F55 A;  1MHO A;  2IS9 A;  3KF9 A;  1AJ4 A;  2Y1N A;  1F4Q A;  1DJH A;  3AAK A;  1FPW A;  1NX3 A;  1EJ3 A;  4U8D A;  1JFJ A;  1TNQ A;  1LIN A;  3LK1 A;  1Y0V H;  4XYN A;  2JXL A;  5I2L A;  5ER4 X;  3SIA A;  5K89 A;  3AKB A;  5D69 A;  1BOC A;  1W7J B;  2ZNE A;  3E3R A;  4GNK B;  1NSH A;  1KFU L;  1BT6 A;  1TNP A;  2V53 A;  1XVJ A;  1NP8 A;  1GJY A;  5AEQ A;  1A4P A;  2L2E A;  2OTG C;  2ZN9 A;  3BXK A;  2KBM A;  1B1G A;  2JT0 A;  1NWD A;  3O4Y A;  5F6T A;  1E8A A;  1KFX L;  2CXJ A;  2WCE A;  2MHH A;  2KYF A;  2K8M B;  4YRU A;  2JT8 A;  2JNF A;  2K7B A;  1QLS A;  3EK7 A;  5D7F A;  5I2Q A;  2F2O A;  2JNX A;  2K61 A;  1NCY A;  3O78 A;  1OOJ A;  4PHN A;  4QJ5 B;  2KHN A;  2KGR A;  1IKU A;  4ZCV A;  1REC A;  2PSR A;  1SBJ A;  1YVL A;  2NCP A;  2CBL A;  2PMY A;  4I5L B;  1KSM A;  1L2O B;  4N1F A;  2HPS A;  2PVB A;  3GK1 A;  2AUC A;  5CPV A;  1UP5 A;  2HQ8 A;  1S6I A;  2JTZ A;  3TUY B;  2ZN8 A;  3PSR A;  1ZMZ A;  3AKA A;  3VGO A;  5I2O A;  2PAS A;  4CLN A;  1UUS A;  2LC5 A;  4I5J A;  2BE6 A;  1YUT A;  3DF0 A;  1QAS A;  1IGV A;  2LVV A;  4L9M A;  2P6B B;  2E30 A;  1SL8 A;  1CTR A;  2KGB C;  1LKJ A;  1CDL A;  4ORC B;  2L50 A;  2NXQ A;  3EKJ A;  1S1E A;  3CZT X;  2E6W A;  3I5G C;  1UHJ A;  1KWO B;  1WDC B;  3WHU B;  4NDD A;  3VRQ A;  1F8H A;  1QIV A;  1J7P A;  5DKR A;  2FJU B;  2K7D A;  3GK2 A;  1JUO A;  4MZL A;  3RM1 A;  1NUB A;  4YGE B;  3IF7 A;  3PM8 A;  1JF0 A;  1JF2 A;  3SG6 A;  1MQ1 A;  1S36 A;  3JTD B;  1RWY A;  1YUU A;  2KAV A;  2LHI A;  2NCO A;  3SG2 A;  1SCM B;  1IQ3 A;  4NDC A;  1XFU O;  2EC6 B;  2Q4U A;  1A2X A;  1KK8 B;  2FCD A;  1XFX O;  2GV5 A;  5KU1 A;  2KI6 D;  1DF0 A;  2LVK A;  2KI4 B;  3OHM B;  1YRU B;  1IJ5 A;  1Y1A A;  2H2K A;  1QS7 A;  5FYX A;  4ETO A;  1OMR A;  2M3W A;  1DJX A;  4ORA B;  4GPL B;  2LLU A;  2KQY A;  3CR2 A;  1X02 A;  2HQW A;  3I5I B;  2NLN A;  2SCP A;  2F2P A;  2F3Z A;  2MLF C;  2O5G A;  3PAL A;  3BUW B;  4A4C A;  3D10 A;  1QVI Z;  1F71 A;  1FBV A;  1QAT A;  4QJ3 B;  4I5N B;  3FS7 A;  2LCP A;  5I8N A;  1DJZ A;  2CCM A;  1M46 A;  2I7A A;  1MWN A;  1AUI B;  5IBW A;  2KDH A;  1M39 A;  2M7L A;  1FW4 A;  1SR6 B;  1QJT A;  1UHN A;  1TOP A;  1V1G A;  4MZJ A;  1BU3 A;  1XFZ O;  3PAT A;  3EVU A;  2O60 A;  3MSE B;  2EHB A;  1WY9 A;  4JQ0 D;  5J3X A;  1GGZ A;  1YVH A;  1XK4 A;  1OZS A;  1K94 A;  2JUL A;  5PAL A;  4YGA A;  3TDU A;  5HKW A;  5AER A;  3JVT C;  1QV1 A;  3IQO A;  1YR5 A;  1FI5 A;  3EK8 A;  3BYA A;  2K2A A;  5CSN A;  1QTX A;  1SKT A;  1B8L A;  1MF8 B;  1NCX A;  3PN7 C;  3PLF B;  1SYM A;  2K7O A;  4OV2 A;  1N65 A;  1PAL A;  1K2H A;  1R2U A;  5CSF A;  2I18 A;  1AJ5 A;  1PRW A;  1KQM B;  1A75 B;  1G4Y R;  4GFT A;  4NDB A;  1JFK A;  2KFH A;  3BOW B;  1D1O A;  1WRZ A;  1TCO B;  2KQ6 A;  1XFY O;  4E68 A;  1WLM A;  3TDI A;  3IQQ A;  5JJG A;  3K21 A;  3I5F C;  4TNC A;  4JWQ A;  1WLZ A;  1MR8 A;  2GGZ A;  2KNE A;  2LVJ A;  1TNW A;  4CFQ A;  3DD4 A;  3H4S E;  5CSJ A;  1TCF A;  1Y6W A;  5HLV A;  1J7R A;  1MXE A;  2L0P A;  3TS5 B;  3F45 A;  2BL0 C;  3DF0 B;  1QVI Y;  4DCK A;  2M8U A;  2LNK A;  2M0R A;  1B8R A;  4PHJ A;  3FWC A;  2VRG A;  1UHK A;  3M0W A;  5DKQ A;  1QV0 A;  1YUS A;  5GQQ C;  2LAP A;  1Y1X A;  3SG5 A;  4MVF A;  2BE4 A;  4PHK A;  1BG1 A;  1UHI A;  1OSA A;  2KBI A;  2LVI A;  1A03 A;  1YTZ C;  1C07 A;  5AFP A;  3O6B A;  1SNL A;  1NIW A;  1PVB A;  1K9K A;  4XJK B;  1ZAC A;  1KFU S;  3CR5 X;  1L7Z A;  2WCB A;  1CM1 A;  3NSI A;  4M2O A;  1EL4 A;  2WC8 A;  1YX8 A;  4YBH B;  3RLZ A;  4HSZ A;  4PAL A;  4WRI A;  4AOM A;  1IWQ A;  1DMO A;  1EH2 A;  1DF0 B;  3OX6 A;  1K96 A;  4OR9 B;  4FTG A;  4GGF C;  2JTT A;  1XFV O;  4BY4 A;  1K90 D;  1B8C A;  2JRF A;  2LAN A;  2OS8 B;  1HT9 A;  2BCB A;  4WQ2 A;  2LLS A;  1KCY A;  4GBA A;  1BR4 B;  2ZRT A;  1KK7 Z;  1OMD A;  1SPY A;  1J1D A;  5HLO A;  3BUN B;  3D0Y B;  4N1G A;  1RRO A;  1F70 A;  4UPG A;  2JXC A;  1A29 A;  3LCP C;  1G8I A;  1Q80 A;  3KPX A;  4MN0 A;  4OCI A;  2B1U A;  1MXL C;  3I5H B;  4HRG A;  2MA2 A;  3LK0 A;  1QX7 A;  4MRX A;  1PVA A;  4R1E A;  2BBM A;  1U5I A;  4USL A;  1EXR A;  1CDN A;  2HF5 A;  1FI6 A;  1PSB A;  1QX2 A;  3WHT B;  4OKH A;  1JSA A;  3EVR A;  1K9P A;  3BUO B;  3ZNI A;  4PE1 A;  4MBE A;  2MAZ A;  5KTY A;  1YRT B;  3SG4 A;  2M29 A;  3CWG A;  1IJ6 A;  5G08 A;  4C0L A;  1TRF A;  1BF5 A;  1CLL A;  5DKN A;  1AVS A;  2LM5 A;  1L2O C;  1ZUZ A;  1J7O A;  1GQM A;  2CT9 A;  1BOD A;  1YUR A;  3CGA A;  1SY9 A;  3TUY C;  1DGV A;  2D8N A;  1ALV A;  2LP2 A;  2JT3 A;  1S26 D;  3QRX A;  1XA5 A;  1W7I B;  3ZWH A;  4MRY A;  2PAL A;  2AAO A;  1IRJ A;  1DJY A;  1R6P A;  1RTP 1;  1WRL A;  2LUX A;  2ZKM X;  1DJW A;  2OTG B;  1CFP A;  2KSP A;  1K8U A;  1J7Q A;  2KAX A;  1CM4 A;  3GK4 X;  2Y1M A;  2JPT A;  1J1E A;  1KK7 Y;  1DJG A;  2L4I A;  1S5G Z;  2BBN A;  1NCZ A;  1TNX A;  1LA3 A;  1DVI A;  4ORB B;  3BUM B;  2COL B;  2LMU A;  4IL1 A;  2GGM A;  4PE4 A;  1EG3 A;  1KWO C;  1WDC C;  2WOR A;  1H4B A;  1SCV A;  3BUX B;  1F54 A;  1SL7 A;  3TDZ A;  3JTD C;  2H61 C;  4MSP A;  2H61 A;  2KI6 C;  2F8P A;  2BCX A;  1SCM C;  4OVN F;  1UUR A;  2KFF A;  2EC6 C;  1KK8 C;  2MBX A;  1NX0 A;  2M7N A;  1CFC A;  2RGI A;  1CFF A;  2PRU A;  1F4O A;  4AQJ A;  2DOQ A;  4PHM A;  2KI4 C;  1CDP A;  1HQV A;  4C0K A;  1S6J A;  2KYC A;  3DVM A;  1C7V A;  2MJW B;  4N5X A;  1OZO A;  3OX5 A;  2CTN A;  3CS1 A;  1OQP A;  4GGN A;  1CKK A;  3I5I C;  1KQV A;  1AK8 A;  4QJ4 B;  2MLE C;  3OP0 A;  1CNP A;  5TNC A;  2WOS A;  4MEW A;  3HX4 A;  2M9G A;  2SAS A;  1XFW O;  3EK4 A;  1DJI A;  2BCA A;  3KHE A;  1GGW A;  4GAO A;  3CLN A;  1Y1U A;  2LE9 B;  2OPO A;  2K7C A;  2KAY A;  4WQ3 A;  1CLM A;  1SR6 C;  5B8I B;  1ALW A;  1M63 B;  1N0Y A;  3KEV A;  3I5G B;  3NXA A;  2WCF A;  2NZ0 A;  4M2Q A;  2ZRS A;  4YGC B;  1K9U A;  2I2R E;  1NX1 A;  1U5I B;  1JBA A;  3EKH A;  1M45 A;  1VRK A;  2L4H A;  2ZFD A;  1S5G Y;  1RK9 A;  4D1E A;  2LUC A;  1N2D A;  2M97 A;  4PCW A;  1QX5 B;  1JWD A;  2FCE A;  1TN4 A;  2JOJ A;  1B7T Z;  1NX2 A;  2BKI B;  2Q91 A;  3VRO A;  3AAJ A;  3SIB A;  1DT7 B;  1G33 A;  4HRE E;  1KFX S;  3DVE A;  2LP3 A;  4GGF A;  1KQM C;  3ICB A;  1DTL A;  1A75 A;  4PDZ A;  3DVJ A;  5ER5 A;  3GOF A;  3VRP A;  1OE9 B;  2LMV A;  3BOW A;  3WNX B;  5HKY A;  1KSO A;  3LL8 B;  1K95 A;  2G2B A;  2CNP A;  3CTN A;  1B4C A;  1TTX A;  1K93 D;  1NYA A;  2JU0 A;  3VRR A;  1UWO A;  1ZOT B;  4M2P A;  4CPV A;  3OB2 B;  2JQ6 A;  1LXF C;  2JC2 A;  2LMT A;  1LVC D;  1IH0 A;  1NPQ A;  1B47 A;  1B9A A;  4PE0 A;  3VRN A;  3TS5 C;  1SK6 D;  3SG3 A;  2L98 A;  2F3Y A;  1DGU A;  2LV7 A;  1PUL A;  1RJV A;  5AAN A;  1AP4 A;  4JPZ B;  5JOL A;  4CFR A;  1QLK A;  4CID A;  1CMG A;  1BR1 B;  1CLB A;  1H8B A;  2KFG A;  4DS7 A;  2Y4Q A;  5AXI A;  1C7W A;  1S3P A;  1AHR A;  3JVT B;  2Y5I A;  1M31 A;  4DUQ A;  1SMG A;  1IG5 A;  1BMO A;  4NQG A;  3SJS A;  1FF1 A;  3PN7 B;  2R2I A;  2AMI A;  4MLW A;  1IQ5 A;  3A8R A;  1EG4 A;  2EGD A;  4XJK A;  4ICB A;  2KOT A;  4AQI A;  3KO0 A;  5CSI A;  4DIR A;  3OB1 B;  2ISD A;  1XYD A;  2K0J A;  2ZND A;  2I94 A;  1QXP A;  2HET A;  2WND A;  3WXA A;  1V1F A;  2L51 A;  1SW8 A;  2G9B A;  3I5F B;  1BLQ A;  1CB1 A;  1B7T Y;  2A4J A;  2BKH B;  3A4U B;  1ZFS A;  3BQ3 A;  2L5X B;  2OS8 C;  1CMF A;  3HCM A;  2QAC A;  1MUX A;  2FOT A;  3CR4 X;  4HRH A;  4F0Z B;  3O2P A;  1ODB A;  1RFJ A;  2JWW A;  2MRD A;  4I5K A;  4P5O E;  5KSZ A;  2K2F A;  1YX7 A;  3FIA A;  3D0Y A;  4A4B A;  1TIZ A;  2BL0 B;  1S6C A;  2M49 B;  1QIW A;  2M1K B;  1WRK A;  2LHL A;  3LLE A;  3I5H C;  4YI8 A;  4YI9 A;  2M1U A;  1OMV A;  1J55 A;  5HKZ A;  4YGD B;  1UHH A;  4Q04 A;  3DVK A;  4YGB B;  2F33 A;  1PSR A;  3NSL A;  1PK0 D;  3PFV A;  2BEC A;  2TN4 A;  2LLT A;  4MZK A;  1SL9 A;  4ZCU A;  4GUK A;  1XK4 C;  1XO5 A;  4FQO A;  4P2Y B;  2JZI A;  1CFD A;  1BJF A;  4DRW A; 
#chains in the Genus database with same CATH topology
 4BY5 A;  2L2C A;  5BPJ A;  3TZ1 A;  1LA0 A;  3NSK A;  3NSO A;  4C0J A;  1SRA A;  1JC2 A;  3SG7 A;  1CDM A;  2QPT A;  1T14 A;  5HYD A;  3FWB A;  4PE7 A;  4IJ7 A;  3EVV A;  3C1V A;  1F55 A;  1MHO A;  2IS9 A;  3DYE A;  3KF9 A;  1AJ4 A;  2Y1N A;  1F4Q A;  1DJH A;  3AAK A;  1FPW A;  1NX3 A;  1EJ3 A;  4U8D A;  1JFJ A;  1TNQ A;  1LIN A;  3LK1 A;  1Y0V H;  4XYN A;  2JXL A;  5I2L A;  2GTE A;  5ER4 X;  3SIA A;  5K89 A;  3AKB A;  5D69 A;  1BOC A;  1W7J B;  2ZNE A;  3E3R A;  4GNK B;  5EL2 A;  1NSH A;  1KFU L;  1BT6 A;  1TNP A;  2V53 A;  1XVJ A;  1NP8 A;  1GJY A;  5AEQ A;  1A4P A;  2L2E A;  2OTG C;  2ZN9 A;  3BXK A;  2QEO A;  2KBM A;  1B1G A;  2JT0 A;  1NWD A;  3O4Y A;  5F6T A;  4FQT A;  3B86 A;  1E8A A;  1KFX L;  2CXJ A;  2WCE A;  2MHH A;  2KYF A;  2K8M B;  3FE8 A;  4YRU A;  2JT8 A;  2JNF A;  2K7B A;  1QLS A;  3EK7 A;  5D7F A;  5I2Q A;  2F2O A;  2JNX A;  2BAP A;  2K61 A;  1NCY A;  1SSE B;  3FE6 A;  2KPH A;  3O78 A;  1OOJ A;  4PHN A;  4QJ5 B;  2P70 A;  2KHN A;  2KGR A;  1IKU A;  4ZCV A;  1REC A;  2PSR A;  1W9Z A;  1SBJ A;  1YVL A;  2NCP A;  2CBL A;  2PMY A;  4I5L B;  1KSM A;  1L2O B;  4N1F A;  2HPS A;  2PVB A;  3GK1 A;  3S0E A;  2AUC A;  5CPV A;  1UP5 A;  2HQ8 A;  1S6I A;  2JTZ A;  2KLE A;  3NGV A;  3RZS A;  3TUY B;  2ZN8 A;  2WCH A;  3PSR A;  1ZMZ A;  5FI2 A;  3AKA A;  3VGO A;  5I2O A;  2PAS A;  4JKT A;  4CLN A;  1UUS A;  2LC5 A;  4I5J A;  3CZ2 A;  2BE6 A;  1YUT A;  1TUZ A;  3DF0 A;  1QAS A;  1IGV A;  2LVV A;  4L9M A;  2P6B B;  2E30 A;  1SL8 A;  1CTR A;  2KGB C;  1LKJ A;  1CDL A;  4ORC B;  2L50 A;  1GM0 A;  2NXQ A;  3EKJ A;  3CYZ A;  1S1E A;  1DQE A;  2E6W A;  3CZT X;  3I5G C;  1UHJ A;  1KWO B;  1WDC B;  3WHU B;  4NDD A;  3VRQ A;  1F8H A;  1QIV A;  1J7P A;  5DKR A;  2FJU B;  2K7D A;  3GK2 A;  1JUO A;  4MZL A;  3RM1 A;  1NUB A;  4YGE B;  3IF7 A;  3PM8 A;  1JF0 A;  1JF2 A;  3SG6 A;  1MQ1 A;  1S36 A;  3JTD B;  1RWY A;  1YUU A;  2KAV A;  2LHI A;  2NCO A;  3SG2 A;  1SCM B;  1IQ3 A;  4NDC A;  1XFU O;  2EC6 B;  2Q4U A;  1A2X A;  1KK8 B;  2FCD A;  1XFX O;  2GV5 A;  5KU1 A;  2KI6 D;  1DF0 A;  2LVK A;  2KI4 B;  3OHM B;  1YRU B;  1IJ5 A;  1Y1A A;  2H2K A;  1QS7 A;  5FYX A;  4ETO A;  1OMR A;  2M3W A;  1DJX A;  4ORA B;  4GPL B;  2LLU A;  2KQY A;  3CR2 A;  3D77 A;  1X02 A;  2HQW A;  3I5I B;  2NLN A;  3CAB A;  2SCP A;  2F2P A;  2F3Z A;  2MLF C;  2O5G A;  3PAL A;  3BUW B;  4A4C A;  3D10 A;  1QVI Z;  1F71 A;  1FBV A;  1QAT A;  4QJ3 B;  4I5N B;  3FS7 A;  2LCP A;  5I8N A;  3D76 A;  1DEK A;  1DJZ A;  2CCM A;  1M46 A;  2I7A A;  1MWN A;  1AUI B;  1QWV A;  2KDH A;  5IBW A;  1M39 A;  2M7L A;  1FW4 A;  1SR6 B;  1QJT A;  1UHN A;  1TOP A;  1V1G A;  2QEH A;  4MZJ A;  1BU3 A;  1XFZ O;  3PAT A;  3EVU A;  2O60 A;  3MSE B;  2EHB A;  1WY9 A;  4JQ0 D;  5J3X A;  1GGZ A;  1YVH A;  1XK4 A;  3DY9 A;  1OZS A;  1K94 A;  2JUL A;  5PAL A;  4YGA A;  3TDU A;  5HKW A;  5AER A;  3JVT C;  1QV1 A;  3IQO A;  1YR5 A;  1FI5 A;  1C3Y A;  3EK8 A;  3BYA A;  2K2A A;  5CSN A;  1QTX A;  1SKT A;  1B8L A;  1MF8 B;  1NCX A;  3PN7 C;  3PLF B;  1SYM A;  1OW4 A;  2K7O A;  1N65 A;  4OV2 A;  1PAL A;  1K2H A;  1R2U A;  5CSF A;  2I18 A;  1AJ5 A;  1PRW A;  1ORG A;  5FI7 A;  1KQM B;  1A75 B;  1G4Y R;  4GFT A;  4NDB A;  1JFK A;  2KFH A;  3BOW B;  1D1O A;  1WRZ A;  1TCO B;  2KQ6 A;  1OOH A;  1XFY O;  4E68 A;  1WLM A;  3TDI A;  3IQQ A;  5JJG A;  3K21 A;  3I5F C;  4TNC A;  4JWQ A;  1WLZ A;  1MR8 A;  2GGZ A;  2KNE A;  2LVJ A;  1TNW A;  4CFQ A;  3D73 A;  3DD4 A;  3H4S E;  5CSJ A;  1TCF A;  1Y6W A;  5HLV A;  1J7R A;  1MXE A;  2L0P A;  3TS5 B;  3F45 A;  2BL0 C;  2BNX A;  3DF0 B;  1QVI Y;  4DCK A;  2M8U A;  2LNK A;  2M0R A;  1B8R A;  4PHJ A;  3FWC A;  2VRG A;  1UHK A;  3PM2 A;  3M0W A;  5DKQ A;  1QV0 A;  1YUS A;  5GQQ C;  2LAP A;  1Y1X A;  1LS8 A;  3SG5 A;  2YGU A;  4MVF A;  2BE4 A;  4PHK A;  1BG1 A;  3EG5 B;  1Z2C B;  1UHI A;  1OSA A;  2KBI A;  2LVI A;  1A03 A;  1YTZ C;  1C07 A;  5AFP A;  3O6B A;  1SNL A;  1NIW A;  1PVB A;  1K9K A;  4XJK B;  1ZAC A;  1KFU S;  3CR5 X;  1L7Z A;  2WCB A;  2JPO A;  1CM1 A;  3NSI A;  4M2O A;  1EL4 A;  3B7A A;  2WC8 A;  1YX8 A;  4YBH B;  3RLZ A;  4HSZ A;  4PAL A;  5DIC A;  4WRI A;  4AOM A;  1IWQ A;  1DMO A;  1EH2 A;  1DF0 B;  3OX6 A;  1K96 A;  4OR9 B;  4FTG A;  3PJI A;  3QME A;  1Z4H A;  2JTT A;  1XFV O;  4GGF C;  4BY4 A;  1K90 D;  1B8C A;  2JRF A;  2LAN A;  2OS8 B;  1HT9 A;  2BCB A;  4WQ2 A;  2LLS A;  1KCY A;  4GBA A;  1BR4 B;  1TUJ A;  2ZRT A;  1KK7 Z;  1OMD A;  1SPY A;  1J1D A;  1P28 A;  5HLO A;  3BUN B;  3D0Y B;  4N1G A;  1RRO A;  5HL1 A;  1F70 A;  4UPG A;  2JXC A;  5D3O A;  1A29 A;  3LCP C;  1G8I A;  1Q80 A;  3UO9 A;  3KPX A;  4MN0 A;  4OCI A;  2B1U A;  1MXL C;  3I5H B;  4HRG A;  2MA2 A;  3LK0 A;  1QX7 A;  4MRX A;  1PVA A;  4R1E A;  2BBM A;  2PYQ A;  1U5I A;  4USL A;  1EXR A;  1CDN A;  3SS4 A;  3BFH A;  2HF5 A;  2H8V A;  1FI6 A;  1PSB A;  1QX2 A;  3WHT B;  3D74 A;  1IIO A;  4OKH A;  1JSA A;  3EVR A;  1K9P A;  2QEV A;  2ERB A;  3BUO B;  3ZNI A;  4PE1 A;  4MBE A;  2MAZ A;  1XFR A;  5KTY A;  1YRT B;  3SG4 A;  2FJY A;  2M29 A;  2QEB A;  1IJ6 A;  3CWG A;  3OBV A;  5G08 A;  4C0L A;  1TRF A;  1BF5 A;  1CLL A;  3Q8I A;  3DXL A;  5DKN A;  1AVS A;  2LM5 A;  1L2O C;  1ZUZ A;  1J7O A;  1GQM A;  3CDN A;  2CT9 A;  1BOD A;  1OOI X;  1YUR A;  3CGA A;  1SY9 A;  3TUY C;  1DGV A;  2D8N A;  1ALV A;  2LP2 A;  2JT3 A;  1S26 D;  5I94 A;  3QRX A;  1XA5 A;  1W7I B;  3ZWH A;  4MRY A;  2PAL A;  2AAO A;  1IRJ A;  1DJY A;  1R6P A;  1RTP 1;  1WRL A;  2LUX A;  2ZKM X;  1DJW A;  2OTG B;  3B88 A;  1CFP A;  3SS3 A;  2KSP A;  2QDI A;  1K8U A;  1J7Q A;  2KAX A;  1CM4 A;  3GK4 X;  3N7H A;  2Y1M A;  2JPT A;  3L4A A;  3S0F A;  1J1E A;  1KK7 Y;  1DJG A;  2L4I A;  1S5G Z;  2BBN A;  1NCZ A;  3D78 A;  1TNX A;  1LA3 A;  1DVI A;  3UNW A;  4ORB B;  3BUM B;  2COL B;  2LMU A;  3R1V A;  4IL1 A;  2GGM A;  4PE4 A;  1EG3 A;  1KWO C;  1WDC C;  3BJH A;  3V2L A;  2WOR A;  1H4B A;  1SCV A;  2WCM A;  3BUX B;  1F54 A;  1SL7 A;  3TDZ A;  3JTD C;  2H61 C;  4MSP A;  2H61 A;  2KI6 C;  2F8P A;  2BCX A;  1SCM C;  4OVN F;  1UUR A;  2KFF A;  4OZD A;  2EC6 C;  1KK8 C;  2MBX A;  1NX0 A;  2M7N A;  1CFC A;  2RGI A;  1CFF A;  2PRU A;  1F4O A;  4INX A;  2DOQ A;  4PHM A;  1DEL A;  2KI4 C;  4AQJ A;  1CDP A;  4F7F A;  1HQV A;  3CZ1 A;  4C0K A;  2KLD A;  1S6J A;  2KYC A;  3DVM A;  1C7V A;  2MJW B;  4N5X A;  1OZO A;  1DC1 A;  3OX5 A;  2CTN A;  3B6X A;  1OQP A;  3CS1 A;  3OGN A;  3I5I C;  3K1E A;  4GGN A;  1CKK A;  1KQV A;  2K60 A;  1AK8 A;  2WCK A;  4QJ4 B;  2MLE C;  2WC5 A;  3OP0 A;  5TNC A;  1CNP A;  2WOS A;  3R72 A;  4MEW A;  3HX4 A;  2M9G A;  2SAS A;  1XFW O;  3EK4 A;  1DJI A;  3R1P A;  2BCA A;  3KHE A;  1GGW A;  4GAO A;  3CLN A;  1Y1U A;  3S0A A;  2LE9 B;  2OPO A;  3BFB A;  2K7C A;  2KAY A;  4WQ3 A;  1CLM A;  1SR6 C;  5B8I B;  1ALW A;  1M63 B;  1N0Y A;  3KEV A;  3I5G B;  3NXA A;  2WCF A;  3L4L A;  2NZ0 A;  4JD9 A;  4M2Q A;  2ZRS A;  4YGC B;  1K9U A;  2I2R E;  3CZ0 A;  1NX1 A;  1U5I B;  1OOG A;  3IVT A;  3S0B A;  1JBA A;  3EKH A;  1M45 A;  1VRK A;  2L4H A;  3NHI A;  2ZFD A;  1S5G Y;  1RK9 A;  4D1E A;  2LUC A;  1N2D A;  2M97 A;  4PCW A;  1QX5 B;  1JWD A;  2FCE A;  1TN4 A;  2WCJ A;  3VB1 A;  2JOJ A;  1B7T Z;  1NX2 A;  2BKI B;  3O4X A;  2Q91 A;  4PT1 A;  3AAJ A;  3SIB A;  3VRO A;  1DT7 B;  1G33 A;  4HRE E;  1KFX S;  3DVE A;  2LP3 A;  3FE9 A;  4GGF A;  1KQM C;  3ICB A;  1DTL A;  1TWO A;  1A75 A;  4PDZ A;  3DVJ A;  5ER5 A;  3GOF A;  3VRP A;  1OE9 B;  2LMV A;  3BOW A;  3NHT A;  3WNX B;  1KSO A;  3LL8 B;  5HKY A;  1K95 A;  2G2B A;  2WCL A;  2CNP A;  3CTN A;  1B4C A;  1TTX A;  1K93 D;  1NYA A;  2JU0 A;  3VRR A;  1UWO A;  1ZOT B;  2P71 A;  3L47 A;  4M2P A;  4CPV A;  3OB2 B;  2JQ6 A;  3S0G A;  1LXF C;  2JC2 A;  2LMT A;  1LVC D;  1IH0 A;  1NPQ A;  1B47 A;  1B9A A;  4PE0 A;  3VRN A;  3TS5 C;  1SK6 D;  3SG3 A;  2L98 A;  2F3Y A;  1DGU A;  2LV7 A;  1PUL A;  1RJV A;  5AAN A;  3R1O A;  1AP4 A;  4JPZ B;  5JOL A;  4CFR A;  1QLK A;  4CID A;  1CMG A;  1BR1 B;  1CLB A;  1H8B A;  2KFG A;  4KYN A;  4DS7 A;  2Y4Q A;  5AXI A;  1C7W A;  1S3P A;  1AHR A;  3JVT B;  2Y5I A;  1M31 A;  4DUQ A;  1SMG A;  1IG5 A;  1BMO A;  4NQG A;  3SJS A;  1FF1 A;  3PN7 B;  2R2I A;  2AMI A;  4MLW A;  2WC6 A;  3B87 A;  4INW A;  1IQ5 A;  3A8R A;  1EG4 A;  2EGD A;  4XJK A;  4ICB A;  2KOT A;  4AQI A;  3KO0 A;  5CSI A;  4DIR A;  3OB1 B;  2ISD A;  1XYD A;  2K0J A;  2ZND A;  1C3Z A;  2I94 A;  1QXP A;  2HET A;  2WND A;  3WXA A;  1V1F A;  2L51 A;  1SW8 A;  2G9B A;  3I5F B;  1BLQ A;  1CB1 A;  1B7T Y;  2A4J A;  2BKH B;  3A4U B;  1ZFS A;  2PQL A;  3BQ3 A;  2L5X B;  2OS8 C;  1CMF A;  5FI6 A;  3HCM A;  2QAC A;  1MUX A;  2FOT A;  3S0D A;  3CR4 X;  4HRH A;  4F0Z B;  3O2P A;  1ODB A;  1RFJ A;  2JWW A;  2MRD A;  4I5K A;  4P5O E;  5KSZ A;  2K2F A;  1YX7 A;  3FIA A;  3D0Y A;  4A4B A;  1TIZ A;  2BL0 B;  1S6C A;  2M49 B;  1QIW A;  2M1K B;  1WRK A;  2LHL A;  3LLE A;  3I5H C;  2L5Y A;  4YI8 A;  4YI9 A;  2M1U A;  1OOF A;  1OMV A;  1J55 A;  5HKZ A;  4YGD B;  1UHH A;  4Q04 A;  3DVK A;  4YGB B;  2F33 A;  1PSR A;  3NSL A;  1PK0 D;  3PFV A;  2BEC A;  2TN4 A;  3SS5 A;  2LLT A;  3DZT A;  1SL9 A;  4MZK A;  3D75 A;  4ZCU A;  3BFA A;  4GUK A;  1XK4 C;  1XO5 A;  4FQO A;  4P2Y B;  2JZI A;  1CFD A;  1BJF A;  4DRW A; 
#chains in the Genus database with same CATH homology
 4BY5 A;  5BPJ A;  3TZ1 A;  1LA0 A;  3NSK A;  3NSO A;  4C0J A;  1SRA A;  1JC2 A;  3SG7 A;  1CDM A;  2QPT A;  5HYD A;  3FWB A;  4PE7 A;  3EVV A;  3C1V A;  1F55 A;  1MHO A;  2IS9 A;  3KF9 A;  1AJ4 A;  2Y1N A;  1F4Q A;  1DJH A;  3AAK A;  1FPW A;  1NX3 A;  1EJ3 A;  4U8D A;  1JFJ A;  1TNQ A;  1LIN A;  3LK1 A;  1Y0V H;  4XYN A;  2JXL A;  5I2L A;  5ER4 X;  3SIA A;  5K89 A;  3AKB A;  5D69 A;  1BOC A;  1W7J B;  2ZNE A;  3E3R A;  4GNK B;  1NSH A;  1KFU L;  1BT6 A;  1TNP A;  2V53 A;  1XVJ A;  1NP8 A;  1GJY A;  5AEQ A;  1A4P A;  2L2E A;  2OTG C;  2ZN9 A;  3BXK A;  2KBM A;  1B1G A;  2JT0 A;  1NWD A;  3O4Y A;  5F6T A;  1E8A A;  1KFX L;  2CXJ A;  2WCE A;  2MHH A;  2KYF A;  2K8M B;  4YRU A;  2JT8 A;  2JNF A;  2K7B A;  1QLS A;  3EK7 A;  5D7F A;  5I2Q A;  2F2O A;  2JNX A;  2K61 A;  1NCY A;  3O78 A;  1OOJ A;  4PHN A;  4QJ5 B;  2KHN A;  2KGR A;  1IKU A;  4ZCV A;  1REC A;  2PSR A;  1SBJ A;  1YVL A;  2NCP A;  2CBL A;  2PMY A;  4I5L B;  1KSM A;  1L2O B;  4N1F A;  2HPS A;  2PVB A;  3GK1 A;  2AUC A;  5CPV A;  1UP5 A;  2HQ8 A;  1S6I A;  2JTZ A;  3TUY B;  2ZN8 A;  3PSR A;  1ZMZ A;  3AKA A;  3VGO A;  5I2O A;  2PAS A;  4CLN A;  1UUS A;  2LC5 A;  4I5J A;  2BE6 A;  1YUT A;  3DF0 A;  1QAS A;  1IGV A;  2LVV A;  4L9M A;  2P6B B;  2E30 A;  1SL8 A;  1CTR A;  2KGB C;  1LKJ A;  1CDL A;  4ORC B;  2L50 A;  2NXQ A;  3EKJ A;  1S1E A;  3CZT X;  2E6W A;  3I5G C;  1UHJ A;  1KWO B;  1WDC B;  3WHU B;  4NDD A;  3VRQ A;  1F8H A;  1QIV A;  1J7P A;  5DKR A;  2FJU B;  2K7D A;  3GK2 A;  1JUO A;  4MZL A;  3RM1 A;  1NUB A;  4YGE B;  3IF7 A;  3PM8 A;  1JF0 A;  1JF2 A;  3SG6 A;  1MQ1 A;  1S36 A;  3JTD B;  1RWY A;  1YUU A;  2KAV A;  2LHI A;  2NCO A;  3SG2 A;  1SCM B;  1IQ3 A;  4NDC A;  1XFU O;  2EC6 B;  2Q4U A;  1A2X A;  1KK8 B;  2FCD A;  1XFX O;  2GV5 A;  5KU1 A;  2KI6 D;  1DF0 A;  2LVK A;  2KI4 B;  3OHM B;  1YRU B;  1IJ5 A;  1Y1A A;  2H2K A;  1QS7 A;  5FYX A;  4ETO A;  1OMR A;  2M3W A;  1DJX A;  4ORA B;  4GPL B;  2LLU A;  2KQY A;  3CR2 A;  1X02 A;  2HQW A;  3I5I B;  2NLN A;  2SCP A;  2F2P A;  2F3Z A;  2MLF C;  2O5G A;  3PAL A;  3BUW B;  4A4C A;  3D10 A;  1QVI Z;  1F71 A;  1FBV A;  1QAT A;  4QJ3 B;  4I5N B;  3FS7 A;  2LCP A;  5I8N A;  1DJZ A;  2CCM A;  1M46 A;  2I7A A;  1MWN A;  1AUI B;  5IBW A;  2KDH A;  1M39 A;  2M7L A;  1FW4 A;  1SR6 B;  1QJT A;  1UHN A;  1TOP A;  1V1G A;  4MZJ A;  1BU3 A;  1XFZ O;  3PAT A;  3EVU A;  2O60 A;  3MSE B;  2EHB A;  1WY9 A;  4JQ0 D;  5J3X A;  1GGZ A;  1YVH A;  1XK4 A;  1OZS A;  1K94 A;  2JUL A;  5PAL A;  4YGA A;  3TDU A;  5HKW A;  5AER A;  3JVT C;  1QV1 A;  3IQO A;  1YR5 A;  1FI5 A;  3EK8 A;  3BYA A;  2K2A A;  5CSN A;  1QTX A;  1SKT A;  1B8L A;  1MF8 B;  1NCX A;  3PN7 C;  3PLF B;  1SYM A;  2K7O A;  4OV2 A;  1N65 A;  1PAL A;  1K2H A;  1R2U A;  5CSF A;  2I18 A;  1AJ5 A;  1PRW A;  1KQM B;  1A75 B;  1G4Y R;  4GFT A;  4NDB A;  1JFK A;  2KFH A;  3BOW B;  1D1O A;  1WRZ A;  1TCO B;  2KQ6 A;  1XFY O;  4E68 A;  1WLM A;  3TDI A;  3IQQ A;  5JJG A;  3K21 A;  3I5F C;  4TNC A;  4JWQ A;  1WLZ A;  1MR8 A;  2GGZ A;  2KNE A;  2LVJ A;  1TNW A;  4CFQ A;  3DD4 A;  3H4S E;  5CSJ A;  1TCF A;  1Y6W A;  5HLV A;  1J7R A;  1MXE A;  2L0P A;  3TS5 B;  3F45 A;  2BL0 C;  3DF0 B;  1QVI Y;  4DCK A;  2M8U A;  2LNK A;  2M0R A;  1B8R A;  4PHJ A;  3FWC A;  2VRG A;  1UHK A;  3M0W A;  5DKQ A;  1QV0 A;  1YUS A;  5GQQ C;  2LAP A;  1Y1X A;  3SG5 A;  4MVF A;  2BE4 A;  4PHK A;  1BG1 A;  1UHI A;  1OSA A;  2KBI A;  2LVI A;  1A03 A;  1YTZ C;  1C07 A;  5AFP A;  3O6B A;  1SNL A;  1NIW A;  1PVB A;  1K9K A;  4XJK B;  1ZAC A;  1KFU S;  3CR5 X;  1L7Z A;  2WCB A;  1CM1 A;  3NSI A;  4M2O A;  1EL4 A;  2WC8 A;  1YX8 A;  4YBH B;  3RLZ A;  4HSZ A;  4PAL A;  4WRI A;  4AOM A;  1IWQ A;  1DMO A;  1EH2 A;  1DF0 B;  3OX6 A;  1K96 A;  4OR9 B;  4FTG A;  4GGF C;  2JTT A;  1XFV O;  4BY4 A;  1K90 D;  1B8C A;  2JRF A;  2LAN A;  2OS8 B;  1HT9 A;  2BCB A;  4WQ2 A;  2LLS A;  1KCY A;  4GBA A;  1BR4 B;  2ZRT A;  1KK7 Z;  1OMD A;  1SPY A;  1J1D A;  5HLO A;  3BUN B;  3D0Y B;  4N1G A;  1RRO A;  1F70 A;  4UPG A;  2JXC A;  1A29 A;  3LCP C;  1G8I A;  1Q80 A;  3KPX A;  4MN0 A;  4OCI A;  2B1U A;  1MXL C;  3I5H B;  4HRG A;  2MA2 A;  3LK0 A;  1QX7 A;  4MRX A;  1PVA A;  4R1E A;  2BBM A;  1U5I A;  4USL A;  1EXR A;  1CDN A;  2HF5 A;  1FI6 A;  1PSB A;  1QX2 A;  3WHT B;  4OKH A;  1JSA A;  3EVR A;  1K9P A;  3BUO B;  3ZNI A;  4PE1 A;  4MBE A;  2MAZ A;  5KTY A;  1YRT B;  3SG4 A;  2M29 A;  3CWG A;  1IJ6 A;  5G08 A;  4C0L A;  1TRF A;  1BF5 A;  1CLL A;  5DKN A;  1AVS A;  2LM5 A;  1L2O C;  1ZUZ A;  1J7O A;  1GQM A;  2CT9 A;  1BOD A;  1YUR A;  3CGA A;  1SY9 A;  3TUY C;  1DGV A;  2D8N A;  1ALV A;  2LP2 A;  2JT3 A;  1S26 D;  3QRX A;  1XA5 A;  1W7I B;  3ZWH A;  4MRY A;  2PAL A;  2AAO A;  1IRJ A;  1DJY A;  1R6P A;  1RTP 1;  1WRL A;  2LUX A;  2ZKM X;  1DJW A;  2OTG B;  1CFP A;  2KSP A;  1K8U A;  1J7Q A;  2KAX A;  1CM4 A;  3GK4 X;  2Y1M A;  2JPT A;  1J1E A;  1KK7 Y;  1DJG A;  2L4I A;  1S5G Z;  2BBN A;  1NCZ A;  1TNX A;  1LA3 A;  1DVI A;  4ORB B;  3BUM B;  2COL B;  2LMU A;  4IL1 A;  2GGM A;  4PE4 A;  1EG3 A;  1KWO C;  1WDC C;  2WOR A;  1H4B A;  1SCV A;  3BUX B;  1F54 A;  1SL7 A;  3TDZ A;  3JTD C;  2H61 C;  4MSP A;  2H61 A;  2KI6 C;  2F8P A;  2BCX A;  1SCM C;  4OVN F;  1UUR A;  2KFF A;  2EC6 C;  1KK8 C;  2MBX A;  1NX0 A;  2M7N A;  1CFC A;  2RGI A;  1CFF A;  2PRU A;  1F4O A;  4AQJ A;  2DOQ A;  4PHM A;  2KI4 C;  1CDP A;  1HQV A;  4C0K A;  1S6J A;  2KYC A;  3DVM A;  1C7V A;  2MJW B;  4N5X A;  1OZO A;  3OX5 A;  2CTN A;  3CS1 A;  1OQP A;  4GGN A;  1CKK A;  3I5I C;  1KQV A;  1AK8 A;  4QJ4 B;  2MLE C;  3OP0 A;  1CNP A;  5TNC A;  2WOS A;  4MEW A;  3HX4 A;  2M9G A;  2SAS A;  1XFW O;  3EK4 A;  1DJI A;  2BCA A;  3KHE A;  1GGW A;  4GAO A;  3CLN A;  1Y1U A;  2LE9 B;  2OPO A;  2K7C A;  2KAY A;  4WQ3 A;  1CLM A;  1SR6 C;  5B8I B;  1ALW A;  1M63 B;  1N0Y A;  3KEV A;  3I5G B;  3NXA A;  2WCF A;  2NZ0 A;  4M2Q A;  2ZRS A;  4YGC B;  1K9U A;  2I2R E;  1NX1 A;  1U5I B;  1JBA A;  3EKH A;  1M45 A;  1VRK A;  2L4H A;  2ZFD A;  1S5G Y;  1RK9 A;  4D1E A;  2LUC A;  1N2D A;  2M97 A;  4PCW A;  1QX5 B;  1JWD A;  2FCE A;  1TN4 A;  2JOJ A;  1B7T Z;  1NX2 A;  2BKI B;  2Q91 A;  3VRO A;  3AAJ A;  3SIB A;  1DT7 B;  1G33 A;  4HRE E;  1KFX S;  3DVE A;  2LP3 A;  4GGF A;  1KQM C;  3ICB A;  1DTL A;  1A75 A;  4PDZ A;  3DVJ A;  5ER5 A;  3GOF A;  3VRP A;  1OE9 B;  2LMV A;  3BOW A;  3WNX B;  5HKY A;  1KSO A;  3LL8 B;  1K95 A;  2G2B A;  2CNP A;  3CTN A;  1B4C A;  1TTX A;  1K93 D;  1NYA A;  2JU0 A;  3VRR A;  1UWO A;  1ZOT B;  4M2P A;  4CPV A;  3OB2 B;  2JQ6 A;  1LXF C;  2JC2 A;  2LMT A;  1LVC D;  1IH0 A;  1NPQ A;  1B47 A;  1B9A A;  4PE0 A;  3VRN A;  3TS5 C;  1SK6 D;  3SG3 A;  2L98 A;  2F3Y A;  1DGU A;  2LV7 A;  1PUL A;  1RJV A;  5AAN A;  1AP4 A;  4JPZ B;  5JOL A;  4CFR A;  1QLK A;  4CID A;  1CMG A;  1BR1 B;  1CLB A;  1H8B A;  2KFG A;  4DS7 A;  2Y4Q A;  5AXI A;  1C7W A;  1S3P A;  1AHR A;  3JVT B;  2Y5I A;  1M31 A;  4DUQ A;  1SMG A;  1IG5 A;  1BMO A;  4NQG A;  3SJS A;  1FF1 A;  3PN7 B;  2R2I A;  2AMI A;  4MLW A;  1IQ5 A;  3A8R A;  1EG4 A;  2EGD A;  4XJK A;  4ICB A;  2KOT A;  4AQI A;  3KO0 A;  5CSI A;  4DIR A;  3OB1 B;  2ISD A;  1XYD A;  2K0J A;  2ZND A;  2I94 A;  1QXP A;  2HET A;  2WND A;  3WXA A;  1V1F A;  2L51 A;  1SW8 A;  2G9B A;  3I5F B;  1BLQ A;  1CB1 A;  1B7T Y;  2A4J A;  2BKH B;  3A4U B;  1ZFS A;  3BQ3 A;  2L5X B;  2OS8 C;  1CMF A;  3HCM A;  2QAC A;  1MUX A;  2FOT A;  3CR4 X;  4HRH A;  4F0Z B;  3O2P A;  1ODB A;  1RFJ A;  2JWW A;  2MRD A;  4I5K A;  4P5O E;  5KSZ A;  2K2F A;  1YX7 A;  3FIA A;  3D0Y A;  4A4B A;  1TIZ A;  2BL0 B;  1S6C A;  2M49 B;  1QIW A;  2M1K B;  1WRK A;  2LHL A;  3LLE A;  3I5H C;  4YI8 A;  4YI9 A;  2M1U A;  1OMV A;  1J55 A;  5HKZ A;  4YGD B;  1UHH A;  4Q04 A;  3DVK A;  4YGB B;  2F33 A;  1PSR A;  3NSL A;  1PK0 D;  3PFV A;  2BEC A;  2TN4 A;  2LLT A;  4MZK A;  1SL9 A;  4ZCU A;  4GUK A;  1XK4 C;  1XO5 A;  4FQO A;  4P2Y B;  2JZI A;  1CFD A;  1BJF A;  4DRW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...