1DT7B

Solution structure of the c-terminal negative regulatory domain of p53 in a complex with ca2+-bound s100b(bb)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
92
structure length
92
Chain Sequence
MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDEDGDGECDFQEFMAFVSMVTTACHEFFEHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords S100 CALCIUM-BINDING PROTEIN
publication title Structure of the negative regulatory domain of p53 bound to S100B(betabeta).
pubmed doi rcsb
source organism Rattus norvegicus
total genus 27
structure length 92
sequence length 92
chains with identical sequence A
ec nomenclature
pdb deposition date 2000-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00036 EF-hand_1 EF hand
B PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1dt7B00
1DTLA 1IWQA 1CM4A 2JNXA 5CPVA 3OP0A 3SG2A 2JT3A 4AQIA 3NXAA 1UHHA 2B1UA 2CTNA 2MA2A 4DS7A 2O5GA 2EC6C 5G08A 2CNPA 5K89A 1A2XA 1QXPA 4I5KA 3MSEB 3OX6A 1AK8A 1OQPA 1EH2A 1QLKA 1W7JB 1SKTA 4E68A 4P2YB 4QJ5B 1CFCA 1KQMC 2L0PA 1UHIA 1BU3A 1UURA 4M2PA 4QJ3B 5KU1A 1UHJA 1BJFA 3WHUB 2KFGA 4AOMA 1K9KA 1IGVA 1PSRA 4CPVA 1WLMA 2K2FA 1EJ3A 2M97A 1A75B 1BR4B 2Q4UA 3EVVA 1FI5A 1PALA 1OZSA 4YGBB 3DVKA 1LKJA 2COLB 1KFUL 1B7TY 1A29A 1TCOB 1JWDA 2JTTA 4A4CA 1DMOA 1RROA 3DVMA 4ICBA 4CLNA 1QV0A 2OS8C 2WCEA 4L9MA 3IQQA 1CFFA 1DF0B 5CSNA 1WDCB 3GK1A 3BUNB 4HRGA 1Y1UA 3TDUA 3AAJA 1DJXA 1SY9A 1KFUS 3D0YA 1KFXL 2MJWB 4PCWA 2LLUA 3M0WA 3I5FB 4I5NB 1SCVA 1G33A 2RGIA 3BOWB 2V53A 2ZRTA 4USLA 2Y4QA 2QPTA 1XO5A 2KI4B 1IJ6A 2KFHA 3CWGA 1B8CA 1B8RA 1KSOA 4NDBA 3SG4A 1S5GY 4I5LB 2PSRA 1PVBA 2LM5A 4GGFA 1WLZA 2F2OA 1S1EA 3OX5A 3TDZA 1GGZA 3TS5B 4IL1A 1ZFSA 2JT8A 3KHEA 4ORAB 3EKJA 2NXQA 2I7AA 1F55A 3DF0A 1WRKA 4C0JA 1RTP1 2H2KA 1VRKA 4YGCB 1KCYA 2L4HA 1S3PA 2Y5IA 3NSLA 3I5GB 1CDMA 4YRUA 2H61C 3LK1A 1U5IB 2KHNA 1A75A 4WQ2A 1WRLA 5AEQA 2NCOA 1S6IA 2BCBA 2JQ6A 1J7PA 1CNPA 5AXIA 4MBEA 3VRQA 3AKBA 3BUWB 2ZRSA 2WCFA 4MSPA 3CS1A 5D7FA 3PN7B 3I5HB 2G2BA 3PALA 5DKQA 5KTYA 1DF0A 2ZKMX 2JTZA 1QX7A 1R6PA 1NX3A 2KBIA 1TNQA 2BCXA 2NLNA 3TUYC 3WXAA 4OCIA 1UHNA 1NUBA 2PVBA 4PE0A 4MZJA 2JULA 1NCZA 3BUXB 1WY9A 2LVKA 3VRNA 1DJIA 3PFVA 4FTGA 1HT9A 5AERA 3JVTB 1LA3A 1XK4C 2JT0A 2TN4A 2G9BA 2K7CA 2KGRA 3BYAA 1FW4A 3BOWA 1LA0A 5DKRA 4BY5A 3SG6A 1QLSA 2KYCA 1SW8A 2HPSA 2LAPA 3A4UB 1DJHA 2K7DA 4TNCA 2KI6C 4QJ4B 3O2PA 2KYFA 1SK6D 1YVHA 1DJZA 3CLNA 1GJYA 1Y6WA 1JF0A 5CSFA 3EK4A 1NIWA 1W7IB 2Q91A 3BQ3A 1YUSA 3O6BA 1KQMB 2E6WA 3D0YB 3OB2B 1M31A 2LLTA 2LC5A 2ZNEA 1NSHA 1S6JA 1TTXA 2AAOA 3PATA 1SCMC 5KSZA 3QRXA 1QASA 2MHHA 4XJKA 1RECA 3SG7A 1F8HA 2QACA 2JZIA 2KOTA 4C0KA 4MVFA 1AHRA 4I5JA 2AMIA 1J1DA 3C1VA 5AFPA 2LV7A 3LLEA 2KAVA 1PK0D 1IJ5A 1J55A 1U5IA 2HETA 4ORCB 1B47A 1TCFA 5I2LA 2M1UA 4MRYA 1ZUZA 1SPYA 1YRUB 1LXFC 1CLMA 4CFQA 5JJGA 1PSBA 4DUQA 2KSPA 1KK8B 1G4YR 1JC2A 4GAOA 2JOJA 1H8BA 5D69A 1MF8B 5I2QA 1GGWA 1JBAA 2FJUB 3DF0B 4HRHA 2F33A 2WOSA 1TNPA 2LMVA 4ZCUA 2LP2A 3PLFB 2KQYA 1NWDA 1AJ5A 3EVRA 4OVNF 1QVIZ 3ZWHA 1C07A 3PSRA 2KFFA 1K96A 2PMYA 4DIRA 2I2RE 1L2OC 4ORBB 1B4CA 1TNWA 1WRZA 2KQ6A 2BL0B 1KSMA 2ZN9A 5TNCA 2PALA 1ALVA 5HKYA 2KGBC 1SL7A 4N1GA 3VRPA 1JFKA 1OZOA 1YX8A 2WNDA 3HCMA 4CFRA 4GGNA 1QV1A 1OOJA 4GFTA 4YBHB 1NCXA 4CIDA 1B1GA 1EL4A 5HKZA 1HQVA 5CSIA 1TNXA 1CDLA 2MLEC 1MXLC 2LP3A 2K7BA 3ZNIA 1YX7A 3CTNA 4JQ0D 4PE1A 1AUIB 1G8IA 1M39A 1MR8A 3DVJA 2F3YA 4NDDA 5I2OA 2WORA 4D1EA 2JXCA 1Y0VH 1X02A 2OPOA 1CLLA 1EXRA 4P5OE 2LVIA 2ZFDA 3RM1A 2M29A 3EKHA 2L4IA 1UWOA 4MEWA 3SG5A 3IF7A 2Y1MA 1RFJA 3E3RA 5CSJA 2M3WA 2OTGB 1QX5B 1IQ5A 1PRWA 2WCBA 1SNLA 1TN4A 3GK2A 2E30A 4XJKB 2JRFA 1SYMA 1KWOC 1XVJA 2BKHB 2JWWA 3VROA 1F71A 4Q04A 2L2EA 1NYAA 2O60A 3FS7A 1J1EA 4PHMA 1BF5A 1BOCA 1KK7Z 1TIZA 3LK0A 2LMUA 1CTRA 2F2PA 2M9GA 1C7VA 1CM1A 1F4QA 2EGDA 4BY4A 1XFXO 1SR6B 1ZMZA 1WDCC 1J7RA 3JTDC 4WRIA 2HF5A 3CZTX 1K93D 2BE6A 1K8UA 3FWBA 3AAKA 1XFVO 2LMTA 2SCPA 3RLZA 1ZOTB 1ALWA 4A4BA 4PALA 1BODA 2LLSA 1EG3A 1M63B 1TRFA 1XYDA 2IS9A 1QATA 1RWYA 2KNEA 2KI4C 3CR5X 1DT7B 2GGZA 1S6CA 1MQ1A 4PHKA 2CBLA 1EG4A 4R1EA 1C7WA 1RJVA 4JPZB 1J7QA 3LCPC 1OMRA 1K95A 1NX0A 1QTXA 5DKNA 2F8PA 1CMGA 2EC6B 3H4SE 1SBJA 5BPJA 4UPGA 2LANA 4YGEB 1N65A 5HKWA 1K9PA 3TS5C 1M46A 3EVUA 2LVVA 1LVCD 1DJYA 4GBAA 2M7NA 1MWNA 1JUOA 4GNKB 3I5IC 1K90D 3DD4A 1F54A 1Y1AA 4F0ZB 2KBMA 3I5GC 1N2DA 2PASA 1J7OA 1BT6A 1SMGA 5ER4X 1BMOA 1YUTA 2GGMA 2JNFA 1AP4A 5J3XA 1BR1B 1XFYO 3FWCA 5PALA 3BXKA 1TOPA 1SL9A 1S36A 1QS7A 3PM8A 1MXEA 1BLQA 3SIAA 2BKIB 1GQMA 1MHOA 2MRDA 1XK4A 2AUCA 2KAYA 3I5HC 3WHTB 1B8LA 1XFUO 2BBNA 2LE9B 4PE7A 2MBXA 1DJGA 2M49B 2K8MB 1ZACA 3TDIA 3A8RA 1FF1A 2DOQA 2OS8B 1BG1A 1OMVA 5GQQC 2JU0A 4YI9A 4DRWA 3OB1B 5FYXA 3BUMB 1OSAA 2I18A 3JVTC 4ZCVA 1FBVA 1YRTB 2M8UA 5AANA 1RK9A 1V1FA 1M45A 1K2HA 4YGDB 2KAXA 1PVAA 1UP5A 3KEVA 4DCKA 3GK4X 1D1OA 3CR2A 2P6BB 3O78A 3EK7A 1A03A 3TZ1A 1JSAA 1B7TZ 4PHJA 1DGVA 2KI6D 1H4BA 4AQJA 3VGOA 1PULA 4PDZA 1CLBA 1QVIY 2PRUA 2BE4A 4GUKA 3VRRA 1DGUA 3KF9A 2WC8A 1KWOB 1MUXA 1XFZO 1LINA 2FOTA 4PE4A 1NX1A 5B8IB 1CKKA 3O4YA 4GGFC 2CT9A 2MAZA 1KK8C 1NP8A 4N5XA 1CMFA 2SASA 2L98A 2M7LA 1QJTA 3JTDB 3IQOA 3DVEA 4FQOA 1S5GZ 4JWQA 1JFJA 3NSKA 2FCDA 4YI8A 1CFPA 1QX2A 5IBWA 1F70A 1E8AA 3NSIA 3KO0A 2BECA 2BBMA 3WNXB 1V1GA 1YR5A 3TUYB 1XA5A 2BL0C 2KDHA 2LNKA 1A4PA 1OMDA 3FIAA 2JC2A 4M2OA 3ICBA 2I94A 4OV2A 2CCMA 1YTZC 1NPQA 3LL8B 3CGAA 1DJWA 1KFXS 2L50A 1SRAA 5HYDA 1NX2A 4ETOA 4HREE 4OR9B 1CDNA 1DVIA 4YGAA 1ODBA 2D8NA 2M1KB 1CFDA 4MRXA 2MLFC 5I8NA 3OHMB 4XYNA 4OKHA 3HX4A 3I5IB 2HQWA 3I5FC 3D10A 2A4JA 3BUOB 3F45A 1KK7Y 5F6TA 2EHBA 2NCPA 1FI6A 4MZLA 1SCMB 4PHNA 1YVLA 3GOFA 2L5XB 4MLWA 5ER5A 1IKUA 1CB1A 3SIBA 1SL8A 1JF2A 2K0JA 2JXLA 1YURA 2ZN8A 1K94A 4N1FA 5HLVA 4MN0A 2H61A 2LHLA 4GPLB 4NDCA 2BCAA 2NZ0A 2OTGC 2HQ8A 3AKAA 1AJ4A 1IH0A 1R2UA 2Y1NA 3K21A 4NQGA 4WQ3A 3EK8A 2LUCA 4C0LA 5HLOA 3CR4X 2M0RA 2K7OA 3SG3A 1OE9B 1IQ3A 1FPWA 2ZNDA 2ISDA 1KQVA 1UHKA 1K9UA 3SJSA 2L51A 1F4OA 2FCEA 2VRGA 1NCYA 1Q80A 1XFWO 1SR6C 1IG5A 3KPXA 1QIVA 1AVSA 1L2OB 2K2AA 4U8DA 2K61A 2JPTA 4MZKA 2GV5A 2LVJA 5JOLA 2LUXA 3PN7C 2F3ZA 1CDPA 2LCPA 1N0YA 2LHIA 1S26D 4M2QA 1UUSA 1B9AA 4HSZA 1L7ZA 1YUUA 2CXJA 2R2IA 3NSOA 1Y1XA 1QIWA 1IRJA
chains in the Genus database with same CATH superfamily
1DTLA 1IWQA 1CM4A 2JNXA 5CPVA 2QEOA 3OP0A 3SG2A 2JT3A 4AQIA 3NXAA 1UHHA 2B1UA 2CTNA 2MA2A 4DS7A 1P28A 2O5GA 2KLDA 2EC6C 5G08A 2CNPA 5K89A 1A2XA 1QXPA 5DICA 4I5KA 3MSEB 3OX6A 1AK8A 1OQPA 3R72A 2PQLA 1EH2A 1QLKA 1W7JB 1SKTA 4E68A 4P2YB 4QJ5B 1CFCA 1KQMC 2L0PA 1UHIA 1BU3A 1UURA 1TUZA 3D73A 4M2PA 4QJ3B 5KU1A 1UHJA 1BJFA 3WHUB 2KFGA 4AOMA 3VB1A 3D76A 1K9KA 1IGVA 1PSRA 4CPVA 2BAPA 1WLMA 1T14A 2K2FA 3CZ0A 1EJ3A 2M97A 1A75B 3S0FA 1BR4B 2Q4UA 3EVVA 1FI5A 1PALA 1LS8A 1OZSA 4YGBB 3DVKA 1LKJA 2COLB 1KFUL 1B7TY 1A29A 1TCOB 1JWDA 2JTTA 4A4CA 1DMOA 3BJHA 1RROA 3DVMA 4ICBA 4CLNA 1QV0A 2OS8C 2WCEA 3CZ1A 3IQQA 4L9MA 1CFFA 1DF0B 5CSNA 4PT1A 1WDCB 3GK1A 3BUNB 4HRGA 2WCHA 1Y1UA 3TDUA 3AAJA 1DJXA 1SY9A 1KFUS 3D0YA 1KFXL 3CYZA 2MJWB 4PCWA 2LLUA 4OZDA 3M0WA 3I5FB 4I5NB 1SCVA 1G33A 2RGIA 3BOWB 2V53A 2ZRTA 4USLA 2Y4QA 2QPTA 1XO5A 2KI4B 1IJ6A 2KFHA 3CWGA 1B8CA 1B8RA 1KSOA 4NDBA 3SG4A 1S5GY 4I5LB 2PSRA 1PVBA 2LM5A 4GGFA 3B87A 1WLZA 2F2OA 1S1EA 3OX5A 3TDZA 1DQEA 1GGZA 3SS5A 4IL1A 1ZFSA 2JT8A 3TS5B 3KHEA 3PJIA 3R1OA 3EKJA 2NXQA 3O4XA 2I7AA 4ORAB 2H8VA 1F55A 3DF0A 1WRKA 4C0JA 1RTP1 2H2KA 1VRKA 4YGCB 1KCYA 2L4HA 1S3PA 2Y5IA 3NSLA 3I5GB 1CDMA 4YRUA 2H61C 3LK1A 1U5IB 2KHNA 1A75A 4WQ2A 1WRLA 5AEQA 2NCOA 1S6IA 2BCBA 2JQ6A 1J7PA 1CNPA 2WCMA 4MBEA 5AXIA 3VRQA 3AKBA 3BUWB 2ZRSA 2WCFA 4MSPA 3CS1A 5D7FA 1GM0A 3PN7B 3I5HB 2G2BA 3PALA 5DKQA 5KTYA 2KPHA 1DF0A 2ZKMX 2JTZA 1QX7A 1R6PA 1NX3A 2KBIA 1TNQA 2BCXA 2NLNA 3TUYC 3WXAA 4OCIA 1UHNA 1NUBA 2PVBA 4PE0A 4MZJA 2JULA 1NCZA 3BFAA 1WY9A 3BUXB 2LVKA 3S0DA 3S0GA 1DJIA 3PFVA 4FTGA 1HT9A 3VRNA 3JVTB 5AERA 1LA3A 1XK4C 2JT0A 2TN4A 2G9BA 2K7CA 2KGRA 3BYAA 1FW4A 3BOWA 1LA0A 5DKRA 4BY5A 1ORGA 3SG6A 1QLSA 2KYCA 1SW8A 2HPSA 2LAPA 3A4UB 1DJHA 2K7DA 4TNCA 2KI6C 3V2LA 4QJ4B 3O2PA 2KYFA 1SK6D 1YVHA 1DJZA 3CLNA 1GJYA 3BFBA 1Y6WA 1JF0A 5CSFA 3EK4A 1NIWA 1W7IB 2Q91A 3BQ3A 1YUSA 3O6BA 1KQMB 2E6WA 3D0YB 3OB2B 1M31A 2LLTA 2LC5A 2ZNEA 1NSHA 3B7AA 1S6JA 1TTXA 3FE6A 5I94A 2AAOA 3PATA 1SCMC 5KSZA 3QRXA 1QASA 2MHHA 4XJKA 1RECA 3SG7A 1F8HA 2QACA 3SS4A 2JZIA 2KOTA 4C0KA 3CABA 4MVFA 1AHRA 4I5JA 2AMIA 1OOHA 1J1DA 3C1VA 5AFPA 2LV7A 3LLEA 2KAVA 3RZSA 1PK0D 1IJ5A 1J55A 1U5IA 2HETA 2QEVA 3L4AA 4ORCB 1B47A 1TCFA 5I2LA 2M1UA 4MRYA 1ZUZA 1SPYA 1YRUB 1LXFC 1CLMA 4CFQA 5JJGA 1PSBA 4DUQA 3BFHA 1TUJA 1TWOA 1XFRA 1KK8B 2KSPA 1G4YR 1JC2A 4GAOA 2JOJA 1H8BA 1DELA 1MF8B 5D69A 5I2QA 1GGWA 3D75A 1JBAA 2FJUB 3DF0B 4HRHA 2F33A 2WOSA 3PM2A 1TNPA 2LMVA 4ZCUA 2LP2A 3PLFB 2KQYA 3SS3A 1NWDA 1AJ5A 3EVRA 4OVNF 1QVIZ 4F7FA 3S0AA 3ZWHA 1C07A 2L2CA 3PSRA 2KFFA 3EG5B 1K96A 2PMYA 4DIRA 3R1PA 3NHIA 2I2RE 1L2OC 4ORBB 1B4CA 1TNWA 1WRZA 3R1VA 2KQ6A 2BL0B 1KSMA 2ZN9A 5TNCA 2PALA 1ALVA 5HKYA 2KGBC 1SL7A 4N1GA 3VRPA 3N7HA 1JFKA 1OZOA 1YX8A 2WNDA 3HCMA 1SSEB 4CFRA 4GGNA 1QV1A 1OOJA 4GFTA 4YBHB 1NCXA 3QMEA 4CIDA 1B1GA 2WCKA 1EL4A 5HKZA 1HQVA 5CSIA 1TNXA 1CDLA 2MLEC 1MXLC 2LP3A 2K7BA 1C3YA 3ZNIA 1YX7A 3CTNA 3CZ2A 4JQ0D 4PE1A 1AUIB 1G8IA 1M39A 1MR8A 3DVJA 2F3YA 4NDDA 5I2OA 2WORA 4D1EA 2JXCA 1Y0VH 2QEBA 1X02A 3FE8A 2OPOA 1CLLA 1EXRA 4P5OE 2LVIA 2ZFDA 3RM1A 5HL1A 2M29A 5D3OA 3EKHA 2L4IA 1UWOA 4MEWA 3SG5A 3IF7A 2Y1MA 1RFJA 3E3RA 5CSJA 2M3WA 2OTGB 1QX5B 1IQ5A 1PRWA 2WCBA 1SNLA 1TN4A 3GK2A 2E30A 4XJKB 2JRFA 3S0EA 1SYMA 1KWOC 1XVJA 2BKHB 2JWWA 3VROA 1OOGA 4Q04A 1F71A 2L2EA 1NYAA 2PYQA 2O60A 3FS7A 1J1EA 4PHMA 1BF5A 1BOCA 1KK7Z 1TIZA 3LK0A 2LMUA 1CTRA 1Z4HA 2F2PA 2M9GA 3UO9A 1CM1A 1F4QA 1C7VA 2EGDA 4BY4A 1XFXO 1SR6B 1ZMZA 1WDCC 1J7RA 3JTDC 4WRIA 2HF5A 3CZTX 1K93D 1K8UA 2BE6A 3FWBA 3AAKA 1XFVO 1OOIX 2LMTA 2SCPA 3RLZA 1ZOTB 3IVTA 2K60A 1ALWA 4A4BA 4PALA 2QDIA 1BODA 2LLSA 1EG3A 1M63B 1TRFA 1XYDA 2IS9A 1QATA 1RWYA 2KNEA 2KI4C 3CR5X 1DT7B 2GGZA 1S6CA 1MQ1A 4PHKA 2CBLA 1EG4A 4R1EA 1C7WA 1RJVA 2P71A 4JPZB 1J7QA 3LCPC 1OMRA 1K95A 1NX0A 1QTXA 5DKNA 2F8PA 1CMGA 2EC6B 3H4SE 1SBJA 5BPJA 4UPGA 2LANA 4YGEB 1N65A 5HKWA 1K9PA 3TS5C 1M46A 3EVUA 2LVVA 1LVCD 1DJYA 4GBAA 1IIOA 2M7NA 1MWNA 1JUOA 4GNKB 3I5IC 1K90D 3DD4A 1F54A 1Y1AA 4F0ZB 2KBMA 3I5GC 1N2DA 2PASA 1J7OA 1BT6A 1SMGA 5ER4X 1BMOA 1YUTA 2GGMA 2JNFA 1AP4A 5J3XA 1BR1B 1XFYO 1OW4A 3FWCA 5PALA 3BXKA 1TOPA 3Q8IA 3UNWA 1SL9A 1S36A 1QS7A 3PM8A 1MXEA 1BLQA 3SIAA 2BKIB 1GQMA 3D74A 1MHOA 2WC6A 2MRDA 1XK4A 2AUCA 2JPOA 2KAYA 3I5HC 2BNXA 4FQTA 3WHTB 1B8LA 3NGVA 1XFUO 2BBNA 2LE9B 4PE7A 2MBXA 1DJGA 2M49B 2K8MB 1ZACA 3TDIA 3A8RA 1FF1A 2DOQA 2OS8B 1BG1A 1OMVA 3D78A 2JU0A 5GQQC 1W9ZA 4YI9A 4DRWA 3OB1B 4KYNA 5FYXA 3BUMB 5EL2A 1OSAA 2I18A 3JVTC 4ZCVA 1FBVA 1YRTB 2M8UA 5AANA 1RK9A 1V1FA 1M45A 4JD9A 1K2HA 4YGDB 2KAXA 1PVAA 1UP5A 3KEVA 4DCKA 3GK4X 1D1OA 3CR2A 3DXLA 2P6BB 3O78A 3EK7A 1A03A 3TZ1A 1QWVA 1JSAA 1B7TZ 4PHJA 1DGVA 2KI6D 2FJYA 1H4BA 4AQJA 3VGOA 1PULA 4PDZA 1CLBA 1QVIY 2PRUA 2BE4A 4GUKA 3VRRA 1DGUA 5FI7A 3KF9A 2WC8A 2ERBA 1KWOB 1MUXA 1XFZO 1LINA 2FOTA 4PE4A 1NX1A 5B8IB 1CKKA 3O4YA 4GGFC 2WC5A 4JKTA 2CT9A 2MAZA 1KK8C 1NP8A 4N5XA 1CMFA 2SASA 2L98A 2P70A 2M7LA 1QJTA 3JTDB 3IQOA 3DVEA 4FQOA 1S5GZ 4JWQA 3S0BA 1JFJA 3NSKA 2FCDA 4YI8A 1CFPA 1QX2A 5IBWA 1DEKA 1OOFA 1F70A 3B6XA 1E8AA 3B86A 2QEHA 3NSIA 3KO0A 2BECA 2BBMA 3WNXB 1V1GA 1YR5A 3TUYB 1XA5A 3K1EA 2BL0C 2KDHA 2LNKA 1A4PA 1OMDA 3FIAA 2JC2A 4M2OA 3ICBA 2I94A 4OV2A 2CCMA 1YTZC 1NPQA 2L5YA 2WCLA 3LL8B 3CGAA 1DJWA 3DZTA 3B88A 1KFXS 2L50A 1SRAA 5HYDA 1NX2A 4ETOA 4HREE 4OR9B 3DYEA 1CDNA 1DVIA 4YGAA 1ODBA 2D8NA 2M1KB 1CFDA 4MRXA 2MLFC 2KLEA 3NHTA 5I8NA 3OHMB 3OBVA 1DC1A 4XYNA 4OKHA 3HX4A 3I5IB 3OGNA 2HQWA 3I5FC 3D10A 2A4JA 3BUOB 3F45A 1KK7Y 5F6TA 2EHBA 2NCPA 3CDNA 4MZLA 1SCMB 4IJ7A 4PHNA 5FI6A 1YVLA 1FI6A 3GOFA 2GTEA 2L5XB 4MLWA 5ER5A 1IKUA 3SIBA 1CB1A 1SL8A 1JF2A 2K0JA 2JXLA 1YURA 2ZN8A 1K94A 4N1FA 5HLVA 4MN0A 2H61A 2LHLA 4GPLB 4NDCA 2BCAA 2NZ0A 2OTGC 2HQ8A 3AKAA 1AJ4A 1IH0A 1R2UA 2Y1NA 3K21A 4NQGA 4WQ3A 3EK8A 2LUCA 4C0LA 5HLOA 3CR4X 2M0RA 2K7OA 3SG3A 1OE9B 1IQ3A 4INWA 3L4LA 1FPWA 2ZNDA 3FE9A 2ISDA 1KQVA 1UHKA 1K9UA 1Z2CB 3D77A 2L51A 3DY9A 1F4OA 5FI2A 3SJSA 2FCEA 2VRGA 1NCYA 1Q80A 1XFWO 1SR6C 1IG5A 3KPXA 1QIVA 3L47A 1AVSA 1L2OB 2K2AA 2YGUA 4U8DA 2K61A 2JPTA 4MZKA 2GV5A 2LVJA 5JOLA 2LUXA 3PN7C 2F3ZA 1CDPA 2LCPA 1N0YA 2LHIA 1S26D 4M2QA 1UUSA 1B9AA 2WCJA 4HSZA 1L7ZA 1YUUA 2CXJA 2R2IA 4INXA 3NSOA 1Y1XA 1QIWA 1C3ZA 1IRJA
chains in the Genus database with same CATH topology
1DTLA 1IWQA 1CM4A 2JNXA 5CPVA 3OP0A 3SG2A 2JT3A 4AQIA 3NXAA 1UHHA 2B1UA 2CTNA 2MA2A 4DS7A 2O5GA 2EC6C 5G08A 2CNPA 5K89A 1A2XA 1QXPA 4I5KA 3MSEB 3OX6A 1AK8A 1OQPA 1EH2A 1QLKA 1W7JB 1SKTA 4E68A 4P2YB 4QJ5B 1CFCA 1KQMC 2L0PA 1UHIA 1BU3A 1UURA 4M2PA 4QJ3B 5KU1A 1UHJA 1BJFA 3WHUB 2KFGA 4AOMA 1K9KA 1IGVA 1PSRA 4CPVA 1WLMA 2K2FA 1EJ3A 2M97A 1A75B 1BR4B 2Q4UA 3EVVA 1FI5A 1PALA 1OZSA 4YGBB 3DVKA 1LKJA 2COLB 1KFUL 1B7TY 1A29A 1TCOB 1JWDA 2JTTA 4A4CA 1DMOA 1RROA 3DVMA 4ICBA 4CLNA 1QV0A 2OS8C 2WCEA 4L9MA 3IQQA 1CFFA 1DF0B 5CSNA 1WDCB 3GK1A 3BUNB 4HRGA 1Y1UA 3TDUA 3AAJA 1DJXA 1SY9A 1KFUS 3D0YA 1KFXL 2MJWB 4PCWA 2LLUA 3M0WA 3I5FB 4I5NB 1SCVA 1G33A 2RGIA 3BOWB 2V53A 2ZRTA 4USLA 2Y4QA 2QPTA 1XO5A 2KI4B 1IJ6A 2KFHA 3CWGA 1B8CA 1B8RA 1KSOA 4NDBA 3SG4A 1S5GY 4I5LB 2PSRA 1PVBA 2LM5A 4GGFA 1WLZA 2F2OA 1S1EA 3OX5A 3TDZA 1GGZA 3TS5B 4IL1A 1ZFSA 2JT8A 3KHEA 4ORAB 3EKJA 2NXQA 2I7AA 1F55A 3DF0A 1WRKA 4C0JA 1RTP1 2H2KA 1VRKA 4YGCB 1KCYA 2L4HA 1S3PA 2Y5IA 3NSLA 3I5GB 1CDMA 4YRUA 2H61C 3LK1A 1U5IB 2KHNA 1A75A 4WQ2A 1WRLA 5AEQA 2NCOA 1S6IA 2BCBA 2JQ6A 1J7PA 1CNPA 5AXIA 4MBEA 3VRQA 3AKBA 3BUWB 2ZRSA 2WCFA 4MSPA 3CS1A 5D7FA 3PN7B 3I5HB 2G2BA 3PALA 5DKQA 5KTYA 1DF0A 2ZKMX 2JTZA 1QX7A 1R6PA 1NX3A 2KBIA 1TNQA 2BCXA 2NLNA 3TUYC 3WXAA 4OCIA 1UHNA 1NUBA 2PVBA 4PE0A 4MZJA 2JULA 1NCZA 3BUXB 1WY9A 2LVKA 3VRNA 1DJIA 3PFVA 4FTGA 1HT9A 5AERA 3JVTB 1LA3A 1XK4C 2JT0A 2TN4A 2G9BA 2K7CA 2KGRA 3BYAA 1FW4A 3BOWA 1LA0A 5DKRA 4BY5A 3SG6A 1QLSA 2KYCA 1SW8A 2HPSA 2LAPA 3A4UB 1DJHA 2K7DA 4TNCA 2KI6C 4QJ4B 3O2PA 2KYFA 1SK6D 1YVHA 1DJZA 3CLNA 1GJYA 1Y6WA 1JF0A 5CSFA 3EK4A 1NIWA 1W7IB 2Q91A 3BQ3A 1YUSA 3O6BA 1KQMB 2E6WA 3D0YB 3OB2B 1M31A 2LLTA 2LC5A 2ZNEA 1NSHA 1S6JA 1TTXA 2AAOA 3PATA 1SCMC 5KSZA 3QRXA 1QASA 2MHHA 4XJKA 1RECA 3SG7A 1F8HA 2QACA 2JZIA 2KOTA 4C0KA 4MVFA 1AHRA 4I5JA 2AMIA 1J1DA 3C1VA 5AFPA 2LV7A 3LLEA 2KAVA 1PK0D 1IJ5A 1J55A 1U5IA 2HETA 4ORCB 1B47A 1TCFA 5I2LA 2M1UA 4MRYA 1ZUZA 1SPYA 1YRUB 1LXFC 1CLMA 4CFQA 5JJGA 1PSBA 4DUQA 2KSPA 1KK8B 1G4YR 1JC2A 4GAOA 2JOJA 1H8BA 5D69A 1MF8B 5I2QA 1GGWA 1JBAA 2FJUB 3DF0B 4HRHA 2F33A 2WOSA 1TNPA 2LMVA 4ZCUA 2LP2A 3PLFB 2KQYA 1NWDA 1AJ5A 3EVRA 4OVNF 1QVIZ 3ZWHA 1C07A 3PSRA 2KFFA 1K96A 2PMYA 4DIRA 2I2RE 1L2OC 4ORBB 1B4CA 1TNWA 1WRZA 2KQ6A 2BL0B 1KSMA 2ZN9A 5TNCA 2PALA 1ALVA 5HKYA 2KGBC 1SL7A 4N1GA 3VRPA 1JFKA 1OZOA 1YX8A 2WNDA 3HCMA 4CFRA 4GGNA 1QV1A 1OOJA 4GFTA 4YBHB 1NCXA 4CIDA 1B1GA 1EL4A 5HKZA 1HQVA 5CSIA 1TNXA 1CDLA 2MLEC 1MXLC 2LP3A 2K7BA 3ZNIA 1YX7A 3CTNA 4JQ0D 4PE1A 1AUIB 1G8IA 1M39A 1MR8A 3DVJA 2F3YA 4NDDA 5I2OA 2WORA 4D1EA 2JXCA 1Y0VH 1X02A 2OPOA 1CLLA 1EXRA 4P5OE 2LVIA 2ZFDA 3RM1A 2M29A 3EKHA 2L4IA 1UWOA 4MEWA 3SG5A 3IF7A 2Y1MA 1RFJA 3E3RA 5CSJA 2M3WA 2OTGB 1QX5B 1IQ5A 1PRWA 2WCBA 1SNLA 1TN4A 3GK2A 2E30A 4XJKB 2JRFA 1SYMA 1KWOC 1XVJA 2BKHB 2JWWA 3VROA 1F71A 4Q04A 2L2EA 1NYAA 2O60A 3FS7A 1J1EA 4PHMA 1BF5A 1BOCA 1KK7Z 1TIZA 3LK0A 2LMUA 1CTRA 2F2PA 2M9GA 1C7VA 1CM1A 1F4QA 2EGDA 4BY4A 1XFXO 1SR6B 1ZMZA 1WDCC 1J7RA 3JTDC 4WRIA 2HF5A 3CZTX 1K93D 2BE6A 1K8UA 3FWBA 3AAKA 1XFVO 2LMTA 2SCPA 3RLZA 1ZOTB 1ALWA 4A4BA 4PALA 1BODA 2LLSA 1EG3A 1M63B 1TRFA 1XYDA 2IS9A 1QATA 1RWYA 2KNEA 2KI4C 3CR5X 1DT7B 2GGZA 1S6CA 1MQ1A 4PHKA 2CBLA 1EG4A 4R1EA 1C7WA 1RJVA 4JPZB 1J7QA 3LCPC 1OMRA 1K95A 1NX0A 1QTXA 5DKNA 2F8PA 1CMGA 2EC6B 3H4SE 1SBJA 5BPJA 4UPGA 2LANA 4YGEB 1N65A 5HKWA 1K9PA 3TS5C 1M46A 3EVUA 2LVVA 1LVCD 1DJYA 4GBAA 2M7NA 1MWNA 1JUOA 4GNKB 3I5IC 1K90D 3DD4A 1F54A 1Y1AA 4F0ZB 2KBMA 3I5GC 1N2DA 2PASA 1J7OA 1BT6A 1SMGA 5ER4X 1BMOA 1YUTA 2GGMA 2JNFA 1AP4A 5J3XA 1BR1B 1XFYO 3FWCA 5PALA 3BXKA 1TOPA 1SL9A 1S36A 1QS7A 3PM8A 1MXEA 1BLQA 3SIAA 2BKIB 1GQMA 1MHOA 2MRDA 1XK4A 2AUCA 2KAYA 3I5HC 3WHTB 1B8LA 1XFUO 2BBNA 2LE9B 4PE7A 2MBXA 1DJGA 2M49B 2K8MB 1ZACA 3TDIA 3A8RA 1FF1A 2DOQA 2OS8B 1BG1A 1OMVA 5GQQC 2JU0A 4YI9A 4DRWA 3OB1B 5FYXA 3BUMB 1OSAA 2I18A 3JVTC 4ZCVA 1FBVA 1YRTB 2M8UA 5AANA 1RK9A 1V1FA 1M45A 1K2HA 4YGDB 2KAXA 1PVAA 1UP5A 3KEVA 4DCKA 3GK4X 1D1OA 3CR2A 2P6BB 3O78A 3EK7A 1A03A 3TZ1A 1JSAA 1B7TZ 4PHJA 1DGVA 2KI6D 1H4BA 4AQJA 3VGOA 1PULA 4PDZA 1CLBA 1QVIY 2PRUA 2BE4A 4GUKA 3VRRA 1DGUA 3KF9A 2WC8A 1KWOB 1MUXA 1XFZO 1LINA 2FOTA 4PE4A 1NX1A 5B8IB 1CKKA 3O4YA 4GGFC 2CT9A 2MAZA 1KK8C 1NP8A 4N5XA 1CMFA 2SASA 2L98A 2M7LA 1QJTA 3JTDB 3IQOA 3DVEA 4FQOA 1S5GZ 4JWQA 1JFJA 3NSKA 2FCDA 4YI8A 1CFPA 1QX2A 5IBWA 1F70A 1E8AA 3NSIA 3KO0A 2BECA 2BBMA 3WNXB 1V1GA 1YR5A 3TUYB 1XA5A 2BL0C 2KDHA 2LNKA 1A4PA 1OMDA 3FIAA 2JC2A 4M2OA 3ICBA 2I94A 4OV2A 2CCMA 1YTZC 1NPQA 3LL8B 3CGAA 1DJWA 1KFXS 2L50A 1SRAA 5HYDA 1NX2A 4ETOA 4HREE 4OR9B 1CDNA 1DVIA 4YGAA 1ODBA 2D8NA 2M1KB 1CFDA 4MRXA 2MLFC 5I8NA 3OHMB 4XYNA 4OKHA 3HX4A 3I5IB 2HQWA 3I5FC 3D10A 2A4JA 3BUOB 3F45A 1KK7Y 5F6TA 2EHBA 2NCPA 1FI6A 4MZLA 1SCMB 4PHNA 1YVLA 3GOFA 2L5XB 4MLWA 5ER5A 1IKUA 1CB1A 3SIBA 1SL8A 1JF2A 2K0JA 2JXLA 1YURA 2ZN8A 1K94A 4N1FA 5HLVA 4MN0A 2H61A 2LHLA 4GPLB 4NDCA 2BCAA 2NZ0A 2OTGC 2HQ8A 3AKAA 1AJ4A 1IH0A 1R2UA 2Y1NA 3K21A 4NQGA 4WQ3A 3EK8A 2LUCA 4C0LA 5HLOA 3CR4X 2M0RA 2K7OA 3SG3A 1OE9B 1IQ3A 1FPWA 2ZNDA 2ISDA 1KQVA 1UHKA 1K9UA 3SJSA 2L51A 1F4OA 2FCEA 2VRGA 1NCYA 1Q80A 1XFWO 1SR6C 1IG5A 3KPXA 1QIVA 1AVSA 1L2OB 2K2AA 4U8DA 2K61A 2JPTA 4MZKA 2GV5A 2LVJA 5JOLA 2LUXA 3PN7C 2F3ZA 1CDPA 2LCPA 1N0YA 2LHIA 1S26D 4M2QA 1UUSA 1B9AA 4HSZA 1L7ZA 1YUUA 2CXJA 2R2IA 3NSOA 1Y1XA 1QIWA 1IRJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DTL A;  1IWQ A;  1CM4 A;  2JNX A;  5CPV A;  3OP0 A;  3SG2 A;  2JT3 A;  4AQI A;  3NXA A;  1UHH A;  2B1U A;  2CTN A;  2MA2 A;  4DS7 A;  2O5G A;  2EC6 C;  5G08 A;  2CNP A;  5K89 A;  1A2X A;  1QXP A;  4I5K A;  3MSE B;  3OX6 A;  1AK8 A;  1OQP A;  1EH2 A;  1QLK A;  1W7J B;  1SKT A;  4E68 A;  4P2Y B;  4QJ5 B;  1CFC A;  1KQM C;  2L0P A;  1UHI A;  1BU3 A;  1UUR A;  4M2P A;  4QJ3 B;  5KU1 A;  1UHJ A;  1BJF A;  3WHU B;  2KFG A;  4AOM A;  1K9K A;  1IGV A;  1PSR A;  4CPV A;  1WLM A;  2K2F A;  1EJ3 A;  2M97 A;  1A75 B;  1BR4 B;  2Q4U A;  3EVV A;  1FI5 A;  1PAL A;  1OZS A;  4YGB B;  3DVK A;  1LKJ A;  2COL B;  1KFU L;  1B7T Y;  1A29 A;  1TCO B;  1JWD A;  2JTT A;  4A4C A;  1DMO A;  1RRO A;  3DVM A;  4ICB A;  4CLN A;  1QV0 A;  2OS8 C;  2WCE A;  4L9M A;  3IQQ A;  1CFF A;  1DF0 B;  5CSN A;  1WDC B;  3GK1 A;  3BUN B;  4HRG A;  1Y1U A;  3TDU A;  3AAJ A;  1DJX A;  1SY9 A;  1KFU S;  3D0Y A;  1KFX L;  2MJW B;  4PCW A;  2LLU A;  3M0W A;  3I5F B;  4I5N B;  1SCV A;  1G33 A;  2RGI A;  3BOW B;  2V53 A;  2ZRT A;  4USL A;  2Y4Q A;  2QPT A;  1XO5 A;  2KI4 B;  1IJ6 A;  2KFH A;  3CWG A;  1B8C A;  1B8R A;  1KSO A;  4NDB A;  3SG4 A;  1S5G Y;  4I5L B;  2PSR A;  1PVB A;  2LM5 A;  4GGF A;  1WLZ A;  2F2O A;  1S1E A;  3OX5 A;  3TDZ A;  1GGZ A;  3TS5 B;  4IL1 A;  1ZFS A;  2JT8 A;  3KHE A;  4ORA B;  3EKJ A;  2NXQ A;  2I7A A;  1F55 A;  3DF0 A;  1WRK A;  4C0J A;  1RTP 1;  2H2K A;  1VRK A;  4YGC B;  1KCY A;  2L4H A;  1S3P A;  2Y5I A;  3NSL A;  3I5G B;  1CDM A;  4YRU A;  2H61 C;  3LK1 A;  1U5I B;  2KHN A;  1A75 A;  4WQ2 A;  1WRL A;  5AEQ A;  2NCO A;  1S6I A;  2BCB A;  2JQ6 A;  1J7P A;  1CNP A;  5AXI A;  4MBE A;  3VRQ A;  3AKB A;  3BUW B;  2ZRS A;  2WCF A;  4MSP A;  3CS1 A;  5D7F A;  3PN7 B;  3I5H B;  2G2B A;  3PAL A;  5DKQ A;  5KTY A;  1DF0 A;  2ZKM X;  2JTZ A;  1QX7 A;  1R6P A;  1NX3 A;  2KBI A;  1TNQ A;  2BCX A;  2NLN A;  3TUY C;  3WXA A;  4OCI A;  1UHN A;  1NUB A;  2PVB A;  4PE0 A;  4MZJ A;  2JUL A;  1NCZ A;  3BUX B;  1WY9 A;  2LVK A;  3VRN A;  1DJI A;  3PFV A;  4FTG A;  1HT9 A;  5AER A;  3JVT B;  1LA3 A;  1XK4 C;  2JT0 A;  2TN4 A;  2G9B A;  2K7C A;  2KGR A;  3BYA A;  1FW4 A;  3BOW A;  1LA0 A;  5DKR A;  4BY5 A;  3SG6 A;  1QLS A;  2KYC A;  1SW8 A;  2HPS A;  2LAP A;  3A4U B;  1DJH A;  2K7D A;  4TNC A;  2KI6 C;  4QJ4 B;  3O2P A;  2KYF A;  1SK6 D;  1YVH A;  1DJZ A;  3CLN A;  1GJY A;  1Y6W A;  1JF0 A;  5CSF A;  3EK4 A;  1NIW A;  1W7I B;  2Q91 A;  3BQ3 A;  1YUS A;  3O6B A;  1KQM B;  2E6W A;  3D0Y B;  3OB2 B;  1M31 A;  2LLT A;  2LC5 A;  2ZNE A;  1NSH A;  1S6J A;  1TTX A;  2AAO A;  3PAT A;  1SCM C;  5KSZ A;  3QRX A;  1QAS A;  2MHH A;  4XJK A;  1REC A;  3SG7 A;  1F8H A;  2QAC A;  2JZI A;  2KOT A;  4C0K A;  4MVF A;  1AHR A;  4I5J A;  2AMI A;  1J1D A;  3C1V A;  5AFP A;  2LV7 A;  3LLE A;  2KAV A;  1PK0 D;  1IJ5 A;  1J55 A;  1U5I A;  2HET A;  4ORC B;  1B47 A;  1TCF A;  5I2L A;  2M1U A;  4MRY A;  1ZUZ A;  1SPY A;  1YRU B;  1LXF C;  1CLM A;  4CFQ A;  5JJG A;  1PSB A;  4DUQ A;  2KSP A;  1KK8 B;  1G4Y R;  1JC2 A;  4GAO A;  2JOJ A;  1H8B A;  5D69 A;  1MF8 B;  5I2Q A;  1GGW A;  1JBA A;  2FJU B;  3DF0 B;  4HRH A;  2F33 A;  2WOS A;  1TNP A;  2LMV A;  4ZCU A;  2LP2 A;  3PLF B;  2KQY A;  1NWD A;  1AJ5 A;  3EVR A;  4OVN F;  1QVI Z;  3ZWH A;  1C07 A;  3PSR A;  2KFF A;  1K96 A;  2PMY A;  4DIR A;  2I2R E;  1L2O C;  4ORB B;  1B4C A;  1TNW A;  1WRZ A;  2KQ6 A;  2BL0 B;  1KSM A;  2ZN9 A;  5TNC A;  2PAL A;  1ALV A;  5HKY A;  2KGB C;  1SL7 A;  4N1G A;  3VRP A;  1JFK A;  1OZO A;  1YX8 A;  2WND A;  3HCM A;  4CFR A;  4GGN A;  1QV1 A;  1OOJ A;  4GFT A;  4YBH B;  1NCX A;  4CID A;  1B1G A;  1EL4 A;  5HKZ A;  1HQV A;  5CSI A;  1TNX A;  1CDL A;  2MLE C;  1MXL C;  2LP3 A;  2K7B A;  3ZNI A;  1YX7 A;  3CTN A;  4JQ0 D;  4PE1 A;  1AUI B;  1G8I A;  1M39 A;  1MR8 A;  3DVJ A;  2F3Y A;  4NDD A;  5I2O A;  2WOR A;  4D1E A;  2JXC A;  1Y0V H;  1X02 A;  2OPO A;  1CLL A;  1EXR A;  4P5O E;  2LVI A;  2ZFD A;  3RM1 A;  2M29 A;  3EKH A;  2L4I A;  1UWO A;  4MEW A;  3SG5 A;  3IF7 A;  2Y1M A;  1RFJ A;  3E3R A;  5CSJ A;  2M3W A;  2OTG B;  1QX5 B;  1IQ5 A;  1PRW A;  2WCB A;  1SNL A;  1TN4 A;  3GK2 A;  2E30 A;  4XJK B;  2JRF A;  1SYM A;  1KWO C;  1XVJ A;  2BKH B;  2JWW A;  3VRO A;  1F71 A;  4Q04 A;  2L2E A;  1NYA A;  2O60 A;  3FS7 A;  1J1E A;  4PHM A;  1BF5 A;  1BOC A;  1KK7 Z;  1TIZ A;  3LK0 A;  2LMU A;  1CTR A;  2F2P A;  2M9G A;  1C7V A;  1CM1 A;  1F4Q A;  2EGD A;  4BY4 A;  1XFX O;  1SR6 B;  1ZMZ A;  1WDC C;  1J7R A;  3JTD C;  4WRI A;  2HF5 A;  3CZT X;  1K93 D;  2BE6 A;  1K8U A;  3FWB A;  3AAK A;  1XFV O;  2LMT A;  2SCP A;  3RLZ A;  1ZOT B;  1ALW A;  4A4B A;  4PAL A;  1BOD A;  2LLS A;  1EG3 A;  1M63 B;  1TRF A;  1XYD A;  2IS9 A;  1QAT A;  1RWY A;  2KNE A;  2KI4 C;  3CR5 X;  1DT7 B;  2GGZ A;  1S6C A;  1MQ1 A;  4PHK A;  2CBL A;  1EG4 A;  4R1E A;  1C7W A;  1RJV A;  4JPZ B;  1J7Q A;  3LCP C;  1OMR A;  1K95 A;  1NX0 A;  1QTX A;  5DKN A;  2F8P A;  1CMG A;  2EC6 B;  3H4S E;  1SBJ A;  5BPJ A;  4UPG A;  2LAN A;  4YGE B;  1N65 A;  5HKW A;  1K9P A;  3TS5 C;  1M46 A;  3EVU A;  2LVV A;  1LVC D;  1DJY A;  4GBA A;  2M7N A;  1MWN A;  1JUO A;  4GNK B;  3I5I C;  1K90 D;  3DD4 A;  1F54 A;  1Y1A A;  4F0Z B;  2KBM A;  3I5G C;  1N2D A;  2PAS A;  1J7O A;  1BT6 A;  1SMG A;  5ER4 X;  1BMO A;  1YUT A;  2GGM A;  2JNF A;  1AP4 A;  5J3X A;  1BR1 B;  1XFY O;  3FWC A;  5PAL A;  3BXK A;  1TOP A;  1SL9 A;  1S36 A;  1QS7 A;  3PM8 A;  1MXE A;  1BLQ A;  3SIA A;  2BKI B;  1GQM A;  1MHO A;  2MRD A;  1XK4 A;  2AUC A;  2KAY A;  3I5H C;  3WHT B;  1B8L A;  1XFU O;  2BBN A;  2LE9 B;  4PE7 A;  2MBX A;  1DJG A;  2M49 B;  2K8M B;  1ZAC A;  3TDI A;  3A8R A;  1FF1 A;  2DOQ A;  2OS8 B;  1BG1 A;  1OMV A;  5GQQ C;  2JU0 A;  4YI9 A;  4DRW A;  3OB1 B;  5FYX A;  3BUM B;  1OSA A;  2I18 A;  3JVT C;  4ZCV A;  1FBV A;  1YRT B;  2M8U A;  5AAN A;  1RK9 A;  1V1F A;  1M45 A;  1K2H A;  4YGD B;  2KAX A;  1PVA A;  1UP5 A;  3KEV A;  4DCK A;  3GK4 X;  1D1O A;  3CR2 A;  2P6B B;  3O78 A;  3EK7 A;  1A03 A;  3TZ1 A;  1JSA A;  1B7T Z;  4PHJ A;  1DGV A;  2KI6 D;  1H4B A;  4AQJ A;  3VGO A;  1PUL A;  4PDZ A;  1CLB A;  1QVI Y;  2PRU A;  2BE4 A;  4GUK A;  3VRR A;  1DGU A;  3KF9 A;  2WC8 A;  1KWO B;  1MUX A;  1XFZ O;  1LIN A;  2FOT A;  4PE4 A;  1NX1 A;  5B8I B;  1CKK A;  3O4Y A;  4GGF C;  2CT9 A;  2MAZ A;  1KK8 C;  1NP8 A;  4N5X A;  1CMF A;  2SAS A;  2L98 A;  2M7L A;  1QJT A;  3JTD B;  3IQO A;  3DVE A;  4FQO A;  1S5G Z;  4JWQ A;  1JFJ A;  3NSK A;  2FCD A;  4YI8 A;  1CFP A;  1QX2 A;  5IBW A;  1F70 A;  1E8A A;  3NSI A;  3KO0 A;  2BEC A;  2BBM A;  3WNX B;  1V1G A;  1YR5 A;  3TUY B;  1XA5 A;  2BL0 C;  2KDH A;  2LNK A;  1A4P A;  1OMD A;  3FIA A;  2JC2 A;  4M2O A;  3ICB A;  2I94 A;  4OV2 A;  2CCM A;  1YTZ C;  1NPQ A;  3LL8 B;  3CGA A;  1DJW A;  1KFX S;  2L50 A;  1SRA A;  5HYD A;  1NX2 A;  4ETO A;  4HRE E;  4OR9 B;  1CDN A;  1DVI A;  4YGA A;  1ODB A;  2D8N A;  2M1K B;  1CFD A;  4MRX A;  2MLF C;  5I8N A;  3OHM B;  4XYN A;  4OKH A;  3HX4 A;  3I5I B;  2HQW A;  3I5F C;  3D10 A;  2A4J A;  3BUO B;  3F45 A;  1KK7 Y;  5F6T A;  2EHB A;  2NCP A;  1FI6 A;  4MZL A;  1SCM B;  4PHN A;  1YVL A;  3GOF A;  2L5X B;  4MLW A;  5ER5 A;  1IKU A;  1CB1 A;  3SIB A;  1SL8 A;  1JF2 A;  2K0J A;  2JXL A;  1YUR A;  2ZN8 A;  1K94 A;  4N1F A;  5HLV A;  4MN0 A;  2H61 A;  2LHL A;  4GPL B;  4NDC A;  2BCA A;  2NZ0 A;  2OTG C;  2HQ8 A;  3AKA A;  1AJ4 A;  1IH0 A;  1R2U A;  2Y1N A;  3K21 A;  4NQG A;  4WQ3 A;  3EK8 A;  2LUC A;  4C0L A;  5HLO A;  3CR4 X;  2M0R A;  2K7O A;  3SG3 A;  1OE9 B;  1IQ3 A;  1FPW A;  2ZND A;  2ISD A;  1KQV A;  1UHK A;  1K9U A;  3SJS A;  2L51 A;  1F4O A;  2FCE A;  2VRG A;  1NCY A;  1Q80 A;  1XFW O;  1SR6 C;  1IG5 A;  3KPX A;  1QIV A;  1AVS A;  1L2O B;  2K2A A;  4U8D A;  2K61 A;  2JPT A;  4MZK A;  2GV5 A;  2LVJ A;  5JOL A;  2LUX A;  3PN7 C;  2F3Z A;  1CDP A;  2LCP A;  1N0Y A;  2LHI A;  1S26 D;  4M2Q A;  1UUS A;  1B9A A;  4HSZ A;  1L7Z A;  1YUU A;  2CXJ A;  2R2I A;  3NSO A;  1Y1X A;  1QIW A;  1IRJ A; 
#chains in the Genus database with same CATH topology
 1DTL A;  1IWQ A;  1CM4 A;  2JNX A;  5CPV A;  2QEO A;  3OP0 A;  3SG2 A;  2JT3 A;  4AQI A;  3NXA A;  1UHH A;  2B1U A;  2CTN A;  2MA2 A;  4DS7 A;  1P28 A;  2O5G A;  2KLD A;  2EC6 C;  5G08 A;  2CNP A;  5K89 A;  1A2X A;  1QXP A;  5DIC A;  4I5K A;  3MSE B;  3OX6 A;  1AK8 A;  1OQP A;  3R72 A;  2PQL A;  1EH2 A;  1QLK A;  1W7J B;  1SKT A;  4E68 A;  4P2Y B;  4QJ5 B;  1CFC A;  1KQM C;  2L0P A;  1UHI A;  1BU3 A;  1UUR A;  1TUZ A;  3D73 A;  4M2P A;  4QJ3 B;  5KU1 A;  1UHJ A;  1BJF A;  3WHU B;  2KFG A;  4AOM A;  3VB1 A;  3D76 A;  1K9K A;  1IGV A;  1PSR A;  4CPV A;  2BAP A;  1WLM A;  1T14 A;  2K2F A;  3CZ0 A;  1EJ3 A;  2M97 A;  1A75 B;  3S0F A;  1BR4 B;  2Q4U A;  3EVV A;  1FI5 A;  1PAL A;  1LS8 A;  1OZS A;  4YGB B;  3DVK A;  1LKJ A;  2COL B;  1KFU L;  1B7T Y;  1A29 A;  1TCO B;  1JWD A;  2JTT A;  4A4C A;  1DMO A;  3BJH A;  1RRO A;  3DVM A;  4ICB A;  4CLN A;  1QV0 A;  2OS8 C;  2WCE A;  3CZ1 A;  3IQQ A;  4L9M A;  1CFF A;  1DF0 B;  5CSN A;  4PT1 A;  1WDC B;  3GK1 A;  3BUN B;  4HRG A;  2WCH A;  1Y1U A;  3TDU A;  3AAJ A;  1DJX A;  1SY9 A;  1KFU S;  3D0Y A;  1KFX L;  3CYZ A;  2MJW B;  4PCW A;  2LLU A;  4OZD A;  3M0W A;  3I5F B;  4I5N B;  1SCV A;  1G33 A;  2RGI A;  3BOW B;  2V53 A;  2ZRT A;  4USL A;  2Y4Q A;  2QPT A;  1XO5 A;  2KI4 B;  1IJ6 A;  2KFH A;  3CWG A;  1B8C A;  1B8R A;  1KSO A;  4NDB A;  3SG4 A;  1S5G Y;  4I5L B;  2PSR A;  1PVB A;  2LM5 A;  4GGF A;  3B87 A;  1WLZ A;  2F2O A;  1S1E A;  3OX5 A;  3TDZ A;  1DQE A;  1GGZ A;  3SS5 A;  4IL1 A;  1ZFS A;  2JT8 A;  3TS5 B;  3KHE A;  3PJI A;  3R1O A;  3EKJ A;  2NXQ A;  3O4X A;  2I7A A;  4ORA B;  2H8V A;  1F55 A;  3DF0 A;  1WRK A;  4C0J A;  1RTP 1;  2H2K A;  1VRK A;  4YGC B;  1KCY A;  2L4H A;  1S3P A;  2Y5I A;  3NSL A;  3I5G B;  1CDM A;  4YRU A;  2H61 C;  3LK1 A;  1U5I B;  2KHN A;  1A75 A;  4WQ2 A;  1WRL A;  5AEQ A;  2NCO A;  1S6I A;  2BCB A;  2JQ6 A;  1J7P A;  1CNP A;  2WCM A;  4MBE A;  5AXI A;  3VRQ A;  3AKB A;  3BUW B;  2ZRS A;  2WCF A;  4MSP A;  3CS1 A;  5D7F A;  1GM0 A;  3PN7 B;  3I5H B;  2G2B A;  3PAL A;  5DKQ A;  5KTY A;  2KPH A;  1DF0 A;  2ZKM X;  2JTZ A;  1QX7 A;  1R6P A;  1NX3 A;  2KBI A;  1TNQ A;  2BCX A;  2NLN A;  3TUY C;  3WXA A;  4OCI A;  1UHN A;  1NUB A;  2PVB A;  4PE0 A;  4MZJ A;  2JUL A;  1NCZ A;  3BFA A;  1WY9 A;  3BUX B;  2LVK A;  3S0D A;  3S0G A;  1DJI A;  3PFV A;  4FTG A;  1HT9 A;  3VRN A;  3JVT B;  5AER A;  1LA3 A;  1XK4 C;  2JT0 A;  2TN4 A;  2G9B A;  2K7C A;  2KGR A;  3BYA A;  1FW4 A;  3BOW A;  1LA0 A;  5DKR A;  4BY5 A;  1ORG A;  3SG6 A;  1QLS A;  2KYC A;  1SW8 A;  2HPS A;  2LAP A;  3A4U B;  1DJH A;  2K7D A;  4TNC A;  2KI6 C;  3V2L A;  4QJ4 B;  3O2P A;  2KYF A;  1SK6 D;  1YVH A;  1DJZ A;  3CLN A;  1GJY A;  3BFB A;  1Y6W A;  1JF0 A;  5CSF A;  3EK4 A;  1NIW A;  1W7I B;  2Q91 A;  3BQ3 A;  1YUS A;  3O6B A;  1KQM B;  2E6W A;  3D0Y B;  3OB2 B;  1M31 A;  2LLT A;  2LC5 A;  2ZNE A;  1NSH A;  3B7A A;  1S6J A;  1TTX A;  3FE6 A;  5I94 A;  2AAO A;  3PAT A;  1SCM C;  5KSZ A;  3QRX A;  1QAS A;  2MHH A;  4XJK A;  1REC A;  3SG7 A;  1F8H A;  2QAC A;  3SS4 A;  2JZI A;  2KOT A;  4C0K A;  3CAB A;  4MVF A;  1AHR A;  4I5J A;  2AMI A;  1OOH A;  1J1D A;  3C1V A;  5AFP A;  2LV7 A;  3LLE A;  2KAV A;  3RZS A;  1PK0 D;  1IJ5 A;  1J55 A;  1U5I A;  2HET A;  2QEV A;  3L4A A;  4ORC B;  1B47 A;  1TCF A;  5I2L A;  2M1U A;  4MRY A;  1ZUZ A;  1SPY A;  1YRU B;  1LXF C;  1CLM A;  4CFQ A;  5JJG A;  1PSB A;  4DUQ A;  3BFH A;  1TUJ A;  1TWO A;  1XFR A;  1KK8 B;  2KSP A;  1G4Y R;  1JC2 A;  4GAO A;  2JOJ A;  1H8B A;  1DEL A;  1MF8 B;  5D69 A;  5I2Q A;  1GGW A;  3D75 A;  1JBA A;  2FJU B;  3DF0 B;  4HRH A;  2F33 A;  2WOS A;  3PM2 A;  1TNP A;  2LMV A;  4ZCU A;  2LP2 A;  3PLF B;  2KQY A;  3SS3 A;  1NWD A;  1AJ5 A;  3EVR A;  4OVN F;  1QVI Z;  4F7F A;  3S0A A;  3ZWH A;  1C07 A;  2L2C A;  3PSR A;  2KFF A;  3EG5 B;  1K96 A;  2PMY A;  4DIR A;  3R1P A;  3NHI A;  2I2R E;  1L2O C;  4ORB B;  1B4C A;  1TNW A;  1WRZ A;  3R1V A;  2KQ6 A;  2BL0 B;  1KSM A;  2ZN9 A;  5TNC A;  2PAL A;  1ALV A;  5HKY A;  2KGB C;  1SL7 A;  4N1G A;  3VRP A;  3N7H A;  1JFK A;  1OZO A;  1YX8 A;  2WND A;  3HCM A;  1SSE B;  4CFR A;  4GGN A;  1QV1 A;  1OOJ A;  4GFT A;  4YBH B;  1NCX A;  3QME A;  4CID A;  1B1G A;  2WCK A;  1EL4 A;  5HKZ A;  1HQV A;  5CSI A;  1TNX A;  1CDL A;  2MLE C;  1MXL C;  2LP3 A;  2K7B A;  1C3Y A;  3ZNI A;  1YX7 A;  3CTN A;  3CZ2 A;  4JQ0 D;  4PE1 A;  1AUI B;  1G8I A;  1M39 A;  1MR8 A;  3DVJ A;  2F3Y A;  4NDD A;  5I2O A;  2WOR A;  4D1E A;  2JXC A;  1Y0V H;  2QEB A;  1X02 A;  3FE8 A;  2OPO A;  1CLL A;  1EXR A;  4P5O E;  2LVI A;  2ZFD A;  3RM1 A;  5HL1 A;  2M29 A;  5D3O A;  3EKH A;  2L4I A;  1UWO A;  4MEW A;  3SG5 A;  3IF7 A;  2Y1M A;  1RFJ A;  3E3R A;  5CSJ A;  2M3W A;  2OTG B;  1QX5 B;  1IQ5 A;  1PRW A;  2WCB A;  1SNL A;  1TN4 A;  3GK2 A;  2E30 A;  4XJK B;  2JRF A;  3S0E A;  1SYM A;  1KWO C;  1XVJ A;  2BKH B;  2JWW A;  3VRO A;  1OOG A;  4Q04 A;  1F71 A;  2L2E A;  1NYA A;  2PYQ A;  2O60 A;  3FS7 A;  1J1E A;  4PHM A;  1BF5 A;  1BOC A;  1KK7 Z;  1TIZ A;  3LK0 A;  2LMU A;  1CTR A;  1Z4H A;  2F2P A;  2M9G A;  3UO9 A;  1CM1 A;  1F4Q A;  1C7V A;  2EGD A;  4BY4 A;  1XFX O;  1SR6 B;  1ZMZ A;  1WDC C;  1J7R A;  3JTD C;  4WRI A;  2HF5 A;  3CZT X;  1K93 D;  1K8U A;  2BE6 A;  3FWB A;  3AAK A;  1XFV O;  1OOI X;  2LMT A;  2SCP A;  3RLZ A;  1ZOT B;  3IVT A;  2K60 A;  1ALW A;  4A4B A;  4PAL A;  2QDI A;  1BOD A;  2LLS A;  1EG3 A;  1M63 B;  1TRF A;  1XYD A;  2IS9 A;  1QAT A;  1RWY A;  2KNE A;  2KI4 C;  3CR5 X;  1DT7 B;  2GGZ A;  1S6C A;  1MQ1 A;  4PHK A;  2CBL A;  1EG4 A;  4R1E A;  1C7W A;  1RJV A;  2P71 A;  4JPZ B;  1J7Q A;  3LCP C;  1OMR A;  1K95 A;  1NX0 A;  1QTX A;  5DKN A;  2F8P A;  1CMG A;  2EC6 B;  3H4S E;  1SBJ A;  5BPJ A;  4UPG A;  2LAN A;  4YGE B;  1N65 A;  5HKW A;  1K9P A;  3TS5 C;  1M46 A;  3EVU A;  2LVV A;  1LVC D;  1DJY A;  4GBA A;  1IIO A;  2M7N A;  1MWN A;  1JUO A;  4GNK B;  3I5I C;  1K90 D;  3DD4 A;  1F54 A;  1Y1A A;  4F0Z B;  2KBM A;  3I5G C;  1N2D A;  2PAS A;  1J7O A;  1BT6 A;  1SMG A;  5ER4 X;  1BMO A;  1YUT A;  2GGM A;  2JNF A;  1AP4 A;  5J3X A;  1BR1 B;  1XFY O;  1OW4 A;  3FWC A;  5PAL A;  3BXK A;  1TOP A;  3Q8I A;  3UNW A;  1SL9 A;  1S36 A;  1QS7 A;  3PM8 A;  1MXE A;  1BLQ A;  3SIA A;  2BKI B;  1GQM A;  3D74 A;  1MHO A;  2WC6 A;  2MRD A;  1XK4 A;  2AUC A;  2JPO A;  2KAY A;  3I5H C;  2BNX A;  4FQT A;  3WHT B;  1B8L A;  3NGV A;  1XFU O;  2BBN A;  2LE9 B;  4PE7 A;  2MBX A;  1DJG A;  2M49 B;  2K8M B;  1ZAC A;  3TDI A;  3A8R A;  1FF1 A;  2DOQ A;  2OS8 B;  1BG1 A;  1OMV A;  3D78 A;  2JU0 A;  5GQQ C;  1W9Z A;  4YI9 A;  4DRW A;  3OB1 B;  4KYN A;  5FYX A;  3BUM B;  5EL2 A;  1OSA A;  2I18 A;  3JVT C;  4ZCV A;  1FBV A;  1YRT B;  2M8U A;  5AAN A;  1RK9 A;  1V1F A;  1M45 A;  4JD9 A;  1K2H A;  4YGD B;  2KAX A;  1PVA A;  1UP5 A;  3KEV A;  4DCK A;  3GK4 X;  1D1O A;  3CR2 A;  3DXL A;  2P6B B;  3O78 A;  3EK7 A;  1A03 A;  3TZ1 A;  1QWV A;  1JSA A;  1B7T Z;  4PHJ A;  1DGV A;  2KI6 D;  2FJY A;  1H4B A;  4AQJ A;  3VGO A;  1PUL A;  4PDZ A;  1CLB A;  1QVI Y;  2PRU A;  2BE4 A;  4GUK A;  3VRR A;  1DGU A;  5FI7 A;  3KF9 A;  2WC8 A;  2ERB A;  1KWO B;  1MUX A;  1XFZ O;  1LIN A;  2FOT A;  4PE4 A;  1NX1 A;  5B8I B;  1CKK A;  3O4Y A;  4GGF C;  2WC5 A;  4JKT A;  2CT9 A;  2MAZ A;  1KK8 C;  1NP8 A;  4N5X A;  1CMF A;  2SAS A;  2L98 A;  2P70 A;  2M7L A;  1QJT A;  3JTD B;  3IQO A;  3DVE A;  4FQO A;  1S5G Z;  4JWQ A;  3S0B A;  1JFJ A;  3NSK A;  2FCD A;  4YI8 A;  1CFP A;  1QX2 A;  5IBW A;  1DEK A;  1OOF A;  1F70 A;  3B6X A;  1E8A A;  3B86 A;  2QEH A;  3NSI A;  3KO0 A;  2BEC A;  2BBM A;  3WNX B;  1V1G A;  1YR5 A;  3TUY B;  1XA5 A;  3K1E A;  2BL0 C;  2KDH A;  2LNK A;  1A4P A;  1OMD A;  3FIA A;  2JC2 A;  4M2O A;  3ICB A;  2I94 A;  4OV2 A;  2CCM A;  1YTZ C;  1NPQ A;  2L5Y A;  2WCL A;  3LL8 B;  3CGA A;  1DJW A;  3DZT A;  3B88 A;  1KFX S;  2L50 A;  1SRA A;  5HYD A;  1NX2 A;  4ETO A;  4HRE E;  4OR9 B;  3DYE A;  1CDN A;  1DVI A;  4YGA A;  1ODB A;  2D8N A;  2M1K B;  1CFD A;  4MRX A;  2MLF C;  2KLE A;  3NHT A;  5I8N A;  3OHM B;  3OBV A;  1DC1 A;  4XYN A;  4OKH A;  3HX4 A;  3I5I B;  3OGN A;  2HQW A;  3I5F C;  3D10 A;  2A4J A;  3BUO B;  3F45 A;  1KK7 Y;  5F6T A;  2EHB A;  2NCP A;  3CDN A;  4MZL A;  1SCM B;  4IJ7 A;  4PHN A;  5FI6 A;  1YVL A;  1FI6 A;  3GOF A;  2GTE A;  2L5X B;  4MLW A;  5ER5 A;  1IKU A;  3SIB A;  1CB1 A;  1SL8 A;  1JF2 A;  2K0J A;  2JXL A;  1YUR A;  2ZN8 A;  1K94 A;  4N1F A;  5HLV A;  4MN0 A;  2H61 A;  2LHL A;  4GPL B;  4NDC A;  2BCA A;  2NZ0 A;  2OTG C;  2HQ8 A;  3AKA A;  1AJ4 A;  1IH0 A;  1R2U A;  2Y1N A;  3K21 A;  4NQG A;  4WQ3 A;  3EK8 A;  2LUC A;  4C0L A;  5HLO A;  3CR4 X;  2M0R A;  2K7O A;  3SG3 A;  1OE9 B;  1IQ3 A;  4INW A;  3L4L A;  1FPW A;  2ZND A;  3FE9 A;  2ISD A;  1KQV A;  1UHK A;  1K9U A;  1Z2C B;  3D77 A;  2L51 A;  3DY9 A;  1F4O A;  5FI2 A;  3SJS A;  2FCE A;  2VRG A;  1NCY A;  1Q80 A;  1XFW O;  1SR6 C;  1IG5 A;  3KPX A;  1QIV A;  3L47 A;  1AVS A;  1L2O B;  2K2A A;  2YGU A;  4U8D A;  2K61 A;  2JPT A;  4MZK A;  2GV5 A;  2LVJ A;  5JOL A;  2LUX A;  3PN7 C;  2F3Z A;  1CDP A;  2LCP A;  1N0Y A;  2LHI A;  1S26 D;  4M2Q A;  1UUS A;  1B9A A;  2WCJ A;  4HSZ A;  1L7Z A;  1YUU A;  2CXJ A;  2R2I A;  4INX A;  3NSO A;  1Y1X A;  1QIW A;  1C3Z A;  1IRJ A; 
#chains in the Genus database with same CATH homology
 1DTL A;  1IWQ A;  1CM4 A;  2JNX A;  5CPV A;  3OP0 A;  3SG2 A;  2JT3 A;  4AQI A;  3NXA A;  1UHH A;  2B1U A;  2CTN A;  2MA2 A;  4DS7 A;  2O5G A;  2EC6 C;  5G08 A;  2CNP A;  5K89 A;  1A2X A;  1QXP A;  4I5K A;  3MSE B;  3OX6 A;  1AK8 A;  1OQP A;  1EH2 A;  1QLK A;  1W7J B;  1SKT A;  4E68 A;  4P2Y B;  4QJ5 B;  1CFC A;  1KQM C;  2L0P A;  1UHI A;  1BU3 A;  1UUR A;  4M2P A;  4QJ3 B;  5KU1 A;  1UHJ A;  1BJF A;  3WHU B;  2KFG A;  4AOM A;  1K9K A;  1IGV A;  1PSR A;  4CPV A;  1WLM A;  2K2F A;  1EJ3 A;  2M97 A;  1A75 B;  1BR4 B;  2Q4U A;  3EVV A;  1FI5 A;  1PAL A;  1OZS A;  4YGB B;  3DVK A;  1LKJ A;  2COL B;  1KFU L;  1B7T Y;  1A29 A;  1TCO B;  1JWD A;  2JTT A;  4A4C A;  1DMO A;  1RRO A;  3DVM A;  4ICB A;  4CLN A;  1QV0 A;  2OS8 C;  2WCE A;  4L9M A;  3IQQ A;  1CFF A;  1DF0 B;  5CSN A;  1WDC B;  3GK1 A;  3BUN B;  4HRG A;  1Y1U A;  3TDU A;  3AAJ A;  1DJX A;  1SY9 A;  1KFU S;  3D0Y A;  1KFX L;  2MJW B;  4PCW A;  2LLU A;  3M0W A;  3I5F B;  4I5N B;  1SCV A;  1G33 A;  2RGI A;  3BOW B;  2V53 A;  2ZRT A;  4USL A;  2Y4Q A;  2QPT A;  1XO5 A;  2KI4 B;  1IJ6 A;  2KFH A;  3CWG A;  1B8C A;  1B8R A;  1KSO A;  4NDB A;  3SG4 A;  1S5G Y;  4I5L B;  2PSR A;  1PVB A;  2LM5 A;  4GGF A;  1WLZ A;  2F2O A;  1S1E A;  3OX5 A;  3TDZ A;  1GGZ A;  3TS5 B;  4IL1 A;  1ZFS A;  2JT8 A;  3KHE A;  4ORA B;  3EKJ A;  2NXQ A;  2I7A A;  1F55 A;  3DF0 A;  1WRK A;  4C0J A;  1RTP 1;  2H2K A;  1VRK A;  4YGC B;  1KCY A;  2L4H A;  1S3P A;  2Y5I A;  3NSL A;  3I5G B;  1CDM A;  4YRU A;  2H61 C;  3LK1 A;  1U5I B;  2KHN A;  1A75 A;  4WQ2 A;  1WRL A;  5AEQ A;  2NCO A;  1S6I A;  2BCB A;  2JQ6 A;  1J7P A;  1CNP A;  5AXI A;  4MBE A;  3VRQ A;  3AKB A;  3BUW B;  2ZRS A;  2WCF A;  4MSP A;  3CS1 A;  5D7F A;  3PN7 B;  3I5H B;  2G2B A;  3PAL A;  5DKQ A;  5KTY A;  1DF0 A;  2ZKM X;  2JTZ A;  1QX7 A;  1R6P A;  1NX3 A;  2KBI A;  1TNQ A;  2BCX A;  2NLN A;  3TUY C;  3WXA A;  4OCI A;  1UHN A;  1NUB A;  2PVB A;  4PE0 A;  4MZJ A;  2JUL A;  1NCZ A;  3BUX B;  1WY9 A;  2LVK A;  3VRN A;  1DJI A;  3PFV A;  4FTG A;  1HT9 A;  5AER A;  3JVT B;  1LA3 A;  1XK4 C;  2JT0 A;  2TN4 A;  2G9B A;  2K7C A;  2KGR A;  3BYA A;  1FW4 A;  3BOW A;  1LA0 A;  5DKR A;  4BY5 A;  3SG6 A;  1QLS A;  2KYC A;  1SW8 A;  2HPS A;  2LAP A;  3A4U B;  1DJH A;  2K7D A;  4TNC A;  2KI6 C;  4QJ4 B;  3O2P A;  2KYF A;  1SK6 D;  1YVH A;  1DJZ A;  3CLN A;  1GJY A;  1Y6W A;  1JF0 A;  5CSF A;  3EK4 A;  1NIW A;  1W7I B;  2Q91 A;  3BQ3 A;  1YUS A;  3O6B A;  1KQM B;  2E6W A;  3D0Y B;  3OB2 B;  1M31 A;  2LLT A;  2LC5 A;  2ZNE A;  1NSH A;  1S6J A;  1TTX A;  2AAO A;  3PAT A;  1SCM C;  5KSZ A;  3QRX A;  1QAS A;  2MHH A;  4XJK A;  1REC A;  3SG7 A;  1F8H A;  2QAC A;  2JZI A;  2KOT A;  4C0K A;  4MVF A;  1AHR A;  4I5J A;  2AMI A;  1J1D A;  3C1V A;  5AFP A;  2LV7 A;  3LLE A;  2KAV A;  1PK0 D;  1IJ5 A;  1J55 A;  1U5I A;  2HET A;  4ORC B;  1B47 A;  1TCF A;  5I2L A;  2M1U A;  4MRY A;  1ZUZ A;  1SPY A;  1YRU B;  1LXF C;  1CLM A;  4CFQ A;  5JJG A;  1PSB A;  4DUQ A;  2KSP A;  1KK8 B;  1G4Y R;  1JC2 A;  4GAO A;  2JOJ A;  1H8B A;  5D69 A;  1MF8 B;  5I2Q A;  1GGW A;  1JBA A;  2FJU B;  3DF0 B;  4HRH A;  2F33 A;  2WOS A;  1TNP A;  2LMV A;  4ZCU A;  2LP2 A;  3PLF B;  2KQY A;  1NWD A;  1AJ5 A;  3EVR A;  4OVN F;  1QVI Z;  3ZWH A;  1C07 A;  3PSR A;  2KFF A;  1K96 A;  2PMY A;  4DIR A;  2I2R E;  1L2O C;  4ORB B;  1B4C A;  1TNW A;  1WRZ A;  2KQ6 A;  2BL0 B;  1KSM A;  2ZN9 A;  5TNC A;  2PAL A;  1ALV A;  5HKY A;  2KGB C;  1SL7 A;  4N1G A;  3VRP A;  1JFK A;  1OZO A;  1YX8 A;  2WND A;  3HCM A;  4CFR A;  4GGN A;  1QV1 A;  1OOJ A;  4GFT A;  4YBH B;  1NCX A;  4CID A;  1B1G A;  1EL4 A;  5HKZ A;  1HQV A;  5CSI A;  1TNX A;  1CDL A;  2MLE C;  1MXL C;  2LP3 A;  2K7B A;  3ZNI A;  1YX7 A;  3CTN A;  4JQ0 D;  4PE1 A;  1AUI B;  1G8I A;  1M39 A;  1MR8 A;  3DVJ A;  2F3Y A;  4NDD A;  5I2O A;  2WOR A;  4D1E A;  2JXC A;  1Y0V H;  1X02 A;  2OPO A;  1CLL A;  1EXR A;  4P5O E;  2LVI A;  2ZFD A;  3RM1 A;  2M29 A;  3EKH A;  2L4I A;  1UWO A;  4MEW A;  3SG5 A;  3IF7 A;  2Y1M A;  1RFJ A;  3E3R A;  5CSJ A;  2M3W A;  2OTG B;  1QX5 B;  1IQ5 A;  1PRW A;  2WCB A;  1SNL A;  1TN4 A;  3GK2 A;  2E30 A;  4XJK B;  2JRF A;  1SYM A;  1KWO C;  1XVJ A;  2BKH B;  2JWW A;  3VRO A;  1F71 A;  4Q04 A;  2L2E A;  1NYA A;  2O60 A;  3FS7 A;  1J1E A;  4PHM A;  1BF5 A;  1BOC A;  1KK7 Z;  1TIZ A;  3LK0 A;  2LMU A;  1CTR A;  2F2P A;  2M9G A;  1C7V A;  1CM1 A;  1F4Q A;  2EGD A;  4BY4 A;  1XFX O;  1SR6 B;  1ZMZ A;  1WDC C;  1J7R A;  3JTD C;  4WRI A;  2HF5 A;  3CZT X;  1K93 D;  2BE6 A;  1K8U A;  3FWB A;  3AAK A;  1XFV O;  2LMT A;  2SCP A;  3RLZ A;  1ZOT B;  1ALW A;  4A4B A;  4PAL A;  1BOD A;  2LLS A;  1EG3 A;  1M63 B;  1TRF A;  1XYD A;  2IS9 A;  1QAT A;  1RWY A;  2KNE A;  2KI4 C;  3CR5 X;  1DT7 B;  2GGZ A;  1S6C A;  1MQ1 A;  4PHK A;  2CBL A;  1EG4 A;  4R1E A;  1C7W A;  1RJV A;  4JPZ B;  1J7Q A;  3LCP C;  1OMR A;  1K95 A;  1NX0 A;  1QTX A;  5DKN A;  2F8P A;  1CMG A;  2EC6 B;  3H4S E;  1SBJ A;  5BPJ A;  4UPG A;  2LAN A;  4YGE B;  1N65 A;  5HKW A;  1K9P A;  3TS5 C;  1M46 A;  3EVU A;  2LVV A;  1LVC D;  1DJY A;  4GBA A;  2M7N A;  1MWN A;  1JUO A;  4GNK B;  3I5I C;  1K90 D;  3DD4 A;  1F54 A;  1Y1A A;  4F0Z B;  2KBM A;  3I5G C;  1N2D A;  2PAS A;  1J7O A;  1BT6 A;  1SMG A;  5ER4 X;  1BMO A;  1YUT A;  2GGM A;  2JNF A;  1AP4 A;  5J3X A;  1BR1 B;  1XFY O;  3FWC A;  5PAL A;  3BXK A;  1TOP A;  1SL9 A;  1S36 A;  1QS7 A;  3PM8 A;  1MXE A;  1BLQ A;  3SIA A;  2BKI B;  1GQM A;  1MHO A;  2MRD A;  1XK4 A;  2AUC A;  2KAY A;  3I5H C;  3WHT B;  1B8L A;  1XFU O;  2BBN A;  2LE9 B;  4PE7 A;  2MBX A;  1DJG A;  2M49 B;  2K8M B;  1ZAC A;  3TDI A;  3A8R A;  1FF1 A;  2DOQ A;  2OS8 B;  1BG1 A;  1OMV A;  5GQQ C;  2JU0 A;  4YI9 A;  4DRW A;  3OB1 B;  5FYX A;  3BUM B;  1OSA A;  2I18 A;  3JVT C;  4ZCV A;  1FBV A;  1YRT B;  2M8U A;  5AAN A;  1RK9 A;  1V1F A;  1M45 A;  1K2H A;  4YGD B;  2KAX A;  1PVA A;  1UP5 A;  3KEV A;  4DCK A;  3GK4 X;  1D1O A;  3CR2 A;  2P6B B;  3O78 A;  3EK7 A;  1A03 A;  3TZ1 A;  1JSA A;  1B7T Z;  4PHJ A;  1DGV A;  2KI6 D;  1H4B A;  4AQJ A;  3VGO A;  1PUL A;  4PDZ A;  1CLB A;  1QVI Y;  2PRU A;  2BE4 A;  4GUK A;  3VRR A;  1DGU A;  3KF9 A;  2WC8 A;  1KWO B;  1MUX A;  1XFZ O;  1LIN A;  2FOT A;  4PE4 A;  1NX1 A;  5B8I B;  1CKK A;  3O4Y A;  4GGF C;  2CT9 A;  2MAZ A;  1KK8 C;  1NP8 A;  4N5X A;  1CMF A;  2SAS A;  2L98 A;  2M7L A;  1QJT A;  3JTD B;  3IQO A;  3DVE A;  4FQO A;  1S5G Z;  4JWQ A;  1JFJ A;  3NSK A;  2FCD A;  4YI8 A;  1CFP A;  1QX2 A;  5IBW A;  1F70 A;  1E8A A;  3NSI A;  3KO0 A;  2BEC A;  2BBM A;  3WNX B;  1V1G A;  1YR5 A;  3TUY B;  1XA5 A;  2BL0 C;  2KDH A;  2LNK A;  1A4P A;  1OMD A;  3FIA A;  2JC2 A;  4M2O A;  3ICB A;  2I94 A;  4OV2 A;  2CCM A;  1YTZ C;  1NPQ A;  3LL8 B;  3CGA A;  1DJW A;  1KFX S;  2L50 A;  1SRA A;  5HYD A;  1NX2 A;  4ETO A;  4HRE E;  4OR9 B;  1CDN A;  1DVI A;  4YGA A;  1ODB A;  2D8N A;  2M1K B;  1CFD A;  4MRX A;  2MLF C;  5I8N A;  3OHM B;  4XYN A;  4OKH A;  3HX4 A;  3I5I B;  2HQW A;  3I5F C;  3D10 A;  2A4J A;  3BUO B;  3F45 A;  1KK7 Y;  5F6T A;  2EHB A;  2NCP A;  1FI6 A;  4MZL A;  1SCM B;  4PHN A;  1YVL A;  3GOF A;  2L5X B;  4MLW A;  5ER5 A;  1IKU A;  1CB1 A;  3SIB A;  1SL8 A;  1JF2 A;  2K0J A;  2JXL A;  1YUR A;  2ZN8 A;  1K94 A;  4N1F A;  5HLV A;  4MN0 A;  2H61 A;  2LHL A;  4GPL B;  4NDC A;  2BCA A;  2NZ0 A;  2OTG C;  2HQ8 A;  3AKA A;  1AJ4 A;  1IH0 A;  1R2U A;  2Y1N A;  3K21 A;  4NQG A;  4WQ3 A;  3EK8 A;  2LUC A;  4C0L A;  5HLO A;  3CR4 X;  2M0R A;  2K7O A;  3SG3 A;  1OE9 B;  1IQ3 A;  1FPW A;  2ZND A;  2ISD A;  1KQV A;  1UHK A;  1K9U A;  3SJS A;  2L51 A;  1F4O A;  2FCE A;  2VRG A;  1NCY A;  1Q80 A;  1XFW O;  1SR6 C;  1IG5 A;  3KPX A;  1QIV A;  1AVS A;  1L2O B;  2K2A A;  4U8D A;  2K61 A;  2JPT A;  4MZK A;  2GV5 A;  2LVJ A;  5JOL A;  2LUX A;  3PN7 C;  2F3Z A;  1CDP A;  2LCP A;  1N0Y A;  2LHI A;  1S26 D;  4M2Q A;  1UUS A;  1B9A A;  4HSZ A;  1L7Z A;  1YUU A;  2CXJ A;  2R2I A;  3NSO A;  1Y1X A;  1QIW A;  1IRJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...