1QLKA

Solution structure of ca(2+)-loaded rat s100b (betabeta) nmr, 20 structures
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
92
structure length
92
Chain Sequence
b'MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDEDGDGECDFQEFMAFVSMVTTACHEFFEHE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-100 PROTEIN
publication title Solution structure of calcium-bound rat S100B(betabeta) as determined by nuclear magnetic resonance spectroscopy,.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Calcium-binding
total genus 24
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1qlkA00
2CBLA 3DD4A 4OVNF 1BOCA 2G9BA 1DGVA 1M63B 1PULA 1DT7B 3DVMA 5KU1A 1L2OB 2PRUA 2KHNA 1YUUA 1QASA 2AUCA 4QJ3B 1SL9A 1WRZA 4M2OA 2LV7A 1S3PA 1LKJA 1OSAA 1K2HA 2MA2A 2TN4A 5AEQA 1QXPA 1KK8C 4PE0A 1M46A 2HETA 1YURA 4HSZA 1YTZC 4JQ0D 4ORAB 5CSFA 1OE9B 1JFKA 1KFXS 2VRGA 3RM1A 3HCMA 2PVBA 5J3XA 1AVSA 2HPSA 1TCOB 1CFPA 5HLVA 3FS7A 2JNXA 3DF0B 1GJYA 2BECA 3GK2A 4C0JA 1J1EA 5I2OA 3EVRA 1H4BA 1GQMA 2F8PA 2KAVA 2KGRA 2LMVA 2LC5A 3EVUA 2WC8A 2MLFC 2PASA 3PM8A 2K8MB 1UHNA 1ZACA 2ZFDA 4MVFA 5JJGA 2LMUA 1EG3A 3VRQA 1EL4A 2LAPA 1FF1A 2LVVA 2K7OA 3CGAA 3AAKA 1K9UA 3BUMB 4PDZA 4XJKB 1LVCD 4QJ4B 1PVAA 1AHRA 2MLEC 3SG5A 5BPJA 4MZLA 1WRKA 3PATA 1KSMA 1W7JB 3DF0A 1DJHA 5HKYA 3O2PA 1CDMA 3NXAA 3BOWB 3AAJA 4NDBA 3CTNA 2L2EA 2LLTA 4PHNA 4A4CA 2L4HA 2LHLA 5D7FA 1XFVO 2M49B 2NLNA 3VRNA 1KFUS 1JUOA 2LHIA 2PSRA 1B7TY 2MAZA 3WHTB 1A03A 1TCFA 4ZCUA 4ICBA 1OMDA 2H61C 1K96A 1S5GY 1F70A 1F54A 2P6BB 1R2UA 4BY5A 1NUBA 1CFCA 1QATA 1ZUZA 3AKAA 4XJKA 4BY4A 1QLKA 1CDNA 1S6JA 1W7IB 1Y1XA 5D69A 1YR5A 2L4IA 2IS9A 5JOLA 2L50A 1SRAA 3FIAA 5CSNA 3BOWA 4U8DA 1ALWA 1RROA 3DVJA 3FWBA 1CKKA 1A4PA 2I2RE 1OQPA 3LL8B 2QPTA 4NQGA 5AXIA 1JF0A 1IG5A 1SBJA 1JF2A 5CSJA 1F55A 1PSBA 5DKRA 3WHUB 5ER4X 4HRGA 3GK1A 5CPVA 1B4CA 1AUIB 4YGBB 3I5HC 3D0YB 1BODA 2M29A 4OR9B 4GGNA 1UUSA 1J7QA 1QVIZ 2H61A 1RK9A 1SKTA 3I5HB 4GGFC 1TIZA 1PVBA 1IQ3A 4MRYA 1M45A 1DJWA 1F4OA 1LINA 2JC2A 2WNDA 2E30A 3OP0A 3O4YA 4DS7A 4AQJA 1DJYA 1ZMZA 5IBWA 1DJIA 3PFVA 2KQYA 3PN7C 4I5JA 4DUQA 4YGAA 3JTDC 2M7NA 2NCOA 3O6BA 3PN7B 1NSHA 5DKQA 3FWCA 1RTP1 1EXRA 1FW4A 1DMOA 3JTDB 1KQVA 1DJXA 3IF7A 2CXJA 5PALA 4CFRA 2JT8A 3D0YA 1IH0A 2ZN9A 2BCXA 3F45A 1XK4C 2CCMA 5I8NA 2I7AA 1QIVA 4MSPA 1J7OA 3K21A 2SCPA 1HT9A 2OS8C 3WNXB 1ALVA 1TOPA 3ZWHA 1BU3A 4DIRA 1BMOA 4GGFA 1A75A 1UHJA 2JU0A 4D1EA 2OS8B 5GQQC 1Y6WA 2K61A 3E3RA 1L2OC 1QV1A 1OMVA 1WY9A 2ZRSA 1FPWA 2G2BA 4JWQA 1SW8A 3CLNA 3OB2B 1NCYA 1K95A 3CR4X 1U5IA 5I2QA 1FI5A 1IWQA 3A4UB 3SG4A 1YVHA 2NXQA 1ZOTB 1YUTA 1K8UA 2KYCA 2RGIA 4UPGA 1XK4A 2F33A 1XFXO 2LVIA 1IGVA 2V53A 3CR5X 1Y1UA 3ICBA 2LP2A 1V1GA 2JTTA 1PK0D 4WQ2A 4OCIA 4PE1A 1YX8A 2COLB 1PRWA 4ETOA 3BUWB 1J1DA 4HREE 2KNEA 2LCPA 2LLSA 2M9GA 1H8BA 1DF0B 4MN0A 3LK0A 1OZOA 1XFWO 2Y1NA 4GPLB 1CB1A 3QRXA 2JOJA 1UHHA 1F8HA 1JFJA 2LNKA 4MLWA 1CLBA 5F6TA 2JULA 1NCZA 2M8UA 1KCYA 1QLSA 1SNLA 1SK6D 1G33A 4GBAA 1MHOA 3PALA 4F0ZB 2L51A 3TS5C 1F71A 4PHJA 1K94A 1VRKA 3I5GC 3TS5B 1AJ5A 1LA3A 1QX2A 2Q91A 1BF5A 5B8IB 2L5XB 1EG4A 3NSKA 1DF0A 1KQMC 3I5GB 1NYAA 1R6PA 4FQOA 3SG6A 2KOTA 4PALA 2F3YA 4OV2A 2FOTA 4MRXA 2I18A 1KQMB 2AAOA 2Q4UA 4PCWA 2FCEA 1N65A 3C1VA 2H2KA 2KFFA 1Y0VH 1KK7Z 4YGDB 1TNXA 1RJVA 3SG7A 4QJ5B 1J7PA 1Q80A 3KEVA 4N1GA 4MZJA 4I5LB 1M31A 1QVIY 1DJGA 3LCPC 1XA5A 1KSOA 3M0WA 5I2LA 2BBMA 2BCBA 2K7BA 2MHHA 2L0PA 1DGUA 5HYDA 3LK1A 1NX2A 1BR4B 1DTLA 4FTGA 1FBVA 3BXKA 2I94A 4JPZB 1S36A 1CMGA 1SMGA 4CIDA 2WCFA 5G08A 1AK8A 2PMYA 3EKJA 1JWDA 1B8CA 4PHMA 2M7LA 1JSAA 2KBIA 1QTXA 4CLNA 1MUXA 1ODBA 4C0KA 1NX1A 5AANA 2BL0C 4N5XA 2Y1MA 1NP8A 2JNFA 1PALA 1DVIA 1PSRA 1CDPA 4HRHA 2BL0B 2HQ8A 2K7CA 3GK4X 1KFXL 2JTZA 3HX4A 4GFTA 2LUCA 1OMRA 2EC6C 1JC2A 4A4BA 1BT6A 3BUXB 1X02A 3AKBA 1GGWA 1LA0A 2EC6B 2KFGA 1GGZA 4TNCA 2LLUA 3EVVA 1N0YA 3LLEA 2L98A 1CNPA 2ISDA 1L7ZA 1CM4A 3WXAA 1IQ5A 1S26D 4WQ3A 4WRIA 5CSIA 2QACA 1S6CA 2B1UA 1B8LA 3KF9A 2ZNEA 4MBEA 2ZRTA 2KFHA 4YBHB 1C7VA 4C0LA 1K9KA 2M97A 3NSLA 1K9PA 4DRWA 3TUYC 1SPYA 5K89A 2SASA 1CDLA 1CLLA 3SIAA 1UURA 3KO0A 2F2PA 4P2YB 4YGCB 3TUYB 2LUXA 2M3WA 1CMFA 1UP5A 4MZKA 5AERA 2KGBC 5HLOA 1NX0A 2KI6D 3MSEB 4NDCA 4ORCB 3EK7A 2JPTA 1NCXA 1MF8B 1KFUL 2WCBA 3JVTC 1EH2A 3IQQA 2NCPA 2OPOA 1G4YR 4USLA 3H4SE 3I5FC 1IRJA 3JVTB 3EK4A 4IL1A 1Y1AA 1TNPA 1UHKA 3I5FB 2WORA 3NSOA 2F3ZA 4N1FA 4R1EA 2M1KB 4I5KA 1XFUO 4AOMA 2MRDA 2LVKA 1OOJA 2BKHB 2ZKMX 4PE4A 2LANA 2K0JA 1K90D 1QV0A 1NWDA 3KPXA 4YI8A 1B9AA 1BR1B 2EGDA 2JXCA 3CZTX 3OB1B 5DKNA 2FCDA 1DJZA 2CTNA 2LE9B 2BE4A 1QX5B 1IJ6A 2AMIA 2GGMA 1KK8B 3I5IC 4NDDA 2BBNA 1XYDA 1UWOA 1KK7Y 1SCVA 1CTRA 3I5IB 3PLFB 3VRPA 2NZ0A 3OHMB 1LXFC 2KSPA 1BJFA 1SL8A 1MXEA 1XO5A 3KHEA 3SG2A 1N2DA 4YGEB 4Q04A 3SIBA 1AP4A 3CS1A 4XYNA 1TN4A 2BKIB 2JWWA 1A2XA 2HF5A 3NSIA 3OX5A 2ZNDA 3RLZA 1MXLC 4CPVA 2ZN8A 2JRFA 1V1FA 1CFFA 2KI6C 1B47A 4M2QA 1D1OA 4P5OE 1B1GA 3A8RA 1XVJA 2LM5A 1OZSA 1CLMA 1YUSA 3CWGA 2DOQA 2KAYA 3OX6A 1K93D 1RECA 1YRTB 3BQ3A 1YRUB 1TRFA 1TTXA 2KI4C 5ER5A 1J55A 4CFQA 1BLQA 3BUOB 2BCAA 3TDZA 2KI4B 1CM1A 1B8RA 1C07A 3DVKA 2E6WA 3TDIA 1BG1A 1MWNA 1QJTA 2M0RA 3D10A 1F4QA 4DCKA 5KTYA 2MJWB 1MR8A 1NIWA 2LP3A 1SL7A 2KYFA 1S6IA 2KAXA 1IKUA 1G8IA 1FI6A 1SCMC 1XFZO 2WOSA 4E68A 3IQOA 2M1UA 1WDCC 4PE7A 3CR2A 5AFPA 1XFYO 1QIWA 1SCMB 3O78A 3BUNB 2CNPA 1RFJA 4YRUA 1SYMA 1WDCB 1WLZA 1WLMA 4OKHA 3TDUA 1NPQA 4ZCVA 1JBAA 2GV5A 4GAOA 2K2FA 2JQ6A 2JT0A 1B7TZ 1SR6C 1QS7A 2K2AA 1IJ5A 1NX3A 4GNKB 2HQWA 1S5GZ 5FYXA 2PALA 1ZFSA 3SJSA 4AQIA 1SR6B 3VRRA 2OTGC 2A4JA 4ORBB 5KSZA 1TNWA 2R2IA 3PSRA 3SG3A 2OTGB 1C7WA 2KBMA 3GOFA 5HKZA 2MBXA 4M2PA 2F2OA 2LMTA 4L9MA 2FJUB 1A75B 1E8AA 1KWOC 3BYAA 3VGOA 2CT9A 3EKHA 3TZ1A 1TNQA 1KWOB 2K7DA 1S1EA 4GUKA 4MEWA 2KQ6A 1AJ4A 1YVLA 2KDHA 1UHIA 1SY9A 1MQ1A 2JXLA 1YX7A 3DVEA 1EJ3A 2BE6A 1M39A 3EK8A 5TNCA 1U5IB 4PHKA 2O5GA 1CFDA 2LVJA 2Y5IA 2JT3A 4I5NB 1A29A 2Y4QA 1HQVA 2GGZA 1J7RA 1QX7A 2JZIA 1WRLA 4YI9A 2O60A 2WCEA 5HKWA 3VROA 3ZNIA 2D8NA 2EHBA 1RWYA
chains in the Genus database with same CATH superfamily
2CBLA 3DD4A 4OVNF 1TUJA 1OOHA 1BOCA 2G9BA 1DGVA 1M63B 1PULA 1DT7B 3DVMA 5KU1A 1L2OB 2PRUA 2KHNA 1YUUA 1QASA 2AUCA 4QJ3B 1SL9A 1WRZA 4M2OA 2LV7A 1S3PA 1LKJA 1OSAA 3V2LA 1K2HA 2MA2A 2TN4A 5AEQA 1QXPA 1KK8C 4PE0A 1M46A 2HETA 1YURA 4HSZA 1YTZC 4JQ0D 4ORAB 5CSFA 3SS4A 1OE9B 1JFKA 1KFXS 2VRGA 3RM1A 3HCMA 2PVBA 5J3XA 1AVSA 2HPSA 1TCOB 1CFPA 3FE8A 5HLVA 3OBVA 3FS7A 1W9ZA 2JNXA 3DF0B 1GJYA 2BECA 3GK2A 4C0JA 1J1EA 5I2OA 3EVRA 1H4BA 1GQMA 2F8PA 2KAVA 2KGRA 3D78A 3BJHA 2LMVA 2LC5A 3EVUA 2WC8A 2MLFC 2PASA 3PM8A 2K8MB 1UHNA 4KYNA 1ZACA 2ZFDA 4MVFA 5JJGA 2LMUA 1EG3A 3VRQA 1EL4A 2LAPA 1FF1A 2LVVA 2K7OA 3CGAA 3AAKA 1K9UA 3BUMB 4PDZA 4XJKB 1LVCD 4QJ4B 1PVAA 1AHRA 2ERBA 2MLEC 3SG5A 5BPJA 4MZLA 1WRKA 2GTEA 1KSMA 1W7JB 3DF0A 1DJHA 3PATA 3O2PA 1CDMA 5HKYA 3NXAA 3BOWB 3AAJA 3D75A 4NDBA 3CTNA 2L2EA 2LLTA 4PHNA 4A4CA 2L4HA 3O4XA 2LHLA 5D7FA 1XFVO 2M49B 2NLNA 3VRNA 1KFUS 1JUOA 2L5YA 2LHIA 2PSRA 1B7TY 2MAZA 3WHTB 1A03A 1TCFA 4ZCUA 4ICBA 1OMDA 2H61C 1K96A 1S5GY 1F70A 1F54A 2P6BB 1R2UA 4BY5A 1NUBA 1CFCA 1QATA 1ZUZA 3AKAA 4XJKA 4BY4A 1QLKA 1CDNA 1S6JA 1W7IB 1Y1XA 5D69A 1YR5A 2L4IA 2IS9A 5JOLA 2L50A 1SRAA 3FIAA 1P28A 3L4LA 5CSNA 2BAPA 3BOWA 1ALWA 1RROA 3DVJA 4JD9A 4U8DA 3FWBA 1CKKA 1A4PA 2I2RE 1OQPA 3LL8B 2QPTA 5D3OA 4NQGA 5AXIA 1JF0A 2FJYA 1IG5A 1SBJA 1JF2A 5CSJA 1F55A 1GM0A 1PSBA 5DKRA 3WHUB 5ER4X 2QEOA 1DELA 3SS3A 4HRGA 3GK1A 5CPVA 1B4CA 1AUIB 4YGBB 3I5HC 3D0YB 1BODA 2M29A 4OR9B 4GGNA 1UUSA 1J7QA 1QVIZ 2H61A 1OOIX 1RK9A 1SKTA 2QEHA 3I5HB 4GGFC 1TIZA 1PVBA 1IQ3A 4MRYA 1M45A 1DJWA 1F4OA 1LINA 2JC2A 2WNDA 2E30A 3OP0A 3O4YA 4DS7A 4AQJA 1DJYA 1ZMZA 3DZTA 5IBWA 3S0AA 1DJIA 5DICA 2WC5A 3PFVA 2KQYA 3N7HA 3PN7C 4I5JA 4DUQA 4YGAA 3JTDC 2M7NA 3CABA 2NCOA 1TUZA 3O6BA 3B88A 3PN7B 1NSHA 5DKQA 3FWCA 1RTP1 1EXRA 1FW4A 2P70A 3JTDB 1DMOA 1KQVA 1DJXA 3IF7A 2CXJA 5PALA 4CFRA 2JT8A 2PQLA 3D0YA 3FE6A 4PT1A 2KLDA 2ZN9A 1IH0A 2BCXA 3F45A 4IJ7A 4JKTA 1XK4C 2CCMA 5I8NA 2I7AA 1QIVA 4MSPA 1J7OA 3K21A 2SCPA 1HT9A 3L4AA 2OS8C 3WNXB 1ALVA 1TOPA 3ZWHA 1BU3A 4DIRA 1BMOA 4GGFA 1A75A 1UHJA 2JU0A 4D1EA 2OS8B 5GQQC 1Y6WA 2K61A 3E3RA 1L2OC 1QV1A 1OMVA 1WY9A 2ZRSA 1FPWA 2G2BA 4JWQA 1SW8A 3CLNA 3OB2B 1NCYA 1K95A 3CR4X 1U5IA 3DYEA 5I2QA 1FI5A 1IWQA 3A4UB 3DXLA 3SG4A 1YVHA 3NHTA 2NXQA 1ZOTB 3B6XA 1YUTA 1K8UA 2KYCA 2RGIA 4UPGA 1XK4A 2F33A 1XFXO 2LVIA 1IGVA 2V53A 3CR5X 1Y1UA 3ICBA 2LP2A 1V1GA 2JTTA 1C3ZA 1PK0D 4WQ2A 4OCIA 4PE1A 1YX8A 2COLB 1PRWA 4ETOA 3BUWB 1J1DA 3B7AA 4HREE 2KNEA 2LCPA 2LLSA 2M9GA 1H8BA 3S0BA 1DF0B 4MN0A 3LK0A 1OZOA 1DEKA 1XFWO 2Y1NA 4GPLB 1CB1A 3QRXA 4FQTA 2JOJA 1UHHA 1F8HA 1JFJA 2LNKA 2QDIA 4MLWA 1CLBA 1Z2CB 5F6TA 2JULA 1NCZA 2M8UA 1KCYA 1QLSA 1SNLA 1SK6D 1G33A 4GBAA 1MHOA 1T14A 3PALA 2L51A 3TS5C 4F0ZB 1F71A 4PHJA 1K94A 1VRKA 3I5GC 3TS5B 1AJ5A 1LA3A 1QX2A 2Q91A 1BF5A 5B8IB 2L5XB 1EG4A 3NSKA 1DF0A 1KQMC 3I5GB 1NYAA 1R6PA 3IVTA 4FQOA 3SS5A 3SG6A 2KOTA 4PALA 2F3YA 4OV2A 2FOTA 4MRXA 4INXA 2I18A 1KQMB 2AAOA 2Q4UA 4PCWA 5I94A 2FCEA 1N65A 3C1VA 2H2KA 2KFFA 3K1EA 1Y0VH 3S0DA 1KK7Z 4YGDB 1TNXA 1RJVA 3SG7A 4QJ5B 1J7PA 1Q80A 3KEVA 2H8VA 4N1GA 3OGNA 4MZJA 4I5LB 1M31A 1QVIY 3PJIA 1DJGA 1SSEB 3LCPC 1XA5A 1KSOA 3M0WA 5I2LA 2BBMA 2BCBA 2K7BA 2MHHA 2L0PA 1DGUA 5HYDA 3LK1A 1NX2A 1BR4B 1DTLA 4FTGA 1FBVA 1IIOA 3R1VA 3BXKA 2I94A 4JPZB 3BFBA 1S36A 1CMGA 1SMGA 4CIDA 2WCFA 5G08A 1AK8A 2PMYA 3EKJA 1JWDA 1B8CA 4PHMA 2M7LA 1JSAA 2KBIA 1QTXA 4CLNA 1MUXA 1ODBA 4C0KA 1NX1A 5AANA 2BL0C 4N5XA 2Y1MA 1NP8A 2JNFA 1PALA 1DVIA 1PSRA 1CDPA 4HRHA 2BL0B 2HQ8A 2YGUA 2K7CA 3GK4X 1KFXL 2JTZA 3HX4A 4GFTA 2LUCA 1OMRA 2EC6C 1JC2A 4A4BA 1BT6A 3BUXB 1X02A 3AKBA 1GGWA 1LA0A 2EC6B 2KFGA 1GGZA 4TNCA 1OOFA 2LLUA 3EVVA 1N0YA 3DY9A 3LLEA 2L98A 1CNPA 2ISDA 1L7ZA 1CM4A 1DQEA 1IQ5A 1S26D 4WQ3A 4WRIA 5CSIA 3UO9A 3WXAA 2QACA 3B87A 1S6CA 2B1UA 1B8LA 2K60A 3KF9A 2ZNEA 3PM2A 4MBEA 5FI7A 2ZRTA 1OOGA 3BFHA 2KFHA 2WCLA 4YBHB 1C7VA 4C0LA 1K9KA 2M97A 3CDNA 1K9PA 3NSLA 4DRWA 3TUYC 1SPYA 3R1PA 5K89A 2SASA 1CDLA 1CLLA 3SIAA 1UURA 3KO0A 2F2PA 4P2YB 4YGCB 3TUYB 2LUXA 2M3WA 3NHIA 1CMFA 1UP5A 2P71A 4MZKA 5AERA 2KGBC 5HLOA 1NX0A 2KLEA 1QWVA 2KI6D 3MSEB 4NDCA 4ORCB 3EK7A 2JPTA 1NCXA 1MF8B 1KFUL 2WCBA 3JVTC 1EH2A 3IQQA 2NCPA 2OPOA 1G4YR 4USLA 3H4SE 3I5FC 1IRJA 3JVTB 3EK4A 4IL1A 1XFRA 1Y1AA 3R72A 1TNPA 1UHKA 3S0GA 3I5FB 2WORA 3NSOA 2F3ZA 4N1FA 4OZDA 4R1EA 2M1KB 4I5KA 1XFUO 4AOMA 2MRDA 2LVKA 1OOJA 3CYZA 2WCMA 2BKHB 2ZKMX 3D73A 4PE4A 2LANA 2K0JA 1K90D 1QV0A 1NWDA 3KPXA 3UNWA 4YI8A 1B9AA 1BR1B 2EGDA 2JXCA 3CZTX 3OB1B 5DKNA 2FCDA 1DJZA 2CTNA 5HL1A 2LE9B 2BE4A 1QX5B 1IJ6A 2AMIA 2WCJA 2GGMA 3R1OA 1KK8B 3I5IC 4NDDA 2BBNA 1XYDA 1UWOA 1KK7Y 1SCVA 1CTRA 3I5IB 3PLFB 3VRPA 3RZSA 2NZ0A 3OHMB 1LXFC 2KSPA 1BJFA 1SL8A 1DC1A 1MXEA 1XO5A 3KHEA 3B86A 3SG2A 1OW4A 1N2DA 4YGEB 4Q04A 2WC6A 3CZ2A 3D76A 3SIBA 1AP4A 3CS1A 1LS8A 4XYNA 1TN4A 2BKIB 2JWWA 1A2XA 2HF5A 3NSIA 3OX5A 2ZNDA 3RLZA 4INWA 1MXLC 4CPVA 3FE9A 2ZN8A 2JRFA 1V1FA 1CFFA 2KI6C 1B47A 4M2QA 3L47A 1D1OA 4P5OE 1B1GA 3A8RA 1XVJA 2LM5A 1OZSA 1CLMA 1YUSA 3CWGA 2DOQA 2KAYA 3OX6A 1K93D 1RECA 1YRTB 2L2CA 3BQ3A 1YRUB 1TRFA 1TTXA 2KI4C 5ER5A 2WCKA 3NGVA 1J55A 4CFQA 1BLQA 3BUOB 2BCAA 3TDZA 2KI4B 1CM1A 1B8RA 1C07A 3DVKA 2E6WA 3TDIA 1BG1A 1MWNA 1QJTA 2M0RA 3D10A 1F4QA 4DCKA 5KTYA 2MJWB 1MR8A 1NIWA 2LP3A 1SL7A 2KYFA 1S6IA 2KAXA 1IKUA 1G8IA 1FI6A 1SCMC 1XFZO 2WOSA 4E68A 3IQOA 2M1UA 1WDCC 2PYQA 4PE7A 4F7FA 3CR2A 5AFPA 1XFYO 1QIWA 1SCMB 2QEBA 3O78A 3BUNB 2CNPA 1RFJA 4YRUA 1SYMA 1WDCB 1WLZA 1WLMA 3CZ0A 2JPOA 1Z4HA 4OKHA 3TDUA 1NPQA 4ZCVA 1JBAA 2GV5A 1ORGA 4GAOA 2K2FA 2JQ6A 2JT0A 1B7TZ 1SR6C 1QS7A 3D74A 2K2AA 1IJ5A 1NX3A 4GNKB 2HQWA 1S5GZ 5FI2A 3S0EA 3BFAA 2PALA 1ZFSA 5FYXA 3SJSA 4AQIA 1SR6B 3VRRA 2OTGC 2A4JA 4ORBB 5KSZA 1TNWA 3Q8IA 2R2IA 3PSRA 3SG3A 2OTGB 1C7WA 2KBMA 3GOFA 5HKZA 2MBXA 4M2PA 2F2OA 2LMTA 4L9MA 2FJUB 1A75B 1E8AA 1KWOC 3BYAA 3CZ1A 3EG5B 3VGOA 2CT9A 3EKHA 3TZ1A 1TNQA 1KWOB 2K7DA 1S1EA 4GUKA 4MEWA 2KQ6A 3VB1A 1AJ4A 1YVLA 2KDHA 1UHIA 1SY9A 1MQ1A 2JXLA 1YX7A 3DVEA 5EL2A 1EJ3A 2BE6A 1M39A 2QEVA 3EK8A 5TNCA 1U5IB 4PHKA 2O5GA 1CFDA 3D77A 2LVJA 2Y5IA 2JT3A 4I5NB 1A29A 2Y4QA 1HQVA 2GGZA 1J7RA 1QX7A 2JZIA 2WCHA 1WRLA 4YI9A 2O60A 2WCEA 5HKWA 1TWOA 5FI6A 3VROA 3S0FA 3QMEA 1C3YA 2KPHA 3ZNIA 2D8NA 2EHBA 1RWYA 2BNXA
chains in the Genus database with same CATH topology
2CBLA 3DD4A 4OVNF 1BOCA 2G9BA 1DGVA 1M63B 1PULA 1DT7B 3DVMA 5KU1A 1L2OB 2PRUA 2KHNA 1YUUA 1QASA 2AUCA 4QJ3B 1SL9A 1WRZA 4M2OA 2LV7A 1S3PA 1LKJA 1OSAA 1K2HA 2MA2A 2TN4A 5AEQA 1QXPA 1KK8C 4PE0A 1M46A 2HETA 1YURA 4HSZA 1YTZC 4JQ0D 4ORAB 5CSFA 1OE9B 1JFKA 1KFXS 2VRGA 3RM1A 3HCMA 2PVBA 5J3XA 1AVSA 2HPSA 1TCOB 1CFPA 5HLVA 3FS7A 2JNXA 3DF0B 1GJYA 2BECA 3GK2A 4C0JA 1J1EA 5I2OA 3EVRA 1H4BA 1GQMA 2F8PA 2KAVA 2KGRA 2LMVA 2LC5A 3EVUA 2WC8A 2MLFC 2PASA 3PM8A 2K8MB 1UHNA 1ZACA 2ZFDA 4MVFA 5JJGA 2LMUA 1EG3A 3VRQA 1EL4A 2LAPA 1FF1A 2LVVA 2K7OA 3CGAA 3AAKA 1K9UA 3BUMB 4PDZA 4XJKB 1LVCD 4QJ4B 1PVAA 1AHRA 2MLEC 3SG5A 5BPJA 4MZLA 1WRKA 3PATA 1KSMA 1W7JB 3DF0A 1DJHA 5HKYA 3O2PA 1CDMA 3NXAA 3BOWB 3AAJA 4NDBA 3CTNA 2L2EA 2LLTA 4PHNA 4A4CA 2L4HA 2LHLA 5D7FA 1XFVO 2M49B 2NLNA 3VRNA 1KFUS 1JUOA 2LHIA 2PSRA 1B7TY 2MAZA 3WHTB 1A03A 1TCFA 4ZCUA 4ICBA 1OMDA 2H61C 1K96A 1S5GY 1F70A 1F54A 2P6BB 1R2UA 4BY5A 1NUBA 1CFCA 1QATA 1ZUZA 3AKAA 4XJKA 4BY4A 1QLKA 1CDNA 1S6JA 1W7IB 1Y1XA 5D69A 1YR5A 2L4IA 2IS9A 5JOLA 2L50A 1SRAA 3FIAA 5CSNA 3BOWA 4U8DA 1ALWA 1RROA 3DVJA 3FWBA 1CKKA 1A4PA 2I2RE 1OQPA 3LL8B 2QPTA 4NQGA 5AXIA 1JF0A 1IG5A 1SBJA 1JF2A 5CSJA 1F55A 1PSBA 5DKRA 3WHUB 5ER4X 4HRGA 3GK1A 5CPVA 1B4CA 1AUIB 4YGBB 3I5HC 3D0YB 1BODA 2M29A 4OR9B 4GGNA 1UUSA 1J7QA 1QVIZ 2H61A 1RK9A 1SKTA 3I5HB 4GGFC 1TIZA 1PVBA 1IQ3A 4MRYA 1M45A 1DJWA 1F4OA 1LINA 2JC2A 2WNDA 2E30A 3OP0A 3O4YA 4DS7A 4AQJA 1DJYA 1ZMZA 5IBWA 1DJIA 3PFVA 2KQYA 3PN7C 4I5JA 4DUQA 4YGAA 3JTDC 2M7NA 2NCOA 3O6BA 3PN7B 1NSHA 5DKQA 3FWCA 1RTP1 1EXRA 1FW4A 1DMOA 3JTDB 1KQVA 1DJXA 3IF7A 2CXJA 5PALA 4CFRA 2JT8A 3D0YA 1IH0A 2ZN9A 2BCXA 3F45A 1XK4C 2CCMA 5I8NA 2I7AA 1QIVA 4MSPA 1J7OA 3K21A 2SCPA 1HT9A 2OS8C 3WNXB 1ALVA 1TOPA 3ZWHA 1BU3A 4DIRA 1BMOA 4GGFA 1A75A 1UHJA 2JU0A 4D1EA 2OS8B 5GQQC 1Y6WA 2K61A 3E3RA 1L2OC 1QV1A 1OMVA 1WY9A 2ZRSA 1FPWA 2G2BA 4JWQA 1SW8A 3CLNA 3OB2B 1NCYA 1K95A 3CR4X 1U5IA 5I2QA 1FI5A 1IWQA 3A4UB 3SG4A 1YVHA 2NXQA 1ZOTB 1YUTA 1K8UA 2KYCA 2RGIA 4UPGA 1XK4A 2F33A 1XFXO 2LVIA 1IGVA 2V53A 3CR5X 1Y1UA 3ICBA 2LP2A 1V1GA 2JTTA 1PK0D 4WQ2A 4OCIA 4PE1A 1YX8A 2COLB 1PRWA 4ETOA 3BUWB 1J1DA 4HREE 2KNEA 2LCPA 2LLSA 2M9GA 1H8BA 1DF0B 4MN0A 3LK0A 1OZOA 1XFWO 2Y1NA 4GPLB 1CB1A 3QRXA 2JOJA 1UHHA 1F8HA 1JFJA 2LNKA 4MLWA 1CLBA 5F6TA 2JULA 1NCZA 2M8UA 1KCYA 1QLSA 1SNLA 1SK6D 1G33A 4GBAA 1MHOA 3PALA 4F0ZB 2L51A 3TS5C 1F71A 4PHJA 1K94A 1VRKA 3I5GC 3TS5B 1AJ5A 1LA3A 1QX2A 2Q91A 1BF5A 5B8IB 2L5XB 1EG4A 3NSKA 1DF0A 1KQMC 3I5GB 1NYAA 1R6PA 4FQOA 3SG6A 2KOTA 4PALA 2F3YA 4OV2A 2FOTA 4MRXA 2I18A 1KQMB 2AAOA 2Q4UA 4PCWA 2FCEA 1N65A 3C1VA 2H2KA 2KFFA 1Y0VH 1KK7Z 4YGDB 1TNXA 1RJVA 3SG7A 4QJ5B 1J7PA 1Q80A 3KEVA 4N1GA 4MZJA 4I5LB 1M31A 1QVIY 1DJGA 3LCPC 1XA5A 1KSOA 3M0WA 5I2LA 2BBMA 2BCBA 2K7BA 2MHHA 2L0PA 1DGUA 5HYDA 3LK1A 1NX2A 1BR4B 1DTLA 4FTGA 1FBVA 3BXKA 2I94A 4JPZB 1S36A 1CMGA 1SMGA 4CIDA 2WCFA 5G08A 1AK8A 2PMYA 3EKJA 1JWDA 1B8CA 4PHMA 2M7LA 1JSAA 2KBIA 1QTXA 4CLNA 1MUXA 1ODBA 4C0KA 1NX1A 5AANA 2BL0C 4N5XA 2Y1MA 1NP8A 2JNFA 1PALA 1DVIA 1PSRA 1CDPA 4HRHA 2BL0B 2HQ8A 2K7CA 3GK4X 1KFXL 2JTZA 3HX4A 4GFTA 2LUCA 1OMRA 2EC6C 1JC2A 4A4BA 1BT6A 3BUXB 1X02A 3AKBA 1GGWA 1LA0A 2EC6B 2KFGA 1GGZA 4TNCA 2LLUA 3EVVA 1N0YA 3LLEA 2L98A 1CNPA 2ISDA 1L7ZA 1CM4A 3WXAA 1IQ5A 1S26D 4WQ3A 4WRIA 5CSIA 2QACA 1S6CA 2B1UA 1B8LA 3KF9A 2ZNEA 4MBEA 2ZRTA 2KFHA 4YBHB 1C7VA 4C0LA 1K9KA 2M97A 3NSLA 1K9PA 4DRWA 3TUYC 1SPYA 5K89A 2SASA 1CDLA 1CLLA 3SIAA 1UURA 3KO0A 2F2PA 4P2YB 4YGCB 3TUYB 2LUXA 2M3WA 1CMFA 1UP5A 4MZKA 5AERA 2KGBC 5HLOA 1NX0A 2KI6D 3MSEB 4NDCA 4ORCB 3EK7A 2JPTA 1NCXA 1MF8B 1KFUL 2WCBA 3JVTC 1EH2A 3IQQA 2NCPA 2OPOA 1G4YR 4USLA 3H4SE 3I5FC 1IRJA 3JVTB 3EK4A 4IL1A 1Y1AA 1TNPA 1UHKA 3I5FB 2WORA 3NSOA 2F3ZA 4N1FA 4R1EA 2M1KB 4I5KA 1XFUO 4AOMA 2MRDA 2LVKA 1OOJA 2BKHB 2ZKMX 4PE4A 2LANA 2K0JA 1K90D 1QV0A 1NWDA 3KPXA 4YI8A 1B9AA 1BR1B 2EGDA 2JXCA 3CZTX 3OB1B 5DKNA 2FCDA 1DJZA 2CTNA 2LE9B 2BE4A 1QX5B 1IJ6A 2AMIA 2GGMA 1KK8B 3I5IC 4NDDA 2BBNA 1XYDA 1UWOA 1KK7Y 1SCVA 1CTRA 3I5IB 3PLFB 3VRPA 2NZ0A 3OHMB 1LXFC 2KSPA 1BJFA 1SL8A 1MXEA 1XO5A 3KHEA 3SG2A 1N2DA 4YGEB 4Q04A 3SIBA 1AP4A 3CS1A 4XYNA 1TN4A 2BKIB 2JWWA 1A2XA 2HF5A 3NSIA 3OX5A 2ZNDA 3RLZA 1MXLC 4CPVA 2ZN8A 2JRFA 1V1FA 1CFFA 2KI6C 1B47A 4M2QA 1D1OA 4P5OE 1B1GA 3A8RA 1XVJA 2LM5A 1OZSA 1CLMA 1YUSA 3CWGA 2DOQA 2KAYA 3OX6A 1K93D 1RECA 1YRTB 3BQ3A 1YRUB 1TRFA 1TTXA 2KI4C 5ER5A 1J55A 4CFQA 1BLQA 3BUOB 2BCAA 3TDZA 2KI4B 1CM1A 1B8RA 1C07A 3DVKA 2E6WA 3TDIA 1BG1A 1MWNA 1QJTA 2M0RA 3D10A 1F4QA 4DCKA 5KTYA 2MJWB 1MR8A 1NIWA 2LP3A 1SL7A 2KYFA 1S6IA 2KAXA 1IKUA 1G8IA 1FI6A 1SCMC 1XFZO 2WOSA 4E68A 3IQOA 2M1UA 1WDCC 4PE7A 3CR2A 5AFPA 1XFYO 1QIWA 1SCMB 3O78A 3BUNB 2CNPA 1RFJA 4YRUA 1SYMA 1WDCB 1WLZA 1WLMA 4OKHA 3TDUA 1NPQA 4ZCVA 1JBAA 2GV5A 4GAOA 2K2FA 2JQ6A 2JT0A 1B7TZ 1SR6C 1QS7A 2K2AA 1IJ5A 1NX3A 4GNKB 2HQWA 1S5GZ 5FYXA 2PALA 1ZFSA 3SJSA 4AQIA 1SR6B 3VRRA 2OTGC 2A4JA 4ORBB 5KSZA 1TNWA 2R2IA 3PSRA 3SG3A 2OTGB 1C7WA 2KBMA 3GOFA 5HKZA 2MBXA 4M2PA 2F2OA 2LMTA 4L9MA 2FJUB 1A75B 1E8AA 1KWOC 3BYAA 3VGOA 2CT9A 3EKHA 3TZ1A 1TNQA 1KWOB 2K7DA 1S1EA 4GUKA 4MEWA 2KQ6A 1AJ4A 1YVLA 2KDHA 1UHIA 1SY9A 1MQ1A 2JXLA 1YX7A 3DVEA 1EJ3A 2BE6A 1M39A 3EK8A 5TNCA 1U5IB 4PHKA 2O5GA 1CFDA 2LVJA 2Y5IA 2JT3A 4I5NB 1A29A 2Y4QA 1HQVA 2GGZA 1J7RA 1QX7A 2JZIA 1WRLA 4YI9A 2O60A 2WCEA 5HKWA 3VROA 3ZNIA 2D8NA 2EHBA 1RWYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CBL A;  3DD4 A;  4OVN F;  1BOC A;  2G9B A;  1DGV A;  1M63 B;  1PUL A;  1DT7 B;  3DVM A;  5KU1 A;  1L2O B;  2PRU A;  2KHN A;  1YUU A;  1QAS A;  2AUC A;  4QJ3 B;  1SL9 A;  1WRZ A;  4M2O A;  2LV7 A;  1S3P A;  1LKJ A;  1OSA A;  1K2H A;  2MA2 A;  2TN4 A;  5AEQ A;  1QXP A;  1KK8 C;  4PE0 A;  1M46 A;  2HET A;  1YUR A;  4HSZ A;  1YTZ C;  4JQ0 D;  4ORA B;  5CSF A;  1OE9 B;  1JFK A;  1KFX S;  2VRG A;  3RM1 A;  3HCM A;  2PVB A;  5J3X A;  1AVS A;  2HPS A;  1TCO B;  1CFP A;  5HLV A;  3FS7 A;  2JNX A;  3DF0 B;  1GJY A;  2BEC A;  3GK2 A;  4C0J A;  1J1E A;  5I2O A;  3EVR A;  1H4B A;  1GQM A;  2F8P A;  2KAV A;  2KGR A;  2LMV A;  2LC5 A;  3EVU A;  2WC8 A;  2MLF C;  2PAS A;  3PM8 A;  2K8M B;  1UHN A;  1ZAC A;  2ZFD A;  4MVF A;  5JJG A;  2LMU A;  1EG3 A;  3VRQ A;  1EL4 A;  2LAP A;  1FF1 A;  2LVV A;  2K7O A;  3CGA A;  3AAK A;  1K9U A;  3BUM B;  4PDZ A;  4XJK B;  1LVC D;  4QJ4 B;  1PVA A;  1AHR A;  2MLE C;  3SG5 A;  5BPJ A;  4MZL A;  1WRK A;  3PAT A;  1KSM A;  1W7J B;  3DF0 A;  1DJH A;  5HKY A;  3O2P A;  1CDM A;  3NXA A;  3BOW B;  3AAJ A;  4NDB A;  3CTN A;  2L2E A;  2LLT A;  4PHN A;  4A4C A;  2L4H A;  2LHL A;  5D7F A;  1XFV O;  2M49 B;  2NLN A;  3VRN A;  1KFU S;  1JUO A;  2LHI A;  2PSR A;  1B7T Y;  2MAZ A;  3WHT B;  1A03 A;  1TCF A;  4ZCU A;  4ICB A;  1OMD A;  2H61 C;  1K96 A;  1S5G Y;  1F70 A;  1F54 A;  2P6B B;  1R2U A;  4BY5 A;  1NUB A;  1CFC A;  1QAT A;  1ZUZ A;  3AKA A;  4XJK A;  4BY4 A;  1QLK A;  1CDN A;  1S6J A;  1W7I B;  1Y1X A;  5D69 A;  1YR5 A;  2L4I A;  2IS9 A;  5JOL A;  2L50 A;  1SRA A;  3FIA A;  5CSN A;  3BOW A;  4U8D A;  1ALW A;  1RRO A;  3DVJ A;  3FWB A;  1CKK A;  1A4P A;  2I2R E;  1OQP A;  3LL8 B;  2QPT A;  4NQG A;  5AXI A;  1JF0 A;  1IG5 A;  1SBJ A;  1JF2 A;  5CSJ A;  1F55 A;  1PSB A;  5DKR A;  3WHU B;  5ER4 X;  4HRG A;  3GK1 A;  5CPV A;  1B4C A;  1AUI B;  4YGB B;  3I5H C;  3D0Y B;  1BOD A;  2M29 A;  4OR9 B;  4GGN A;  1UUS A;  1J7Q A;  1QVI Z;  2H61 A;  1RK9 A;  1SKT A;  3I5H B;  4GGF C;  1TIZ A;  1PVB A;  1IQ3 A;  4MRY A;  1M45 A;  1DJW A;  1F4O A;  1LIN A;  2JC2 A;  2WND A;  2E30 A;  3OP0 A;  3O4Y A;  4DS7 A;  4AQJ A;  1DJY A;  1ZMZ A;  5IBW A;  1DJI A;  3PFV A;  2KQY A;  3PN7 C;  4I5J A;  4DUQ A;  4YGA A;  3JTD C;  2M7N A;  2NCO A;  3O6B A;  3PN7 B;  1NSH A;  5DKQ A;  3FWC A;  1RTP 1;  1EXR A;  1FW4 A;  1DMO A;  3JTD B;  1KQV A;  1DJX A;  3IF7 A;  2CXJ A;  5PAL A;  4CFR A;  2JT8 A;  3D0Y A;  1IH0 A;  2ZN9 A;  2BCX A;  3F45 A;  1XK4 C;  2CCM A;  5I8N A;  2I7A A;  1QIV A;  4MSP A;  1J7O A;  3K21 A;  2SCP A;  1HT9 A;  2OS8 C;  3WNX B;  1ALV A;  1TOP A;  3ZWH A;  1BU3 A;  4DIR A;  1BMO A;  4GGF A;  1A75 A;  1UHJ A;  2JU0 A;  4D1E A;  2OS8 B;  5GQQ C;  1Y6W A;  2K61 A;  3E3R A;  1L2O C;  1QV1 A;  1OMV A;  1WY9 A;  2ZRS A;  1FPW A;  2G2B A;  4JWQ A;  1SW8 A;  3CLN A;  3OB2 B;  1NCY A;  1K95 A;  3CR4 X;  1U5I A;  5I2Q A;  1FI5 A;  1IWQ A;  3A4U B;  3SG4 A;  1YVH A;  2NXQ A;  1ZOT B;  1YUT A;  1K8U A;  2KYC A;  2RGI A;  4UPG A;  1XK4 A;  2F33 A;  1XFX O;  2LVI A;  1IGV A;  2V53 A;  3CR5 X;  1Y1U A;  3ICB A;  2LP2 A;  1V1G A;  2JTT A;  1PK0 D;  4WQ2 A;  4OCI A;  4PE1 A;  1YX8 A;  2COL B;  1PRW A;  4ETO A;  3BUW B;  1J1D A;  4HRE E;  2KNE A;  2LCP A;  2LLS A;  2M9G A;  1H8B A;  1DF0 B;  4MN0 A;  3LK0 A;  1OZO A;  1XFW O;  2Y1N A;  4GPL B;  1CB1 A;  3QRX A;  2JOJ A;  1UHH A;  1F8H A;  1JFJ A;  2LNK A;  4MLW A;  1CLB A;  5F6T A;  2JUL A;  1NCZ A;  2M8U A;  1KCY A;  1QLS A;  1SNL A;  1SK6 D;  1G33 A;  4GBA A;  1MHO A;  3PAL A;  4F0Z B;  2L51 A;  3TS5 C;  1F71 A;  4PHJ A;  1K94 A;  1VRK A;  3I5G C;  3TS5 B;  1AJ5 A;  1LA3 A;  1QX2 A;  2Q91 A;  1BF5 A;  5B8I B;  2L5X B;  1EG4 A;  3NSK A;  1DF0 A;  1KQM C;  3I5G B;  1NYA A;  1R6P A;  4FQO A;  3SG6 A;  2KOT A;  4PAL A;  2F3Y A;  4OV2 A;  2FOT A;  4MRX A;  2I18 A;  1KQM B;  2AAO A;  2Q4U A;  4PCW A;  2FCE A;  1N65 A;  3C1V A;  2H2K A;  2KFF A;  1Y0V H;  1KK7 Z;  4YGD B;  1TNX A;  1RJV A;  3SG7 A;  4QJ5 B;  1J7P A;  1Q80 A;  3KEV A;  4N1G A;  4MZJ A;  4I5L B;  1M31 A;  1QVI Y;  1DJG A;  3LCP C;  1XA5 A;  1KSO A;  3M0W A;  5I2L A;  2BBM A;  2BCB A;  2K7B A;  2MHH A;  2L0P A;  1DGU A;  5HYD A;  3LK1 A;  1NX2 A;  1BR4 B;  1DTL A;  4FTG A;  1FBV A;  3BXK A;  2I94 A;  4JPZ B;  1S36 A;  1CMG A;  1SMG A;  4CID A;  2WCF A;  5G08 A;  1AK8 A;  2PMY A;  3EKJ A;  1JWD A;  1B8C A;  4PHM A;  2M7L A;  1JSA A;  2KBI A;  1QTX A;  4CLN A;  1MUX A;  1ODB A;  4C0K A;  1NX1 A;  5AAN A;  2BL0 C;  4N5X A;  2Y1M A;  1NP8 A;  2JNF A;  1PAL A;  1DVI A;  1PSR A;  1CDP A;  4HRH A;  2BL0 B;  2HQ8 A;  2K7C A;  3GK4 X;  1KFX L;  2JTZ A;  3HX4 A;  4GFT A;  2LUC A;  1OMR A;  2EC6 C;  1JC2 A;  4A4B A;  1BT6 A;  3BUX B;  1X02 A;  3AKB A;  1GGW A;  1LA0 A;  2EC6 B;  2KFG A;  1GGZ A;  4TNC A;  2LLU A;  3EVV A;  1N0Y A;  3LLE A;  2L98 A;  1CNP A;  2ISD A;  1L7Z A;  1CM4 A;  3WXA A;  1IQ5 A;  1S26 D;  4WQ3 A;  4WRI A;  5CSI A;  2QAC A;  1S6C A;  2B1U A;  1B8L A;  3KF9 A;  2ZNE A;  4MBE A;  2ZRT A;  2KFH A;  4YBH B;  1C7V A;  4C0L A;  1K9K A;  2M97 A;  3NSL A;  1K9P A;  4DRW A;  3TUY C;  1SPY A;  5K89 A;  2SAS A;  1CDL A;  1CLL A;  3SIA A;  1UUR A;  3KO0 A;  2F2P A;  4P2Y B;  4YGC B;  3TUY B;  2LUX A;  2M3W A;  1CMF A;  1UP5 A;  4MZK A;  5AER A;  2KGB C;  5HLO A;  1NX0 A;  2KI6 D;  3MSE B;  4NDC A;  4ORC B;  3EK7 A;  2JPT A;  1NCX A;  1MF8 B;  1KFU L;  2WCB A;  3JVT C;  1EH2 A;  3IQQ A;  2NCP A;  2OPO A;  1G4Y R;  4USL A;  3H4S E;  3I5F C;  1IRJ A;  3JVT B;  3EK4 A;  4IL1 A;  1Y1A A;  1TNP A;  1UHK A;  3I5F B;  2WOR A;  3NSO A;  2F3Z A;  4N1F A;  4R1E A;  2M1K B;  4I5K A;  1XFU O;  4AOM A;  2MRD A;  2LVK A;  1OOJ A;  2BKH B;  2ZKM X;  4PE4 A;  2LAN A;  2K0J A;  1K90 D;  1QV0 A;  1NWD A;  3KPX A;  4YI8 A;  1B9A A;  1BR1 B;  2EGD A;  2JXC A;  3CZT X;  3OB1 B;  5DKN A;  2FCD A;  1DJZ A;  2CTN A;  2LE9 B;  2BE4 A;  1QX5 B;  1IJ6 A;  2AMI A;  2GGM A;  1KK8 B;  3I5I C;  4NDD A;  2BBN A;  1XYD A;  1UWO A;  1KK7 Y;  1SCV A;  1CTR A;  3I5I B;  3PLF B;  3VRP A;  2NZ0 A;  3OHM B;  1LXF C;  2KSP A;  1BJF A;  1SL8 A;  1MXE A;  1XO5 A;  3KHE A;  3SG2 A;  1N2D A;  4YGE B;  4Q04 A;  3SIB A;  1AP4 A;  3CS1 A;  4XYN A;  1TN4 A;  2BKI B;  2JWW A;  1A2X A;  2HF5 A;  3NSI A;  3OX5 A;  2ZND A;  3RLZ A;  1MXL C;  4CPV A;  2ZN8 A;  2JRF A;  1V1F A;  1CFF A;  2KI6 C;  1B47 A;  4M2Q A;  1D1O A;  4P5O E;  1B1G A;  3A8R A;  1XVJ A;  2LM5 A;  1OZS A;  1CLM A;  1YUS A;  3CWG A;  2DOQ A;  2KAY A;  3OX6 A;  1K93 D;  1REC A;  1YRT B;  3BQ3 A;  1YRU B;  1TRF A;  1TTX A;  2KI4 C;  5ER5 A;  1J55 A;  4CFQ A;  1BLQ A;  3BUO B;  2BCA A;  3TDZ A;  2KI4 B;  1CM1 A;  1B8R A;  1C07 A;  3DVK A;  2E6W A;  3TDI A;  1BG1 A;  1MWN A;  1QJT A;  2M0R A;  3D10 A;  1F4Q A;  4DCK A;  5KTY A;  2MJW B;  1MR8 A;  1NIW A;  2LP3 A;  1SL7 A;  2KYF A;  1S6I A;  2KAX A;  1IKU A;  1G8I A;  1FI6 A;  1SCM C;  1XFZ O;  2WOS A;  4E68 A;  3IQO A;  2M1U A;  1WDC C;  4PE7 A;  3CR2 A;  5AFP A;  1XFY O;  1QIW A;  1SCM B;  3O78 A;  3BUN B;  2CNP A;  1RFJ A;  4YRU A;  1SYM A;  1WDC B;  1WLZ A;  1WLM A;  4OKH A;  3TDU A;  1NPQ A;  4ZCV A;  1JBA A;  2GV5 A;  4GAO A;  2K2F A;  2JQ6 A;  2JT0 A;  1B7T Z;  1SR6 C;  1QS7 A;  2K2A A;  1IJ5 A;  1NX3 A;  4GNK B;  2HQW A;  1S5G Z;  5FYX A;  2PAL A;  1ZFS A;  3SJS A;  4AQI A;  1SR6 B;  3VRR A;  2OTG C;  2A4J A;  4ORB B;  5KSZ A;  1TNW A;  2R2I A;  3PSR A;  3SG3 A;  2OTG B;  1C7W A;  2KBM A;  3GOF A;  5HKZ A;  2MBX A;  4M2P A;  2F2O A;  2LMT A;  4L9M A;  2FJU B;  1A75 B;  1E8A A;  1KWO C;  3BYA A;  3VGO A;  2CT9 A;  3EKH A;  3TZ1 A;  1TNQ A;  1KWO B;  2K7D A;  1S1E A;  4GUK A;  4MEW A;  2KQ6 A;  1AJ4 A;  1YVL A;  2KDH A;  1UHI A;  1SY9 A;  1MQ1 A;  2JXL A;  1YX7 A;  3DVE A;  1EJ3 A;  2BE6 A;  1M39 A;  3EK8 A;  5TNC A;  1U5I B;  4PHK A;  2O5G A;  1CFD A;  2LVJ A;  2Y5I A;  2JT3 A;  4I5N B;  1A29 A;  2Y4Q A;  1HQV A;  2GGZ A;  1J7R A;  1QX7 A;  2JZI A;  1WRL A;  4YI9 A;  2O60 A;  2WCE A;  5HKW A;  3VRO A;  3ZNI A;  2D8N A;  2EHB A;  1RWY A; 
#chains in the Genus database with same CATH topology
 2CBL A;  3DD4 A;  4OVN F;  1TUJ A;  1OOH A;  1BOC A;  2G9B A;  1DGV A;  1M63 B;  1PUL A;  1DT7 B;  3DVM A;  5KU1 A;  1L2O B;  2PRU A;  2KHN A;  1YUU A;  1QAS A;  2AUC A;  4QJ3 B;  1SL9 A;  1WRZ A;  4M2O A;  2LV7 A;  1S3P A;  1LKJ A;  1OSA A;  3V2L A;  1K2H A;  2MA2 A;  2TN4 A;  5AEQ A;  1QXP A;  1KK8 C;  4PE0 A;  1M46 A;  2HET A;  1YUR A;  4HSZ A;  1YTZ C;  4JQ0 D;  4ORA B;  5CSF A;  3SS4 A;  1OE9 B;  1JFK A;  1KFX S;  2VRG A;  3RM1 A;  3HCM A;  2PVB A;  5J3X A;  1AVS A;  2HPS A;  1TCO B;  1CFP A;  3FE8 A;  5HLV A;  3OBV A;  3FS7 A;  1W9Z A;  2JNX A;  3DF0 B;  1GJY A;  2BEC A;  3GK2 A;  4C0J A;  1J1E A;  5I2O A;  3EVR A;  1H4B A;  1GQM A;  2F8P A;  2KAV A;  2KGR A;  3D78 A;  3BJH A;  2LMV A;  2LC5 A;  3EVU A;  2WC8 A;  2MLF C;  2PAS A;  3PM8 A;  2K8M B;  1UHN A;  4KYN A;  1ZAC A;  2ZFD A;  4MVF A;  5JJG A;  2LMU A;  1EG3 A;  3VRQ A;  1EL4 A;  2LAP A;  1FF1 A;  2LVV A;  2K7O A;  3CGA A;  3AAK A;  1K9U A;  3BUM B;  4PDZ A;  4XJK B;  1LVC D;  4QJ4 B;  1PVA A;  1AHR A;  2ERB A;  2MLE C;  3SG5 A;  5BPJ A;  4MZL A;  1WRK A;  2GTE A;  1KSM A;  1W7J B;  3DF0 A;  1DJH A;  3PAT A;  3O2P A;  1CDM A;  5HKY A;  3NXA A;  3BOW B;  3AAJ A;  3D75 A;  4NDB A;  3CTN A;  2L2E A;  2LLT A;  4PHN A;  4A4C A;  2L4H A;  3O4X A;  2LHL A;  5D7F A;  1XFV O;  2M49 B;  2NLN A;  3VRN A;  1KFU S;  1JUO A;  2L5Y A;  2LHI A;  2PSR A;  1B7T Y;  2MAZ A;  3WHT B;  1A03 A;  1TCF A;  4ZCU A;  4ICB A;  1OMD A;  2H61 C;  1K96 A;  1S5G Y;  1F70 A;  1F54 A;  2P6B B;  1R2U A;  4BY5 A;  1NUB A;  1CFC A;  1QAT A;  1ZUZ A;  3AKA A;  4XJK A;  4BY4 A;  1QLK A;  1CDN A;  1S6J A;  1W7I B;  1Y1X A;  5D69 A;  1YR5 A;  2L4I A;  2IS9 A;  5JOL A;  2L50 A;  1SRA A;  3FIA A;  1P28 A;  3L4L A;  5CSN A;  2BAP A;  3BOW A;  1ALW A;  1RRO A;  3DVJ A;  4JD9 A;  4U8D A;  3FWB A;  1CKK A;  1A4P A;  2I2R E;  1OQP A;  3LL8 B;  2QPT A;  5D3O A;  4NQG A;  5AXI A;  1JF0 A;  2FJY A;  1IG5 A;  1SBJ A;  1JF2 A;  5CSJ A;  1F55 A;  1GM0 A;  1PSB A;  5DKR A;  3WHU B;  5ER4 X;  2QEO A;  1DEL A;  3SS3 A;  4HRG A;  3GK1 A;  5CPV A;  1B4C A;  1AUI B;  4YGB B;  3I5H C;  3D0Y B;  1BOD A;  2M29 A;  4OR9 B;  4GGN A;  1UUS A;  1J7Q A;  1QVI Z;  2H61 A;  1OOI X;  1RK9 A;  1SKT A;  2QEH A;  3I5H B;  4GGF C;  1TIZ A;  1PVB A;  1IQ3 A;  4MRY A;  1M45 A;  1DJW A;  1F4O A;  1LIN A;  2JC2 A;  2WND A;  2E30 A;  3OP0 A;  3O4Y A;  4DS7 A;  4AQJ A;  1DJY A;  1ZMZ A;  3DZT A;  5IBW A;  3S0A A;  1DJI A;  5DIC A;  2WC5 A;  3PFV A;  2KQY A;  3N7H A;  3PN7 C;  4I5J A;  4DUQ A;  4YGA A;  3JTD C;  2M7N A;  3CAB A;  2NCO A;  1TUZ A;  3O6B A;  3B88 A;  3PN7 B;  1NSH A;  5DKQ A;  3FWC A;  1RTP 1;  1EXR A;  1FW4 A;  2P70 A;  3JTD B;  1DMO A;  1KQV A;  1DJX A;  3IF7 A;  2CXJ A;  5PAL A;  4CFR A;  2JT8 A;  2PQL A;  3D0Y A;  3FE6 A;  4PT1 A;  2KLD A;  2ZN9 A;  1IH0 A;  2BCX A;  3F45 A;  4IJ7 A;  4JKT A;  1XK4 C;  2CCM A;  5I8N A;  2I7A A;  1QIV A;  4MSP A;  1J7O A;  3K21 A;  2SCP A;  1HT9 A;  3L4A A;  2OS8 C;  3WNX B;  1ALV A;  1TOP A;  3ZWH A;  1BU3 A;  4DIR A;  1BMO A;  4GGF A;  1A75 A;  1UHJ A;  2JU0 A;  4D1E A;  2OS8 B;  5GQQ C;  1Y6W A;  2K61 A;  3E3R A;  1L2O C;  1QV1 A;  1OMV A;  1WY9 A;  2ZRS A;  1FPW A;  2G2B A;  4JWQ A;  1SW8 A;  3CLN A;  3OB2 B;  1NCY A;  1K95 A;  3CR4 X;  1U5I A;  3DYE A;  5I2Q A;  1FI5 A;  1IWQ A;  3A4U B;  3DXL A;  3SG4 A;  1YVH A;  3NHT A;  2NXQ A;  1ZOT B;  3B6X A;  1YUT A;  1K8U A;  2KYC A;  2RGI A;  4UPG A;  1XK4 A;  2F33 A;  1XFX O;  2LVI A;  1IGV A;  2V53 A;  3CR5 X;  1Y1U A;  3ICB A;  2LP2 A;  1V1G A;  2JTT A;  1C3Z A;  1PK0 D;  4WQ2 A;  4OCI A;  4PE1 A;  1YX8 A;  2COL B;  1PRW A;  4ETO A;  3BUW B;  1J1D A;  3B7A A;  4HRE E;  2KNE A;  2LCP A;  2LLS A;  2M9G A;  1H8B A;  3S0B A;  1DF0 B;  4MN0 A;  3LK0 A;  1OZO A;  1DEK A;  1XFW O;  2Y1N A;  4GPL B;  1CB1 A;  3QRX A;  4FQT A;  2JOJ A;  1UHH A;  1F8H A;  1JFJ A;  2LNK A;  2QDI A;  4MLW A;  1CLB A;  1Z2C B;  5F6T A;  2JUL A;  1NCZ A;  2M8U A;  1KCY A;  1QLS A;  1SNL A;  1SK6 D;  1G33 A;  4GBA A;  1MHO A;  1T14 A;  3PAL A;  2L51 A;  3TS5 C;  4F0Z B;  1F71 A;  4PHJ A;  1K94 A;  1VRK A;  3I5G C;  3TS5 B;  1AJ5 A;  1LA3 A;  1QX2 A;  2Q91 A;  1BF5 A;  5B8I B;  2L5X B;  1EG4 A;  3NSK A;  1DF0 A;  1KQM C;  3I5G B;  1NYA A;  1R6P A;  3IVT A;  4FQO A;  3SS5 A;  3SG6 A;  2KOT A;  4PAL A;  2F3Y A;  4OV2 A;  2FOT A;  4MRX A;  4INX A;  2I18 A;  1KQM B;  2AAO A;  2Q4U A;  4PCW A;  5I94 A;  2FCE A;  1N65 A;  3C1V A;  2H2K A;  2KFF A;  3K1E A;  1Y0V H;  3S0D A;  1KK7 Z;  4YGD B;  1TNX A;  1RJV A;  3SG7 A;  4QJ5 B;  1J7P A;  1Q80 A;  3KEV A;  2H8V A;  4N1G A;  3OGN A;  4MZJ A;  4I5L B;  1M31 A;  1QVI Y;  3PJI A;  1DJG A;  1SSE B;  3LCP C;  1XA5 A;  1KSO A;  3M0W A;  5I2L A;  2BBM A;  2BCB A;  2K7B A;  2MHH A;  2L0P A;  1DGU A;  5HYD A;  3LK1 A;  1NX2 A;  1BR4 B;  1DTL A;  4FTG A;  1FBV A;  1IIO A;  3R1V A;  3BXK A;  2I94 A;  4JPZ B;  3BFB A;  1S36 A;  1CMG A;  1SMG A;  4CID A;  2WCF A;  5G08 A;  1AK8 A;  2PMY A;  3EKJ A;  1JWD A;  1B8C A;  4PHM A;  2M7L A;  1JSA A;  2KBI A;  1QTX A;  4CLN A;  1MUX A;  1ODB A;  4C0K A;  1NX1 A;  5AAN A;  2BL0 C;  4N5X A;  2Y1M A;  1NP8 A;  2JNF A;  1PAL A;  1DVI A;  1PSR A;  1CDP A;  4HRH A;  2BL0 B;  2HQ8 A;  2YGU A;  2K7C A;  3GK4 X;  1KFX L;  2JTZ A;  3HX4 A;  4GFT A;  2LUC A;  1OMR A;  2EC6 C;  1JC2 A;  4A4B A;  1BT6 A;  3BUX B;  1X02 A;  3AKB A;  1GGW A;  1LA0 A;  2EC6 B;  2KFG A;  1GGZ A;  4TNC A;  1OOF A;  2LLU A;  3EVV A;  1N0Y A;  3DY9 A;  3LLE A;  2L98 A;  1CNP A;  2ISD A;  1L7Z A;  1CM4 A;  1DQE A;  1IQ5 A;  1S26 D;  4WQ3 A;  4WRI A;  5CSI A;  3UO9 A;  3WXA A;  2QAC A;  3B87 A;  1S6C A;  2B1U A;  1B8L A;  2K60 A;  3KF9 A;  2ZNE A;  3PM2 A;  4MBE A;  5FI7 A;  2ZRT A;  1OOG A;  3BFH A;  2KFH A;  2WCL A;  4YBH B;  1C7V A;  4C0L A;  1K9K A;  2M97 A;  3CDN A;  1K9P A;  3NSL A;  4DRW A;  3TUY C;  1SPY A;  3R1P A;  5K89 A;  2SAS A;  1CDL A;  1CLL A;  3SIA A;  1UUR A;  3KO0 A;  2F2P A;  4P2Y B;  4YGC B;  3TUY B;  2LUX A;  2M3W A;  3NHI A;  1CMF A;  1UP5 A;  2P71 A;  4MZK A;  5AER A;  2KGB C;  5HLO A;  1NX0 A;  2KLE A;  1QWV A;  2KI6 D;  3MSE B;  4NDC A;  4ORC B;  3EK7 A;  2JPT A;  1NCX A;  1MF8 B;  1KFU L;  2WCB A;  3JVT C;  1EH2 A;  3IQQ A;  2NCP A;  2OPO A;  1G4Y R;  4USL A;  3H4S E;  3I5F C;  1IRJ A;  3JVT B;  3EK4 A;  4IL1 A;  1XFR A;  1Y1A A;  3R72 A;  1TNP A;  1UHK A;  3S0G A;  3I5F B;  2WOR A;  3NSO A;  2F3Z A;  4N1F A;  4OZD A;  4R1E A;  2M1K B;  4I5K A;  1XFU O;  4AOM A;  2MRD A;  2LVK A;  1OOJ A;  3CYZ A;  2WCM A;  2BKH B;  2ZKM X;  3D73 A;  4PE4 A;  2LAN A;  2K0J A;  1K90 D;  1QV0 A;  1NWD A;  3KPX A;  3UNW A;  4YI8 A;  1B9A A;  1BR1 B;  2EGD A;  2JXC A;  3CZT X;  3OB1 B;  5DKN A;  2FCD A;  1DJZ A;  2CTN A;  5HL1 A;  2LE9 B;  2BE4 A;  1QX5 B;  1IJ6 A;  2AMI A;  2WCJ A;  2GGM A;  3R1O A;  1KK8 B;  3I5I C;  4NDD A;  2BBN A;  1XYD A;  1UWO A;  1KK7 Y;  1SCV A;  1CTR A;  3I5I B;  3PLF B;  3VRP A;  3RZS A;  2NZ0 A;  3OHM B;  1LXF C;  2KSP A;  1BJF A;  1SL8 A;  1DC1 A;  1MXE A;  1XO5 A;  3KHE A;  3B86 A;  3SG2 A;  1OW4 A;  1N2D A;  4YGE B;  4Q04 A;  2WC6 A;  3CZ2 A;  3D76 A;  3SIB A;  1AP4 A;  3CS1 A;  1LS8 A;  4XYN A;  1TN4 A;  2BKI B;  2JWW A;  1A2X A;  2HF5 A;  3NSI A;  3OX5 A;  2ZND A;  3RLZ A;  4INW A;  1MXL C;  4CPV A;  3FE9 A;  2ZN8 A;  2JRF A;  1V1F A;  1CFF A;  2KI6 C;  1B47 A;  4M2Q A;  3L47 A;  1D1O A;  4P5O E;  1B1G A;  3A8R A;  1XVJ A;  2LM5 A;  1OZS A;  1CLM A;  1YUS A;  3CWG A;  2DOQ A;  2KAY A;  3OX6 A;  1K93 D;  1REC A;  1YRT B;  2L2C A;  3BQ3 A;  1YRU B;  1TRF A;  1TTX A;  2KI4 C;  5ER5 A;  2WCK A;  3NGV A;  1J55 A;  4CFQ A;  1BLQ A;  3BUO B;  2BCA A;  3TDZ A;  2KI4 B;  1CM1 A;  1B8R A;  1C07 A;  3DVK A;  2E6W A;  3TDI A;  1BG1 A;  1MWN A;  1QJT A;  2M0R A;  3D10 A;  1F4Q A;  4DCK A;  5KTY A;  2MJW B;  1MR8 A;  1NIW A;  2LP3 A;  1SL7 A;  2KYF A;  1S6I A;  2KAX A;  1IKU A;  1G8I A;  1FI6 A;  1SCM C;  1XFZ O;  2WOS A;  4E68 A;  3IQO A;  2M1U A;  1WDC C;  2PYQ A;  4PE7 A;  4F7F A;  3CR2 A;  5AFP A;  1XFY O;  1QIW A;  1SCM B;  2QEB A;  3O78 A;  3BUN B;  2CNP A;  1RFJ A;  4YRU A;  1SYM A;  1WDC B;  1WLZ A;  1WLM A;  3CZ0 A;  2JPO A;  1Z4H A;  4OKH A;  3TDU A;  1NPQ A;  4ZCV A;  1JBA A;  2GV5 A;  1ORG A;  4GAO A;  2K2F A;  2JQ6 A;  2JT0 A;  1B7T Z;  1SR6 C;  1QS7 A;  3D74 A;  2K2A A;  1IJ5 A;  1NX3 A;  4GNK B;  2HQW A;  1S5G Z;  5FI2 A;  3S0E A;  3BFA A;  2PAL A;  1ZFS A;  5FYX A;  3SJS A;  4AQI A;  1SR6 B;  3VRR A;  2OTG C;  2A4J A;  4ORB B;  5KSZ A;  1TNW A;  3Q8I A;  2R2I A;  3PSR A;  3SG3 A;  2OTG B;  1C7W A;  2KBM A;  3GOF A;  5HKZ A;  2MBX A;  4M2P A;  2F2O A;  2LMT A;  4L9M A;  2FJU B;  1A75 B;  1E8A A;  1KWO C;  3BYA A;  3CZ1 A;  3EG5 B;  3VGO A;  2CT9 A;  3EKH A;  3TZ1 A;  1TNQ A;  1KWO B;  2K7D A;  1S1E A;  4GUK A;  4MEW A;  2KQ6 A;  3VB1 A;  1AJ4 A;  1YVL A;  2KDH A;  1UHI A;  1SY9 A;  1MQ1 A;  2JXL A;  1YX7 A;  3DVE A;  5EL2 A;  1EJ3 A;  2BE6 A;  1M39 A;  2QEV A;  3EK8 A;  5TNC A;  1U5I B;  4PHK A;  2O5G A;  1CFD A;  3D77 A;  2LVJ A;  2Y5I A;  2JT3 A;  4I5N B;  1A29 A;  2Y4Q A;  1HQV A;  2GGZ A;  1J7R A;  1QX7 A;  2JZI A;  2WCH A;  1WRL A;  4YI9 A;  2O60 A;  2WCE A;  5HKW A;  1TWO A;  5FI6 A;  3VRO A;  3S0F A;  3QME A;  1C3Y A;  2KPH A;  3ZNI A;  2D8N A;  2EHB A;  1RWY A;  2BNX A; 
#chains in the Genus database with same CATH homology
 2CBL A;  3DD4 A;  4OVN F;  1BOC A;  2G9B A;  1DGV A;  1M63 B;  1PUL A;  1DT7 B;  3DVM A;  5KU1 A;  1L2O B;  2PRU A;  2KHN A;  1YUU A;  1QAS A;  2AUC A;  4QJ3 B;  1SL9 A;  1WRZ A;  4M2O A;  2LV7 A;  1S3P A;  1LKJ A;  1OSA A;  1K2H A;  2MA2 A;  2TN4 A;  5AEQ A;  1QXP A;  1KK8 C;  4PE0 A;  1M46 A;  2HET A;  1YUR A;  4HSZ A;  1YTZ C;  4JQ0 D;  4ORA B;  5CSF A;  1OE9 B;  1JFK A;  1KFX S;  2VRG A;  3RM1 A;  3HCM A;  2PVB A;  5J3X A;  1AVS A;  2HPS A;  1TCO B;  1CFP A;  5HLV A;  3FS7 A;  2JNX A;  3DF0 B;  1GJY A;  2BEC A;  3GK2 A;  4C0J A;  1J1E A;  5I2O A;  3EVR A;  1H4B A;  1GQM A;  2F8P A;  2KAV A;  2KGR A;  2LMV A;  2LC5 A;  3EVU A;  2WC8 A;  2MLF C;  2PAS A;  3PM8 A;  2K8M B;  1UHN A;  1ZAC A;  2ZFD A;  4MVF A;  5JJG A;  2LMU A;  1EG3 A;  3VRQ A;  1EL4 A;  2LAP A;  1FF1 A;  2LVV A;  2K7O A;  3CGA A;  3AAK A;  1K9U A;  3BUM B;  4PDZ A;  4XJK B;  1LVC D;  4QJ4 B;  1PVA A;  1AHR A;  2MLE C;  3SG5 A;  5BPJ A;  4MZL A;  1WRK A;  3PAT A;  1KSM A;  1W7J B;  3DF0 A;  1DJH A;  5HKY A;  3O2P A;  1CDM A;  3NXA A;  3BOW B;  3AAJ A;  4NDB A;  3CTN A;  2L2E A;  2LLT A;  4PHN A;  4A4C A;  2L4H A;  2LHL A;  5D7F A;  1XFV O;  2M49 B;  2NLN A;  3VRN A;  1KFU S;  1JUO A;  2LHI A;  2PSR A;  1B7T Y;  2MAZ A;  3WHT B;  1A03 A;  1TCF A;  4ZCU A;  4ICB A;  1OMD A;  2H61 C;  1K96 A;  1S5G Y;  1F70 A;  1F54 A;  2P6B B;  1R2U A;  4BY5 A;  1NUB A;  1CFC A;  1QAT A;  1ZUZ A;  3AKA A;  4XJK A;  4BY4 A;  1QLK A;  1CDN A;  1S6J A;  1W7I B;  1Y1X A;  5D69 A;  1YR5 A;  2L4I A;  2IS9 A;  5JOL A;  2L50 A;  1SRA A;  3FIA A;  5CSN A;  3BOW A;  4U8D A;  1ALW A;  1RRO A;  3DVJ A;  3FWB A;  1CKK A;  1A4P A;  2I2R E;  1OQP A;  3LL8 B;  2QPT A;  4NQG A;  5AXI A;  1JF0 A;  1IG5 A;  1SBJ A;  1JF2 A;  5CSJ A;  1F55 A;  1PSB A;  5DKR A;  3WHU B;  5ER4 X;  4HRG A;  3GK1 A;  5CPV A;  1B4C A;  1AUI B;  4YGB B;  3I5H C;  3D0Y B;  1BOD A;  2M29 A;  4OR9 B;  4GGN A;  1UUS A;  1J7Q A;  1QVI Z;  2H61 A;  1RK9 A;  1SKT A;  3I5H B;  4GGF C;  1TIZ A;  1PVB A;  1IQ3 A;  4MRY A;  1M45 A;  1DJW A;  1F4O A;  1LIN A;  2JC2 A;  2WND A;  2E30 A;  3OP0 A;  3O4Y A;  4DS7 A;  4AQJ A;  1DJY A;  1ZMZ A;  5IBW A;  1DJI A;  3PFV A;  2KQY A;  3PN7 C;  4I5J A;  4DUQ A;  4YGA A;  3JTD C;  2M7N A;  2NCO A;  3O6B A;  3PN7 B;  1NSH A;  5DKQ A;  3FWC A;  1RTP 1;  1EXR A;  1FW4 A;  1DMO A;  3JTD B;  1KQV A;  1DJX A;  3IF7 A;  2CXJ A;  5PAL A;  4CFR A;  2JT8 A;  3D0Y A;  1IH0 A;  2ZN9 A;  2BCX A;  3F45 A;  1XK4 C;  2CCM A;  5I8N A;  2I7A A;  1QIV A;  4MSP A;  1J7O A;  3K21 A;  2SCP A;  1HT9 A;  2OS8 C;  3WNX B;  1ALV A;  1TOP A;  3ZWH A;  1BU3 A;  4DIR A;  1BMO A;  4GGF A;  1A75 A;  1UHJ A;  2JU0 A;  4D1E A;  2OS8 B;  5GQQ C;  1Y6W A;  2K61 A;  3E3R A;  1L2O C;  1QV1 A;  1OMV A;  1WY9 A;  2ZRS A;  1FPW A;  2G2B A;  4JWQ A;  1SW8 A;  3CLN A;  3OB2 B;  1NCY A;  1K95 A;  3CR4 X;  1U5I A;  5I2Q A;  1FI5 A;  1IWQ A;  3A4U B;  3SG4 A;  1YVH A;  2NXQ A;  1ZOT B;  1YUT A;  1K8U A;  2KYC A;  2RGI A;  4UPG A;  1XK4 A;  2F33 A;  1XFX O;  2LVI A;  1IGV A;  2V53 A;  3CR5 X;  1Y1U A;  3ICB A;  2LP2 A;  1V1G A;  2JTT A;  1PK0 D;  4WQ2 A;  4OCI A;  4PE1 A;  1YX8 A;  2COL B;  1PRW A;  4ETO A;  3BUW B;  1J1D A;  4HRE E;  2KNE A;  2LCP A;  2LLS A;  2M9G A;  1H8B A;  1DF0 B;  4MN0 A;  3LK0 A;  1OZO A;  1XFW O;  2Y1N A;  4GPL B;  1CB1 A;  3QRX A;  2JOJ A;  1UHH A;  1F8H A;  1JFJ A;  2LNK A;  4MLW A;  1CLB A;  5F6T A;  2JUL A;  1NCZ A;  2M8U A;  1KCY A;  1QLS A;  1SNL A;  1SK6 D;  1G33 A;  4GBA A;  1MHO A;  3PAL A;  4F0Z B;  2L51 A;  3TS5 C;  1F71 A;  4PHJ A;  1K94 A;  1VRK A;  3I5G C;  3TS5 B;  1AJ5 A;  1LA3 A;  1QX2 A;  2Q91 A;  1BF5 A;  5B8I B;  2L5X B;  1EG4 A;  3NSK A;  1DF0 A;  1KQM C;  3I5G B;  1NYA A;  1R6P A;  4FQO A;  3SG6 A;  2KOT A;  4PAL A;  2F3Y A;  4OV2 A;  2FOT A;  4MRX A;  2I18 A;  1KQM B;  2AAO A;  2Q4U A;  4PCW A;  2FCE A;  1N65 A;  3C1V A;  2H2K A;  2KFF A;  1Y0V H;  1KK7 Z;  4YGD B;  1TNX A;  1RJV A;  3SG7 A;  4QJ5 B;  1J7P A;  1Q80 A;  3KEV A;  4N1G A;  4MZJ A;  4I5L B;  1M31 A;  1QVI Y;  1DJG A;  3LCP C;  1XA5 A;  1KSO A;  3M0W A;  5I2L A;  2BBM A;  2BCB A;  2K7B A;  2MHH A;  2L0P A;  1DGU A;  5HYD A;  3LK1 A;  1NX2 A;  1BR4 B;  1DTL A;  4FTG A;  1FBV A;  3BXK A;  2I94 A;  4JPZ B;  1S36 A;  1CMG A;  1SMG A;  4CID A;  2WCF A;  5G08 A;  1AK8 A;  2PMY A;  3EKJ A;  1JWD A;  1B8C A;  4PHM A;  2M7L A;  1JSA A;  2KBI A;  1QTX A;  4CLN A;  1MUX A;  1ODB A;  4C0K A;  1NX1 A;  5AAN A;  2BL0 C;  4N5X A;  2Y1M A;  1NP8 A;  2JNF A;  1PAL A;  1DVI A;  1PSR A;  1CDP A;  4HRH A;  2BL0 B;  2HQ8 A;  2K7C A;  3GK4 X;  1KFX L;  2JTZ A;  3HX4 A;  4GFT A;  2LUC A;  1OMR A;  2EC6 C;  1JC2 A;  4A4B A;  1BT6 A;  3BUX B;  1X02 A;  3AKB A;  1GGW A;  1LA0 A;  2EC6 B;  2KFG A;  1GGZ A;  4TNC A;  2LLU A;  3EVV A;  1N0Y A;  3LLE A;  2L98 A;  1CNP A;  2ISD A;  1L7Z A;  1CM4 A;  3WXA A;  1IQ5 A;  1S26 D;  4WQ3 A;  4WRI A;  5CSI A;  2QAC A;  1S6C A;  2B1U A;  1B8L A;  3KF9 A;  2ZNE A;  4MBE A;  2ZRT A;  2KFH A;  4YBH B;  1C7V A;  4C0L A;  1K9K A;  2M97 A;  3NSL A;  1K9P A;  4DRW A;  3TUY C;  1SPY A;  5K89 A;  2SAS A;  1CDL A;  1CLL A;  3SIA A;  1UUR A;  3KO0 A;  2F2P A;  4P2Y B;  4YGC B;  3TUY B;  2LUX A;  2M3W A;  1CMF A;  1UP5 A;  4MZK A;  5AER A;  2KGB C;  5HLO A;  1NX0 A;  2KI6 D;  3MSE B;  4NDC A;  4ORC B;  3EK7 A;  2JPT A;  1NCX A;  1MF8 B;  1KFU L;  2WCB A;  3JVT C;  1EH2 A;  3IQQ A;  2NCP A;  2OPO A;  1G4Y R;  4USL A;  3H4S E;  3I5F C;  1IRJ A;  3JVT B;  3EK4 A;  4IL1 A;  1Y1A A;  1TNP A;  1UHK A;  3I5F B;  2WOR A;  3NSO A;  2F3Z A;  4N1F A;  4R1E A;  2M1K B;  4I5K A;  1XFU O;  4AOM A;  2MRD A;  2LVK A;  1OOJ A;  2BKH B;  2ZKM X;  4PE4 A;  2LAN A;  2K0J A;  1K90 D;  1QV0 A;  1NWD A;  3KPX A;  4YI8 A;  1B9A A;  1BR1 B;  2EGD A;  2JXC A;  3CZT X;  3OB1 B;  5DKN A;  2FCD A;  1DJZ A;  2CTN A;  2LE9 B;  2BE4 A;  1QX5 B;  1IJ6 A;  2AMI A;  2GGM A;  1KK8 B;  3I5I C;  4NDD A;  2BBN A;  1XYD A;  1UWO A;  1KK7 Y;  1SCV A;  1CTR A;  3I5I B;  3PLF B;  3VRP A;  2NZ0 A;  3OHM B;  1LXF C;  2KSP A;  1BJF A;  1SL8 A;  1MXE A;  1XO5 A;  3KHE A;  3SG2 A;  1N2D A;  4YGE B;  4Q04 A;  3SIB A;  1AP4 A;  3CS1 A;  4XYN A;  1TN4 A;  2BKI B;  2JWW A;  1A2X A;  2HF5 A;  3NSI A;  3OX5 A;  2ZND A;  3RLZ A;  1MXL C;  4CPV A;  2ZN8 A;  2JRF A;  1V1F A;  1CFF A;  2KI6 C;  1B47 A;  4M2Q A;  1D1O A;  4P5O E;  1B1G A;  3A8R A;  1XVJ A;  2LM5 A;  1OZS A;  1CLM A;  1YUS A;  3CWG A;  2DOQ A;  2KAY A;  3OX6 A;  1K93 D;  1REC A;  1YRT B;  3BQ3 A;  1YRU B;  1TRF A;  1TTX A;  2KI4 C;  5ER5 A;  1J55 A;  4CFQ A;  1BLQ A;  3BUO B;  2BCA A;  3TDZ A;  2KI4 B;  1CM1 A;  1B8R A;  1C07 A;  3DVK A;  2E6W A;  3TDI A;  1BG1 A;  1MWN A;  1QJT A;  2M0R A;  3D10 A;  1F4Q A;  4DCK A;  5KTY A;  2MJW B;  1MR8 A;  1NIW A;  2LP3 A;  1SL7 A;  2KYF A;  1S6I A;  2KAX A;  1IKU A;  1G8I A;  1FI6 A;  1SCM C;  1XFZ O;  2WOS A;  4E68 A;  3IQO A;  2M1U A;  1WDC C;  4PE7 A;  3CR2 A;  5AFP A;  1XFY O;  1QIW A;  1SCM B;  3O78 A;  3BUN B;  2CNP A;  1RFJ A;  4YRU A;  1SYM A;  1WDC B;  1WLZ A;  1WLM A;  4OKH A;  3TDU A;  1NPQ A;  4ZCV A;  1JBA A;  2GV5 A;  4GAO A;  2K2F A;  2JQ6 A;  2JT0 A;  1B7T Z;  1SR6 C;  1QS7 A;  2K2A A;  1IJ5 A;  1NX3 A;  4GNK B;  2HQW A;  1S5G Z;  5FYX A;  2PAL A;  1ZFS A;  3SJS A;  4AQI A;  1SR6 B;  3VRR A;  2OTG C;  2A4J A;  4ORB B;  5KSZ A;  1TNW A;  2R2I A;  3PSR A;  3SG3 A;  2OTG B;  1C7W A;  2KBM A;  3GOF A;  5HKZ A;  2MBX A;  4M2P A;  2F2O A;  2LMT A;  4L9M A;  2FJU B;  1A75 B;  1E8A A;  1KWO C;  3BYA A;  3VGO A;  2CT9 A;  3EKH A;  3TZ1 A;  1TNQ A;  1KWO B;  2K7D A;  1S1E A;  4GUK A;  4MEW A;  2KQ6 A;  1AJ4 A;  1YVL A;  2KDH A;  1UHI A;  1SY9 A;  1MQ1 A;  2JXL A;  1YX7 A;  3DVE A;  1EJ3 A;  2BE6 A;  1M39 A;  3EK8 A;  5TNC A;  1U5I B;  4PHK A;  2O5G A;  1CFD A;  2LVJ A;  2Y5I A;  2JT3 A;  4I5N B;  1A29 A;  2Y4Q A;  1HQV A;  2GGZ A;  1J7R A;  1QX7 A;  2JZI A;  1WRL A;  4YI9 A;  2O60 A;  2WCE A;  5HKW A;  3VRO A;  3ZNI A;  2D8N A;  2EHB A;  1RWY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...