1SL7A

Crystal structure of calcium-loaded apo-obelin from obelia longissima
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
173
structure length
173
Chain Sequence
TDFDNPRWIKRHKHMFDFLDINGNGKITLDEIVSKASDDICAKLEATPEQTKRHQVCVEAFFRGCGMEYGKEIAFPQFLDGWKQLATSELKKWARNEPTLIREWGDAVFDIFDKDGSGTITLDEWKAYGKISGISPSQEDCEATFRHCDLDDSGDLDVDEMTRQHLGFWYTLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Luminescent protein
molecule keywords Obelin
publication title All three Ca2+-binding loops of photoproteins bind calcium ions: The crystal structures of calcium-loaded apo-aequorin and apo-obelin.
pubmed doi rcsb
source organism Obelia longissima
total genus 65
structure length 173
sequence length 173
ec nomenclature
pdb deposition date 2004-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1sl7A00
1SMGA 2G9BA 2JT3A 4JPZB 1SCMC 1XK4C 1YVLA 3BUMB 2F3ZA 2KBMA 4GGFC 5HLOA 1XFWO 2L0PA 1V1GA 2KDHA 2TN4A 1AJ4A 1Y1AA 1XFYO 1JFKA 1RFJA 1DJYA 1WDCB 1UUSA 1UHIA 2O60A 4JWQA 1OSAA 1QXPA 4I5NB 2PMYA 4YGCB 1A2XA 1TCFA 1ODBA 3K21A 1XFUO 3IQQA 4NDCA 1DT7B 3KO0A 2RGIA 4YBHB 4MZKA 1BMOA 2MLEC 3BUNB 3VRQA 4MLWA 1K90D 3RLZA 4HRGA 1UP5A 2F8PA 2KNEA 2M1UA 2WCEA 2K7DA 2LHIA 4ETOA 1Y0VH 1ZUZA 3BQ3A 5DKNA 1K2HA 1J1DA 1BJFA 1FBVA 3GK2A 5D7FA 1CLLA 2PSRA 1GGWA 1XK4A 4GGFA 1BG1A 4PDZA 1GQMA 3AKBA 3BOWB 2KFGA 1YRTB 4U8DA 1JSAA 5AERA 4HREE 1LINA 1M46A 4MRXA 5K89A 2KGBC 1MXLC 1NX3A 3SJSA 2KSPA 2KYFA 4AQIA 1KK7Z 2JXLA 3LLEA 4DRWA 1CMFA 3QRXA 4YGDB 3CWGA 1Y1XA 1NPQA 1G4YR 1YX8A 2WORA 4GBAA 2JU0A 2LAPA 3BXKA 2JQ6A 3OX6A 1K96A 4L9MA 2LNKA 4GAOA 1N65A 1XFVO 2ZN9A 3JTDC 4I5LB 1MF8B 1NUBA 3TUYC 2CXJA 2HF5A 1YUSA 2L4IA 4MRYA 5HKZA 2WCFA 1BR4B 1DF0B 1KFUS 2O5GA 1B8LA 3CLNA 1UHNA 3GK1A 1WY9A 4MZJA 1MR8A 3PATA 2ZFDA 3VRNA 1B9AA 2AAOA 1TNWA 4GPLB 2WC8A 1SR6C 2MA2A 1S5GY 2LLUA 3VRPA 1AK8A 1YRUB 1IWQA 5F6TA 1MWNA 1SK6D 2KI4B 2JNFA 1SL9A 4M2PA 4PE4A 4AOMA 1IRJA 1LVCD 1QJTA 1BT6A 1Y1UA 1TTXA 2M8UA 3DF0A 1SPYA 1AHRA 1A29A 3I5IC 3TZ1A 1U5IB 2K2FA 1J7QA 3PFVA 3I5HB 5AXIA 3JVTB 2D8NA 1DMOA 4OVNF 3WNXB 1CLBA 1NYAA 1GGZA 2LMVA 3O2PA 2FCEA 2Y5IA 4GGNA 3HX4A 3D0YB 3SG7A 1DJWA 3SIAA 1EL4A 1TIZA 4CPVA 4MZLA 2BL0B 2BBMA 1FW4A 3VROA 1RK9A 1YTZC 1AJ5A 2BKHB 4PHMA 2ZNDA 4ZCVA 3SG2A 1KWOB 3TS5B 4DUQA 4YGBB 4XJKB 3O4YA 2MRDA 2K0JA 1NIWA 2I18A 2K7BA 5KTYA 2SCPA 1B1GA 2A4JA 2KI6D 1KQMB 2PRUA 2WCBA 1SL7A 2CBLA 3H4SE 2EC6C 1QIWA 2M9GA 2AMIA 2I2RE 1TNPA 4OCIA 1PSRA 2LVVA 4BY4A 3CR4X 1C7VA 1J7RA 1SW8A 2OTGC 4QJ5B 3CR2A 1TNQA 3CR5X 2JOJA 3SG4A 1N0YA 4C0LA 1XYDA 5DKQA 1QV1A 2Y1NA 1N2DA 2KQ6A 2EHBA 4ZCUA 2JTZA 1J55A 4HRHA 2F2PA 4PE1A 1E8AA 1F4QA 1QX5B 3BUXB 3EK8A 1R6PA 3E3RA 1JF2A 1DGUA 1B4CA 1DF0A 4A4CA 3NSKA 1EJ3A 2R2IA 3PM8A 1DJHA 3I5HC 3CTNA 1F4OA 1CKKA 1IJ5A 5IBWA 1CM4A 2M1KB 2JPTA 2GGZA 3FS7A 5ER5A 1QX2A 2MJWB 1XA5A 2BL0C 2JZIA 1UHKA 1NSHA 3EVVA 1C07A 3LK1A 2ZRSA 1MHOA 3EVRA 1B8RA 4PALA 1DJXA 4NQGA 3DD4A 2ISDA 4P5OE 2HQWA 2KGRA 3BUWB 1EG3A 1JBAA 2H61C 3PN7B 5CSJA 1D1OA 1RJVA 3DVMA 4C0JA 1L2OB 2LM5A 1DVIA 2KBIA 1RROA 1V1FA 4A4BA 4I5KA 1CLMA 2JT8A 2M97A 1TCOB 1WLZA 1HQVA 1J1EA 3OHMB 3PALA 2SASA 3I5FB 1ALWA 1XFXO 2PVBA 4YI8A 1J7PA 5JOLA 1A75B 1ZFSA 3D0YA 2EGDA 5CSNA 4NDBA 3OP0A 1H4BA 1QASA 4FTGA 1YURA 1NCZA 4MSPA 1WDCC 2KHNA 1CFPA 1K9UA 3BYAA 4PE7A 4WRIA 4MN0A 4MEWA 2H61A 2K8MB 1KCYA 1ZMZA 1KQVA 1OMVA 1PSBA 1QVIY 3A4UB 1KFXL 3C1VA 4HSZA 3GOFA 3KEVA 1CB1A 2LV7A 2GV5A 2Y1MA 1F55A 1K9PA 4WQ2A 2WOSA 5HKYA 3TDIA 2HETA 3KHEA 4DS7A 2LMTA 3BUOB 2CNPA 3FIAA 2MBXA 1CFDA 3FWCA 4DCKA 3PN7C 1SY9A 4N1FA 1IKUA 1BR1B 3AAJA 2L50A 3WXAA 2F3YA 3I5GB 1S6IA 2LUCA 4PHKA 3IQOA 4CLNA 1MXEA 2E30A 2JT0A 1S3PA 2M29A 1LA0A 3I5FC 4ORCB 2ZKMX 1H8BA 1B7TY 2COLB 2CTNA 5KSZA 1DTLA 4Q04A 2FOTA 3IF7A 1JC2A 1OMRA 1ALVA 3OB2B 4YI9A 2Q4UA 3SG6A 1Y6WA 1FPWA 1DJZA 1IG5A 2LVIA 1B8CA 1DJGA 1K93D 2VRGA 1QS7A 2Y4QA 1SBJA 3D10A 1SCMB 2E6WA 2KOTA 3F45A 1CDPA 2LANA 1X02A 1YVHA 4YGEB 1W7JB 1S1EA 2IS9A 2L51A 3O78A 1BF5A 5AANA 1CDNA 1S5GZ 1BOCA 1K9KA 3BOWA 2G2BA 3EKHA 5I8NA 3HCMA 2LMUA 2QPTA 4BY5A 1UURA 2L5XB 1JWDA 1OZOA 1JF0A 4PHNA 1AVSA 5TNCA 1XO5A 2JC2A 1A03A 2AUCA 2M49B 3DVKA 2KAXA 2JULA 4I5JA 1IGVA 5DKRA 3VGOA 1B7TZ 2KI4C 1ZOTB 2ZRTA 4MBEA 2I7AA 2LHLA 1BLQA 1TN4A 1QLSA 1S6CA 5BPJA 1TNXA 4CFQA 2BCBA 2KAVA 1J7OA 1PVBA 3EK7A 1EH2A 1RWYA 1XVJA 1M31A 1M39A 2LLSA 2BKIB 4ORBB 4CFRA 3KF9A 4DIRA 5G08A 2P6BB 3JVTC 3PLFB 1F54A 5HYDA 4XYNA 1EXRA 2BE4A 1RECA 2K7OA 1CDMA 1PVAA 3EVUA 1DGVA 3AKAA 3SG3A 2FCDA 1MUXA 1KK8B 3TS5C 1OOJA 1KWOC 1SNLA 1KFXS 1TOPA 5CPVA 1G8IA 1YUUA 5I2LA 3ICBA 3LL8B 4D1EA 1YUTA 1KQMC 1Q80A 3OX5A 1NX1A 1IQ3A 1NX0A 2JTTA 1KK7Y 2WNDA 3JTDB 1QX7A 2K2AA 3DF0B 3TUYB 5AFPA 5JJGA 4CIDA 5HKWA 2LP2A 1KSMA 5GQQC 1SL8A 1U5IA 1BODA 2HPSA 2KFFA 2KFHA 1F71A 3OB1B 2GGMA 1AUIB 3MSEB 4OV2A 2MHHA 3SG5A 1GJYA 1NP8A 1S26D 3NSOA 2MAZA 4P2YB 4QJ3B 4TNCA 3WHUB 1LKJA 2BE6A 1SR6B 3O6BA 1XFZO 2L98A 1F8HA 4N5XA 4PCWA 3WHTB 1S36A 1CFCA 2M3WA 2PALA 4XJKA 2M0RA 1FI5A 1SYMA 3CGAA 4USLA 3NXAA 4NDDA 1VRKA 1TRFA 1EG4A 1YX7A 1SRAA 1JFJA 2K61A 1QTXA 1LXFC 4PE0A 1W7IB 3VRRA 4C0KA 4YRUA 4UPGA 1AP4A 3I5IB 2PASA 1KK8C 2KQYA 2L4HA 4WQ3A 2LVKA 2JRFA 1BU3A 1OMDA 2OS8B 1WRKA 3CZTX 1L7ZA 5ER4X 1K8UA 4PHJA 1NCXA 1WRZA 1S6JA 2Q91A 2FJUB 4QJ4B 2DOQA 4FQOA 4R1EA 2LC5A 1QIVA 1L2OC 1PULA 3RM1A 1UHHA 2LVJA 2MLFC 1B47A 2JXCA 2BECA 3LCPC 1ZACA 2EC6B 1NWDA 2F33A 3LK0A 2F2OA 3SIBA 1K94A 3TDZA 1A4PA 1LA3A 3M0WA 1WLMA 2BCAA 2OTGB 3FWBA 2CCMA 1OZSA 3DVEA 1HT9A 1QVIZ 4JQ0D 1K95A 5CSIA 4AQJA 5B8IB 1CNPA 1NX2A 4GFTA 2B1UA 2M7NA 4ORAB 3TDUA 4M2QA 1UHJA 2I94A 1QV0A 1NCYA 2KAYA 2LCPA 1IQ5A 1PK0D 3KPXA 2QACA 1M63B 2M7LA 3NSLA 1KSOA 1CFFA 1PRWA 5HLVA 2H2KA 5CSFA 3A8RA 1YR5A 2KI6C 5I2QA 3EK4A 5D69A 5J3XA 1FF1A 1MQ1A 4GNKB 2NLNA 1CDLA 2NZ0A 2OPOA 2OS8C 1QATA 4OKHA 2NCOA 2ZN8A 5FYXA 1R2UA 1CTRA 2LUXA 4IL1A 4E68A 1CM1A 2L2EA 2NXQA 4OR9B 3AAKA 4MVFA 4F0ZB 3EKJA 3GK4X 2CT9A 2JNXA 1UWOA 2V53A 1OE9B 1OQPA 1A75A 2BBNA 4GUKA 2LP3A 1RTP1 1KFUL 4M2OA 3PSRA 2JWWA 5PALA 3DVJA 1DJIA 1QLKA 1SKTA 3I5GC 4N1GA 1IJ6A 2K7CA 2LE9B 3NSIA 1IH0A 1WRLA 2HQ8A 1C7WA 1FI6A 2KYCA 1CMGA 1SCVA 1M45A 5KU1A 1JUOA 2BCXA 1PALA 1G33A 5AEQA 4YGAA 2ZNEA 3ZNIA 3ZWHA 2NCPA 2LLTA 3CS1A 4ICBA 1F70A 5I2OA
chains in the Genus database with same CATH superfamily
1SMGA 2G9BA 2JT3A 3S0AA 4JPZB 1SCMC 1XK4C 1YVLA 3BUMB 1DEKA 2F3ZA 2KBMA 4GGFC 5HLOA 1XFWO 2L0PA 1V1GA 2KDHA 2TN4A 1AJ4A 1Y1AA 1XFYO 1JFKA 1RFJA 1DJYA 3DYEA 1WDCB 1UUSA 1UHIA 2O60A 4JWQA 1OSAA 1QXPA 1DC1A 4I5NB 2PMYA 4YGCB 1A2XA 1TCFA 1ODBA 3K21A 1XFUO 3IQQA 4NDCA 1DT7B 3KO0A 2RGIA 4YBHB 4MZKA 1BMOA 2MLEC 3BUNB 3VRQA 4MLWA 1K90D 3RLZA 4HRGA 3OBVA 1UP5A 2F8PA 2KNEA 2M1UA 2WCEA 2K7DA 2LHIA 4ETOA 3OGNA 1Y0VH 1ZUZA 3BQ3A 5DKNA 1K2HA 1J1DA 1BJFA 1FBVA 3GK2A 5D7FA 1CLLA 2PSRA 1GGWA 5EL2A 1XK4A 4GGFA 3BFHA 1BG1A 4PDZA 1GQMA 3AKBA 3BOWB 2KFGA 1YRTB 2WCHA 4U8DA 1JSAA 5AERA 4HREE 1LINA 1M46A 4MRXA 5K89A 2QDIA 2L2CA 2KGBC 1MXLC 1GM0A 1NX3A 3SJSA 2KSPA 2KYFA 4AQIA 1KK7Z 2JXLA 3LLEA 4DRWA 1CMFA 3QRXA 4YGDB 3CWGA 1Y1XA 1NPQA 1G4YR 1YX8A 2WORA 4GBAA 1OOIX 2JU0A 2LAPA 3BXKA 2JQ6A 3OX6A 1K96A 4L9MA 5D3OA 2LNKA 4GAOA 1N65A 1XFVO 2ZN9A 3JTDC 3R1VA 4I5LB 1MF8B 1NUBA 4FQTA 3TUYC 2CXJA 2HF5A 1YUSA 2L4IA 4MRYA 5HKZA 2WCFA 1BR4B 1DF0B 1KFUS 2O5GA 4INXA 1B8LA 3CLNA 1UHNA 2QEHA 3GK1A 3SS3A 1WY9A 4MZJA 1XFRA 2GTEA 1MR8A 3PATA 1QWVA 2ZFDA 3VRNA 1B9AA 2AAOA 1P28A 1TNWA 4GPLB 2WC8A 1SR6C 2MA2A 1S5GY 2LLUA 3VRPA 1AK8A 1YRUB 1IWQA 5F6TA 1MWNA 1SK6D 2KI4B 2JNFA 1SL9A 1C3ZA 4M2PA 4PE4A 3SS4A 4AOMA 1IRJA 1LVCD 1QJTA 1BT6A 1Y1UA 1TTXA 2H8VA 2M8UA 3DF0A 1SPYA 1AHRA 1A29A 3I5IC 3TZ1A 1U5IB 3PM2A 2L5YA 2K2FA 1J7QA 3PFVA 3I5HB 5AXIA 3JVTB 2D8NA 2WC5A 1DMOA 4OVNF 3D75A 3WNXB 1CLBA 1NYAA 1GGZA 2LMVA 3O2PA 2FCEA 2Y5IA 4GGNA 3HX4A 5I94A 3D0YB 3SG7A 1DJWA 1ORGA 3SIAA 1EL4A 1TIZA 4CPVA 4MZLA 2BL0B 2BBMA 1FW4A 3VROA 1RK9A 1YTZC 1AJ5A 2BKHB 4PHMA 2ZNDA 4ZCVA 3SG2A 1KWOB 3TS5B 4DUQA 4YGBB 4XJKB 3O4YA 2MRDA 2K0JA 1NIWA 2I18A 2K7BA 2QEVA 5KTYA 2SCPA 1B1GA 2A4JA 2KI6D 1KQMB 2PRUA 2WCBA 1SL7A 2CBLA 3H4SE 2EC6C 1QIWA 2M9GA 2AMIA 2I2RE 1TNPA 4OCIA 2PYQA 1PSRA 2LVVA 4BY4A 3CR4X 1C7VA 1J7RA 1SW8A 2OTGC 4QJ5B 3CR2A 1TNQA 3CR5X 2JOJA 3SG4A 1N0YA 4C0LA 1XYDA 5DKQA 1QV1A 2Y1NA 3FE9A 1N2DA 4F7FA 2KQ6A 2EHBA 4ZCUA 3D74A 2JTZA 1J55A 4HRHA 2WCKA 2F2PA 4PE1A 1E8AA 1F4QA 1QX5B 3BUXB 3EK8A 1R6PA 5FI7A 3E3RA 1JF2A 1DGUA 1B4CA 1DF0A 4A4CA 2BNXA 1EJ3A 2R2IA 1DELA 1DJHA 3I5HC 3NSKA 3CTNA 2BAPA 3PM8A 1F4OA 1CKKA 1IJ5A 5IBWA 1CM4A 2M1KB 2JPTA 3N7HA 2GGZA 3FS7A 2JPOA 4OZDA 5ER5A 1QX2A 2MJWB 1XA5A 2BL0C 2JZIA 1UHKA 1NSHA 3EVVA 1C07A 3NGVA 3EG5B 3LK1A 2ZRSA 1MHOA 3EVRA 2KLDA 5FI6A 1B8RA 4PALA 1DJXA 4NQGA 3CYZA 3DD4A 2ISDA 2PQLA 3FE8A 4P5OE 2HQWA 2KGRA 3BUWB 1EG3A 1JBAA 2H61C 3PN7B 5CSJA 2ERBA 1D1OA 1RJVA 3DVMA 4C0JA 1L2OB 2LM5A 1DVIA 2KBIA 1RROA 1V1FA 4A4BA 4I5KA 1CLMA 2JT8A 2M97A 1TCOB 1WLZA 1HQVA 1J1EA 3DXLA 3OHMB 3PALA 2SASA 3I5FB 1ALWA 3BFAA 1TUJA 1XFXO 2PVBA 4YI8A 1J7PA 5JOLA 1A75B 1ZFSA 3D0YA 2EGDA 3Q8IA 5CSNA 4NDBA 3OP0A 1H4BA 1QASA 4FTGA 1YURA 1NCZA 4MSPA 1WDCC 2KHNA 1CFPA 3BFBA 1K9UA 3BYAA 4PE7A 3S0GA 3DY9A 4WRIA 3L47A 4MN0A 4MEWA 5DICA 2H61A 2K8MB 1KCYA 1ZMZA 1KQVA 1OMVA 1PSBA 1QVIY 3A4UB 1KFXL 3C1VA 4HSZA 3GOFA 3KEVA 3R1OA 1CB1A 2LV7A 2GV5A 2Y1MA 1F55A 3D77A 1K9PA 4WQ2A 2WOSA 3S0FA 5HKYA 3TDIA 5HL1A 2HETA 4INWA 1OOHA 3KHEA 4DS7A 2LMTA 3BUOB 2CNPA 3D73A 3FIAA 1CFDA 3FWCA 2MBXA 4DCKA 3PN7C 1SY9A 2QEBA 4N1FA 2FJYA 3V2LA 4IJ7A 1BR1B 1IKUA 1SSEB 3AAJA 2L50A 3WXAA 2F3YA 3I5GB 1S6IA 1TUZA 2LUCA 3IQOA 4PHKA 4CLNA 1MXEA 2E30A 3UO9A 2JT0A 3CDNA 1W9ZA 1S3PA 2M29A 1LA0A 3I5FC 4ORCB 2ZKMX 1H8BA 1B7TY 2COLB 2CTNA 5KSZA 2WC6A 1DTLA 4Q04A 2FOTA 3IF7A 1JC2A 1OMRA 1ALVA 3OB2B 4YI9A 2Q4UA 3SG6A 1Y6WA 1FPWA 1DJZA 1IG5A 2LVIA 1B8CA 1DJGA 2WCJA 1K93D 2VRGA 1QS7A 2P71A 1SBJA 2Y4QA 3D10A 1SCMB 2E6WA 2KOTA 3F45A 1CDPA 2LANA 1X02A 1YVHA 4YGEB 1W7JB 1S1EA 2IS9A 2L51A 3O78A 1BF5A 5AANA 1CDNA 3B7AA 1S5GZ 3K1EA 1K9KA 1BOCA 3BOWA 3PJIA 2G2BA 3EKHA 5I8NA 3HCMA 1IIOA 2LMUA 2QPTA 3IVTA 4BY5A 1UURA 2L5XB 1JWDA 1OZOA 1JF0A 4PHNA 1AVSA 5TNCA 1XO5A 2JC2A 3NHIA 1A03A 2AUCA 2M49B 2WCLA 1TWOA 3DVKA 2KAXA 2JULA 4I5JA 3L4LA 1Z4HA 1IGVA 5DKRA 3VGOA 3B6XA 1B7TZ 2KI4C 1ZOTB 2ZRTA 4MBEA 2I7AA 2LHLA 1BLQA 1TN4A 1QLSA 1S6CA 3DZTA 5BPJA 1TNXA 4CFQA 2BCBA 3S0DA 2KAVA 1J7OA 1PVBA 3EK7A 1EH2A 2KPHA 1RWYA 1XVJA 1M31A 1M39A 2LLSA 2BKIB 4ORBB 4PT1A 4CFRA 3KF9A 3CZ0A 2KLEA 4DIRA 5G08A 2P6BB 3JVTC 3PLFB 1F54A 5HYDA 4XYNA 1EXRA 2BE4A 1RECA 3D78A 3QMEA 2K7OA 3R72A 1CDMA 1PVAA 3EVUA 1DGVA 3AKAA 3SG3A 2FCDA 1MUXA 1KK8B 3TS5C 1OOJA 1KWOC 1SNLA 1KFXS 1TOPA 3S0EA 5CPVA 1G8IA 1YUUA 5I2LA 3ICBA 3LL8B 4D1EA 1YUTA 1KQMC 1Q80A 3OX5A 1NX1A 1IQ3A 1NX0A 2JTTA 1KK7Y 2WNDA 3JTDB 1QX7A 2K2AA 3DF0B 3TUYB 5AFPA 5JJGA 3D76A 4CIDA 5HKWA 2LP2A 1KSMA 5GQQC 1SL8A 1U5IA 3B86A 1BODA 2HPSA 2KFFA 2KFHA 1F71A 3OB1B 2GGMA 1AUIB 3MSEB 4OV2A 2MHHA 3SG5A 1GJYA 1NP8A 1S26D 3NSOA 1OOGA 2MAZA 4P2YB 2WCMA 4QJ3B 2QEOA 4TNCA 3WHUB 1LKJA 4JD9A 2BE6A 1SR6B 3CZ2A 3O6BA 1OOFA 1XFZO 2L98A 4N5XA 1F8HA 1C3YA 4PCWA 3WHTB 1S36A 1CFCA 2M3WA 2PALA 2YGUA 4XJKA 2M0RA 2P70A 3R1PA 3S0BA 1FI5A 1SYMA 3CGAA 4USLA 3NXAA 4NDDA 1VRKA 1TRFA 1EG4A 1YX7A 1SRAA 1JFJA 2K61A 1QTXA 1LXFC 4PE0A 1W7IB 3VRRA 4C0KA 4YRUA 4UPGA 1AP4A 3I5IB 2PASA 1KK8C 2KQYA 2L4HA 4WQ3A 2LVKA 2JRFA 1BU3A 1OMDA 2OS8B 3SS5A 1WRKA 3CZTX 1L7ZA 5ER4X 1K8UA 4PHJA 1NCXA 1WRZA 1S6JA 2Q91A 2FJUB 4QJ4B 2DOQA 4FQOA 4R1EA 2LC5A 1QIVA 1L2OC 1PULA 3RM1A 1UHHA 1Z2CB 2LVJA 2MLFC 1B47A 2JXCA 2BECA 3LCPC 1ZACA 2EC6B 1NWDA 2F33A 3LK0A 2F2OA 3SIBA 1K94A 3TDZA 1A4PA 1LA3A 3M0WA 1WLMA 2BCAA 3B87A 3O4XA 2OTGB 3FWBA 3VB1A 2CCMA 1OZSA 3DVEA 1HT9A 1QVIZ 4JQ0D 1K95A 4KYNA 5CSIA 4AQJA 5B8IB 1CNPA 1NX2A 1LS8A 4GFTA 2B1UA 2M7NA 4ORAB 3TDUA 4M2QA 1UHJA 4JKTA 2I94A 1QV0A 1NCYA 2KAYA 2LCPA 1IQ5A 3UNWA 1PK0D 3KPXA 2QACA 1M63B 2M7LA 3NSLA 1KSOA 1OW4A 1PRWA 1CFFA 5HLVA 2H2KA 5CSFA 3A8RA 1YR5A 2KI6C 1DQEA 3EK4A 5I2QA 3RZSA 5D69A 5J3XA 1FF1A 1MQ1A 4GNKB 2NLNA 1CDLA 2NZ0A 2OPOA 2OS8C 1QATA 4OKHA 2NCOA 2ZN8A 5FYXA 1R2UA 1CTRA 2LUXA 4IL1A 4E68A 1CM1A 2L2EA 2NXQA 4OR9B 3AAKA 3BJHA 4MVFA 4F0ZB 3EKJA 3GK4X 2CT9A 2JNXA 1UWOA 2V53A 1OE9B 1OQPA 1A75A 2BBNA 2K60A 3CABA 4GUKA 2LP3A 1RTP1 1KFUL 4M2OA 3PSRA 2JWWA 5FI2A 1T14A 3DVJA 5PALA 1DJIA 1QLKA 1SKTA 3I5GC 4N1GA 1IJ6A 3CZ1A 2K7CA 2LE9B 3NSIA 1IH0A 1WRLA 2HQ8A 1C7WA 1FI6A 3B88A 2KYCA 1CMGA 1SCVA 1M45A 5KU1A 1JUOA 2BCXA 1PALA 1G33A 5AEQA 4YGAA 2ZNEA 3ZNIA 3ZWHA 2NCPA 2LLTA 3CS1A 3NHTA 4ICBA 3L4AA 1F70A 3FE6A 5I2OA
chains in the Genus database with same CATH topology
1SMGA 2G9BA 2JT3A 4JPZB 1SCMC 1XK4C 1YVLA 3BUMB 2F3ZA 2KBMA 4GGFC 5HLOA 1XFWO 2L0PA 1V1GA 2KDHA 2TN4A 1AJ4A 1Y1AA 1XFYO 1JFKA 1RFJA 1DJYA 1WDCB 1UUSA 1UHIA 2O60A 4JWQA 1OSAA 1QXPA 4I5NB 2PMYA 4YGCB 1A2XA 1TCFA 1ODBA 3K21A 1XFUO 3IQQA 4NDCA 1DT7B 3KO0A 2RGIA 4YBHB 4MZKA 1BMOA 2MLEC 3BUNB 3VRQA 4MLWA 1K90D 3RLZA 4HRGA 1UP5A 2F8PA 2KNEA 2M1UA 2WCEA 2K7DA 2LHIA 4ETOA 1Y0VH 1ZUZA 3BQ3A 5DKNA 1K2HA 1J1DA 1BJFA 1FBVA 3GK2A 5D7FA 1CLLA 2PSRA 1GGWA 1XK4A 4GGFA 1BG1A 4PDZA 1GQMA 3AKBA 3BOWB 2KFGA 1YRTB 4U8DA 1JSAA 5AERA 4HREE 1LINA 1M46A 4MRXA 5K89A 2KGBC 1MXLC 1NX3A 3SJSA 2KSPA 2KYFA 4AQIA 1KK7Z 2JXLA 3LLEA 4DRWA 1CMFA 3QRXA 4YGDB 3CWGA 1Y1XA 1NPQA 1G4YR 1YX8A 2WORA 4GBAA 2JU0A 2LAPA 3BXKA 2JQ6A 3OX6A 1K96A 4L9MA 2LNKA 4GAOA 1N65A 1XFVO 2ZN9A 3JTDC 4I5LB 1MF8B 1NUBA 3TUYC 2CXJA 2HF5A 1YUSA 2L4IA 4MRYA 5HKZA 2WCFA 1BR4B 1DF0B 1KFUS 2O5GA 1B8LA 3CLNA 1UHNA 3GK1A 1WY9A 4MZJA 1MR8A 3PATA 2ZFDA 3VRNA 1B9AA 2AAOA 1TNWA 4GPLB 2WC8A 1SR6C 2MA2A 1S5GY 2LLUA 3VRPA 1AK8A 1YRUB 1IWQA 5F6TA 1MWNA 1SK6D 2KI4B 2JNFA 1SL9A 4M2PA 4PE4A 4AOMA 1IRJA 1LVCD 1QJTA 1BT6A 1Y1UA 1TTXA 2M8UA 3DF0A 1SPYA 1AHRA 1A29A 3I5IC 3TZ1A 1U5IB 2K2FA 1J7QA 3PFVA 3I5HB 5AXIA 3JVTB 2D8NA 1DMOA 4OVNF 3WNXB 1CLBA 1NYAA 1GGZA 2LMVA 3O2PA 2FCEA 2Y5IA 4GGNA 3HX4A 3D0YB 3SG7A 1DJWA 3SIAA 1EL4A 1TIZA 4CPVA 4MZLA 2BL0B 2BBMA 1FW4A 3VROA 1RK9A 1YTZC 1AJ5A 2BKHB 4PHMA 2ZNDA 4ZCVA 3SG2A 1KWOB 3TS5B 4DUQA 4YGBB 4XJKB 3O4YA 2MRDA 2K0JA 1NIWA 2I18A 2K7BA 5KTYA 2SCPA 1B1GA 2A4JA 2KI6D 1KQMB 2PRUA 2WCBA 1SL7A 2CBLA 3H4SE 2EC6C 1QIWA 2M9GA 2AMIA 2I2RE 1TNPA 4OCIA 1PSRA 2LVVA 4BY4A 3CR4X 1C7VA 1J7RA 1SW8A 2OTGC 4QJ5B 3CR2A 1TNQA 3CR5X 2JOJA 3SG4A 1N0YA 4C0LA 1XYDA 5DKQA 1QV1A 2Y1NA 1N2DA 2KQ6A 2EHBA 4ZCUA 2JTZA 1J55A 4HRHA 2F2PA 4PE1A 1E8AA 1F4QA 1QX5B 3BUXB 3EK8A 1R6PA 3E3RA 1JF2A 1DGUA 1B4CA 1DF0A 4A4CA 3NSKA 1EJ3A 2R2IA 3PM8A 1DJHA 3I5HC 3CTNA 1F4OA 1CKKA 1IJ5A 5IBWA 1CM4A 2M1KB 2JPTA 2GGZA 3FS7A 5ER5A 1QX2A 2MJWB 1XA5A 2BL0C 2JZIA 1UHKA 1NSHA 3EVVA 1C07A 3LK1A 2ZRSA 1MHOA 3EVRA 1B8RA 4PALA 1DJXA 4NQGA 3DD4A 2ISDA 4P5OE 2HQWA 2KGRA 3BUWB 1EG3A 1JBAA 2H61C 3PN7B 5CSJA 1D1OA 1RJVA 3DVMA 4C0JA 1L2OB 2LM5A 1DVIA 2KBIA 1RROA 1V1FA 4A4BA 4I5KA 1CLMA 2JT8A 2M97A 1TCOB 1WLZA 1HQVA 1J1EA 3OHMB 3PALA 2SASA 3I5FB 1ALWA 1XFXO 2PVBA 4YI8A 1J7PA 5JOLA 1A75B 1ZFSA 3D0YA 2EGDA 5CSNA 4NDBA 3OP0A 1H4BA 1QASA 4FTGA 1YURA 1NCZA 4MSPA 1WDCC 2KHNA 1CFPA 1K9UA 3BYAA 4PE7A 4WRIA 4MN0A 4MEWA 2H61A 2K8MB 1KCYA 1ZMZA 1KQVA 1OMVA 1PSBA 1QVIY 3A4UB 1KFXL 3C1VA 4HSZA 3GOFA 3KEVA 1CB1A 2LV7A 2GV5A 2Y1MA 1F55A 1K9PA 4WQ2A 2WOSA 5HKYA 3TDIA 2HETA 3KHEA 4DS7A 2LMTA 3BUOB 2CNPA 3FIAA 2MBXA 1CFDA 3FWCA 4DCKA 3PN7C 1SY9A 4N1FA 1IKUA 1BR1B 3AAJA 2L50A 3WXAA 2F3YA 3I5GB 1S6IA 2LUCA 4PHKA 3IQOA 4CLNA 1MXEA 2E30A 2JT0A 1S3PA 2M29A 1LA0A 3I5FC 4ORCB 2ZKMX 1H8BA 1B7TY 2COLB 2CTNA 5KSZA 1DTLA 4Q04A 2FOTA 3IF7A 1JC2A 1OMRA 1ALVA 3OB2B 4YI9A 2Q4UA 3SG6A 1Y6WA 1FPWA 1DJZA 1IG5A 2LVIA 1B8CA 1DJGA 1K93D 2VRGA 1QS7A 2Y4QA 1SBJA 3D10A 1SCMB 2E6WA 2KOTA 3F45A 1CDPA 2LANA 1X02A 1YVHA 4YGEB 1W7JB 1S1EA 2IS9A 2L51A 3O78A 1BF5A 5AANA 1CDNA 1S5GZ 1BOCA 1K9KA 3BOWA 2G2BA 3EKHA 5I8NA 3HCMA 2LMUA 2QPTA 4BY5A 1UURA 2L5XB 1JWDA 1OZOA 1JF0A 4PHNA 1AVSA 5TNCA 1XO5A 2JC2A 1A03A 2AUCA 2M49B 3DVKA 2KAXA 2JULA 4I5JA 1IGVA 5DKRA 3VGOA 1B7TZ 2KI4C 1ZOTB 2ZRTA 4MBEA 2I7AA 2LHLA 1BLQA 1TN4A 1QLSA 1S6CA 5BPJA 1TNXA 4CFQA 2BCBA 2KAVA 1J7OA 1PVBA 3EK7A 1EH2A 1RWYA 1XVJA 1M31A 1M39A 2LLSA 2BKIB 4ORBB 4CFRA 3KF9A 4DIRA 5G08A 2P6BB 3JVTC 3PLFB 1F54A 5HYDA 4XYNA 1EXRA 2BE4A 1RECA 2K7OA 1CDMA 1PVAA 3EVUA 1DGVA 3AKAA 3SG3A 2FCDA 1MUXA 1KK8B 3TS5C 1OOJA 1KWOC 1SNLA 1KFXS 1TOPA 5CPVA 1G8IA 1YUUA 5I2LA 3ICBA 3LL8B 4D1EA 1YUTA 1KQMC 1Q80A 3OX5A 1NX1A 1IQ3A 1NX0A 2JTTA 1KK7Y 2WNDA 3JTDB 1QX7A 2K2AA 3DF0B 3TUYB 5AFPA 5JJGA 4CIDA 5HKWA 2LP2A 1KSMA 5GQQC 1SL8A 1U5IA 1BODA 2HPSA 2KFFA 2KFHA 1F71A 3OB1B 2GGMA 1AUIB 3MSEB 4OV2A 2MHHA 3SG5A 1GJYA 1NP8A 1S26D 3NSOA 2MAZA 4P2YB 4QJ3B 4TNCA 3WHUB 1LKJA 2BE6A 1SR6B 3O6BA 1XFZO 2L98A 1F8HA 4N5XA 4PCWA 3WHTB 1S36A 1CFCA 2M3WA 2PALA 4XJKA 2M0RA 1FI5A 1SYMA 3CGAA 4USLA 3NXAA 4NDDA 1VRKA 1TRFA 1EG4A 1YX7A 1SRAA 1JFJA 2K61A 1QTXA 1LXFC 4PE0A 1W7IB 3VRRA 4C0KA 4YRUA 4UPGA 1AP4A 3I5IB 2PASA 1KK8C 2KQYA 2L4HA 4WQ3A 2LVKA 2JRFA 1BU3A 1OMDA 2OS8B 1WRKA 3CZTX 1L7ZA 5ER4X 1K8UA 4PHJA 1NCXA 1WRZA 1S6JA 2Q91A 2FJUB 4QJ4B 2DOQA 4FQOA 4R1EA 2LC5A 1QIVA 1L2OC 1PULA 3RM1A 1UHHA 2LVJA 2MLFC 1B47A 2JXCA 2BECA 3LCPC 1ZACA 2EC6B 1NWDA 2F33A 3LK0A 2F2OA 3SIBA 1K94A 3TDZA 1A4PA 1LA3A 3M0WA 1WLMA 2BCAA 2OTGB 3FWBA 2CCMA 1OZSA 3DVEA 1HT9A 1QVIZ 4JQ0D 1K95A 5CSIA 4AQJA 5B8IB 1CNPA 1NX2A 4GFTA 2B1UA 2M7NA 4ORAB 3TDUA 4M2QA 1UHJA 2I94A 1QV0A 1NCYA 2KAYA 2LCPA 1IQ5A 1PK0D 3KPXA 2QACA 1M63B 2M7LA 3NSLA 1KSOA 1CFFA 1PRWA 5HLVA 2H2KA 5CSFA 3A8RA 1YR5A 2KI6C 5I2QA 3EK4A 5D69A 5J3XA 1FF1A 1MQ1A 4GNKB 2NLNA 1CDLA 2NZ0A 2OPOA 2OS8C 1QATA 4OKHA 2NCOA 2ZN8A 5FYXA 1R2UA 1CTRA 2LUXA 4IL1A 4E68A 1CM1A 2L2EA 2NXQA 4OR9B 3AAKA 4MVFA 4F0ZB 3EKJA 3GK4X 2CT9A 2JNXA 1UWOA 2V53A 1OE9B 1OQPA 1A75A 2BBNA 4GUKA 2LP3A 1RTP1 1KFUL 4M2OA 3PSRA 2JWWA 5PALA 3DVJA 1DJIA 1QLKA 1SKTA 3I5GC 4N1GA 1IJ6A 2K7CA 2LE9B 3NSIA 1IH0A 1WRLA 2HQ8A 1C7WA 1FI6A 2KYCA 1CMGA 1SCVA 1M45A 5KU1A 1JUOA 2BCXA 1PALA 1G33A 5AEQA 4YGAA 2ZNEA 3ZNIA 3ZWHA 2NCPA 2LLTA 3CS1A 4ICBA 1F70A 5I2OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SMG A;  2G9B A;  2JT3 A;  4JPZ B;  1SCM C;  1XK4 C;  1YVL A;  3BUM B;  2F3Z A;  2KBM A;  4GGF C;  5HLO A;  1XFW O;  2L0P A;  1V1G A;  2KDH A;  2TN4 A;  1AJ4 A;  1Y1A A;  1XFY O;  1JFK A;  1RFJ A;  1DJY A;  1WDC B;  1UUS A;  1UHI A;  2O60 A;  4JWQ A;  1OSA A;  1QXP A;  4I5N B;  2PMY A;  4YGC B;  1A2X A;  1TCF A;  1ODB A;  3K21 A;  1XFU O;  3IQQ A;  4NDC A;  1DT7 B;  3KO0 A;  2RGI A;  4YBH B;  4MZK A;  1BMO A;  2MLE C;  3BUN B;  3VRQ A;  4MLW A;  1K90 D;  3RLZ A;  4HRG A;  1UP5 A;  2F8P A;  2KNE A;  2M1U A;  2WCE A;  2K7D A;  2LHI A;  4ETO A;  1Y0V H;  1ZUZ A;  3BQ3 A;  5DKN A;  1K2H A;  1J1D A;  1BJF A;  1FBV A;  3GK2 A;  5D7F A;  1CLL A;  2PSR A;  1GGW A;  1XK4 A;  4GGF A;  1BG1 A;  4PDZ A;  1GQM A;  3AKB A;  3BOW B;  2KFG A;  1YRT B;  4U8D A;  1JSA A;  5AER A;  4HRE E;  1LIN A;  1M46 A;  4MRX A;  5K89 A;  2KGB C;  1MXL C;  1NX3 A;  3SJS A;  2KSP A;  2KYF A;  4AQI A;  1KK7 Z;  2JXL A;  3LLE A;  4DRW A;  1CMF A;  3QRX A;  4YGD B;  3CWG A;  1Y1X A;  1NPQ A;  1G4Y R;  1YX8 A;  2WOR A;  4GBA A;  2JU0 A;  2LAP A;  3BXK A;  2JQ6 A;  3OX6 A;  1K96 A;  4L9M A;  2LNK A;  4GAO A;  1N65 A;  1XFV O;  2ZN9 A;  3JTD C;  4I5L B;  1MF8 B;  1NUB A;  3TUY C;  2CXJ A;  2HF5 A;  1YUS A;  2L4I A;  4MRY A;  5HKZ A;  2WCF A;  1BR4 B;  1DF0 B;  1KFU S;  2O5G A;  1B8L A;  3CLN A;  1UHN A;  3GK1 A;  1WY9 A;  4MZJ A;  1MR8 A;  3PAT A;  2ZFD A;  3VRN A;  1B9A A;  2AAO A;  1TNW A;  4GPL B;  2WC8 A;  1SR6 C;  2MA2 A;  1S5G Y;  2LLU A;  3VRP A;  1AK8 A;  1YRU B;  1IWQ A;  5F6T A;  1MWN A;  1SK6 D;  2KI4 B;  2JNF A;  1SL9 A;  4M2P A;  4PE4 A;  4AOM A;  1IRJ A;  1LVC D;  1QJT A;  1BT6 A;  1Y1U A;  1TTX A;  2M8U A;  3DF0 A;  1SPY A;  1AHR A;  1A29 A;  3I5I C;  3TZ1 A;  1U5I B;  2K2F A;  1J7Q A;  3PFV A;  3I5H B;  5AXI A;  3JVT B;  2D8N A;  1DMO A;  4OVN F;  3WNX B;  1CLB A;  1NYA A;  1GGZ A;  2LMV A;  3O2P A;  2FCE A;  2Y5I A;  4GGN A;  3HX4 A;  3D0Y B;  3SG7 A;  1DJW A;  3SIA A;  1EL4 A;  1TIZ A;  4CPV A;  4MZL A;  2BL0 B;  2BBM A;  1FW4 A;  3VRO A;  1RK9 A;  1YTZ C;  1AJ5 A;  2BKH B;  4PHM A;  2ZND A;  4ZCV A;  3SG2 A;  1KWO B;  3TS5 B;  4DUQ A;  4YGB B;  4XJK B;  3O4Y A;  2MRD A;  2K0J A;  1NIW A;  2I18 A;  2K7B A;  5KTY A;  2SCP A;  1B1G A;  2A4J A;  2KI6 D;  1KQM B;  2PRU A;  2WCB A;  1SL7 A;  2CBL A;  3H4S E;  2EC6 C;  1QIW A;  2M9G A;  2AMI A;  2I2R E;  1TNP A;  4OCI A;  1PSR A;  2LVV A;  4BY4 A;  3CR4 X;  1C7V A;  1J7R A;  1SW8 A;  2OTG C;  4QJ5 B;  3CR2 A;  1TNQ A;  3CR5 X;  2JOJ A;  3SG4 A;  1N0Y A;  4C0L A;  1XYD A;  5DKQ A;  1QV1 A;  2Y1N A;  1N2D A;  2KQ6 A;  2EHB A;  4ZCU A;  2JTZ A;  1J55 A;  4HRH A;  2F2P A;  4PE1 A;  1E8A A;  1F4Q A;  1QX5 B;  3BUX B;  3EK8 A;  1R6P A;  3E3R A;  1JF2 A;  1DGU A;  1B4C A;  1DF0 A;  4A4C A;  3NSK A;  1EJ3 A;  2R2I A;  3PM8 A;  1DJH A;  3I5H C;  3CTN A;  1F4O A;  1CKK A;  1IJ5 A;  5IBW A;  1CM4 A;  2M1K B;  2JPT A;  2GGZ A;  3FS7 A;  5ER5 A;  1QX2 A;  2MJW B;  1XA5 A;  2BL0 C;  2JZI A;  1UHK A;  1NSH A;  3EVV A;  1C07 A;  3LK1 A;  2ZRS A;  1MHO A;  3EVR A;  1B8R A;  4PAL A;  1DJX A;  4NQG A;  3DD4 A;  2ISD A;  4P5O E;  2HQW A;  2KGR A;  3BUW B;  1EG3 A;  1JBA A;  2H61 C;  3PN7 B;  5CSJ A;  1D1O A;  1RJV A;  3DVM A;  4C0J A;  1L2O B;  2LM5 A;  1DVI A;  2KBI A;  1RRO A;  1V1F A;  4A4B A;  4I5K A;  1CLM A;  2JT8 A;  2M97 A;  1TCO B;  1WLZ A;  1HQV A;  1J1E A;  3OHM B;  3PAL A;  2SAS A;  3I5F B;  1ALW A;  1XFX O;  2PVB A;  4YI8 A;  1J7P A;  5JOL A;  1A75 B;  1ZFS A;  3D0Y A;  2EGD A;  5CSN A;  4NDB A;  3OP0 A;  1H4B A;  1QAS A;  4FTG A;  1YUR A;  1NCZ A;  4MSP A;  1WDC C;  2KHN A;  1CFP A;  1K9U A;  3BYA A;  4PE7 A;  4WRI A;  4MN0 A;  4MEW A;  2H61 A;  2K8M B;  1KCY A;  1ZMZ A;  1KQV A;  1OMV A;  1PSB A;  1QVI Y;  3A4U B;  1KFX L;  3C1V A;  4HSZ A;  3GOF A;  3KEV A;  1CB1 A;  2LV7 A;  2GV5 A;  2Y1M A;  1F55 A;  1K9P A;  4WQ2 A;  2WOS A;  5HKY A;  3TDI A;  2HET A;  3KHE A;  4DS7 A;  2LMT A;  3BUO B;  2CNP A;  3FIA A;  2MBX A;  1CFD A;  3FWC A;  4DCK A;  3PN7 C;  1SY9 A;  4N1F A;  1IKU A;  1BR1 B;  3AAJ A;  2L50 A;  3WXA A;  2F3Y A;  3I5G B;  1S6I A;  2LUC A;  4PHK A;  3IQO A;  4CLN A;  1MXE A;  2E30 A;  2JT0 A;  1S3P A;  2M29 A;  1LA0 A;  3I5F C;  4ORC B;  2ZKM X;  1H8B A;  1B7T Y;  2COL B;  2CTN A;  5KSZ A;  1DTL A;  4Q04 A;  2FOT A;  3IF7 A;  1JC2 A;  1OMR A;  1ALV A;  3OB2 B;  4YI9 A;  2Q4U A;  3SG6 A;  1Y6W A;  1FPW A;  1DJZ A;  1IG5 A;  2LVI A;  1B8C A;  1DJG A;  1K93 D;  2VRG A;  1QS7 A;  2Y4Q A;  1SBJ A;  3D10 A;  1SCM B;  2E6W A;  2KOT A;  3F45 A;  1CDP A;  2LAN A;  1X02 A;  1YVH A;  4YGE B;  1W7J B;  1S1E A;  2IS9 A;  2L51 A;  3O78 A;  1BF5 A;  5AAN A;  1CDN A;  1S5G Z;  1BOC A;  1K9K A;  3BOW A;  2G2B A;  3EKH A;  5I8N A;  3HCM A;  2LMU A;  2QPT A;  4BY5 A;  1UUR A;  2L5X B;  1JWD A;  1OZO A;  1JF0 A;  4PHN A;  1AVS A;  5TNC A;  1XO5 A;  2JC2 A;  1A03 A;  2AUC A;  2M49 B;  3DVK A;  2KAX A;  2JUL A;  4I5J A;  1IGV A;  5DKR A;  3VGO A;  1B7T Z;  2KI4 C;  1ZOT B;  2ZRT A;  4MBE A;  2I7A A;  2LHL A;  1BLQ A;  1TN4 A;  1QLS A;  1S6C A;  5BPJ A;  1TNX A;  4CFQ A;  2BCB A;  2KAV A;  1J7O A;  1PVB A;  3EK7 A;  1EH2 A;  1RWY A;  1XVJ A;  1M31 A;  1M39 A;  2LLS A;  2BKI B;  4ORB B;  4CFR A;  3KF9 A;  4DIR A;  5G08 A;  2P6B B;  3JVT C;  3PLF B;  1F54 A;  5HYD A;  4XYN A;  1EXR A;  2BE4 A;  1REC A;  2K7O A;  1CDM A;  1PVA A;  3EVU A;  1DGV A;  3AKA A;  3SG3 A;  2FCD A;  1MUX A;  1KK8 B;  3TS5 C;  1OOJ A;  1KWO C;  1SNL A;  1KFX S;  1TOP A;  5CPV A;  1G8I A;  1YUU A;  5I2L A;  3ICB A;  3LL8 B;  4D1E A;  1YUT A;  1KQM C;  1Q80 A;  3OX5 A;  1NX1 A;  1IQ3 A;  1NX0 A;  2JTT A;  1KK7 Y;  2WND A;  3JTD B;  1QX7 A;  2K2A A;  3DF0 B;  3TUY B;  5AFP A;  5JJG A;  4CID A;  5HKW A;  2LP2 A;  1KSM A;  5GQQ C;  1SL8 A;  1U5I A;  1BOD A;  2HPS A;  2KFF A;  2KFH A;  1F71 A;  3OB1 B;  2GGM A;  1AUI B;  3MSE B;  4OV2 A;  2MHH A;  3SG5 A;  1GJY A;  1NP8 A;  1S26 D;  3NSO A;  2MAZ A;  4P2Y B;  4QJ3 B;  4TNC A;  3WHU B;  1LKJ A;  2BE6 A;  1SR6 B;  3O6B A;  1XFZ O;  2L98 A;  1F8H A;  4N5X A;  4PCW A;  3WHT B;  1S36 A;  1CFC A;  2M3W A;  2PAL A;  4XJK A;  2M0R A;  1FI5 A;  1SYM A;  3CGA A;  4USL A;  3NXA A;  4NDD A;  1VRK A;  1TRF A;  1EG4 A;  1YX7 A;  1SRA A;  1JFJ A;  2K61 A;  1QTX A;  1LXF C;  4PE0 A;  1W7I B;  3VRR A;  4C0K A;  4YRU A;  4UPG A;  1AP4 A;  3I5I B;  2PAS A;  1KK8 C;  2KQY A;  2L4H A;  4WQ3 A;  2LVK A;  2JRF A;  1BU3 A;  1OMD A;  2OS8 B;  1WRK A;  3CZT X;  1L7Z A;  5ER4 X;  1K8U A;  4PHJ A;  1NCX A;  1WRZ A;  1S6J A;  2Q91 A;  2FJU B;  4QJ4 B;  2DOQ A;  4FQO A;  4R1E A;  2LC5 A;  1QIV A;  1L2O C;  1PUL A;  3RM1 A;  1UHH A;  2LVJ A;  2MLF C;  1B47 A;  2JXC A;  2BEC A;  3LCP C;  1ZAC A;  2EC6 B;  1NWD A;  2F33 A;  3LK0 A;  2F2O A;  3SIB A;  1K94 A;  3TDZ A;  1A4P A;  1LA3 A;  3M0W A;  1WLM A;  2BCA A;  2OTG B;  3FWB A;  2CCM A;  1OZS A;  3DVE A;  1HT9 A;  1QVI Z;  4JQ0 D;  1K95 A;  5CSI A;  4AQJ A;  5B8I B;  1CNP A;  1NX2 A;  4GFT A;  2B1U A;  2M7N A;  4ORA B;  3TDU A;  4M2Q A;  1UHJ A;  2I94 A;  1QV0 A;  1NCY A;  2KAY A;  2LCP A;  1IQ5 A;  1PK0 D;  3KPX A;  2QAC A;  1M63 B;  2M7L A;  3NSL A;  1KSO A;  1CFF A;  1PRW A;  5HLV A;  2H2K A;  5CSF A;  3A8R A;  1YR5 A;  2KI6 C;  5I2Q A;  3EK4 A;  5D69 A;  5J3X A;  1FF1 A;  1MQ1 A;  4GNK B;  2NLN A;  1CDL A;  2NZ0 A;  2OPO A;  2OS8 C;  1QAT A;  4OKH A;  2NCO A;  2ZN8 A;  5FYX A;  1R2U A;  1CTR A;  2LUX A;  4IL1 A;  4E68 A;  1CM1 A;  2L2E A;  2NXQ A;  4OR9 B;  3AAK A;  4MVF A;  4F0Z B;  3EKJ A;  3GK4 X;  2CT9 A;  2JNX A;  1UWO A;  2V53 A;  1OE9 B;  1OQP A;  1A75 A;  2BBN A;  4GUK A;  2LP3 A;  1RTP 1;  1KFU L;  4M2O A;  3PSR A;  2JWW A;  5PAL A;  3DVJ A;  1DJI A;  1QLK A;  1SKT A;  3I5G C;  4N1G A;  1IJ6 A;  2K7C A;  2LE9 B;  3NSI A;  1IH0 A;  1WRL A;  2HQ8 A;  1C7W A;  1FI6 A;  2KYC A;  1CMG A;  1SCV A;  1M45 A;  5KU1 A;  1JUO A;  2BCX A;  1PAL A;  1G33 A;  5AEQ A;  4YGA A;  2ZNE A;  3ZNI A;  3ZWH A;  2NCP A;  2LLT A;  3CS1 A;  4ICB A;  1F70 A;  5I2O A; 
#chains in the Genus database with same CATH topology
 1SMG A;  2G9B A;  2JT3 A;  3S0A A;  4JPZ B;  1SCM C;  1XK4 C;  1YVL A;  3BUM B;  1DEK A;  2F3Z A;  2KBM A;  4GGF C;  5HLO A;  1XFW O;  2L0P A;  1V1G A;  2KDH A;  2TN4 A;  1AJ4 A;  1Y1A A;  1XFY O;  1JFK A;  1RFJ A;  1DJY A;  3DYE A;  1WDC B;  1UUS A;  1UHI A;  2O60 A;  4JWQ A;  1OSA A;  1QXP A;  1DC1 A;  4I5N B;  2PMY A;  4YGC B;  1A2X A;  1TCF A;  1ODB A;  3K21 A;  1XFU O;  3IQQ A;  4NDC A;  1DT7 B;  3KO0 A;  2RGI A;  4YBH B;  4MZK A;  1BMO A;  2MLE C;  3BUN B;  3VRQ A;  4MLW A;  1K90 D;  3RLZ A;  4HRG A;  3OBV A;  1UP5 A;  2F8P A;  2KNE A;  2M1U A;  2WCE A;  2K7D A;  2LHI A;  4ETO A;  3OGN A;  1Y0V H;  1ZUZ A;  3BQ3 A;  5DKN A;  1K2H A;  1J1D A;  1BJF A;  1FBV A;  3GK2 A;  5D7F A;  1CLL A;  2PSR A;  1GGW A;  5EL2 A;  1XK4 A;  4GGF A;  3BFH A;  1BG1 A;  4PDZ A;  1GQM A;  3AKB A;  3BOW B;  2KFG A;  1YRT B;  2WCH A;  4U8D A;  1JSA A;  5AER A;  4HRE E;  1LIN A;  1M46 A;  4MRX A;  5K89 A;  2QDI A;  2L2C A;  2KGB C;  1MXL C;  1GM0 A;  1NX3 A;  3SJS A;  2KSP A;  2KYF A;  4AQI A;  1KK7 Z;  2JXL A;  3LLE A;  4DRW A;  1CMF A;  3QRX A;  4YGD B;  3CWG A;  1Y1X A;  1NPQ A;  1G4Y R;  1YX8 A;  2WOR A;  4GBA A;  1OOI X;  2JU0 A;  2LAP A;  3BXK A;  2JQ6 A;  3OX6 A;  1K96 A;  4L9M A;  5D3O A;  2LNK A;  4GAO A;  1N65 A;  1XFV O;  2ZN9 A;  3JTD C;  3R1V A;  4I5L B;  1MF8 B;  1NUB A;  4FQT A;  3TUY C;  2CXJ A;  2HF5 A;  1YUS A;  2L4I A;  4MRY A;  5HKZ A;  2WCF A;  1BR4 B;  1DF0 B;  1KFU S;  2O5G A;  4INX A;  1B8L A;  3CLN A;  1UHN A;  2QEH A;  3GK1 A;  3SS3 A;  1WY9 A;  4MZJ A;  1XFR A;  2GTE A;  1MR8 A;  3PAT A;  1QWV A;  2ZFD A;  3VRN A;  1B9A A;  2AAO A;  1P28 A;  1TNW A;  4GPL B;  2WC8 A;  1SR6 C;  2MA2 A;  1S5G Y;  2LLU A;  3VRP A;  1AK8 A;  1YRU B;  1IWQ A;  5F6T A;  1MWN A;  1SK6 D;  2KI4 B;  2JNF A;  1SL9 A;  1C3Z A;  4M2P A;  4PE4 A;  3SS4 A;  4AOM A;  1IRJ A;  1LVC D;  1QJT A;  1BT6 A;  1Y1U A;  1TTX A;  2H8V A;  2M8U A;  3DF0 A;  1SPY A;  1AHR A;  1A29 A;  3I5I C;  3TZ1 A;  1U5I B;  3PM2 A;  2L5Y A;  2K2F A;  1J7Q A;  3PFV A;  3I5H B;  5AXI A;  3JVT B;  2D8N A;  2WC5 A;  1DMO A;  4OVN F;  3D75 A;  3WNX B;  1CLB A;  1NYA A;  1GGZ A;  2LMV A;  3O2P A;  2FCE A;  2Y5I A;  4GGN A;  3HX4 A;  5I94 A;  3D0Y B;  3SG7 A;  1DJW A;  1ORG A;  3SIA A;  1EL4 A;  1TIZ A;  4CPV A;  4MZL A;  2BL0 B;  2BBM A;  1FW4 A;  3VRO A;  1RK9 A;  1YTZ C;  1AJ5 A;  2BKH B;  4PHM A;  2ZND A;  4ZCV A;  3SG2 A;  1KWO B;  3TS5 B;  4DUQ A;  4YGB B;  4XJK B;  3O4Y A;  2MRD A;  2K0J A;  1NIW A;  2I18 A;  2K7B A;  2QEV A;  5KTY A;  2SCP A;  1B1G A;  2A4J A;  2KI6 D;  1KQM B;  2PRU A;  2WCB A;  1SL7 A;  2CBL A;  3H4S E;  2EC6 C;  1QIW A;  2M9G A;  2AMI A;  2I2R E;  1TNP A;  4OCI A;  2PYQ A;  1PSR A;  2LVV A;  4BY4 A;  3CR4 X;  1C7V A;  1J7R A;  1SW8 A;  2OTG C;  4QJ5 B;  3CR2 A;  1TNQ A;  3CR5 X;  2JOJ A;  3SG4 A;  1N0Y A;  4C0L A;  1XYD A;  5DKQ A;  1QV1 A;  2Y1N A;  3FE9 A;  1N2D A;  4F7F A;  2KQ6 A;  2EHB A;  4ZCU A;  3D74 A;  2JTZ A;  1J55 A;  4HRH A;  2WCK A;  2F2P A;  4PE1 A;  1E8A A;  1F4Q A;  1QX5 B;  3BUX B;  3EK8 A;  1R6P A;  5FI7 A;  3E3R A;  1JF2 A;  1DGU A;  1B4C A;  1DF0 A;  4A4C A;  2BNX A;  1EJ3 A;  2R2I A;  1DEL A;  1DJH A;  3I5H C;  3NSK A;  3CTN A;  2BAP A;  3PM8 A;  1F4O A;  1CKK A;  1IJ5 A;  5IBW A;  1CM4 A;  2M1K B;  2JPT A;  3N7H A;  2GGZ A;  3FS7 A;  2JPO A;  4OZD A;  5ER5 A;  1QX2 A;  2MJW B;  1XA5 A;  2BL0 C;  2JZI A;  1UHK A;  1NSH A;  3EVV A;  1C07 A;  3NGV A;  3EG5 B;  3LK1 A;  2ZRS A;  1MHO A;  3EVR A;  2KLD A;  5FI6 A;  1B8R A;  4PAL A;  1DJX A;  4NQG A;  3CYZ A;  3DD4 A;  2ISD A;  2PQL A;  3FE8 A;  4P5O E;  2HQW A;  2KGR A;  3BUW B;  1EG3 A;  1JBA A;  2H61 C;  3PN7 B;  5CSJ A;  2ERB A;  1D1O A;  1RJV A;  3DVM A;  4C0J A;  1L2O B;  2LM5 A;  1DVI A;  2KBI A;  1RRO A;  1V1F A;  4A4B A;  4I5K A;  1CLM A;  2JT8 A;  2M97 A;  1TCO B;  1WLZ A;  1HQV A;  1J1E A;  3DXL A;  3OHM B;  3PAL A;  2SAS A;  3I5F B;  1ALW A;  3BFA A;  1TUJ A;  1XFX O;  2PVB A;  4YI8 A;  1J7P A;  5JOL A;  1A75 B;  1ZFS A;  3D0Y A;  2EGD A;  3Q8I A;  5CSN A;  4NDB A;  3OP0 A;  1H4B A;  1QAS A;  4FTG A;  1YUR A;  1NCZ A;  4MSP A;  1WDC C;  2KHN A;  1CFP A;  3BFB A;  1K9U A;  3BYA A;  4PE7 A;  3S0G A;  3DY9 A;  4WRI A;  3L47 A;  4MN0 A;  4MEW A;  5DIC A;  2H61 A;  2K8M B;  1KCY A;  1ZMZ A;  1KQV A;  1OMV A;  1PSB A;  1QVI Y;  3A4U B;  1KFX L;  3C1V A;  4HSZ A;  3GOF A;  3KEV A;  3R1O A;  1CB1 A;  2LV7 A;  2GV5 A;  2Y1M A;  1F55 A;  3D77 A;  1K9P A;  4WQ2 A;  2WOS A;  3S0F A;  5HKY A;  3TDI A;  5HL1 A;  2HET A;  4INW A;  1OOH A;  3KHE A;  4DS7 A;  2LMT A;  3BUO B;  2CNP A;  3D73 A;  3FIA A;  1CFD A;  3FWC A;  2MBX A;  4DCK A;  3PN7 C;  1SY9 A;  2QEB A;  4N1F A;  2FJY A;  3V2L A;  4IJ7 A;  1BR1 B;  1IKU A;  1SSE B;  3AAJ A;  2L50 A;  3WXA A;  2F3Y A;  3I5G B;  1S6I A;  1TUZ A;  2LUC A;  3IQO A;  4PHK A;  4CLN A;  1MXE A;  2E30 A;  3UO9 A;  2JT0 A;  3CDN A;  1W9Z A;  1S3P A;  2M29 A;  1LA0 A;  3I5F C;  4ORC B;  2ZKM X;  1H8B A;  1B7T Y;  2COL B;  2CTN A;  5KSZ A;  2WC6 A;  1DTL A;  4Q04 A;  2FOT A;  3IF7 A;  1JC2 A;  1OMR A;  1ALV A;  3OB2 B;  4YI9 A;  2Q4U A;  3SG6 A;  1Y6W A;  1FPW A;  1DJZ A;  1IG5 A;  2LVI A;  1B8C A;  1DJG A;  2WCJ A;  1K93 D;  2VRG A;  1QS7 A;  2P71 A;  1SBJ A;  2Y4Q A;  3D10 A;  1SCM B;  2E6W A;  2KOT A;  3F45 A;  1CDP A;  2LAN A;  1X02 A;  1YVH A;  4YGE B;  1W7J B;  1S1E A;  2IS9 A;  2L51 A;  3O78 A;  1BF5 A;  5AAN A;  1CDN A;  3B7A A;  1S5G Z;  3K1E A;  1K9K A;  1BOC A;  3BOW A;  3PJI A;  2G2B A;  3EKH A;  5I8N A;  3HCM A;  1IIO A;  2LMU A;  2QPT A;  3IVT A;  4BY5 A;  1UUR A;  2L5X B;  1JWD A;  1OZO A;  1JF0 A;  4PHN A;  1AVS A;  5TNC A;  1XO5 A;  2JC2 A;  3NHI A;  1A03 A;  2AUC A;  2M49 B;  2WCL A;  1TWO A;  3DVK A;  2KAX A;  2JUL A;  4I5J A;  3L4L A;  1Z4H A;  1IGV A;  5DKR A;  3VGO A;  3B6X A;  1B7T Z;  2KI4 C;  1ZOT B;  2ZRT A;  4MBE A;  2I7A A;  2LHL A;  1BLQ A;  1TN4 A;  1QLS A;  1S6C A;  3DZT A;  5BPJ A;  1TNX A;  4CFQ A;  2BCB A;  3S0D A;  2KAV A;  1J7O A;  1PVB A;  3EK7 A;  1EH2 A;  2KPH A;  1RWY A;  1XVJ A;  1M31 A;  1M39 A;  2LLS A;  2BKI B;  4ORB B;  4PT1 A;  4CFR A;  3KF9 A;  3CZ0 A;  2KLE A;  4DIR A;  5G08 A;  2P6B B;  3JVT C;  3PLF B;  1F54 A;  5HYD A;  4XYN A;  1EXR A;  2BE4 A;  1REC A;  3D78 A;  3QME A;  2K7O A;  3R72 A;  1CDM A;  1PVA A;  3EVU A;  1DGV A;  3AKA A;  3SG3 A;  2FCD A;  1MUX A;  1KK8 B;  3TS5 C;  1OOJ A;  1KWO C;  1SNL A;  1KFX S;  1TOP A;  3S0E A;  5CPV A;  1G8I A;  1YUU A;  5I2L A;  3ICB A;  3LL8 B;  4D1E A;  1YUT A;  1KQM C;  1Q80 A;  3OX5 A;  1NX1 A;  1IQ3 A;  1NX0 A;  2JTT A;  1KK7 Y;  2WND A;  3JTD B;  1QX7 A;  2K2A A;  3DF0 B;  3TUY B;  5AFP A;  5JJG A;  3D76 A;  4CID A;  5HKW A;  2LP2 A;  1KSM A;  5GQQ C;  1SL8 A;  1U5I A;  3B86 A;  1BOD A;  2HPS A;  2KFF A;  2KFH A;  1F71 A;  3OB1 B;  2GGM A;  1AUI B;  3MSE B;  4OV2 A;  2MHH A;  3SG5 A;  1GJY A;  1NP8 A;  1S26 D;  3NSO A;  1OOG A;  2MAZ A;  4P2Y B;  2WCM A;  4QJ3 B;  2QEO A;  4TNC A;  3WHU B;  1LKJ A;  4JD9 A;  2BE6 A;  1SR6 B;  3CZ2 A;  3O6B A;  1OOF A;  1XFZ O;  2L98 A;  4N5X A;  1F8H A;  1C3Y A;  4PCW A;  3WHT B;  1S36 A;  1CFC A;  2M3W A;  2PAL A;  2YGU A;  4XJK A;  2M0R A;  2P70 A;  3R1P A;  3S0B A;  1FI5 A;  1SYM A;  3CGA A;  4USL A;  3NXA A;  4NDD A;  1VRK A;  1TRF A;  1EG4 A;  1YX7 A;  1SRA A;  1JFJ A;  2K61 A;  1QTX A;  1LXF C;  4PE0 A;  1W7I B;  3VRR A;  4C0K A;  4YRU A;  4UPG A;  1AP4 A;  3I5I B;  2PAS A;  1KK8 C;  2KQY A;  2L4H A;  4WQ3 A;  2LVK A;  2JRF A;  1BU3 A;  1OMD A;  2OS8 B;  3SS5 A;  1WRK A;  3CZT X;  1L7Z A;  5ER4 X;  1K8U A;  4PHJ A;  1NCX A;  1WRZ A;  1S6J A;  2Q91 A;  2FJU B;  4QJ4 B;  2DOQ A;  4FQO A;  4R1E A;  2LC5 A;  1QIV A;  1L2O C;  1PUL A;  3RM1 A;  1UHH A;  1Z2C B;  2LVJ A;  2MLF C;  1B47 A;  2JXC A;  2BEC A;  3LCP C;  1ZAC A;  2EC6 B;  1NWD A;  2F33 A;  3LK0 A;  2F2O A;  3SIB A;  1K94 A;  3TDZ A;  1A4P A;  1LA3 A;  3M0W A;  1WLM A;  2BCA A;  3B87 A;  3O4X A;  2OTG B;  3FWB A;  3VB1 A;  2CCM A;  1OZS A;  3DVE A;  1HT9 A;  1QVI Z;  4JQ0 D;  1K95 A;  4KYN A;  5CSI A;  4AQJ A;  5B8I B;  1CNP A;  1NX2 A;  1LS8 A;  4GFT A;  2B1U A;  2M7N A;  4ORA B;  3TDU A;  4M2Q A;  1UHJ A;  4JKT A;  2I94 A;  1QV0 A;  1NCY A;  2KAY A;  2LCP A;  1IQ5 A;  3UNW A;  1PK0 D;  3KPX A;  2QAC A;  1M63 B;  2M7L A;  3NSL A;  1KSO A;  1OW4 A;  1PRW A;  1CFF A;  5HLV A;  2H2K A;  5CSF A;  3A8R A;  1YR5 A;  2KI6 C;  1DQE A;  3EK4 A;  5I2Q A;  3RZS A;  5D69 A;  5J3X A;  1FF1 A;  1MQ1 A;  4GNK B;  2NLN A;  1CDL A;  2NZ0 A;  2OPO A;  2OS8 C;  1QAT A;  4OKH A;  2NCO A;  2ZN8 A;  5FYX A;  1R2U A;  1CTR A;  2LUX A;  4IL1 A;  4E68 A;  1CM1 A;  2L2E A;  2NXQ A;  4OR9 B;  3AAK A;  3BJH A;  4MVF A;  4F0Z B;  3EKJ A;  3GK4 X;  2CT9 A;  2JNX A;  1UWO A;  2V53 A;  1OE9 B;  1OQP A;  1A75 A;  2BBN A;  2K60 A;  3CAB A;  4GUK A;  2LP3 A;  1RTP 1;  1KFU L;  4M2O A;  3PSR A;  2JWW A;  5FI2 A;  1T14 A;  3DVJ A;  5PAL A;  1DJI A;  1QLK A;  1SKT A;  3I5G C;  4N1G A;  1IJ6 A;  3CZ1 A;  2K7C A;  2LE9 B;  3NSI A;  1IH0 A;  1WRL A;  2HQ8 A;  1C7W A;  1FI6 A;  3B88 A;  2KYC A;  1CMG A;  1SCV A;  1M45 A;  5KU1 A;  1JUO A;  2BCX A;  1PAL A;  1G33 A;  5AEQ A;  4YGA A;  2ZNE A;  3ZNI A;  3ZWH A;  2NCP A;  2LLT A;  3CS1 A;  3NHT A;  4ICB A;  3L4A A;  1F70 A;  3FE6 A;  5I2O A; 
#chains in the Genus database with same CATH homology
 1SMG A;  2G9B A;  2JT3 A;  4JPZ B;  1SCM C;  1XK4 C;  1YVL A;  3BUM B;  2F3Z A;  2KBM A;  4GGF C;  5HLO A;  1XFW O;  2L0P A;  1V1G A;  2KDH A;  2TN4 A;  1AJ4 A;  1Y1A A;  1XFY O;  1JFK A;  1RFJ A;  1DJY A;  1WDC B;  1UUS A;  1UHI A;  2O60 A;  4JWQ A;  1OSA A;  1QXP A;  4I5N B;  2PMY A;  4YGC B;  1A2X A;  1TCF A;  1ODB A;  3K21 A;  1XFU O;  3IQQ A;  4NDC A;  1DT7 B;  3KO0 A;  2RGI A;  4YBH B;  4MZK A;  1BMO A;  2MLE C;  3BUN B;  3VRQ A;  4MLW A;  1K90 D;  3RLZ A;  4HRG A;  1UP5 A;  2F8P A;  2KNE A;  2M1U A;  2WCE A;  2K7D A;  2LHI A;  4ETO A;  1Y0V H;  1ZUZ A;  3BQ3 A;  5DKN A;  1K2H A;  1J1D A;  1BJF A;  1FBV A;  3GK2 A;  5D7F A;  1CLL A;  2PSR A;  1GGW A;  1XK4 A;  4GGF A;  1BG1 A;  4PDZ A;  1GQM A;  3AKB A;  3BOW B;  2KFG A;  1YRT B;  4U8D A;  1JSA A;  5AER A;  4HRE E;  1LIN A;  1M46 A;  4MRX A;  5K89 A;  2KGB C;  1MXL C;  1NX3 A;  3SJS A;  2KSP A;  2KYF A;  4AQI A;  1KK7 Z;  2JXL A;  3LLE A;  4DRW A;  1CMF A;  3QRX A;  4YGD B;  3CWG A;  1Y1X A;  1NPQ A;  1G4Y R;  1YX8 A;  2WOR A;  4GBA A;  2JU0 A;  2LAP A;  3BXK A;  2JQ6 A;  3OX6 A;  1K96 A;  4L9M A;  2LNK A;  4GAO A;  1N65 A;  1XFV O;  2ZN9 A;  3JTD C;  4I5L B;  1MF8 B;  1NUB A;  3TUY C;  2CXJ A;  2HF5 A;  1YUS A;  2L4I A;  4MRY A;  5HKZ A;  2WCF A;  1BR4 B;  1DF0 B;  1KFU S;  2O5G A;  1B8L A;  3CLN A;  1UHN A;  3GK1 A;  1WY9 A;  4MZJ A;  1MR8 A;  3PAT A;  2ZFD A;  3VRN A;  1B9A A;  2AAO A;  1TNW A;  4GPL B;  2WC8 A;  1SR6 C;  2MA2 A;  1S5G Y;  2LLU A;  3VRP A;  1AK8 A;  1YRU B;  1IWQ A;  5F6T A;  1MWN A;  1SK6 D;  2KI4 B;  2JNF A;  1SL9 A;  4M2P A;  4PE4 A;  4AOM A;  1IRJ A;  1LVC D;  1QJT A;  1BT6 A;  1Y1U A;  1TTX A;  2M8U A;  3DF0 A;  1SPY A;  1AHR A;  1A29 A;  3I5I C;  3TZ1 A;  1U5I B;  2K2F A;  1J7Q A;  3PFV A;  3I5H B;  5AXI A;  3JVT B;  2D8N A;  1DMO A;  4OVN F;  3WNX B;  1CLB A;  1NYA A;  1GGZ A;  2LMV A;  3O2P A;  2FCE A;  2Y5I A;  4GGN A;  3HX4 A;  3D0Y B;  3SG7 A;  1DJW A;  3SIA A;  1EL4 A;  1TIZ A;  4CPV A;  4MZL A;  2BL0 B;  2BBM A;  1FW4 A;  3VRO A;  1RK9 A;  1YTZ C;  1AJ5 A;  2BKH B;  4PHM A;  2ZND A;  4ZCV A;  3SG2 A;  1KWO B;  3TS5 B;  4DUQ A;  4YGB B;  4XJK B;  3O4Y A;  2MRD A;  2K0J A;  1NIW A;  2I18 A;  2K7B A;  5KTY A;  2SCP A;  1B1G A;  2A4J A;  2KI6 D;  1KQM B;  2PRU A;  2WCB A;  1SL7 A;  2CBL A;  3H4S E;  2EC6 C;  1QIW A;  2M9G A;  2AMI A;  2I2R E;  1TNP A;  4OCI A;  1PSR A;  2LVV A;  4BY4 A;  3CR4 X;  1C7V A;  1J7R A;  1SW8 A;  2OTG C;  4QJ5 B;  3CR2 A;  1TNQ A;  3CR5 X;  2JOJ A;  3SG4 A;  1N0Y A;  4C0L A;  1XYD A;  5DKQ A;  1QV1 A;  2Y1N A;  1N2D A;  2KQ6 A;  2EHB A;  4ZCU A;  2JTZ A;  1J55 A;  4HRH A;  2F2P A;  4PE1 A;  1E8A A;  1F4Q A;  1QX5 B;  3BUX B;  3EK8 A;  1R6P A;  3E3R A;  1JF2 A;  1DGU A;  1B4C A;  1DF0 A;  4A4C A;  3NSK A;  1EJ3 A;  2R2I A;  3PM8 A;  1DJH A;  3I5H C;  3CTN A;  1F4O A;  1CKK A;  1IJ5 A;  5IBW A;  1CM4 A;  2M1K B;  2JPT A;  2GGZ A;  3FS7 A;  5ER5 A;  1QX2 A;  2MJW B;  1XA5 A;  2BL0 C;  2JZI A;  1UHK A;  1NSH A;  3EVV A;  1C07 A;  3LK1 A;  2ZRS A;  1MHO A;  3EVR A;  1B8R A;  4PAL A;  1DJX A;  4NQG A;  3DD4 A;  2ISD A;  4P5O E;  2HQW A;  2KGR A;  3BUW B;  1EG3 A;  1JBA A;  2H61 C;  3PN7 B;  5CSJ A;  1D1O A;  1RJV A;  3DVM A;  4C0J A;  1L2O B;  2LM5 A;  1DVI A;  2KBI A;  1RRO A;  1V1F A;  4A4B A;  4I5K A;  1CLM A;  2JT8 A;  2M97 A;  1TCO B;  1WLZ A;  1HQV A;  1J1E A;  3OHM B;  3PAL A;  2SAS A;  3I5F B;  1ALW A;  1XFX O;  2PVB A;  4YI8 A;  1J7P A;  5JOL A;  1A75 B;  1ZFS A;  3D0Y A;  2EGD A;  5CSN A;  4NDB A;  3OP0 A;  1H4B A;  1QAS A;  4FTG A;  1YUR A;  1NCZ A;  4MSP A;  1WDC C;  2KHN A;  1CFP A;  1K9U A;  3BYA A;  4PE7 A;  4WRI A;  4MN0 A;  4MEW A;  2H61 A;  2K8M B;  1KCY A;  1ZMZ A;  1KQV A;  1OMV A;  1PSB A;  1QVI Y;  3A4U B;  1KFX L;  3C1V A;  4HSZ A;  3GOF A;  3KEV A;  1CB1 A;  2LV7 A;  2GV5 A;  2Y1M A;  1F55 A;  1K9P A;  4WQ2 A;  2WOS A;  5HKY A;  3TDI A;  2HET A;  3KHE A;  4DS7 A;  2LMT A;  3BUO B;  2CNP A;  3FIA A;  2MBX A;  1CFD A;  3FWC A;  4DCK A;  3PN7 C;  1SY9 A;  4N1F A;  1IKU A;  1BR1 B;  3AAJ A;  2L50 A;  3WXA A;  2F3Y A;  3I5G B;  1S6I A;  2LUC A;  4PHK A;  3IQO A;  4CLN A;  1MXE A;  2E30 A;  2JT0 A;  1S3P A;  2M29 A;  1LA0 A;  3I5F C;  4ORC B;  2ZKM X;  1H8B A;  1B7T Y;  2COL B;  2CTN A;  5KSZ A;  1DTL A;  4Q04 A;  2FOT A;  3IF7 A;  1JC2 A;  1OMR A;  1ALV A;  3OB2 B;  4YI9 A;  2Q4U A;  3SG6 A;  1Y6W A;  1FPW A;  1DJZ A;  1IG5 A;  2LVI A;  1B8C A;  1DJG A;  1K93 D;  2VRG A;  1QS7 A;  2Y4Q A;  1SBJ A;  3D10 A;  1SCM B;  2E6W A;  2KOT A;  3F45 A;  1CDP A;  2LAN A;  1X02 A;  1YVH A;  4YGE B;  1W7J B;  1S1E A;  2IS9 A;  2L51 A;  3O78 A;  1BF5 A;  5AAN A;  1CDN A;  1S5G Z;  1BOC A;  1K9K A;  3BOW A;  2G2B A;  3EKH A;  5I8N A;  3HCM A;  2LMU A;  2QPT A;  4BY5 A;  1UUR A;  2L5X B;  1JWD A;  1OZO A;  1JF0 A;  4PHN A;  1AVS A;  5TNC A;  1XO5 A;  2JC2 A;  1A03 A;  2AUC A;  2M49 B;  3DVK A;  2KAX A;  2JUL A;  4I5J A;  1IGV A;  5DKR A;  3VGO A;  1B7T Z;  2KI4 C;  1ZOT B;  2ZRT A;  4MBE A;  2I7A A;  2LHL A;  1BLQ A;  1TN4 A;  1QLS A;  1S6C A;  5BPJ A;  1TNX A;  4CFQ A;  2BCB A;  2KAV A;  1J7O A;  1PVB A;  3EK7 A;  1EH2 A;  1RWY A;  1XVJ A;  1M31 A;  1M39 A;  2LLS A;  2BKI B;  4ORB B;  4CFR A;  3KF9 A;  4DIR A;  5G08 A;  2P6B B;  3JVT C;  3PLF B;  1F54 A;  5HYD A;  4XYN A;  1EXR A;  2BE4 A;  1REC A;  2K7O A;  1CDM A;  1PVA A;  3EVU A;  1DGV A;  3AKA A;  3SG3 A;  2FCD A;  1MUX A;  1KK8 B;  3TS5 C;  1OOJ A;  1KWO C;  1SNL A;  1KFX S;  1TOP A;  5CPV A;  1G8I A;  1YUU A;  5I2L A;  3ICB A;  3LL8 B;  4D1E A;  1YUT A;  1KQM C;  1Q80 A;  3OX5 A;  1NX1 A;  1IQ3 A;  1NX0 A;  2JTT A;  1KK7 Y;  2WND A;  3JTD B;  1QX7 A;  2K2A A;  3DF0 B;  3TUY B;  5AFP A;  5JJG A;  4CID A;  5HKW A;  2LP2 A;  1KSM A;  5GQQ C;  1SL8 A;  1U5I A;  1BOD A;  2HPS A;  2KFF A;  2KFH A;  1F71 A;  3OB1 B;  2GGM A;  1AUI B;  3MSE B;  4OV2 A;  2MHH A;  3SG5 A;  1GJY A;  1NP8 A;  1S26 D;  3NSO A;  2MAZ A;  4P2Y B;  4QJ3 B;  4TNC A;  3WHU B;  1LKJ A;  2BE6 A;  1SR6 B;  3O6B A;  1XFZ O;  2L98 A;  1F8H A;  4N5X A;  4PCW A;  3WHT B;  1S36 A;  1CFC A;  2M3W A;  2PAL A;  4XJK A;  2M0R A;  1FI5 A;  1SYM A;  3CGA A;  4USL A;  3NXA A;  4NDD A;  1VRK A;  1TRF A;  1EG4 A;  1YX7 A;  1SRA A;  1JFJ A;  2K61 A;  1QTX A;  1LXF C;  4PE0 A;  1W7I B;  3VRR A;  4C0K A;  4YRU A;  4UPG A;  1AP4 A;  3I5I B;  2PAS A;  1KK8 C;  2KQY A;  2L4H A;  4WQ3 A;  2LVK A;  2JRF A;  1BU3 A;  1OMD A;  2OS8 B;  1WRK A;  3CZT X;  1L7Z A;  5ER4 X;  1K8U A;  4PHJ A;  1NCX A;  1WRZ A;  1S6J A;  2Q91 A;  2FJU B;  4QJ4 B;  2DOQ A;  4FQO A;  4R1E A;  2LC5 A;  1QIV A;  1L2O C;  1PUL A;  3RM1 A;  1UHH A;  2LVJ A;  2MLF C;  1B47 A;  2JXC A;  2BEC A;  3LCP C;  1ZAC A;  2EC6 B;  1NWD A;  2F33 A;  3LK0 A;  2F2O A;  3SIB A;  1K94 A;  3TDZ A;  1A4P A;  1LA3 A;  3M0W A;  1WLM A;  2BCA A;  2OTG B;  3FWB A;  2CCM A;  1OZS A;  3DVE A;  1HT9 A;  1QVI Z;  4JQ0 D;  1K95 A;  5CSI A;  4AQJ A;  5B8I B;  1CNP A;  1NX2 A;  4GFT A;  2B1U A;  2M7N A;  4ORA B;  3TDU A;  4M2Q A;  1UHJ A;  2I94 A;  1QV0 A;  1NCY A;  2KAY A;  2LCP A;  1IQ5 A;  1PK0 D;  3KPX A;  2QAC A;  1M63 B;  2M7L A;  3NSL A;  1KSO A;  1CFF A;  1PRW A;  5HLV A;  2H2K A;  5CSF A;  3A8R A;  1YR5 A;  2KI6 C;  5I2Q A;  3EK4 A;  5D69 A;  5J3X A;  1FF1 A;  1MQ1 A;  4GNK B;  2NLN A;  1CDL A;  2NZ0 A;  2OPO A;  2OS8 C;  1QAT A;  4OKH A;  2NCO A;  2ZN8 A;  5FYX A;  1R2U A;  1CTR A;  2LUX A;  4IL1 A;  4E68 A;  1CM1 A;  2L2E A;  2NXQ A;  4OR9 B;  3AAK A;  4MVF A;  4F0Z B;  3EKJ A;  3GK4 X;  2CT9 A;  2JNX A;  1UWO A;  2V53 A;  1OE9 B;  1OQP A;  1A75 A;  2BBN A;  4GUK A;  2LP3 A;  1RTP 1;  1KFU L;  4M2O A;  3PSR A;  2JWW A;  5PAL A;  3DVJ A;  1DJI A;  1QLK A;  1SKT A;  3I5G C;  4N1G A;  1IJ6 A;  2K7C A;  2LE9 B;  3NSI A;  1IH0 A;  1WRL A;  2HQ8 A;  1C7W A;  1FI6 A;  2KYC A;  1CMG A;  1SCV A;  1M45 A;  5KU1 A;  1JUO A;  2BCX A;  1PAL A;  1G33 A;  5AEQ A;  4YGA A;  2ZNE A;  3ZNI A;  3ZWH A;  2NCP A;  2LLT A;  3CS1 A;  4ICB A;  1F70 A;  5I2O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...