1DT7B

Solution structure of the c-terminal negative regulatory domain of p53 in a complex with ca2+-bound s100b(bb)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
92
structure length
92
Chain Sequence
MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDEDGDGECDFQEFMAFVSMVTTACHEFFEHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S100 CALCIUM-BINDING PROTEIN
publication title Structure of the negative regulatory domain of p53 bound to S100B(betabeta).
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 27
structure length 92
sequence length 92
chains with identical sequence A
ec nomenclature
pdb deposition date 2000-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00036 EF-hand_1 EF hand
B PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1dt7B00
2BECA 2I94A 3PM8A 1LINA 2LP3A 2M9GA 3NSLA 1H4BA 1FBVA 2LUCA 2NLNA 3GK4X 4CLNA 2JULA 4A4CA 3CR4X 3LK1A 4PE7A 1JF0A 4CPVA 1KCYA 4HRGA 3ZNIA 2CXJA 4PHKA 4U8DA 3A4UB 3IQOA 1G33A 1BG1A 1LXFC 1YURA 1QX7A 2LM5A 1TRFA 3JTDB 1NX3A 2BBMA 4ZCVA 2AMIA 1UHNA 3O6BA 1UHIA 2HQWA 2IS9A 2WCEA 4GBAA 1XO5A 4Q04A 1TCFA 1MF8B 1S5GZ 2KFGA 3D0YA 1YX8A 2K8MB 1SCMC 1ODBA 1CFPA 4N1FA 3BOWB 4JWQA 3E3RA 1OMDA 1CTRA 5AANA 2BL0C 1J55A 5DKRA 2ZN9A 3KPXA 4QJ5B 4C0LA 3PSRA 3NXAA 1CFCA 1DJZA 4YGEB 2EC6C 2P6BB 1PVAA 1SNLA 2JXCA 2CT9A 3AKBA 1WLZA 3TS5B 3C1VA 4YGCB 1B7TZ 2KI6D 3BYAA 4P2YB 1CM1A 1GQMA 1KQMC 2F3ZA 1F4QA 2KSPA 1TCOB 2BE6A 1S3PA 2PMYA 5IBWA 1L2OB 2F3YA 4AQIA 4BY4A 4ICBA 4PE0A 1F4OA 1KWOC 3HX4A 2K7DA 2K7CA 4MSPA 1DF0B 1LA3A 5CSFA 3O2PA 2MBXA 1NX0A 1XYDA 4F0ZB 4YBHB 1AP4A 1JF2A 2K61A 1W7JB 2JOJA 3A8RA 1XVJA 2BKHB 3PLFB 2OTGB 2CBLA 1CDPA 2ZNDA 1S5GY 3OP0A 4M2QA 1CB1A 1EG3A 1NCYA 2LVIA 1EL4A 2KAVA 3RM1A 1C7VA 1PULA 1JFKA 1X02A 2H61C 1JWDA 1J1DA 1CDLA 1QVIZ 2JWWA 2K7BA 2L2EA 1F8HA 1S26D 1YX7A 1RK9A 3IF7A 2M7LA 1F70A 1YRTB 4TNCA 1B7TY 3EK8A 5KTYA 1S36A 1XFUO 1ZOTB 4MZKA 1S1EA 4OVNF 3VRPA 2KFHA 4PDZA 1KK7Z 3NSIA 1TOPA 5TNCA 4CIDA 2B1UA 2FJUB 1QX5B 4PALA 2Y1MA 1L7ZA 2BBNA 2HF5A 2KQYA 1KSOA 2Q91A 3SG7A 1NCXA 4YGBB 3O78A 1QLSA 4WQ3A 4XJKA 1J7PA 4P5OE 1QLKA 1QXPA 1NPQA 3CS1A 1A2XA 1A03A 1XFVO 4I5KA 1J7RA 3SIAA 1OE9B 1QIWA 5CSIA 2Y1NA 1B4CA 1PVBA 1BR4B 2PALA 1RTP1 3GK1A 5HYDA 2LVJA 2WC8A 2OPOA 1WRZA 1A75A 3OB1B 2M0RA 5KSZA 3K21A 1UUSA 2ZNEA 2PSRA 5B8IB 2HETA 5AEQA 1V1GA 1IJ6A 1B9AA 2LNKA 3CR2A 4E68A 5I2OA 1QVIY 1SL8A 4JQ0D 1DJYA 4NQGA 3BUNB 1C07A 1A29A 2FCEA 1FW4A 2MJWB 3DF0A 3I5GB 3LK0A 1JBAA 1K95A 4GAOA 1LA0A 1TNXA 2JNFA 4JPZB 5I8NA 1K9UA 1SCMB 2LMUA 3HCMA 2OS8B 1IKUA 1M39A 2JXLA 3PALA 3H4SE 1KK7Y 2MLFC 1NSHA 4PE4A 4A4BA 1K9KA 2BL0B 4YI8A 2JZIA 3DD4A 4QJ4B 1OOJA 2WNDA 1DTLA 1K2HA 4MRYA 5HKYA 2ISDA 4AQJA 2EC6B 2KFFA 2LLSA 5CPVA 1FI6A 1GJYA 2SCPA 4MLWA 4WQ2A 3LLEA 2JC2A 1PSBA 4NDCA 1KSMA 3I5FC 3VGOA 4L9MA 3ZWHA 1KQMB 1K93D 1NCZA 3PN7C 5I2LA 2O5GA 3I5HC 2LHLA 2R2IA 3DVEA 3I5GC 4MN0A 3EK7A 4OKHA 4GGFC 3FWBA 1K96A 1R2UA 4ORCB 4CFRA 1MQ1A 1KWOB 1UURA 1BJFA 4PHNA 2OS8C 3TUYC 1QIVA 4WRIA 2JT3A 1NYAA 2WCFA 1CLMA 1IG5A 2JTTA 4DUQA 1QATA 1SK6D 3EVVA 4DIRA 3SG5A 3IQQA 4GGFA 4M2OA 1M63B 3DVKA 3OX6A 2COLB 5ER4X 3BXKA 1AK8A 3LCPC 4IL1A 1Y6WA 3VRNA 2LP2A 3CTNA 1Y1AA 1SRAA 3EK4A 1IH0A 4QJ3B 3AKAA 2BKIB 1CM4A 5PALA 2PVBA 1F71A 1QV1A 1XFYO 2HQ8A 1AVSA 1YRUB 2LV7A 1OQPA 2MRDA 1W7IB 1QV0A 2JRFA 3TDUA 4C0JA 4OV2A 3I5IC 5DKNA 3WHUB 4MEWA 1EH2A 3F45A 5ER5A 1TIZA 2KGRA 2FCDA 1OZOA 2K2FA 3SG6A 4MBEA 4AOMA 1BLQA 1YVHA 1FI5A 1ZUZA 2LVKA 5FYXA 4DCKA 1AUIB 2L4HA 1NIWA 4ZCUA 2GGZA 3CR5X 1AJ4A 3DF0B 1J7QA 4C0KA 3M0WA 4UPGA 1EJ3A 1Q80A 1WRKA 1Y1UA 1D1OA 2LMVA 3FS7A 3NSKA 1DMOA 1SMGA 2MA2A 1UHKA 2LCPA 2PRUA 3CWGA 2M7NA 1DJGA 3KO0A 5CSNA 1K8UA 1CMFA 1K94A 1BOCA 1KQVA 2O60A 1SYMA 3JVTC 1DJIA 2JNXA 1NUBA 1SBJA 3CGAA 1SL9A 2G9BA 3TDZA 1HQVA 4DS7A 3LL8B 4N5XA 1NWDA 5HLOA 2Y4QA 4FTGA 2WOSA 4OR9B 3BOWA 1K9PA 2QACA 1BODA 1DGVA 2BCXA 1JFJA 2GV5A 2CCMA 2ZRSA 1MXLC 4PHJA 3FWCA 2KQ6A 1G8IA 2KGBC 3D0YB 1OSAA 1TNWA 1CMGA 3ICBA 1XFXO 2LMTA 3KHEA 1YR5A 2NZ0A 2LUXA 2L50A 4PHMA 3I5FB 1JC2A 2NCPA 4CFQA 3PN7B 3EKHA 3I5HB 1DJHA 1ZACA 2HPSA 2JQ6A 2ZKMX 5JJGA 1CLBA 2BCAA 1GGZA 2V53A 4FQOA 3VROA 3SG4A 1H8BA 2KAYA 3CZTX 1QS7A 1KFXL 2JT8A 1YUTA 4YGDB 1ALWA 1CDMA 2LLTA 3PATA 3KF9A 5I2QA 1CDNA 3TUYB 1WDCB 3BUXB 1UP5A 2KI6C 2QPTA 3GK2A 1B1GA 1N0YA 1YUSA 1YUUA 1SY9A 1J1EA 3PFVA 1EG4A 1NX1A 2KOTA 1N65A 3VRRA 1S6JA 1KK8C 2JPTA 3BQ3A 2M97A 2L4IA 2AUCA 4OCIA 3SIBA 1Y0VH 2CTNA 4ORBB 5F6TA 1MHOA 3OX5A 1XK4C 2G2BA 2KNEA 1BMOA 2F2PA 2L5XB 4D1EA 2LLUA 3KEVA 1JUOA 1OMRA 4HREE 1F55A 1ALVA 1PK0D 2KI4C 1KFUL 4GFTA 1OZSA 1U5IA 2LANA 3AAJA 1WDCC 3BUMB 2TN4A 3MSEB 4GUKA 1F54A 3GOFA 1GGWA 4I5NB 1TNPA 4PCWA 2JTZA 5DKQA 1S6IA 1AJ5A 3I5IB 3O4YA 2I7AA 1A4PA 1CLLA 1N2DA 1TNQA 1VRKA 3BUOB 1CNPA 1XK4A 1KFUS 5JOLA 1LKJA 1LVCD 4I5LB 1IRJA 1FF1A 3VRQA 2ZRTA 1SR6C 4XYNA 2M8UA 5CSJA 3TZ1A 2F2OA 1ZMZA 1OMVA 2F8PA 2LAPA 2LVVA 3BUWB 4GGNA 5G08A 2KYFA 2K7OA 4USLA 4BY5A 1K90D 1EXRA 1SKTA 4GNKB 4XJKB 5GQQC 1M31A 1B8CA 4YI9A 1MR8A 1BR1B 2L0PA 4HSZA 3SG2A 1IGVA 2L98A 3JVTB 1Y1XA 1QX2A 2NCOA 2KDHA 1RJVA 4HRHA 3EKJA 1DVIA 2I18A 2K0JA 3JTDC 4PE1A 2PASA 3EVRA 1A75B 3RLZA 1BF5A 1XA5A 1M46A 2FOTA 2M3WA 2NXQA 2EHBA 5HKZA 1CFFA 2M1UA 2BCBA 3NSOA 4ORAB 1NP8A 1PALA 2RGIA 1IJ5A 1IWQA 1UWOA 2M1KB 1RFJA 1XFWO 3TDIA 4I5JA 1DJXA 5AXIA 4MZJA 1B8RA 5D69A 1G4YR 1QTXA 1DJWA 1CFDA 1R6PA 1DT7B 1IQ3A 5HLVA 2BE4A 2ZN8A 2DOQA 1XFZO 2E30A 2M49B 3QRXA 4GPLB 2WCBA 1SL7A 1BT6A 1TN4A 2H2KA 3D10A 3TS5C 2MLEC 1FPWA 1E8AA 1AHRA 1B47A 1SW8A 2JT0A 3EVUA 3DVMA 2GGMA 1C7WA 2CNPA 1TTXA 1PSRA 2F33A 4YRUA 1L2OC 5AERA 2KAXA 2KYCA 1RECA 2ZFDA 1B8LA 3AAKA 1UHJA 2LE9B 2L51A 1RWYA 4MZLA 3WNXB 1CKKA 1BU3A 1PRWA 1MXEA 1WLMA 1IQ5A 1U5IB 3CLNA 4ETOA 1WY9A 2KBIA 5AFPA 2H61A 1JSAA 1WRLA 2OTGC 4M2PA 1YVLA 2VRGA 1KK8B 4MVFA 1QASA 2I2RE 2K2AA 5D7FA 2WORA 2KBMA 1J7OA 5J3XA 1HT9A 1DF0A 1M45A 1MUXA 2LC5A 3OB2B 1QJTA 2KI4B 1ZFSA 2LHIA 4DRWA 1SCVA 2D8NA 3DVJA 2Q4UA 2M29A 1V1FA 3OHMB 1SPYA 2E6WA 1UHHA 2MHHA 5HKWA 5K89A 2EGDA 3FIAA 4NDBA 1KFXS 2SASA 2KHNA 3SJSA 4R1EA 2AAOA 4MRXA 3WHTB 1YTZC 1NX2A 1RROA 2MAZA 5KU1A 4NDDA 1S6CA 3WXAA 5BPJA 2A4JA 1DGUA 1MWNA 1SR6B 2JU0A 4YGAA 3SG3A 4N1GA 2Y5IA
chains in the Genus database with same CATH superfamily
2BECA 2I94A 3IVTA 3PM8A 1LINA 2LP3A 2M9GA 3NSLA 1H4BA 1FBVA 2LUCA 2NLNA 3GK4X 4CLNA 2JULA 4A4CA 3CR4X 3LK1A 4PE7A 1JF0A 2YGUA 2PYQA 4CPVA 1KCYA 4HRGA 3NHIA 3ZNIA 2CXJA 4PHKA 4U8DA 3A4UB 3IQOA 1G33A 1BG1A 1LXFC 4FQTA 2K60A 1YURA 1QX7A 2LM5A 1TRFA 3JTDB 1NX3A 2BBMA 4ZCVA 2AMIA 1UHNA 3O6BA 1UHIA 2HQWA 1DEKA 2IS9A 2WCEA 4GBAA 1XO5A 2KLEA 4Q04A 1TCFA 3R1OA 1MF8B 1S5GZ 3D76A 2KFGA 3D0YA 1YX8A 2K8MB 1SCMC 1ODBA 3Q8IA 4N1FA 3BOWB 5DICA 1CFPA 4JWQA 3E3RA 1OMDA 1CTRA 3CZ2A 5AANA 2BL0C 1J55A 2KPHA 5DKRA 2ZN9A 3KPXA 4QJ5B 4C0LA 3PSRA 3NXAA 1CFCA 1DJZA 4YGEB 2EC6C 2P6BB 3DYEA 1PVAA 1SNLA 2JXCA 2CT9A 3AKBA 1WLZA 3TS5B 3C1VA 4YGCB 1B7TZ 2KI6D 3BYAA 4P2YB 1CM1A 1GQMA 1KQMC 2F3ZA 1F4QA 2KSPA 1TCOB 2BE6A 3OBVA 1S3PA 3DXLA 2PMYA 5IBWA 1L2OB 2F3YA 2WCHA 2WCJA 3EG5B 3FE9A 4AQIA 4BY4A 4ICBA 4PE0A 1F4OA 2P70A 1KWOC 3HX4A 1Z4HA 2K7DA 2K7CA 4MSPA 1DF0B 1LA3A 5CSFA 3O2PA 2MBXA 1NX0A 1XYDA 4F0ZB 4YBHB 1AP4A 1JF2A 2K61A 1W7JB 2JOJA 3A8RA 1XVJA 2BKHB 3PLFB 2OTGB 2CBLA 1CDPA 1QWVA 2ZNDA 1S5GY 3OP0A 2KLDA 4M2QA 1CB1A 1EG3A 1NCYA 2LVIA 1EL4A 2KAVA 3RM1A 1C7VA 1C3ZA 1PULA 2QEVA 1JFKA 1X02A 2H61C 1JWDA 3DZTA 3QMEA 1J1DA 1CDLA 1QVIZ 2JWWA 2K7BA 2L2EA 1F8HA 1S26D 1YX7A 1RK9A 3IF7A 2M7LA 1F70A 1YRTB 4TNCA 1B7TY 3EK8A 2WC5A 5KTYA 1S36A 1XFUO 1ZOTB 3FE6A 1S1EA 4MZKA 4OVNF 3VRPA 2P71A 2QDIA 2KFHA 4PDZA 5FI7A 1KK7Z 3NSIA 1TOPA 4PT1A 5TNCA 3V2LA 4CIDA 3L47A 1OW4A 2B1UA 3SS4A 3UO9A 2FJUB 1QX5B 4PALA 2Y1MA 1L7ZA 2BBNA 2HF5A 2KQYA 1KSOA 2Q91A 3SG7A 1NCXA 4YGBB 3O78A 1QLSA 4WQ3A 4XJKA 1J7PA 4P5OE 1QLKA 1QXPA 1NPQA 3CS1A 1A2XA 1A03A 1XFVO 4I5KA 1IIOA 1J7RA 3SIAA 1OE9B 1QIWA 3CZ0A 5CSIA 2Y1NA 1B4CA 1PVBA 1BR4B 2PALA 1RTP1 3GK1A 3PM2A 5HYDA 2LVJA 2WC8A 2OPOA 1WRZA 1A75A 3OB1B 2M0RA 3NGVA 5KSZA 3K21A 1UUSA 2ZNEA 2PSRA 5B8IB 2HETA 5AEQA 1V1GA 1IJ6A 1B9AA 1DELA 2LNKA 3CR2A 5I2OA 4E68A 1QVIY 1SL8A 4JQ0D 1DJYA 4NQGA 3BUNB 1C07A 1A29A 3O4XA 2FCEA 1FW4A 2MJWB 3DF0A 3I5GB 3LK0A 3BFAA 1JBAA 1K95A 4GAOA 1LA0A 1TNXA 2JNFA 4JPZB 5I8NA 1K9UA 1SCMB 2LMUA 3HCMA 2OS8B 3VB1A 1IKUA 1M39A 2JXLA 3PALA 3H4SE 1KK7Y 2MLFC 1NSHA 3CABA 2FJYA 4PE4A 4A4BA 1K9KA 2BL0B 3L4LA 4YI8A 2JZIA 2H8VA 3DD4A 4QJ4B 1OOJA 2WNDA 1DTLA 1K2HA 4MRYA 5HKYA 2ISDA 1P28A 2EC6B 2KFFA 2LLSA 4AQJA 5CPVA 1FI6A 1GJYA 2SCPA 4MLWA 4WQ2A 3LLEA 2JC2A 1PSBA 4NDCA 1KSMA 3I5FC 3VGOA 1C3YA 4L9MA 3ZWHA 3B87A 1KQMB 1K93D 1NCZA 3PN7C 5I2LA 2O5GA 3I5HC 2LHLA 2R2IA 3DVEA 3CZ1A 3I5GC 4MN0A 3EK7A 4OKHA 4F7FA 4GGFC 3FWBA 1K96A 1R2UA 4ORCB 4CFRA 1MQ1A 1KWOB 1UURA 1BJFA 4PHNA 2OS8C 3TUYC 1QIVA 4WRIA 2JT3A 1NYAA 2WCFA 1OOFA 1CLMA 1IG5A 2JTTA 4DUQA 3L4AA 1QATA 2QEBA 1SK6D 3EVVA 4DIRA 3SG5A 3IQQA 4GGFA 4M2OA 1M63B 3DVKA 3OX6A 2COLB 3PJIA 3BXKA 5ER4X 5HL1A 1AK8A 3LCPC 4IL1A 3S0AA 1Y6WA 3VRNA 2LP2A 3CTNA 1Y1AA 2QEOA 3DY9A 1SRAA 3EK4A 3RZSA 1IH0A 4QJ3B 3AKAA 2BKIB 1CM4A 3S0FA 3UNWA 3S0BA 5PALA 2PVBA 1F71A 1QV1A 1XFYO 2HQ8A 1AVSA 1YRUB 2LV7A 1OQPA 2MRDA 1W7IB 1QV0A 2JRFA 3TDUA 4C0JA 4OV2A 3I5IC 5DKNA 3WHUB 4MEWA 1EH2A 3F45A 5ER5A 1TIZA 2KGRA 2FCDA 1OZOA 2K2FA 3BFHA 4MBEA 3SG6A 4AOMA 1BLQA 2BNXA 1YVHA 1FI5A 2L2CA 1ZUZA 2LVKA 5FYXA 4DCKA 1AUIB 2L4HA 1NIWA 4ZCUA 2GGZA 3CR5X 1AJ4A 3DF0B 1J7QA 4C0KA 1T14A 3M0WA 4UPGA 1EJ3A 1Q80A 1WRKA 1Y1UA 3NHTA 2LMVA 1D1OA 3FS7A 3NSKA 1DMOA 1SMGA 2MA2A 1UHKA 2LCPA 2PRUA 3CWGA 2M7NA 1DJGA 3KO0A 5CSNA 1K8UA 1CMFA 1K94A 1BOCA 1KQVA 2O60A 1SYMA 3JVTC 1DJIA 2JNXA 1NUBA 1SBJA 3CGAA 3K1EA 1SL9A 2G9BA 3S0GA 3TDZA 1HQVA 4DS7A 3LL8B 3D77A 4N5XA 1NWDA 5HLOA 2Y4QA 4FTGA 2WOSA 4OR9B 3BOWA 1K9PA 2QACA 3BFBA 1BODA 1DGVA 2BCXA 4OZDA 1JFJA 2GV5A 2CCMA 2ZRSA 1MXLC 3FE8A 4PHJA 3FWCA 2KQ6A 3R1PA 1G8IA 4KYNA 2KGBC 4JKTA 3D0YB 1OSAA 1TNWA 1CMGA 3ICBA 1XFXO 1OOIX 2LMTA 3KHEA 1YR5A 2NZ0A 5EL2A 2LUXA 2L50A 4PHMA 3I5FB 3D78A 1JC2A 2WCKA 2NCPA 4IJ7A 4CFQA 3PN7B 2BAPA 3EKHA 3I5HB 1DJHA 1ZACA 2HPSA 2JQ6A 2ZKMX 5JJGA 1CLBA 2BCAA 1GGZA 2V53A 2ERBA 3N7HA 4FQOA 3VROA 3SG4A 3R1VA 1H8BA 2KAYA 3CZTX 1QS7A 1KFXL 2JT8A 1YUTA 4YGDB 1ALWA 1CDMA 2LLTA 3PATA 3KF9A 5I2QA 1CDNA 3TUYB 1WDCB 3BUXB 1UP5A 2KI6C 2QPTA 3GK2A 1B1GA 1N0YA 1YUSA 1YUUA 1SY9A 5D3OA 1J1EA 3PFVA 1EG4A 1XFRA 1NX1A 2KOTA 1N65A 3VRRA 1S6JA 1KK8C 2JPTA 3BQ3A 2GTEA 2M97A 2L4IA 2AUCA 4OCIA 3SIBA 1Y0VH 2CTNA 4ORBB 5F6TA 3B86A 1MHOA 3OX5A 1XK4C 2G2BA 2KNEA 1BMOA 2F2PA 2L5XB 4D1EA 3D73A 2LLUA 3KEVA 1JUOA 1OMRA 4HREE 1F55A 1ALVA 1PK0D 1OOHA 2KI4C 1KFUL 4GFTA 1OZSA 1U5IA 2LANA 3AAJA 1WDCC 3BUMB 3S0EA 2TN4A 3MSEB 4GUKA 3SS3A 3GOFA 1F54A 1GGWA 4I5NB 1TNPA 3B6XA 4PCWA 2JTZA 4INXA 1DC1A 4JD9A 5DKQA 1S6IA 1AJ5A 3I5IB 3O4YA 2I7AA 1A4PA 1CLLA 1N2DA 1TNQA 1VRKA 1Z2CB 3BUOB 1CNPA 1XK4A 1KFUS 5JOLA 1LKJA 1LVCD 4I5LB 1IRJA 1LS8A 1FF1A 3VRQA 2ZRTA 1SR6C 4XYNA 2M8UA 5CSJA 3TZ1A 2F2OA 5I94A 1ZMZA 1OMVA 2F8PA 2LAPA 2LVVA 3BUWB 4GGNA 5G08A 2KYFA 2K7OA 4USLA 4BY5A 1K90D 3OGNA 1EXRA 1SKTA 4GNKB 4XJKB 5GQQC 1M31A 1B8CA 4YI9A 1MR8A 5FI6A 1BR1B 2L0PA 4HSZA 3SG2A 1IGVA 2L98A 3JVTB 1Y1XA 1QX2A 2NCOA 2KDHA 1DQEA 1RJVA 1TWOA 4HRHA 3EKJA 1DVIA 2I18A 2K0JA 3JTDC 4PE1A 2PASA 3EVRA 1A75B 3CYZA 3RLZA 1BF5A 1XA5A 1M46A 2FOTA 2M3WA 2NXQA 2EHBA 5HKZA 1CFFA 2M1UA 2BCBA 3NSOA 4ORAB 1NP8A 2L5YA 1PALA 2RGIA 1IJ5A 1GM0A 1IWQA 3R72A 3B7AA 1UWOA 2M1KB 1RFJA 1XFWO 3TDIA 4I5JA 1DJXA 5AXIA 4MZJA 1B8RA 5D69A 1G4YR 1QTXA 1OOGA 1DJWA 1CFDA 1R6PA 1DT7B 1IQ3A 5HLVA 2BE4A 2ZN8A 2DOQA 1XFZO 2E30A 2M49B 3QRXA 4GPLB 2WCBA 1SL7A 1BT6A 1TN4A 2H2KA 3D10A 3TS5C 2MLEC 1FPWA 1E8AA 1AHRA 1B47A 1ORGA 1SW8A 2JT0A 3EVUA 3DVMA 2GGMA 1C7WA 3CDNA 2CNPA 2WCMA 1TTXA 1PSRA 2F33A 4YRUA 1L2OC 5AERA 2KAXA 2JPOA 1TUZA 2KYCA 1RECA 2ZFDA 1B8LA 3AAKA 2WCLA 1UHJA 2LE9B 2L51A 1RWYA 4MZLA 3WNXB 3S0DA 1CKKA 1BU3A 1PRWA 1MXEA 3D74A 1WLMA 1IQ5A 1U5IB 3CLNA 4ETOA 1WY9A 2KBIA 5AFPA 2H61A 1JSAA 1WRLA 2OTGC 1W9ZA 1YVLA 2VRGA 4M2PA 1KK8B 1SSEB 3D75A 4MVFA 1QASA 2I2RE 2K2AA 2QEHA 5D7FA 2WORA 2KBMA 1J7OA 3BJHA 5J3XA 1HT9A 1DF0A 1M45A 1MUXA 2LC5A 3OB2B 1QJTA 3B88A 2KI4B 1ZFSA 2LHIA 4DRWA 1SCVA 2D8NA 3DVJA 2Q4UA 2M29A 1V1FA 3OHMB 1SPYA 2E6WA 1UHHA 2MHHA 5HKWA 5K89A 2EGDA 5FI2A 3FIAA 4NDBA 1KFXS 2SASA 2KHNA 3SJSA 4R1EA 2AAOA 4MRXA 3WHTB 1YTZC 1NX2A 1RROA 2MAZA 5KU1A 4NDDA 1S6CA 3WXAA 5BPJA 2A4JA 2PQLA 1DGUA 1MWNA 1TUJA 1SR6B 2JU0A 4YGAA 2WC6A 4N1GA 3SS5A 3SG3A 2Y5IA 4INWA
chains in the Genus database with same CATH topology
2BECA 2I94A 3PM8A 1LINA 2LP3A 2M9GA 3NSLA 1H4BA 1FBVA 2LUCA 2NLNA 3GK4X 4CLNA 2JULA 4A4CA 3CR4X 3LK1A 4PE7A 1JF0A 4CPVA 1KCYA 4HRGA 3ZNIA 2CXJA 4PHKA 4U8DA 3A4UB 3IQOA 1G33A 1BG1A 1LXFC 1YURA 1QX7A 2LM5A 1TRFA 3JTDB 1NX3A 2BBMA 4ZCVA 2AMIA 1UHNA 3O6BA 1UHIA 2HQWA 2IS9A 2WCEA 4GBAA 1XO5A 4Q04A 1TCFA 1MF8B 1S5GZ 2KFGA 3D0YA 1YX8A 2K8MB 1SCMC 1ODBA 1CFPA 4N1FA 3BOWB 4JWQA 3E3RA 1OMDA 1CTRA 5AANA 2BL0C 1J55A 5DKRA 2ZN9A 3KPXA 4QJ5B 4C0LA 3PSRA 3NXAA 1CFCA 1DJZA 4YGEB 2EC6C 2P6BB 1PVAA 1SNLA 2JXCA 2CT9A 3AKBA 1WLZA 3TS5B 3C1VA 4YGCB 1B7TZ 2KI6D 3BYAA 4P2YB 1CM1A 1GQMA 1KQMC 2F3ZA 1F4QA 2KSPA 1TCOB 2BE6A 1S3PA 2PMYA 5IBWA 1L2OB 2F3YA 4AQIA 4BY4A 4ICBA 4PE0A 1F4OA 1KWOC 3HX4A 2K7DA 2K7CA 4MSPA 1DF0B 1LA3A 5CSFA 3O2PA 2MBXA 1NX0A 1XYDA 4F0ZB 4YBHB 1AP4A 1JF2A 2K61A 1W7JB 2JOJA 3A8RA 1XVJA 2BKHB 3PLFB 2OTGB 2CBLA 1CDPA 2ZNDA 1S5GY 3OP0A 4M2QA 1CB1A 1EG3A 1NCYA 2LVIA 1EL4A 2KAVA 3RM1A 1C7VA 1PULA 1JFKA 1X02A 2H61C 1JWDA 1J1DA 1CDLA 1QVIZ 2JWWA 2K7BA 2L2EA 1F8HA 1S26D 1YX7A 1RK9A 3IF7A 2M7LA 1F70A 1YRTB 4TNCA 1B7TY 3EK8A 5KTYA 1S36A 1XFUO 1ZOTB 4MZKA 1S1EA 4OVNF 3VRPA 2KFHA 4PDZA 1KK7Z 3NSIA 1TOPA 5TNCA 4CIDA 2B1UA 2FJUB 1QX5B 4PALA 2Y1MA 1L7ZA 2BBNA 2HF5A 2KQYA 1KSOA 2Q91A 3SG7A 1NCXA 4YGBB 3O78A 1QLSA 4WQ3A 4XJKA 1J7PA 4P5OE 1QLKA 1QXPA 1NPQA 3CS1A 1A2XA 1A03A 1XFVO 4I5KA 1J7RA 3SIAA 1OE9B 1QIWA 5CSIA 2Y1NA 1B4CA 1PVBA 1BR4B 2PALA 1RTP1 3GK1A 5HYDA 2LVJA 2WC8A 2OPOA 1WRZA 1A75A 3OB1B 2M0RA 5KSZA 3K21A 1UUSA 2ZNEA 2PSRA 5B8IB 2HETA 5AEQA 1V1GA 1IJ6A 1B9AA 2LNKA 3CR2A 4E68A 5I2OA 1QVIY 1SL8A 4JQ0D 1DJYA 4NQGA 3BUNB 1C07A 1A29A 2FCEA 1FW4A 2MJWB 3DF0A 3I5GB 3LK0A 1JBAA 1K95A 4GAOA 1LA0A 1TNXA 2JNFA 4JPZB 5I8NA 1K9UA 1SCMB 2LMUA 3HCMA 2OS8B 1IKUA 1M39A 2JXLA 3PALA 3H4SE 1KK7Y 2MLFC 1NSHA 4PE4A 4A4BA 1K9KA 2BL0B 4YI8A 2JZIA 3DD4A 4QJ4B 1OOJA 2WNDA 1DTLA 1K2HA 4MRYA 5HKYA 2ISDA 4AQJA 2EC6B 2KFFA 2LLSA 5CPVA 1FI6A 1GJYA 2SCPA 4MLWA 4WQ2A 3LLEA 2JC2A 1PSBA 4NDCA 1KSMA 3I5FC 3VGOA 4L9MA 3ZWHA 1KQMB 1K93D 1NCZA 3PN7C 5I2LA 2O5GA 3I5HC 2LHLA 2R2IA 3DVEA 3I5GC 4MN0A 3EK7A 4OKHA 4GGFC 3FWBA 1K96A 1R2UA 4ORCB 4CFRA 1MQ1A 1KWOB 1UURA 1BJFA 4PHNA 2OS8C 3TUYC 1QIVA 4WRIA 2JT3A 1NYAA 2WCFA 1CLMA 1IG5A 2JTTA 4DUQA 1QATA 1SK6D 3EVVA 4DIRA 3SG5A 3IQQA 4GGFA 4M2OA 1M63B 3DVKA 3OX6A 2COLB 5ER4X 3BXKA 1AK8A 3LCPC 4IL1A 1Y6WA 3VRNA 2LP2A 3CTNA 1Y1AA 1SRAA 3EK4A 1IH0A 4QJ3B 3AKAA 2BKIB 1CM4A 5PALA 2PVBA 1F71A 1QV1A 1XFYO 2HQ8A 1AVSA 1YRUB 2LV7A 1OQPA 2MRDA 1W7IB 1QV0A 2JRFA 3TDUA 4C0JA 4OV2A 3I5IC 5DKNA 3WHUB 4MEWA 1EH2A 3F45A 5ER5A 1TIZA 2KGRA 2FCDA 1OZOA 2K2FA 3SG6A 4MBEA 4AOMA 1BLQA 1YVHA 1FI5A 1ZUZA 2LVKA 5FYXA 4DCKA 1AUIB 2L4HA 1NIWA 4ZCUA 2GGZA 3CR5X 1AJ4A 3DF0B 1J7QA 4C0KA 3M0WA 4UPGA 1EJ3A 1Q80A 1WRKA 1Y1UA 1D1OA 2LMVA 3FS7A 3NSKA 1DMOA 1SMGA 2MA2A 1UHKA 2LCPA 2PRUA 3CWGA 2M7NA 1DJGA 3KO0A 5CSNA 1K8UA 1CMFA 1K94A 1BOCA 1KQVA 2O60A 1SYMA 3JVTC 1DJIA 2JNXA 1NUBA 1SBJA 3CGAA 1SL9A 2G9BA 3TDZA 1HQVA 4DS7A 3LL8B 4N5XA 1NWDA 5HLOA 2Y4QA 4FTGA 2WOSA 4OR9B 3BOWA 1K9PA 2QACA 1BODA 1DGVA 2BCXA 1JFJA 2GV5A 2CCMA 2ZRSA 1MXLC 4PHJA 3FWCA 2KQ6A 1G8IA 2KGBC 3D0YB 1OSAA 1TNWA 1CMGA 3ICBA 1XFXO 2LMTA 3KHEA 1YR5A 2NZ0A 2LUXA 2L50A 4PHMA 3I5FB 1JC2A 2NCPA 4CFQA 3PN7B 3EKHA 3I5HB 1DJHA 1ZACA 2HPSA 2JQ6A 2ZKMX 5JJGA 1CLBA 2BCAA 1GGZA 2V53A 4FQOA 3VROA 3SG4A 1H8BA 2KAYA 3CZTX 1QS7A 1KFXL 2JT8A 1YUTA 4YGDB 1ALWA 1CDMA 2LLTA 3PATA 3KF9A 5I2QA 1CDNA 3TUYB 1WDCB 3BUXB 1UP5A 2KI6C 2QPTA 3GK2A 1B1GA 1N0YA 1YUSA 1YUUA 1SY9A 1J1EA 3PFVA 1EG4A 1NX1A 2KOTA 1N65A 3VRRA 1S6JA 1KK8C 2JPTA 3BQ3A 2M97A 2L4IA 2AUCA 4OCIA 3SIBA 1Y0VH 2CTNA 4ORBB 5F6TA 1MHOA 3OX5A 1XK4C 2G2BA 2KNEA 1BMOA 2F2PA 2L5XB 4D1EA 2LLUA 3KEVA 1JUOA 1OMRA 4HREE 1F55A 1ALVA 1PK0D 2KI4C 1KFUL 4GFTA 1OZSA 1U5IA 2LANA 3AAJA 1WDCC 3BUMB 2TN4A 3MSEB 4GUKA 1F54A 3GOFA 1GGWA 4I5NB 1TNPA 4PCWA 2JTZA 5DKQA 1S6IA 1AJ5A 3I5IB 3O4YA 2I7AA 1A4PA 1CLLA 1N2DA 1TNQA 1VRKA 3BUOB 1CNPA 1XK4A 1KFUS 5JOLA 1LKJA 1LVCD 4I5LB 1IRJA 1FF1A 3VRQA 2ZRTA 1SR6C 4XYNA 2M8UA 5CSJA 3TZ1A 2F2OA 1ZMZA 1OMVA 2F8PA 2LAPA 2LVVA 3BUWB 4GGNA 5G08A 2KYFA 2K7OA 4USLA 4BY5A 1K90D 1EXRA 1SKTA 4GNKB 4XJKB 5GQQC 1M31A 1B8CA 4YI9A 1MR8A 1BR1B 2L0PA 4HSZA 3SG2A 1IGVA 2L98A 3JVTB 1Y1XA 1QX2A 2NCOA 2KDHA 1RJVA 4HRHA 3EKJA 1DVIA 2I18A 2K0JA 3JTDC 4PE1A 2PASA 3EVRA 1A75B 3RLZA 1BF5A 1XA5A 1M46A 2FOTA 2M3WA 2NXQA 2EHBA 5HKZA 1CFFA 2M1UA 2BCBA 3NSOA 4ORAB 1NP8A 1PALA 2RGIA 1IJ5A 1IWQA 1UWOA 2M1KB 1RFJA 1XFWO 3TDIA 4I5JA 1DJXA 5AXIA 4MZJA 1B8RA 5D69A 1G4YR 1QTXA 1DJWA 1CFDA 1R6PA 1DT7B 1IQ3A 5HLVA 2BE4A 2ZN8A 2DOQA 1XFZO 2E30A 2M49B 3QRXA 4GPLB 2WCBA 1SL7A 1BT6A 1TN4A 2H2KA 3D10A 3TS5C 2MLEC 1FPWA 1E8AA 1AHRA 1B47A 1SW8A 2JT0A 3EVUA 3DVMA 2GGMA 1C7WA 2CNPA 1TTXA 1PSRA 2F33A 4YRUA 1L2OC 5AERA 2KAXA 2KYCA 1RECA 2ZFDA 1B8LA 3AAKA 1UHJA 2LE9B 2L51A 1RWYA 4MZLA 3WNXB 1CKKA 1BU3A 1PRWA 1MXEA 1WLMA 1IQ5A 1U5IB 3CLNA 4ETOA 1WY9A 2KBIA 5AFPA 2H61A 1JSAA 1WRLA 2OTGC 4M2PA 1YVLA 2VRGA 1KK8B 4MVFA 1QASA 2I2RE 2K2AA 5D7FA 2WORA 2KBMA 1J7OA 5J3XA 1HT9A 1DF0A 1M45A 1MUXA 2LC5A 3OB2B 1QJTA 2KI4B 1ZFSA 2LHIA 4DRWA 1SCVA 2D8NA 3DVJA 2Q4UA 2M29A 1V1FA 3OHMB 1SPYA 2E6WA 1UHHA 2MHHA 5HKWA 5K89A 2EGDA 3FIAA 4NDBA 1KFXS 2SASA 2KHNA 3SJSA 4R1EA 2AAOA 4MRXA 3WHTB 1YTZC 1NX2A 1RROA 2MAZA 5KU1A 4NDDA 1S6CA 3WXAA 5BPJA 2A4JA 1DGUA 1MWNA 1SR6B 2JU0A 4YGAA 3SG3A 4N1GA 2Y5IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BEC A;  2I94 A;  3PM8 A;  1LIN A;  2LP3 A;  2M9G A;  3NSL A;  1H4B A;  1FBV A;  2LUC A;  2NLN A;  3GK4 X;  4CLN A;  2JUL A;  4A4C A;  3CR4 X;  3LK1 A;  4PE7 A;  1JF0 A;  4CPV A;  1KCY A;  4HRG A;  3ZNI A;  2CXJ A;  4PHK A;  4U8D A;  3A4U B;  3IQO A;  1G33 A;  1BG1 A;  1LXF C;  1YUR A;  1QX7 A;  2LM5 A;  1TRF A;  3JTD B;  1NX3 A;  2BBM A;  4ZCV A;  2AMI A;  1UHN A;  3O6B A;  1UHI A;  2HQW A;  2IS9 A;  2WCE A;  4GBA A;  1XO5 A;  4Q04 A;  1TCF A;  1MF8 B;  1S5G Z;  2KFG A;  3D0Y A;  1YX8 A;  2K8M B;  1SCM C;  1ODB A;  1CFP A;  4N1F A;  3BOW B;  4JWQ A;  3E3R A;  1OMD A;  1CTR A;  5AAN A;  2BL0 C;  1J55 A;  5DKR A;  2ZN9 A;  3KPX A;  4QJ5 B;  4C0L A;  3PSR A;  3NXA A;  1CFC A;  1DJZ A;  4YGE B;  2EC6 C;  2P6B B;  1PVA A;  1SNL A;  2JXC A;  2CT9 A;  3AKB A;  1WLZ A;  3TS5 B;  3C1V A;  4YGC B;  1B7T Z;  2KI6 D;  3BYA A;  4P2Y B;  1CM1 A;  1GQM A;  1KQM C;  2F3Z A;  1F4Q A;  2KSP A;  1TCO B;  2BE6 A;  1S3P A;  2PMY A;  5IBW A;  1L2O B;  2F3Y A;  4AQI A;  4BY4 A;  4ICB A;  4PE0 A;  1F4O A;  1KWO C;  3HX4 A;  2K7D A;  2K7C A;  4MSP A;  1DF0 B;  1LA3 A;  5CSF A;  3O2P A;  2MBX A;  1NX0 A;  1XYD A;  4F0Z B;  4YBH B;  1AP4 A;  1JF2 A;  2K61 A;  1W7J B;  2JOJ A;  3A8R A;  1XVJ A;  2BKH B;  3PLF B;  2OTG B;  2CBL A;  1CDP A;  2ZND A;  1S5G Y;  3OP0 A;  4M2Q A;  1CB1 A;  1EG3 A;  1NCY A;  2LVI A;  1EL4 A;  2KAV A;  3RM1 A;  1C7V A;  1PUL A;  1JFK A;  1X02 A;  2H61 C;  1JWD A;  1J1D A;  1CDL A;  1QVI Z;  2JWW A;  2K7B A;  2L2E A;  1F8H A;  1S26 D;  1YX7 A;  1RK9 A;  3IF7 A;  2M7L A;  1F70 A;  1YRT B;  4TNC A;  1B7T Y;  3EK8 A;  5KTY A;  1S36 A;  1XFU O;  1ZOT B;  4MZK A;  1S1E A;  4OVN F;  3VRP A;  2KFH A;  4PDZ A;  1KK7 Z;  3NSI A;  1TOP A;  5TNC A;  4CID A;  2B1U A;  2FJU B;  1QX5 B;  4PAL A;  2Y1M A;  1L7Z A;  2BBN A;  2HF5 A;  2KQY A;  1KSO A;  2Q91 A;  3SG7 A;  1NCX A;  4YGB B;  3O78 A;  1QLS A;  4WQ3 A;  4XJK A;  1J7P A;  4P5O E;  1QLK A;  1QXP A;  1NPQ A;  3CS1 A;  1A2X A;  1A03 A;  1XFV O;  4I5K A;  1J7R A;  3SIA A;  1OE9 B;  1QIW A;  5CSI A;  2Y1N A;  1B4C A;  1PVB A;  1BR4 B;  2PAL A;  1RTP 1;  3GK1 A;  5HYD A;  2LVJ A;  2WC8 A;  2OPO A;  1WRZ A;  1A75 A;  3OB1 B;  2M0R A;  5KSZ A;  3K21 A;  1UUS A;  2ZNE A;  2PSR A;  5B8I B;  2HET A;  5AEQ A;  1V1G A;  1IJ6 A;  1B9A A;  2LNK A;  3CR2 A;  4E68 A;  5I2O A;  1QVI Y;  1SL8 A;  4JQ0 D;  1DJY A;  4NQG A;  3BUN B;  1C07 A;  1A29 A;  2FCE A;  1FW4 A;  2MJW B;  3DF0 A;  3I5G B;  3LK0 A;  1JBA A;  1K95 A;  4GAO A;  1LA0 A;  1TNX A;  2JNF A;  4JPZ B;  5I8N A;  1K9U A;  1SCM B;  2LMU A;  3HCM A;  2OS8 B;  1IKU A;  1M39 A;  2JXL A;  3PAL A;  3H4S E;  1KK7 Y;  2MLF C;  1NSH A;  4PE4 A;  4A4B A;  1K9K A;  2BL0 B;  4YI8 A;  2JZI A;  3DD4 A;  4QJ4 B;  1OOJ A;  2WND A;  1DTL A;  1K2H A;  4MRY A;  5HKY A;  2ISD A;  4AQJ A;  2EC6 B;  2KFF A;  2LLS A;  5CPV A;  1FI6 A;  1GJY A;  2SCP A;  4MLW A;  4WQ2 A;  3LLE A;  2JC2 A;  1PSB A;  4NDC A;  1KSM A;  3I5F C;  3VGO A;  4L9M A;  3ZWH A;  1KQM B;  1K93 D;  1NCZ A;  3PN7 C;  5I2L A;  2O5G A;  3I5H C;  2LHL A;  2R2I A;  3DVE A;  3I5G C;  4MN0 A;  3EK7 A;  4OKH A;  4GGF C;  3FWB A;  1K96 A;  1R2U A;  4ORC B;  4CFR A;  1MQ1 A;  1KWO B;  1UUR A;  1BJF A;  4PHN A;  2OS8 C;  3TUY C;  1QIV A;  4WRI A;  2JT3 A;  1NYA A;  2WCF A;  1CLM A;  1IG5 A;  2JTT A;  4DUQ A;  1QAT A;  1SK6 D;  3EVV A;  4DIR A;  3SG5 A;  3IQQ A;  4GGF A;  4M2O A;  1M63 B;  3DVK A;  3OX6 A;  2COL B;  5ER4 X;  3BXK A;  1AK8 A;  3LCP C;  4IL1 A;  1Y6W A;  3VRN A;  2LP2 A;  3CTN A;  1Y1A A;  1SRA A;  3EK4 A;  1IH0 A;  4QJ3 B;  3AKA A;  2BKI B;  1CM4 A;  5PAL A;  2PVB A;  1F71 A;  1QV1 A;  1XFY O;  2HQ8 A;  1AVS A;  1YRU B;  2LV7 A;  1OQP A;  2MRD A;  1W7I B;  1QV0 A;  2JRF A;  3TDU A;  4C0J A;  4OV2 A;  3I5I C;  5DKN A;  3WHU B;  4MEW A;  1EH2 A;  3F45 A;  5ER5 A;  1TIZ A;  2KGR A;  2FCD A;  1OZO A;  2K2F A;  3SG6 A;  4MBE A;  4AOM A;  1BLQ A;  1YVH A;  1FI5 A;  1ZUZ A;  2LVK A;  5FYX A;  4DCK A;  1AUI B;  2L4H A;  1NIW A;  4ZCU A;  2GGZ A;  3CR5 X;  1AJ4 A;  3DF0 B;  1J7Q A;  4C0K A;  3M0W A;  4UPG A;  1EJ3 A;  1Q80 A;  1WRK A;  1Y1U A;  1D1O A;  2LMV A;  3FS7 A;  3NSK A;  1DMO A;  1SMG A;  2MA2 A;  1UHK A;  2LCP A;  2PRU A;  3CWG A;  2M7N A;  1DJG A;  3KO0 A;  5CSN A;  1K8U A;  1CMF A;  1K94 A;  1BOC A;  1KQV A;  2O60 A;  1SYM A;  3JVT C;  1DJI A;  2JNX A;  1NUB A;  1SBJ A;  3CGA A;  1SL9 A;  2G9B A;  3TDZ A;  1HQV A;  4DS7 A;  3LL8 B;  4N5X A;  1NWD A;  5HLO A;  2Y4Q A;  4FTG A;  2WOS A;  4OR9 B;  3BOW A;  1K9P A;  2QAC A;  1BOD A;  1DGV A;  2BCX A;  1JFJ A;  2GV5 A;  2CCM A;  2ZRS A;  1MXL C;  4PHJ A;  3FWC A;  2KQ6 A;  1G8I A;  2KGB C;  3D0Y B;  1OSA A;  1TNW A;  1CMG A;  3ICB A;  1XFX O;  2LMT A;  3KHE A;  1YR5 A;  2NZ0 A;  2LUX A;  2L50 A;  4PHM A;  3I5F B;  1JC2 A;  2NCP A;  4CFQ A;  3PN7 B;  3EKH A;  3I5H B;  1DJH A;  1ZAC A;  2HPS A;  2JQ6 A;  2ZKM X;  5JJG A;  1CLB A;  2BCA A;  1GGZ A;  2V53 A;  4FQO A;  3VRO A;  3SG4 A;  1H8B A;  2KAY A;  3CZT X;  1QS7 A;  1KFX L;  2JT8 A;  1YUT A;  4YGD B;  1ALW A;  1CDM A;  2LLT A;  3PAT A;  3KF9 A;  5I2Q A;  1CDN A;  3TUY B;  1WDC B;  3BUX B;  1UP5 A;  2KI6 C;  2QPT A;  3GK2 A;  1B1G A;  1N0Y A;  1YUS A;  1YUU A;  1SY9 A;  1J1E A;  3PFV A;  1EG4 A;  1NX1 A;  2KOT A;  1N65 A;  3VRR A;  1S6J A;  1KK8 C;  2JPT A;  3BQ3 A;  2M97 A;  2L4I A;  2AUC A;  4OCI A;  3SIB A;  1Y0V H;  2CTN A;  4ORB B;  5F6T A;  1MHO A;  3OX5 A;  1XK4 C;  2G2B A;  2KNE A;  1BMO A;  2F2P A;  2L5X B;  4D1E A;  2LLU A;  3KEV A;  1JUO A;  1OMR A;  4HRE E;  1F55 A;  1ALV A;  1PK0 D;  2KI4 C;  1KFU L;  4GFT A;  1OZS A;  1U5I A;  2LAN A;  3AAJ A;  1WDC C;  3BUM B;  2TN4 A;  3MSE B;  4GUK A;  1F54 A;  3GOF A;  1GGW A;  4I5N B;  1TNP A;  4PCW A;  2JTZ A;  5DKQ A;  1S6I A;  1AJ5 A;  3I5I B;  3O4Y A;  2I7A A;  1A4P A;  1CLL A;  1N2D A;  1TNQ A;  1VRK A;  3BUO B;  1CNP A;  1XK4 A;  1KFU S;  5JOL A;  1LKJ A;  1LVC D;  4I5L B;  1IRJ A;  1FF1 A;  3VRQ A;  2ZRT A;  1SR6 C;  4XYN A;  2M8U A;  5CSJ A;  3TZ1 A;  2F2O A;  1ZMZ A;  1OMV A;  2F8P A;  2LAP A;  2LVV A;  3BUW B;  4GGN A;  5G08 A;  2KYF A;  2K7O A;  4USL A;  4BY5 A;  1K90 D;  1EXR A;  1SKT A;  4GNK B;  4XJK B;  5GQQ C;  1M31 A;  1B8C A;  4YI9 A;  1MR8 A;  1BR1 B;  2L0P A;  4HSZ A;  3SG2 A;  1IGV A;  2L98 A;  3JVT B;  1Y1X A;  1QX2 A;  2NCO A;  2KDH A;  1RJV A;  4HRH A;  3EKJ A;  1DVI A;  2I18 A;  2K0J A;  3JTD C;  4PE1 A;  2PAS A;  3EVR A;  1A75 B;  3RLZ A;  1BF5 A;  1XA5 A;  1M46 A;  2FOT A;  2M3W A;  2NXQ A;  2EHB A;  5HKZ A;  1CFF A;  2M1U A;  2BCB A;  3NSO A;  4ORA B;  1NP8 A;  1PAL A;  2RGI A;  1IJ5 A;  1IWQ A;  1UWO A;  2M1K B;  1RFJ A;  1XFW O;  3TDI A;  4I5J A;  1DJX A;  5AXI A;  4MZJ A;  1B8R A;  5D69 A;  1G4Y R;  1QTX A;  1DJW A;  1CFD A;  1R6P A;  1DT7 B;  1IQ3 A;  5HLV A;  2BE4 A;  2ZN8 A;  2DOQ A;  1XFZ O;  2E30 A;  2M49 B;  3QRX A;  4GPL B;  2WCB A;  1SL7 A;  1BT6 A;  1TN4 A;  2H2K A;  3D10 A;  3TS5 C;  2MLE C;  1FPW A;  1E8A A;  1AHR A;  1B47 A;  1SW8 A;  2JT0 A;  3EVU A;  3DVM A;  2GGM A;  1C7W A;  2CNP A;  1TTX A;  1PSR A;  2F33 A;  4YRU A;  1L2O C;  5AER A;  2KAX A;  2KYC A;  1REC A;  2ZFD A;  1B8L A;  3AAK A;  1UHJ A;  2LE9 B;  2L51 A;  1RWY A;  4MZL A;  3WNX B;  1CKK A;  1BU3 A;  1PRW A;  1MXE A;  1WLM A;  1IQ5 A;  1U5I B;  3CLN A;  4ETO A;  1WY9 A;  2KBI A;  5AFP A;  2H61 A;  1JSA A;  1WRL A;  2OTG C;  4M2P A;  1YVL A;  2VRG A;  1KK8 B;  4MVF A;  1QAS A;  2I2R E;  2K2A A;  5D7F A;  2WOR A;  2KBM A;  1J7O A;  5J3X A;  1HT9 A;  1DF0 A;  1M45 A;  1MUX A;  2LC5 A;  3OB2 B;  1QJT A;  2KI4 B;  1ZFS A;  2LHI A;  4DRW A;  1SCV A;  2D8N A;  3DVJ A;  2Q4U A;  2M29 A;  1V1F A;  3OHM B;  1SPY A;  2E6W A;  1UHH A;  2MHH A;  5HKW A;  5K89 A;  2EGD A;  3FIA A;  4NDB A;  1KFX S;  2SAS A;  2KHN A;  3SJS A;  4R1E A;  2AAO A;  4MRX A;  3WHT B;  1YTZ C;  1NX2 A;  1RRO A;  2MAZ A;  5KU1 A;  4NDD A;  1S6C A;  3WXA A;  5BPJ A;  2A4J A;  1DGU A;  1MWN A;  1SR6 B;  2JU0 A;  4YGA A;  3SG3 A;  4N1G A;  2Y5I A; 
#chains in the Genus database with same CATH topology
 2BEC A;  2I94 A;  3IVT A;  3PM8 A;  1LIN A;  2LP3 A;  2M9G A;  3NSL A;  1H4B A;  1FBV A;  2LUC A;  2NLN A;  3GK4 X;  4CLN A;  2JUL A;  4A4C A;  3CR4 X;  3LK1 A;  4PE7 A;  1JF0 A;  2YGU A;  2PYQ A;  4CPV A;  1KCY A;  4HRG A;  3NHI A;  3ZNI A;  2CXJ A;  4PHK A;  4U8D A;  3A4U B;  3IQO A;  1G33 A;  1BG1 A;  1LXF C;  4FQT A;  2K60 A;  1YUR A;  1QX7 A;  2LM5 A;  1TRF A;  3JTD B;  1NX3 A;  2BBM A;  4ZCV A;  2AMI A;  1UHN A;  3O6B A;  1UHI A;  2HQW A;  1DEK A;  2IS9 A;  2WCE A;  4GBA A;  1XO5 A;  2KLE A;  4Q04 A;  1TCF A;  3R1O A;  1MF8 B;  1S5G Z;  3D76 A;  2KFG A;  3D0Y A;  1YX8 A;  2K8M B;  1SCM C;  1ODB A;  3Q8I A;  4N1F A;  3BOW B;  5DIC A;  1CFP A;  4JWQ A;  3E3R A;  1OMD A;  1CTR A;  3CZ2 A;  5AAN A;  2BL0 C;  1J55 A;  2KPH A;  5DKR A;  2ZN9 A;  3KPX A;  4QJ5 B;  4C0L A;  3PSR A;  3NXA A;  1CFC A;  1DJZ A;  4YGE B;  2EC6 C;  2P6B B;  3DYE A;  1PVA A;  1SNL A;  2JXC A;  2CT9 A;  3AKB A;  1WLZ A;  3TS5 B;  3C1V A;  4YGC B;  1B7T Z;  2KI6 D;  3BYA A;  4P2Y B;  1CM1 A;  1GQM A;  1KQM C;  2F3Z A;  1F4Q A;  2KSP A;  1TCO B;  2BE6 A;  3OBV A;  1S3P A;  3DXL A;  2PMY A;  5IBW A;  1L2O B;  2F3Y A;  2WCH A;  2WCJ A;  3EG5 B;  3FE9 A;  4AQI A;  4BY4 A;  4ICB A;  4PE0 A;  1F4O A;  2P70 A;  1KWO C;  3HX4 A;  1Z4H A;  2K7D A;  2K7C A;  4MSP A;  1DF0 B;  1LA3 A;  5CSF A;  3O2P A;  2MBX A;  1NX0 A;  1XYD A;  4F0Z B;  4YBH B;  1AP4 A;  1JF2 A;  2K61 A;  1W7J B;  2JOJ A;  3A8R A;  1XVJ A;  2BKH B;  3PLF B;  2OTG B;  2CBL A;  1CDP A;  1QWV A;  2ZND A;  1S5G Y;  3OP0 A;  2KLD A;  4M2Q A;  1CB1 A;  1EG3 A;  1NCY A;  2LVI A;  1EL4 A;  2KAV A;  3RM1 A;  1C7V A;  1C3Z A;  1PUL A;  2QEV A;  1JFK A;  1X02 A;  2H61 C;  1JWD A;  3DZT A;  3QME A;  1J1D A;  1CDL A;  1QVI Z;  2JWW A;  2K7B A;  2L2E A;  1F8H A;  1S26 D;  1YX7 A;  1RK9 A;  3IF7 A;  2M7L A;  1F70 A;  1YRT B;  4TNC A;  1B7T Y;  3EK8 A;  2WC5 A;  5KTY A;  1S36 A;  1XFU O;  1ZOT B;  3FE6 A;  1S1E A;  4MZK A;  4OVN F;  3VRP A;  2P71 A;  2QDI A;  2KFH A;  4PDZ A;  5FI7 A;  1KK7 Z;  3NSI A;  1TOP A;  4PT1 A;  5TNC A;  3V2L A;  4CID A;  3L47 A;  1OW4 A;  2B1U A;  3SS4 A;  3UO9 A;  2FJU B;  1QX5 B;  4PAL A;  2Y1M A;  1L7Z A;  2BBN A;  2HF5 A;  2KQY A;  1KSO A;  2Q91 A;  3SG7 A;  1NCX A;  4YGB B;  3O78 A;  1QLS A;  4WQ3 A;  4XJK A;  1J7P A;  4P5O E;  1QLK A;  1QXP A;  1NPQ A;  3CS1 A;  1A2X A;  1A03 A;  1XFV O;  4I5K A;  1IIO A;  1J7R A;  3SIA A;  1OE9 B;  1QIW A;  3CZ0 A;  5CSI A;  2Y1N A;  1B4C A;  1PVB A;  1BR4 B;  2PAL A;  1RTP 1;  3GK1 A;  3PM2 A;  5HYD A;  2LVJ A;  2WC8 A;  2OPO A;  1WRZ A;  1A75 A;  3OB1 B;  2M0R A;  3NGV A;  5KSZ A;  3K21 A;  1UUS A;  2ZNE A;  2PSR A;  5B8I B;  2HET A;  5AEQ A;  1V1G A;  1IJ6 A;  1B9A A;  1DEL A;  2LNK A;  3CR2 A;  5I2O A;  4E68 A;  1QVI Y;  1SL8 A;  4JQ0 D;  1DJY A;  4NQG A;  3BUN B;  1C07 A;  1A29 A;  3O4X A;  2FCE A;  1FW4 A;  2MJW B;  3DF0 A;  3I5G B;  3LK0 A;  3BFA A;  1JBA A;  1K95 A;  4GAO A;  1LA0 A;  1TNX A;  2JNF A;  4JPZ B;  5I8N A;  1K9U A;  1SCM B;  2LMU A;  3HCM A;  2OS8 B;  3VB1 A;  1IKU A;  1M39 A;  2JXL A;  3PAL A;  3H4S E;  1KK7 Y;  2MLF C;  1NSH A;  3CAB A;  2FJY A;  4PE4 A;  4A4B A;  1K9K A;  2BL0 B;  3L4L A;  4YI8 A;  2JZI A;  2H8V A;  3DD4 A;  4QJ4 B;  1OOJ A;  2WND A;  1DTL A;  1K2H A;  4MRY A;  5HKY A;  2ISD A;  1P28 A;  2EC6 B;  2KFF A;  2LLS A;  4AQJ A;  5CPV A;  1FI6 A;  1GJY A;  2SCP A;  4MLW A;  4WQ2 A;  3LLE A;  2JC2 A;  1PSB A;  4NDC A;  1KSM A;  3I5F C;  3VGO A;  1C3Y A;  4L9M A;  3ZWH A;  3B87 A;  1KQM B;  1K93 D;  1NCZ A;  3PN7 C;  5I2L A;  2O5G A;  3I5H C;  2LHL A;  2R2I A;  3DVE A;  3CZ1 A;  3I5G C;  4MN0 A;  3EK7 A;  4OKH A;  4F7F A;  4GGF C;  3FWB A;  1K96 A;  1R2U A;  4ORC B;  4CFR A;  1MQ1 A;  1KWO B;  1UUR A;  1BJF A;  4PHN A;  2OS8 C;  3TUY C;  1QIV A;  4WRI A;  2JT3 A;  1NYA A;  2WCF A;  1OOF A;  1CLM A;  1IG5 A;  2JTT A;  4DUQ A;  3L4A A;  1QAT A;  2QEB A;  1SK6 D;  3EVV A;  4DIR A;  3SG5 A;  3IQQ A;  4GGF A;  4M2O A;  1M63 B;  3DVK A;  3OX6 A;  2COL B;  3PJI A;  3BXK A;  5ER4 X;  5HL1 A;  1AK8 A;  3LCP C;  4IL1 A;  3S0A A;  1Y6W A;  3VRN A;  2LP2 A;  3CTN A;  1Y1A A;  2QEO A;  3DY9 A;  1SRA A;  3EK4 A;  3RZS A;  1IH0 A;  4QJ3 B;  3AKA A;  2BKI B;  1CM4 A;  3S0F A;  3UNW A;  3S0B A;  5PAL A;  2PVB A;  1F71 A;  1QV1 A;  1XFY O;  2HQ8 A;  1AVS A;  1YRU B;  2LV7 A;  1OQP A;  2MRD A;  1W7I B;  1QV0 A;  2JRF A;  3TDU A;  4C0J A;  4OV2 A;  3I5I C;  5DKN A;  3WHU B;  4MEW A;  1EH2 A;  3F45 A;  5ER5 A;  1TIZ A;  2KGR A;  2FCD A;  1OZO A;  2K2F A;  3BFH A;  4MBE A;  3SG6 A;  4AOM A;  1BLQ A;  2BNX A;  1YVH A;  1FI5 A;  2L2C A;  1ZUZ A;  2LVK A;  5FYX A;  4DCK A;  1AUI B;  2L4H A;  1NIW A;  4ZCU A;  2GGZ A;  3CR5 X;  1AJ4 A;  3DF0 B;  1J7Q A;  4C0K A;  1T14 A;  3M0W A;  4UPG A;  1EJ3 A;  1Q80 A;  1WRK A;  1Y1U A;  3NHT A;  2LMV A;  1D1O A;  3FS7 A;  3NSK A;  1DMO A;  1SMG A;  2MA2 A;  1UHK A;  2LCP A;  2PRU A;  3CWG A;  2M7N A;  1DJG A;  3KO0 A;  5CSN A;  1K8U A;  1CMF A;  1K94 A;  1BOC A;  1KQV A;  2O60 A;  1SYM A;  3JVT C;  1DJI A;  2JNX A;  1NUB A;  1SBJ A;  3CGA A;  3K1E A;  1SL9 A;  2G9B A;  3S0G A;  3TDZ A;  1HQV A;  4DS7 A;  3LL8 B;  3D77 A;  4N5X A;  1NWD A;  5HLO A;  2Y4Q A;  4FTG A;  2WOS A;  4OR9 B;  3BOW A;  1K9P A;  2QAC A;  3BFB A;  1BOD A;  1DGV A;  2BCX A;  4OZD A;  1JFJ A;  2GV5 A;  2CCM A;  2ZRS A;  1MXL C;  3FE8 A;  4PHJ A;  3FWC A;  2KQ6 A;  3R1P A;  1G8I A;  4KYN A;  2KGB C;  4JKT A;  3D0Y B;  1OSA A;  1TNW A;  1CMG A;  3ICB A;  1XFX O;  1OOI X;  2LMT A;  3KHE A;  1YR5 A;  2NZ0 A;  5EL2 A;  2LUX A;  2L50 A;  4PHM A;  3I5F B;  3D78 A;  1JC2 A;  2WCK A;  2NCP A;  4IJ7 A;  4CFQ A;  3PN7 B;  2BAP A;  3EKH A;  3I5H B;  1DJH A;  1ZAC A;  2HPS A;  2JQ6 A;  2ZKM X;  5JJG A;  1CLB A;  2BCA A;  1GGZ A;  2V53 A;  2ERB A;  3N7H A;  4FQO A;  3VRO A;  3SG4 A;  3R1V A;  1H8B A;  2KAY A;  3CZT X;  1QS7 A;  1KFX L;  2JT8 A;  1YUT A;  4YGD B;  1ALW A;  1CDM A;  2LLT A;  3PAT A;  3KF9 A;  5I2Q A;  1CDN A;  3TUY B;  1WDC B;  3BUX B;  1UP5 A;  2KI6 C;  2QPT A;  3GK2 A;  1B1G A;  1N0Y A;  1YUS A;  1YUU A;  1SY9 A;  5D3O A;  1J1E A;  3PFV A;  1EG4 A;  1XFR A;  1NX1 A;  2KOT A;  1N65 A;  3VRR A;  1S6J A;  1KK8 C;  2JPT A;  3BQ3 A;  2GTE A;  2M97 A;  2L4I A;  2AUC A;  4OCI A;  3SIB A;  1Y0V H;  2CTN A;  4ORB B;  5F6T A;  3B86 A;  1MHO A;  3OX5 A;  1XK4 C;  2G2B A;  2KNE A;  1BMO A;  2F2P A;  2L5X B;  4D1E A;  3D73 A;  2LLU A;  3KEV A;  1JUO A;  1OMR A;  4HRE E;  1F55 A;  1ALV A;  1PK0 D;  1OOH A;  2KI4 C;  1KFU L;  4GFT A;  1OZS A;  1U5I A;  2LAN A;  3AAJ A;  1WDC C;  3BUM B;  3S0E A;  2TN4 A;  3MSE B;  4GUK A;  3SS3 A;  3GOF A;  1F54 A;  1GGW A;  4I5N B;  1TNP A;  3B6X A;  4PCW A;  2JTZ A;  4INX A;  1DC1 A;  4JD9 A;  5DKQ A;  1S6I A;  1AJ5 A;  3I5I B;  3O4Y A;  2I7A A;  1A4P A;  1CLL A;  1N2D A;  1TNQ A;  1VRK A;  1Z2C B;  3BUO B;  1CNP A;  1XK4 A;  1KFU S;  5JOL A;  1LKJ A;  1LVC D;  4I5L B;  1IRJ A;  1LS8 A;  1FF1 A;  3VRQ A;  2ZRT A;  1SR6 C;  4XYN A;  2M8U A;  5CSJ A;  3TZ1 A;  2F2O A;  5I94 A;  1ZMZ A;  1OMV A;  2F8P A;  2LAP A;  2LVV A;  3BUW B;  4GGN A;  5G08 A;  2KYF A;  2K7O A;  4USL A;  4BY5 A;  1K90 D;  3OGN A;  1EXR A;  1SKT A;  4GNK B;  4XJK B;  5GQQ C;  1M31 A;  1B8C A;  4YI9 A;  1MR8 A;  5FI6 A;  1BR1 B;  2L0P A;  4HSZ A;  3SG2 A;  1IGV A;  2L98 A;  3JVT B;  1Y1X A;  1QX2 A;  2NCO A;  2KDH A;  1DQE A;  1RJV A;  1TWO A;  4HRH A;  3EKJ A;  1DVI A;  2I18 A;  2K0J A;  3JTD C;  4PE1 A;  2PAS A;  3EVR A;  1A75 B;  3CYZ A;  3RLZ A;  1BF5 A;  1XA5 A;  1M46 A;  2FOT A;  2M3W A;  2NXQ A;  2EHB A;  5HKZ A;  1CFF A;  2M1U A;  2BCB A;  3NSO A;  4ORA B;  1NP8 A;  2L5Y A;  1PAL A;  2RGI A;  1IJ5 A;  1GM0 A;  1IWQ A;  3R72 A;  3B7A A;  1UWO A;  2M1K B;  1RFJ A;  1XFW O;  3TDI A;  4I5J A;  1DJX A;  5AXI A;  4MZJ A;  1B8R A;  5D69 A;  1G4Y R;  1QTX A;  1OOG A;  1DJW A;  1CFD A;  1R6P A;  1DT7 B;  1IQ3 A;  5HLV A;  2BE4 A;  2ZN8 A;  2DOQ A;  1XFZ O;  2E30 A;  2M49 B;  3QRX A;  4GPL B;  2WCB A;  1SL7 A;  1BT6 A;  1TN4 A;  2H2K A;  3D10 A;  3TS5 C;  2MLE C;  1FPW A;  1E8A A;  1AHR A;  1B47 A;  1ORG A;  1SW8 A;  2JT0 A;  3EVU A;  3DVM A;  2GGM A;  1C7W A;  3CDN A;  2CNP A;  2WCM A;  1TTX A;  1PSR A;  2F33 A;  4YRU A;  1L2O C;  5AER A;  2KAX A;  2JPO A;  1TUZ A;  2KYC A;  1REC A;  2ZFD A;  1B8L A;  3AAK A;  2WCL A;  1UHJ A;  2LE9 B;  2L51 A;  1RWY A;  4MZL A;  3WNX B;  3S0D A;  1CKK A;  1BU3 A;  1PRW A;  1MXE A;  3D74 A;  1WLM A;  1IQ5 A;  1U5I B;  3CLN A;  4ETO A;  1WY9 A;  2KBI A;  5AFP A;  2H61 A;  1JSA A;  1WRL A;  2OTG C;  1W9Z A;  1YVL A;  2VRG A;  4M2P A;  1KK8 B;  1SSE B;  3D75 A;  4MVF A;  1QAS A;  2I2R E;  2K2A A;  2QEH A;  5D7F A;  2WOR A;  2KBM A;  1J7O A;  3BJH A;  5J3X A;  1HT9 A;  1DF0 A;  1M45 A;  1MUX A;  2LC5 A;  3OB2 B;  1QJT A;  3B88 A;  2KI4 B;  1ZFS A;  2LHI A;  4DRW A;  1SCV A;  2D8N A;  3DVJ A;  2Q4U A;  2M29 A;  1V1F A;  3OHM B;  1SPY A;  2E6W A;  1UHH A;  2MHH A;  5HKW A;  5K89 A;  2EGD A;  5FI2 A;  3FIA A;  4NDB A;  1KFX S;  2SAS A;  2KHN A;  3SJS A;  4R1E A;  2AAO A;  4MRX A;  3WHT B;  1YTZ C;  1NX2 A;  1RRO A;  2MAZ A;  5KU1 A;  4NDD A;  1S6C A;  3WXA A;  5BPJ A;  2A4J A;  2PQL A;  1DGU A;  1MWN A;  1TUJ A;  1SR6 B;  2JU0 A;  4YGA A;  2WC6 A;  4N1G A;  3SS5 A;  3SG3 A;  2Y5I A;  4INW A; 
#chains in the Genus database with same CATH homology
 2BEC A;  2I94 A;  3PM8 A;  1LIN A;  2LP3 A;  2M9G A;  3NSL A;  1H4B A;  1FBV A;  2LUC A;  2NLN A;  3GK4 X;  4CLN A;  2JUL A;  4A4C A;  3CR4 X;  3LK1 A;  4PE7 A;  1JF0 A;  4CPV A;  1KCY A;  4HRG A;  3ZNI A;  2CXJ A;  4PHK A;  4U8D A;  3A4U B;  3IQO A;  1G33 A;  1BG1 A;  1LXF C;  1YUR A;  1QX7 A;  2LM5 A;  1TRF A;  3JTD B;  1NX3 A;  2BBM A;  4ZCV A;  2AMI A;  1UHN A;  3O6B A;  1UHI A;  2HQW A;  2IS9 A;  2WCE A;  4GBA A;  1XO5 A;  4Q04 A;  1TCF A;  1MF8 B;  1S5G Z;  2KFG A;  3D0Y A;  1YX8 A;  2K8M B;  1SCM C;  1ODB A;  1CFP A;  4N1F A;  3BOW B;  4JWQ A;  3E3R A;  1OMD A;  1CTR A;  5AAN A;  2BL0 C;  1J55 A;  5DKR A;  2ZN9 A;  3KPX A;  4QJ5 B;  4C0L A;  3PSR A;  3NXA A;  1CFC A;  1DJZ A;  4YGE B;  2EC6 C;  2P6B B;  1PVA A;  1SNL A;  2JXC A;  2CT9 A;  3AKB A;  1WLZ A;  3TS5 B;  3C1V A;  4YGC B;  1B7T Z;  2KI6 D;  3BYA A;  4P2Y B;  1CM1 A;  1GQM A;  1KQM C;  2F3Z A;  1F4Q A;  2KSP A;  1TCO B;  2BE6 A;  1S3P A;  2PMY A;  5IBW A;  1L2O B;  2F3Y A;  4AQI A;  4BY4 A;  4ICB A;  4PE0 A;  1F4O A;  1KWO C;  3HX4 A;  2K7D A;  2K7C A;  4MSP A;  1DF0 B;  1LA3 A;  5CSF A;  3O2P A;  2MBX A;  1NX0 A;  1XYD A;  4F0Z B;  4YBH B;  1AP4 A;  1JF2 A;  2K61 A;  1W7J B;  2JOJ A;  3A8R A;  1XVJ A;  2BKH B;  3PLF B;  2OTG B;  2CBL A;  1CDP A;  2ZND A;  1S5G Y;  3OP0 A;  4M2Q A;  1CB1 A;  1EG3 A;  1NCY A;  2LVI A;  1EL4 A;  2KAV A;  3RM1 A;  1C7V A;  1PUL A;  1JFK A;  1X02 A;  2H61 C;  1JWD A;  1J1D A;  1CDL A;  1QVI Z;  2JWW A;  2K7B A;  2L2E A;  1F8H A;  1S26 D;  1YX7 A;  1RK9 A;  3IF7 A;  2M7L A;  1F70 A;  1YRT B;  4TNC A;  1B7T Y;  3EK8 A;  5KTY A;  1S36 A;  1XFU O;  1ZOT B;  4MZK A;  1S1E A;  4OVN F;  3VRP A;  2KFH A;  4PDZ A;  1KK7 Z;  3NSI A;  1TOP A;  5TNC A;  4CID A;  2B1U A;  2FJU B;  1QX5 B;  4PAL A;  2Y1M A;  1L7Z A;  2BBN A;  2HF5 A;  2KQY A;  1KSO A;  2Q91 A;  3SG7 A;  1NCX A;  4YGB B;  3O78 A;  1QLS A;  4WQ3 A;  4XJK A;  1J7P A;  4P5O E;  1QLK A;  1QXP A;  1NPQ A;  3CS1 A;  1A2X A;  1A03 A;  1XFV O;  4I5K A;  1J7R A;  3SIA A;  1OE9 B;  1QIW A;  5CSI A;  2Y1N A;  1B4C A;  1PVB A;  1BR4 B;  2PAL A;  1RTP 1;  3GK1 A;  5HYD A;  2LVJ A;  2WC8 A;  2OPO A;  1WRZ A;  1A75 A;  3OB1 B;  2M0R A;  5KSZ A;  3K21 A;  1UUS A;  2ZNE A;  2PSR A;  5B8I B;  2HET A;  5AEQ A;  1V1G A;  1IJ6 A;  1B9A A;  2LNK A;  3CR2 A;  4E68 A;  5I2O A;  1QVI Y;  1SL8 A;  4JQ0 D;  1DJY A;  4NQG A;  3BUN B;  1C07 A;  1A29 A;  2FCE A;  1FW4 A;  2MJW B;  3DF0 A;  3I5G B;  3LK0 A;  1JBA A;  1K95 A;  4GAO A;  1LA0 A;  1TNX A;  2JNF A;  4JPZ B;  5I8N A;  1K9U A;  1SCM B;  2LMU A;  3HCM A;  2OS8 B;  1IKU A;  1M39 A;  2JXL A;  3PAL A;  3H4S E;  1KK7 Y;  2MLF C;  1NSH A;  4PE4 A;  4A4B A;  1K9K A;  2BL0 B;  4YI8 A;  2JZI A;  3DD4 A;  4QJ4 B;  1OOJ A;  2WND A;  1DTL A;  1K2H A;  4MRY A;  5HKY A;  2ISD A;  4AQJ A;  2EC6 B;  2KFF A;  2LLS A;  5CPV A;  1FI6 A;  1GJY A;  2SCP A;  4MLW A;  4WQ2 A;  3LLE A;  2JC2 A;  1PSB A;  4NDC A;  1KSM A;  3I5F C;  3VGO A;  4L9M A;  3ZWH A;  1KQM B;  1K93 D;  1NCZ A;  3PN7 C;  5I2L A;  2O5G A;  3I5H C;  2LHL A;  2R2I A;  3DVE A;  3I5G C;  4MN0 A;  3EK7 A;  4OKH A;  4GGF C;  3FWB A;  1K96 A;  1R2U A;  4ORC B;  4CFR A;  1MQ1 A;  1KWO B;  1UUR A;  1BJF A;  4PHN A;  2OS8 C;  3TUY C;  1QIV A;  4WRI A;  2JT3 A;  1NYA A;  2WCF A;  1CLM A;  1IG5 A;  2JTT A;  4DUQ A;  1QAT A;  1SK6 D;  3EVV A;  4DIR A;  3SG5 A;  3IQQ A;  4GGF A;  4M2O A;  1M63 B;  3DVK A;  3OX6 A;  2COL B;  5ER4 X;  3BXK A;  1AK8 A;  3LCP C;  4IL1 A;  1Y6W A;  3VRN A;  2LP2 A;  3CTN A;  1Y1A A;  1SRA A;  3EK4 A;  1IH0 A;  4QJ3 B;  3AKA A;  2BKI B;  1CM4 A;  5PAL A;  2PVB A;  1F71 A;  1QV1 A;  1XFY O;  2HQ8 A;  1AVS A;  1YRU B;  2LV7 A;  1OQP A;  2MRD A;  1W7I B;  1QV0 A;  2JRF A;  3TDU A;  4C0J A;  4OV2 A;  3I5I C;  5DKN A;  3WHU B;  4MEW A;  1EH2 A;  3F45 A;  5ER5 A;  1TIZ A;  2KGR A;  2FCD A;  1OZO A;  2K2F A;  3SG6 A;  4MBE A;  4AOM A;  1BLQ A;  1YVH A;  1FI5 A;  1ZUZ A;  2LVK A;  5FYX A;  4DCK A;  1AUI B;  2L4H A;  1NIW A;  4ZCU A;  2GGZ A;  3CR5 X;  1AJ4 A;  3DF0 B;  1J7Q A;  4C0K A;  3M0W A;  4UPG A;  1EJ3 A;  1Q80 A;  1WRK A;  1Y1U A;  1D1O A;  2LMV A;  3FS7 A;  3NSK A;  1DMO A;  1SMG A;  2MA2 A;  1UHK A;  2LCP A;  2PRU A;  3CWG A;  2M7N A;  1DJG A;  3KO0 A;  5CSN A;  1K8U A;  1CMF A;  1K94 A;  1BOC A;  1KQV A;  2O60 A;  1SYM A;  3JVT C;  1DJI A;  2JNX A;  1NUB A;  1SBJ A;  3CGA A;  1SL9 A;  2G9B A;  3TDZ A;  1HQV A;  4DS7 A;  3LL8 B;  4N5X A;  1NWD A;  5HLO A;  2Y4Q A;  4FTG A;  2WOS A;  4OR9 B;  3BOW A;  1K9P A;  2QAC A;  1BOD A;  1DGV A;  2BCX A;  1JFJ A;  2GV5 A;  2CCM A;  2ZRS A;  1MXL C;  4PHJ A;  3FWC A;  2KQ6 A;  1G8I A;  2KGB C;  3D0Y B;  1OSA A;  1TNW A;  1CMG A;  3ICB A;  1XFX O;  2LMT A;  3KHE A;  1YR5 A;  2NZ0 A;  2LUX A;  2L50 A;  4PHM A;  3I5F B;  1JC2 A;  2NCP A;  4CFQ A;  3PN7 B;  3EKH A;  3I5H B;  1DJH A;  1ZAC A;  2HPS A;  2JQ6 A;  2ZKM X;  5JJG A;  1CLB A;  2BCA A;  1GGZ A;  2V53 A;  4FQO A;  3VRO A;  3SG4 A;  1H8B A;  2KAY A;  3CZT X;  1QS7 A;  1KFX L;  2JT8 A;  1YUT A;  4YGD B;  1ALW A;  1CDM A;  2LLT A;  3PAT A;  3KF9 A;  5I2Q A;  1CDN A;  3TUY B;  1WDC B;  3BUX B;  1UP5 A;  2KI6 C;  2QPT A;  3GK2 A;  1B1G A;  1N0Y A;  1YUS A;  1YUU A;  1SY9 A;  1J1E A;  3PFV A;  1EG4 A;  1NX1 A;  2KOT A;  1N65 A;  3VRR A;  1S6J A;  1KK8 C;  2JPT A;  3BQ3 A;  2M97 A;  2L4I A;  2AUC A;  4OCI A;  3SIB A;  1Y0V H;  2CTN A;  4ORB B;  5F6T A;  1MHO A;  3OX5 A;  1XK4 C;  2G2B A;  2KNE A;  1BMO A;  2F2P A;  2L5X B;  4D1E A;  2LLU A;  3KEV A;  1JUO A;  1OMR A;  4HRE E;  1F55 A;  1ALV A;  1PK0 D;  2KI4 C;  1KFU L;  4GFT A;  1OZS A;  1U5I A;  2LAN A;  3AAJ A;  1WDC C;  3BUM B;  2TN4 A;  3MSE B;  4GUK A;  1F54 A;  3GOF A;  1GGW A;  4I5N B;  1TNP A;  4PCW A;  2JTZ A;  5DKQ A;  1S6I A;  1AJ5 A;  3I5I B;  3O4Y A;  2I7A A;  1A4P A;  1CLL A;  1N2D A;  1TNQ A;  1VRK A;  3BUO B;  1CNP A;  1XK4 A;  1KFU S;  5JOL A;  1LKJ A;  1LVC D;  4I5L B;  1IRJ A;  1FF1 A;  3VRQ A;  2ZRT A;  1SR6 C;  4XYN A;  2M8U A;  5CSJ A;  3TZ1 A;  2F2O A;  1ZMZ A;  1OMV A;  2F8P A;  2LAP A;  2LVV A;  3BUW B;  4GGN A;  5G08 A;  2KYF A;  2K7O A;  4USL A;  4BY5 A;  1K90 D;  1EXR A;  1SKT A;  4GNK B;  4XJK B;  5GQQ C;  1M31 A;  1B8C A;  4YI9 A;  1MR8 A;  1BR1 B;  2L0P A;  4HSZ A;  3SG2 A;  1IGV A;  2L98 A;  3JVT B;  1Y1X A;  1QX2 A;  2NCO A;  2KDH A;  1RJV A;  4HRH A;  3EKJ A;  1DVI A;  2I18 A;  2K0J A;  3JTD C;  4PE1 A;  2PAS A;  3EVR A;  1A75 B;  3RLZ A;  1BF5 A;  1XA5 A;  1M46 A;  2FOT A;  2M3W A;  2NXQ A;  2EHB A;  5HKZ A;  1CFF A;  2M1U A;  2BCB A;  3NSO A;  4ORA B;  1NP8 A;  1PAL A;  2RGI A;  1IJ5 A;  1IWQ A;  1UWO A;  2M1K B;  1RFJ A;  1XFW O;  3TDI A;  4I5J A;  1DJX A;  5AXI A;  4MZJ A;  1B8R A;  5D69 A;  1G4Y R;  1QTX A;  1DJW A;  1CFD A;  1R6P A;  1DT7 B;  1IQ3 A;  5HLV A;  2BE4 A;  2ZN8 A;  2DOQ A;  1XFZ O;  2E30 A;  2M49 B;  3QRX A;  4GPL B;  2WCB A;  1SL7 A;  1BT6 A;  1TN4 A;  2H2K A;  3D10 A;  3TS5 C;  2MLE C;  1FPW A;  1E8A A;  1AHR A;  1B47 A;  1SW8 A;  2JT0 A;  3EVU A;  3DVM A;  2GGM A;  1C7W A;  2CNP A;  1TTX A;  1PSR A;  2F33 A;  4YRU A;  1L2O C;  5AER A;  2KAX A;  2KYC A;  1REC A;  2ZFD A;  1B8L A;  3AAK A;  1UHJ A;  2LE9 B;  2L51 A;  1RWY A;  4MZL A;  3WNX B;  1CKK A;  1BU3 A;  1PRW A;  1MXE A;  1WLM A;  1IQ5 A;  1U5I B;  3CLN A;  4ETO A;  1WY9 A;  2KBI A;  5AFP A;  2H61 A;  1JSA A;  1WRL A;  2OTG C;  4M2P A;  1YVL A;  2VRG A;  1KK8 B;  4MVF A;  1QAS A;  2I2R E;  2K2A A;  5D7F A;  2WOR A;  2KBM A;  1J7O A;  5J3X A;  1HT9 A;  1DF0 A;  1M45 A;  1MUX A;  2LC5 A;  3OB2 B;  1QJT A;  2KI4 B;  1ZFS A;  2LHI A;  4DRW A;  1SCV A;  2D8N A;  3DVJ A;  2Q4U A;  2M29 A;  1V1F A;  3OHM B;  1SPY A;  2E6W A;  1UHH A;  2MHH A;  5HKW A;  5K89 A;  2EGD A;  3FIA A;  4NDB A;  1KFX S;  2SAS A;  2KHN A;  3SJS A;  4R1E A;  2AAO A;  4MRX A;  3WHT B;  1YTZ C;  1NX2 A;  1RRO A;  2MAZ A;  5KU1 A;  4NDD A;  1S6C A;  3WXA A;  5BPJ A;  2A4J A;  1DGU A;  1MWN A;  1SR6 B;  2JU0 A;  4YGA A;  3SG3 A;  4N1G A;  2Y5I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...