1SL7A

Crystal structure of calcium-loaded apo-obelin from obelia longissima
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
173
structure length
173
Chain Sequence
TDFDNPRWIKRHKHMFDFLDINGNGKITLDEIVSKASDDICAKLEATPEQTKRHQVCVEAFFRGCGMEYGKEIAFPQFLDGWKQLATSELKKWARNEPTLIREWGDAVFDIFDKDGSGTITLDEWKAYGKISGISPSQEDCEATFRHCDLDDSGDLDVDEMTRQHLGFWYTLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Obelin
publication title All three Ca2+-binding loops of photoproteins bind calcium ions: The crystal structures of calcium-loaded apo-aequorin and apo-obelin.
pubmed doi rcsb
source organism Obelia longissima
molecule tags Luminescent protein
total genus 65
structure length 173
sequence length 173
ec nomenclature
pdb deposition date 2004-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1sl7A00
1DJXA 2MLFC 2RGIA 5AANA 2OPOA 3PLFB 4NDBA 4L9MA 3CR4X 5K89A 1ZACA 3K21A 1Y1XA 2MRDA 1J1DA 2F2PA 1UHKA 2H2KA 3D0YB 3FWBA 1TNQA 1FF1A 3EK4A 3VGOA 2R2IA 4ORBB 1WRLA 1K93D 1SR6B 3SG2A 1SCMB 1TCOB 1JWDA 3O4YA 1Y0VH 1SR6C 1SCMC 1JC2A 1N65A 2JNXA 2LMVA 1F4QA 2BBNA 3ZNIA 1S3PA 3D10A 1KCYA 3F45A 4HSZA 3LK0A 4AQIA 2JNFA 3D0YA 1YVHA 5G08A 4YI9A 1U5IA 1FI6A 4CFRA 1SPYA 2JT0A 4HREE 2GV5A 3VROA 4PHNA 4P2YB 1DJHA 1J7OA 1D1OA 1ZFSA 1XA5A 1A75B 1QX7A 2EGDA 4JQ0D 3DF0B 2M7LA 2PASA 3SG5A 1H4BA 4A4CA 2LP3A 1NX2A 2BCAA 1HQVA 1CDLA 1KFXL 3BUNB 2K2AA 4ORAB 1F55A 3BOWB 2ZRTA 4HRHA 2KHNA 3PATA 3BUMB 4GGNA 1GQMA 2M1UA 1A2XA 3SG4A 1TN4A 3PALA 1CB1A 1CMFA 1BODA 1K9PA 1WLZA 1QIVA 2E30A 2KGBC 2NLNA 4PDZA 2K8MB 4OVNF 4PHKA 2EC6B 4MBEA 2LANA 4PE7A 2EC6C 1KQVA 1CM1A 1KFUS 1CDPA 1LVCD 4DS7A 2KSPA 1HT9A 5KTYA 1IQ5A 4GBAA 1IG5A 1NYAA 1V1GA 1J7RA 2KFFA 1OZOA 3CWGA 5JJGA 1CFFA 2KFHA 5ER5A 2I2RE 2P6BB 2K7BA 2ZN9A 4QJ4B 5GQQC 2LLUA 2PALA 1OMVA 3CGAA 2KFGA 1JF2A 1LA0A 1JF0A 5HLOA 1QV0A 2FOTA 2COLB 3M0WA 3LCPC 5AXIA 5CSJA 2VRGA 3EK8A 3SG3A 1R6PA 2BCXA 4R1EA 5I2QA 1BR4B 1YUTA 5HKZA 4OCIA 1AVSA 2MHHA 2IS9A 4PE0A 1G4YR 2MJWB 4FTGA 1UHHA 3O6BA 1S5GZ 1AHRA 4PE4A 1B1GA 4QJ5B 1IH0A 2Q4UA 1XFXO 4ORCB 2K61A 2HQ8A 1S36A 2L5XB 3VRPA 1FW4A 1IKUA 2KGRA 1A29A 1C7WA 2M7NA 2L4HA 4D1EA 1QLKA 1NX0A 1RTP1 1PSRA 2ZRSA 3BUOB 2ZKMX 4MRYA 2ZNEA 1B7TY 1VRKA 3TS5B 2Y4QA 3NSOA 2H61C 3OB2B 1CDNA 1S6CA 1XYDA 4YGEB 4ETOA 1OSAA 1EJ3A 1B7TZ 1MUXA 1YRTB 2M0RA 3CTNA 3I5HC 1PRWA 2M29A 1S6IA 2GGZA 1OMRA 3WNXB 2F3YA 1OZSA 2LHLA 1M31A 2ISDA 2O60A 2WOSA 1JFKA 2M9GA 4MZKA 1L2OB 2LLTA 4NQGA 1TNPA 2ZNDA 1X02A 2K7CA 1L2OC 1AJ4A 3JVTB 1CFDA 3JVTC 1QTXA 1DGVA 1DGUA 2CCMA 1J7QA 2QPTA 1WY9A 1RROA 4PALA 1SL8A 1GJYA 2LMTA 3VRQA 3NSLA 4N1FA 1B8LA 1BR1B 1YUSA 1XFYO 2CXJA 4OR9B 3GK4X 2WC8A 1QATA 3KPXA 2K7DA 3LLEA 2I18A 2BE6A 3QRXA 2G9BA 1FBVA 2BBMA 4GPLB 1NSHA 5CSNA 2ZFDA 3EK7A 2LC5A 3GK1A 1AUIB 3ZWHA 3RM1A 1BF5A 1C07A 2KI6C 3DVKA 1OMDA 3NSIA 1B8CA 1RWYA 4F0ZB 4HRGA 2A4JA 2MAZA 2O5GA 3DVMA 4GFTA 1GGZA 5HLVA 2LM5A 1DJZA 3A8RA 2KQYA 2WCEA 3BUWB 5D69A 1LKJA 1MHOA 1E8AA 1M45A 2LVIA 2F8PA 1JUOA 1MQ1A 3FS7A 3VRNA 2JWWA 1YURA 4MVFA 1UP5A 1B9AA 1N2DA 2WCFA 2KBMA 3TUYB 3TDZA 1NP8A 5ER4X 3TUYC 1A75A 1YX7A 1TCFA 4GNKB 2JTZA 2LVJA 5AFPA 1KSMA 1NWDA 1Y1UA 3DF0A 1MXLC 2K2FA 5D7FA 4DIRA 3DVEA 1QX2A 3AAJA 1ALWA 1SRAA 1QVIY 2TN4A 3NSKA 4YI8A 2LP2A 3PM8A 1XFVO 4CIDA 2CT9A 3BOWA 4U8DA 1BOCA 1Y1AA 1NIWA 2JU0A 2KAXA 4MLWA 1ZOTB 4DUQA 3I5GB 2BKHB 1QVIZ 2JQ6A 1S1EA 3I5GC 1XK4C 2B1UA 2PVBA 1DTLA 2E6WA 1IQ3A 1UHIA 5HKWA 3EVRA 2K0JA 4PCWA 2FJUB 1KFUL 1DJIA 5J3XA 2L2EA 4M2OA 1M46A 1AK8A 4DCKA 4ICBA 1KK7Y 4N5XA 2KI4B 1FI5A 2M8UA 4GAOA 2KI4C 1QX5B 4USLA 3EKJA 4PHJA 3CS1A 1KK7Z 1S6JA 2LVVA 1AP4A 1DVIA 3C1VA 1J7PA 5KU1A 1IJ5A 1EG3A 4I5JA 4P5OE 4TNCA 5CPVA 4C0JA 4N1GA 2L4IA 3I5FB 1R2UA 4PE1A 4AOMA 5CSIA 4A4BA 4YRUA 2BCBA 3I5FC 4AQJA 1J1EA 1TTXA 2BL0B 3CLNA 1YR5A 5F6TA 1CLLA 2PMYA 1K95A 2BL0C 2NZ0A 1DJYA 3CZTX 1XFZO 1PALA 1LA3A 2JC2A 2SCPA 2M97A 3WHTB 3FWCA 1CLBA 4WRIA 1A03A 4YBHB 4GGFC 1CLMA 4Q04A 1TOPA 1CNPA 1TIZA 4GUKA 4FQOA 2HETA 2JOJA 1KK8B 1QASA 2PRUA 5HKYA 1MWNA 1F71A 1KK8C 2AAOA 3EVUA 3IF7A 3I5HB 1SNLA 4I5KA 3PFVA 1EH2A 5B8IB 1XO5A 2LE9B 1IGVA 4IL1A 2KYCA 2LV7A 1NX3A 2H61A 2LAPA 2HF5A 3SG6A 2V53A 1QIWA 1IRJA 1CFCA 1MXEA 1GGWA 2LMUA 4ZCVA 1NCXA 2LUCA 1B8RA 1W7IB 2PSRA 2Y1MA 3CR2A 3ICBA 2FCDA 2WCBA 3SIAA 5HYDA 1BG1A 3SJSA 1NCYA 4YGCB 4I5LB 3BXKA 4C0KA 1YUUA 4OV2A 5KSZA 4YGAA 1SYMA 1EL4A 4BY5A 1F70A 3HX4A 1WDCC 2MA2A 1JBAA 3TDUA 1CFPA 2Y1NA 3OX5A 5PALA 1RECA 3KO0A 4OKHA 2OS8B 3NXAA 1ZMZA 2GGMA 4XYNA 2JXCA 2OS8C 1ODBA 4DRWA 1IJ6A 5AEQA 4NDCA 1CKKA 5CSFA 1J55A 4JPZB 3AKBA 1BLQA 3OB1B 2MBXA 1MR8A 3KHEA 3FIAA 2I7AA 2BE4A 1K8UA 2HPSA 5DKNA 5TNCA 1U5IB 2KAVA 2M49B 5JOLA 1S26D 1UUSA 1BMOA 1NUBA 4MEWA 1JSAA 3RLZA 1SBJA 2KI6D 1SKTA 1BJFA 3O2PA 1YX8A 4MSPA 4M2PA 2LVKA 3PSRA 1N0YA 1K96A 1ALVA 4PHMA 2WNDA 1L7ZA 2WORA 2Q91A 4C0LA 1W7JB 3KF9A 1PSBA 5I2OA 1F4OA 3EKHA 1KFXS 2F33A 1H8BA 3LL8B 1QS7A 3CR5X 2M3WA 1K9UA 1EXRA 4ZCUA 4XJKB 3E3RA 1M63B 2CBLA 1QJTA 2K7OA 2JT8A 1PULA 4CFQA 1C7VA 4BY4A 1UURA 3A4UB 3VRRA 1TNXA 2HQWA 1K9KA 2NCOA 1IWQA 3OP0A 2LNKA 5I8NA 1QLSA 1SCVA 2JPTA 1TNWA 4XJKA 1MF8B 5FYXA 4JWQA 4MRXA 1DJGA 2LCPA 1LXFC 2NCPA 3HCMA 3AAKA 1CM4A 2SASA 3TDIA 1XK4A 2AMIA 1NCZA 2BKIB 5DKQA 5DKRA 1CTRA 4CLNA 2M1KB 1B4CA 1BU3A 1SY9A 2Y5IA 5AERA 2KAYA 2LUXA 4NDDA 3H4SE 1DMOA 4I5NB 2DOQA 2I94A 1PK0D 3LK1A 1QV1A 1SW8A 2F3ZA 2KBIA 2KOTA 1PVBA 3BUXB 1F54A 4UPGA 1ZUZA 4WQ2A 2L51A 3PN7B 3GK2A 1Q80A 3OX6A 1FPWA 1K2HA 3PN7C 1JFJA 1WRZA 1OE9B 1S5GY 2L0PA 1UWOA 3SIBA 1UHJA 4WQ3A 4E68A 1AJ5A 1QXPA 3SG7A 3MSEB 1YRUB 1XVJA 1SK6D 1KSOA 4CPVA 2JULA 2JXLA 2MLEC 4MN0A 2EHBA 1PVAA 4QJ3B 1CDMA 2KNEA 1DT7B 2BECA 5BPJA 1SMGA 4GGFA 4M2QA 1B47A 1TRFA 4YGDB 1OOJA 1KWOB 3I5IB 3KEVA 1RFJA 1RJVA 1SL9A 4MZLA 3WHUB 3I5IC 1KWOC 5IBWA 2JTTA 2D8NA 1Y6WA 1EG4A 2ZN8A 2QACA 2G2BA 1G33A 4YGBB 1A4PA 2JT3A 3IQOA 3TS5C 1BT6A 1DF0B 3BQ3A 1OQPA 2CTNA 2KDHA 2NXQA 2OTGB 1F8HA 2OTGC 2JZIA 2L98A 3BYAA 1NPQA 1WDCB 1YVLA 2F2OA 3TZ1A 1G8IA 1V1FA 1XFUO 3O78A 1UHNA 1WRKA 3JTDB 3IQQA 5I2LA 2AUCA 1XFWO 1YTZC 1KQMB 3JTDC 2KQ6A 2LLSA 1WLMA 2FCEA 3EVVA 1KQMC 1M39A 1DF0A 1LINA 3AKAA 1CMGA 1DJWA 2KYFA 3GOFA 3OHMB 1SL7A 2JRFA 3DD4A 1RK9A 2CNPA 1K90D 3DVJA 1K94A 1NX1A 2L50A 4MZJA 3WXAA 2LHIA
chains in the Genus database with same CATH superfamily
1DJXA 2MLFC 2RGIA 1OOIX 5AANA 2OPOA 3PLFB 4NDBA 4L9MA 3CR4X 3DYEA 5K89A 1ZACA 3K21A 4OZDA 1Y1XA 2MRDA 1J1DA 2F2PA 1UHKA 2H2KA 3D0YB 3FWBA 1TNQA 1FF1A 3EK4A 3VGOA 2R2IA 3L4AA 1WRLA 4ORBB 1K93D 2ERBA 1SR6B 3SG2A 1SCMB 1TCOB 1JWDA 2WC6A 3O4YA 1Y0VH 1SR6C 1SCMC 1JC2A 1N65A 2JNXA 2LMVA 1F4QA 2BBNA 3ZNIA 1S3PA 3D10A 1KCYA 3F45A 4HSZA 3LK0A 1TUJA 4AQIA 2JNFA 3D0YA 1YVHA 5G08A 4YI9A 1U5IA 1FI6A 4CFRA 1SPYA 2PQLA 2JT0A 4HREE 2GV5A 3VROA 4PHNA 4P2YB 1DJHA 2K60A 3PJIA 1J7OA 1D1OA 1ZFSA 1XA5A 1A75B 1QX7A 2EGDA 4JQ0D 3DF0B 3DY9A 2M7LA 2PASA 3SG5A 1H4BA 4A4CA 2LP3A 1NX2A 2BCAA 5FI7A 1HQVA 1CDLA 1KFXL 3BUNB 3S0AA 2K2AA 4ORAB 2WCLA 3BOWB 2ZRTA 1F55A 4HRHA 2KHNA 3PATA 1DQEA 3BUMB 4GGNA 4PT1A 1GQMA 2M1UA 1A2XA 3SG4A 1TN4A 3PALA 1CB1A 1CMFA 1BODA 1K9PA 1WLZA 1QIVA 2E30A 2KGBC 2NLNA 4PDZA 2K8MB 4OVNF 4PHKA 2EC6B 3NHIA 3D76A 2LANA 4MBEA 4PE7A 3S0BA 5FI6A 2EC6C 3OGNA 1KQVA 1CM1A 1KFUS 1CDPA 1LVCD 4DS7A 2KSPA 1HT9A 3QMEA 5KTYA 1IQ5A 4GBAA 1IG5A 1NYAA 1V1GA 1J7RA 3BJHA 2KFFA 1OZOA 3CWGA 5JJGA 1CFFA 2KFHA 3B7AA 2I2RE 2P6BB 2K7BA 2ZN9A 5ER5A 4QJ4B 5GQQC 2LLUA 2PALA 1OMVA 3CGAA 2KFGA 1JF2A 1LA0A 1JF0A 5HLOA 3CZ1A 1QV0A 2FOTA 2COLB 3L4LA 3M0WA 3LCPC 5AXIA 5CSJA 1GM0A 3D73A 2VRGA 1OOGA 3EK8A 3SG3A 1SSEB 1Z4HA 1R6PA 2WCHA 2BCXA 2QEBA 4R1EA 5I2QA 1BR4B 1YUTA 5HKZA 4OCIA 1AVSA 2MHHA 2IS9A 4PE0A 1G4YR 2MJWB 4FTGA 3VB1A 1UHHA 3O6BA 1S5GZ 1AHRA 4PE4A 1B1GA 4QJ5B 1IH0A 2Q4UA 1XFXO 4ORCB 2K61A 2HQ8A 1S36A 2L5XB 3VRPA 1FW4A 3B86A 1IKUA 2KGRA 1A29A 3S0FA 1C7WA 2M7NA 2L4HA 4D1EA 1QLKA 1NX0A 1RTP1 1PSRA 2ZRSA 3BUOB 2KPHA 3DZTA 2ZKMX 2WCMA 4MRYA 2ZNEA 2FJYA 1B7TY 1VRKA 3TS5B 2Y4QA 3NSOA 2H61C 3OB2B 1CDNA 1S6CA 1XYDA 2H8VA 4YGEB 3UNWA 4ETOA 3N7HA 1OSAA 1EJ3A 1B7TZ 1MUXA 1YRTB 2M0RA 3CTNA 3I5HC 4JKTA 1PRWA 1T14A 1S6IA 2M29A 2GGZA 1OMRA 3WNXB 2F3YA 1OZSA 2KLDA 2LHLA 1M31A 2ISDA 1DC1A 2O60A 2WOSA 1JFKA 2M9GA 4MZKA 1L2OB 2LLTA 4NQGA 1TNPA 2ZNDA 1X02A 2K7CA 5D3OA 1L2OC 1AJ4A 3JVTB 1CFDA 3JVTC 1QTXA 1DGVA 1DGUA 2CCMA 1J7QA 2QPTA 1WY9A 1RROA 4PALA 1SL8A 1GJYA 2LMTA 3VRQA 3NSLA 4N1FA 1B8LA 1BR1B 1YUSA 1XFYO 2CXJA 4OR9B 3GK4X 2WC8A 3BFHA 1QATA 3KPXA 1OOFA 2K7DA 3LLEA 2I18A 2BE6A 3QRXA 2G9BA 1FBVA 4FQTA 5FI2A 2BBMA 4GPLB 1NSHA 5CSNA 2ZFDA 3EK7A 2LC5A 3GK1A 1C3ZA 1AUIB 3ZWHA 3RM1A 1BF5A 1C07A 2KI6C 3DVKA 1OMDA 3NSIA 1B8CA 1RWYA 4F7FA 4F0ZB 4HRGA 2A4JA 2MAZA 3NGVA 1OW4A 2O5GA 3DVMA 4GFTA 1GGZA 5HLVA 2LM5A 1DJZA 3A8RA 2KQYA 2WCEA 3BUWB 5D69A 1LKJA 1MHOA 1E8AA 1M45A 2LVIA 2F8PA 1JUOA 1MQ1A 3FS7A 3V2LA 3VRNA 2JWWA 5I94A 1YURA 4MVFA 1UP5A 1B9AA 1N2DA 2WCFA 2KBMA 3TUYB 3TDZA 1NP8A 5ER4X 3TUYC 1A75A 1YX7A 1TCFA 4GNKB 2BNXA 2JTZA 2LVJA 3R72A 5AFPA 1KSMA 1NWDA 1Y1UA 3DF0A 1MXLC 2K2FA 5D7FA 4DIRA 5HL1A 3DVEA 1QX2A 3SS5A 3AAJA 1ALWA 1SRAA 1QVIY 2TN4A 2GTEA 3NSKA 4YI8A 2LP2A 3PM8A 1XFVO 4CIDA 2CT9A 3BOWA 4U8DA 1BOCA 1Y1AA 1NIWA 2JU0A 2KAXA 4MLWA 1ZOTB 4DUQA 3I5GB 2BKHB 1QVIZ 2JQ6A 1S1EA 3I5GC 4INWA 1DELA 1XK4C 2B1UA 2PVBA 1DTLA 2E6WA 1IQ3A 3EG5B 1UHIA 5HKWA 3EVRA 2K0JA 4PCWA 2FJUB 1KFUL 1DJIA 5J3XA 2L2EA 4M2OA 1M46A 1AK8A 4DCKA 4ICBA 1KK7Y 2QEOA 4N5XA 2KI4B 1FI5A 2M8UA 4GAOA 2KI4C 1QX5B 2QEVA 4USLA 3EKJA 4PHJA 1W9ZA 3CS1A 1KK7Z 1S6JA 2LVVA 1TUZA 1AP4A 1DVIA 3C1VA 3UO9A 1J7PA 5KU1A 5DICA 3R1VA 1IJ5A 1EG3A 3SS4A 4I5JA 4P5OE 4TNCA 2JPOA 5CPVA 4C0JA 4N1GA 2L4IA 3I5FB 1R2UA 4PE1A 4AOMA 5CSIA 4A4BA 4YRUA 2BCBA 3I5FC 3D75A 4AQJA 1J1EA 1TTXA 2BL0B 3CLNA 1YR5A 5F6TA 1CLLA 2PMYA 1K95A 2BL0C 2NZ0A 1DJYA 3DXLA 3CZTX 1XFZO 2L5YA 4JD9A 1PALA 1LA3A 2JC2A 2SCPA 3BFBA 2M97A 3WHTB 3FWCA 3NHTA 1OOHA 1CLBA 4WRIA 1A03A 4YBHB 1Z2CB 1CLMA 4GGFC 4Q04A 1TOPA 1CNPA 1TIZA 4GUKA 4FQOA 2HETA 2JOJA 1KK8B 1QASA 2PRUA 5HKYA 1MWNA 1F71A 1KK8C 2AAOA 2BAPA 3EVUA 3IF7A 3I5HB 1SNLA 3S0GA 4I5KA 3PFVA 1EH2A 5B8IB 1XO5A 2LE9B 3BFAA 2WC5A 1IGVA 4IL1A 2KYCA 2LV7A 1NX3A 2WCJA 2H61A 3K1EA 2LAPA 2HF5A 3SG6A 2V53A 1QIWA 2KLEA 1DEKA 1IRJA 1CFCA 1MXEA 1GGWA 2LMUA 3R1PA 4ZCVA 1NCXA 2PYQA 2LUCA 1B8RA 1W7IB 2PSRA 2Y1MA 3CR2A 3FE6A 2FCDA 2WCBA 3ICBA 3SIAA 5HYDA 3SJSA 1BG1A 1NCYA 4YGCB 4I5LB 3FE9A 3BXKA 4C0KA 1YUUA 4OV2A 3Q8IA 4YGAA 1SYMA 1EL4A 5KSZA 4BY5A 1F70A 3HX4A 1WDCC 2MA2A 1JBAA 3B87A 3TDUA 1CFPA 2Y1NA 3OX5A 5PALA 1RECA 2QEHA 3KO0A 4OKHA 2OS8B 3NXAA 1ZMZA 2GGMA 4XYNA 2JXCA 2OS8C 1ODBA 3D78A 4DRWA 1IJ6A 5AEQA 3FE8A 4NDCA 1C3YA 5CSFA 1J55A 1CKKA 4JPZB 3AKBA 3B88A 3PM2A 1BLQA 3OB1B 2MBXA 1MR8A 3KHEA 3FIAA 2I7AA 2BE4A 1K8UA 2HPSA 5DKNA 5TNCA 1U5IB 2KAVA 2M49B 5JOLA 1S26D 1UUSA 1BMOA 1NUBA 4MEWA 1JSAA 3RLZA 1SBJA 2KI6D 1SKTA 1BJFA 3O2PA 1YX8A 4MSPA 4M2PA 2LVKA 3PSRA 1N0YA 1K96A 1ALVA 4PHMA 2L2CA 2WNDA 1L7ZA 2WORA 1LS8A 2Q91A 4C0LA 1W7JB 3KF9A 1PSBA 5I2OA 1F4OA 3EKHA 3S0DA 1KFXS 1ORGA 2F33A 1H8BA 3LL8B 1QS7A 3CR5X 2M3WA 1K9UA 1EXRA 3CDNA 4ZCUA 4XJKB 3E3RA 3D74A 1M63B 2CBLA 1QJTA 2K7OA 2JT8A 1PULA 4CFQA 1C7VA 4BY4A 1UURA 3A4UB 3VRRA 1TNXA 2HQWA 1K9KA 2NCOA 1IWQA 3OP0A 2LNKA 5I8NA 1QLSA 1SCVA 2JPTA 1TNWA 4XJKA 1MF8B 5FYXA 4IJ7A 4JWQA 4MRXA 1DJGA 2LCPA 1LXFC 2NCPA 3HCMA 3AAKA 1CM4A 2SASA 3TDIA 1XK4A 2AMIA 1NCZA 2BKIB 5DKQA 5DKRA 1CTRA 3CZ2A 4CLNA 2M1KB 1B4CA 1BU3A 1SY9A 2Y5IA 5AERA 2KAYA 2LUXA 4NDDA 3H4SE 1DMOA 4I5NB 2DOQA 3R1OA 2I94A 1PK0D 2WCKA 1TWOA 1QV1A 3LK1A 1SW8A 2F3ZA 2KBIA 2KOTA 1PVBA 3BUXB 3IVTA 4UPGA 1F54A 1ZUZA 4WQ2A 1XFRA 2L51A 3PN7B 4KYNA 3GK2A 1Q80A 3OX6A 1FPWA 1K2HA 3PN7C 3CZ0A 3SS3A 1JFJA 3RZSA 1WRZA 1OE9B 1S5GY 2L0PA 3CYZA 1UWOA 2YGUA 3SIBA 3S0EA 1UHJA 4WQ3A 4E68A 1AJ5A 1QXPA 3SG7A 3MSEB 1YRUB 1XVJA 1SK6D 1KSOA 3D77A 4CPVA 2JULA 2JXLA 2MLEC 4MN0A 2EHBA 1PVAA 4QJ3B 1CDMA 2KNEA 1DT7B 2BECA 5EL2A 5BPJA 1SMGA 4GGFA 4M2QA 1B47A 1TRFA 4YGDB 1OOJA 1KWOB 3I5IB 3KEVA 1RFJA 1P28A 1RJVA 1SL9A 4MZLA 3WHUB 3I5IC 1KWOC 5IBWA 2JTTA 2D8NA 1Y6WA 1EG4A 2ZN8A 2QACA 3B6XA 3L47A 2G2BA 1G33A 4YGBB 1A4PA 2JT3A 3IQOA 3TS5C 1BT6A 1DF0B 3BQ3A 1OQPA 2CTNA 2KDHA 2NXQA 2OTGB 2P71A 1F8HA 2OTGC 2JZIA 2L98A 3OBVA 1QWVA 4INXA 3BYAA 1NPQA 1WDCB 1YVLA 2F2OA 3TZ1A 1G8IA 1V1FA 1XFUO 3O78A 1UHNA 1WRKA 3JTDB 3IQQA 5I2LA 2AUCA 2P70A 1XFWO 1YTZC 1KQMB 3O4XA 3JTDC 2KQ6A 2LLSA 1WLMA 2FCEA 3EVVA 1KQMC 1M39A 1DF0A 1LINA 3AKAA 1CMGA 1DJWA 2KYFA 3GOFA 2QDIA 3OHMB 1SL7A 2JRFA 1IIOA 3DD4A 1RK9A 2CNPA 1K90D 3CABA 3DVJA 1K94A 1NX1A 2L50A 4MZJA 3WXAA 2LHIA
chains in the Genus database with same CATH topology
1DJXA 2MLFC 2RGIA 5AANA 2OPOA 3PLFB 4NDBA 4L9MA 3CR4X 5K89A 1ZACA 3K21A 1Y1XA 2MRDA 1J1DA 2F2PA 1UHKA 2H2KA 3D0YB 3FWBA 1TNQA 1FF1A 3EK4A 3VGOA 2R2IA 4ORBB 1WRLA 1K93D 1SR6B 3SG2A 1SCMB 1TCOB 1JWDA 3O4YA 1Y0VH 1SR6C 1SCMC 1JC2A 1N65A 2JNXA 2LMVA 1F4QA 2BBNA 3ZNIA 1S3PA 3D10A 1KCYA 3F45A 4HSZA 3LK0A 4AQIA 2JNFA 3D0YA 1YVHA 5G08A 4YI9A 1U5IA 1FI6A 4CFRA 1SPYA 2JT0A 4HREE 2GV5A 3VROA 4PHNA 4P2YB 1DJHA 1J7OA 1D1OA 1ZFSA 1XA5A 1A75B 1QX7A 2EGDA 4JQ0D 3DF0B 2M7LA 2PASA 3SG5A 1H4BA 4A4CA 2LP3A 1NX2A 2BCAA 1HQVA 1CDLA 1KFXL 3BUNB 2K2AA 4ORAB 1F55A 3BOWB 2ZRTA 4HRHA 2KHNA 3PATA 3BUMB 4GGNA 1GQMA 2M1UA 1A2XA 3SG4A 1TN4A 3PALA 1CB1A 1CMFA 1BODA 1K9PA 1WLZA 1QIVA 2E30A 2KGBC 2NLNA 4PDZA 2K8MB 4OVNF 4PHKA 2EC6B 4MBEA 2LANA 4PE7A 2EC6C 1KQVA 1CM1A 1KFUS 1CDPA 1LVCD 4DS7A 2KSPA 1HT9A 5KTYA 1IQ5A 4GBAA 1IG5A 1NYAA 1V1GA 1J7RA 2KFFA 1OZOA 3CWGA 5JJGA 1CFFA 2KFHA 5ER5A 2I2RE 2P6BB 2K7BA 2ZN9A 4QJ4B 5GQQC 2LLUA 2PALA 1OMVA 3CGAA 2KFGA 1JF2A 1LA0A 1JF0A 5HLOA 1QV0A 2FOTA 2COLB 3M0WA 3LCPC 5AXIA 5CSJA 2VRGA 3EK8A 3SG3A 1R6PA 2BCXA 4R1EA 5I2QA 1BR4B 1YUTA 5HKZA 4OCIA 1AVSA 2MHHA 2IS9A 4PE0A 1G4YR 2MJWB 4FTGA 1UHHA 3O6BA 1S5GZ 1AHRA 4PE4A 1B1GA 4QJ5B 1IH0A 2Q4UA 1XFXO 4ORCB 2K61A 2HQ8A 1S36A 2L5XB 3VRPA 1FW4A 1IKUA 2KGRA 1A29A 1C7WA 2M7NA 2L4HA 4D1EA 1QLKA 1NX0A 1RTP1 1PSRA 2ZRSA 3BUOB 2ZKMX 4MRYA 2ZNEA 1B7TY 1VRKA 3TS5B 2Y4QA 3NSOA 2H61C 3OB2B 1CDNA 1S6CA 1XYDA 4YGEB 4ETOA 1OSAA 1EJ3A 1B7TZ 1MUXA 1YRTB 2M0RA 3CTNA 3I5HC 1PRWA 2M29A 1S6IA 2GGZA 1OMRA 3WNXB 2F3YA 1OZSA 2LHLA 1M31A 2ISDA 2O60A 2WOSA 1JFKA 2M9GA 4MZKA 1L2OB 2LLTA 4NQGA 1TNPA 2ZNDA 1X02A 2K7CA 1L2OC 1AJ4A 3JVTB 1CFDA 3JVTC 1QTXA 1DGVA 1DGUA 2CCMA 1J7QA 2QPTA 1WY9A 1RROA 4PALA 1SL8A 1GJYA 2LMTA 3VRQA 3NSLA 4N1FA 1B8LA 1BR1B 1YUSA 1XFYO 2CXJA 4OR9B 3GK4X 2WC8A 1QATA 3KPXA 2K7DA 3LLEA 2I18A 2BE6A 3QRXA 2G9BA 1FBVA 2BBMA 4GPLB 1NSHA 5CSNA 2ZFDA 3EK7A 2LC5A 3GK1A 1AUIB 3ZWHA 3RM1A 1BF5A 1C07A 2KI6C 3DVKA 1OMDA 3NSIA 1B8CA 1RWYA 4F0ZB 4HRGA 2A4JA 2MAZA 2O5GA 3DVMA 4GFTA 1GGZA 5HLVA 2LM5A 1DJZA 3A8RA 2KQYA 2WCEA 3BUWB 5D69A 1LKJA 1MHOA 1E8AA 1M45A 2LVIA 2F8PA 1JUOA 1MQ1A 3FS7A 3VRNA 2JWWA 1YURA 4MVFA 1UP5A 1B9AA 1N2DA 2WCFA 2KBMA 3TUYB 3TDZA 1NP8A 5ER4X 3TUYC 1A75A 1YX7A 1TCFA 4GNKB 2JTZA 2LVJA 5AFPA 1KSMA 1NWDA 1Y1UA 3DF0A 1MXLC 2K2FA 5D7FA 4DIRA 3DVEA 1QX2A 3AAJA 1ALWA 1SRAA 1QVIY 2TN4A 3NSKA 4YI8A 2LP2A 3PM8A 1XFVO 4CIDA 2CT9A 3BOWA 4U8DA 1BOCA 1Y1AA 1NIWA 2JU0A 2KAXA 4MLWA 1ZOTB 4DUQA 3I5GB 2BKHB 1QVIZ 2JQ6A 1S1EA 3I5GC 1XK4C 2B1UA 2PVBA 1DTLA 2E6WA 1IQ3A 1UHIA 5HKWA 3EVRA 2K0JA 4PCWA 2FJUB 1KFUL 1DJIA 5J3XA 2L2EA 4M2OA 1M46A 1AK8A 4DCKA 4ICBA 1KK7Y 4N5XA 2KI4B 1FI5A 2M8UA 4GAOA 2KI4C 1QX5B 4USLA 3EKJA 4PHJA 3CS1A 1KK7Z 1S6JA 2LVVA 1AP4A 1DVIA 3C1VA 1J7PA 5KU1A 1IJ5A 1EG3A 4I5JA 4P5OE 4TNCA 5CPVA 4C0JA 4N1GA 2L4IA 3I5FB 1R2UA 4PE1A 4AOMA 5CSIA 4A4BA 4YRUA 2BCBA 3I5FC 4AQJA 1J1EA 1TTXA 2BL0B 3CLNA 1YR5A 5F6TA 1CLLA 2PMYA 1K95A 2BL0C 2NZ0A 1DJYA 3CZTX 1XFZO 1PALA 1LA3A 2JC2A 2SCPA 2M97A 3WHTB 3FWCA 1CLBA 4WRIA 1A03A 4YBHB 4GGFC 1CLMA 4Q04A 1TOPA 1CNPA 1TIZA 4GUKA 4FQOA 2HETA 2JOJA 1KK8B 1QASA 2PRUA 5HKYA 1MWNA 1F71A 1KK8C 2AAOA 3EVUA 3IF7A 3I5HB 1SNLA 4I5KA 3PFVA 1EH2A 5B8IB 1XO5A 2LE9B 1IGVA 4IL1A 2KYCA 2LV7A 1NX3A 2H61A 2LAPA 2HF5A 3SG6A 2V53A 1QIWA 1IRJA 1CFCA 1MXEA 1GGWA 2LMUA 4ZCVA 1NCXA 2LUCA 1B8RA 1W7IB 2PSRA 2Y1MA 3CR2A 3ICBA 2FCDA 2WCBA 3SIAA 5HYDA 1BG1A 3SJSA 1NCYA 4YGCB 4I5LB 3BXKA 4C0KA 1YUUA 4OV2A 5KSZA 4YGAA 1SYMA 1EL4A 4BY5A 1F70A 3HX4A 1WDCC 2MA2A 1JBAA 3TDUA 1CFPA 2Y1NA 3OX5A 5PALA 1RECA 3KO0A 4OKHA 2OS8B 3NXAA 1ZMZA 2GGMA 4XYNA 2JXCA 2OS8C 1ODBA 4DRWA 1IJ6A 5AEQA 4NDCA 1CKKA 5CSFA 1J55A 4JPZB 3AKBA 1BLQA 3OB1B 2MBXA 1MR8A 3KHEA 3FIAA 2I7AA 2BE4A 1K8UA 2HPSA 5DKNA 5TNCA 1U5IB 2KAVA 2M49B 5JOLA 1S26D 1UUSA 1BMOA 1NUBA 4MEWA 1JSAA 3RLZA 1SBJA 2KI6D 1SKTA 1BJFA 3O2PA 1YX8A 4MSPA 4M2PA 2LVKA 3PSRA 1N0YA 1K96A 1ALVA 4PHMA 2WNDA 1L7ZA 2WORA 2Q91A 4C0LA 1W7JB 3KF9A 1PSBA 5I2OA 1F4OA 3EKHA 1KFXS 2F33A 1H8BA 3LL8B 1QS7A 3CR5X 2M3WA 1K9UA 1EXRA 4ZCUA 4XJKB 3E3RA 1M63B 2CBLA 1QJTA 2K7OA 2JT8A 1PULA 4CFQA 1C7VA 4BY4A 1UURA 3A4UB 3VRRA 1TNXA 2HQWA 1K9KA 2NCOA 1IWQA 3OP0A 2LNKA 5I8NA 1QLSA 1SCVA 2JPTA 1TNWA 4XJKA 1MF8B 5FYXA 4JWQA 4MRXA 1DJGA 2LCPA 1LXFC 2NCPA 3HCMA 3AAKA 1CM4A 2SASA 3TDIA 1XK4A 2AMIA 1NCZA 2BKIB 5DKQA 5DKRA 1CTRA 4CLNA 2M1KB 1B4CA 1BU3A 1SY9A 2Y5IA 5AERA 2KAYA 2LUXA 4NDDA 3H4SE 1DMOA 4I5NB 2DOQA 2I94A 1PK0D 3LK1A 1QV1A 1SW8A 2F3ZA 2KBIA 2KOTA 1PVBA 3BUXB 1F54A 4UPGA 1ZUZA 4WQ2A 2L51A 3PN7B 3GK2A 1Q80A 3OX6A 1FPWA 1K2HA 3PN7C 1JFJA 1WRZA 1OE9B 1S5GY 2L0PA 1UWOA 3SIBA 1UHJA 4WQ3A 4E68A 1AJ5A 1QXPA 3SG7A 3MSEB 1YRUB 1XVJA 1SK6D 1KSOA 4CPVA 2JULA 2JXLA 2MLEC 4MN0A 2EHBA 1PVAA 4QJ3B 1CDMA 2KNEA 1DT7B 2BECA 5BPJA 1SMGA 4GGFA 4M2QA 1B47A 1TRFA 4YGDB 1OOJA 1KWOB 3I5IB 3KEVA 1RFJA 1RJVA 1SL9A 4MZLA 3WHUB 3I5IC 1KWOC 5IBWA 2JTTA 2D8NA 1Y6WA 1EG4A 2ZN8A 2QACA 2G2BA 1G33A 4YGBB 1A4PA 2JT3A 3IQOA 3TS5C 1BT6A 1DF0B 3BQ3A 1OQPA 2CTNA 2KDHA 2NXQA 2OTGB 1F8HA 2OTGC 2JZIA 2L98A 3BYAA 1NPQA 1WDCB 1YVLA 2F2OA 3TZ1A 1G8IA 1V1FA 1XFUO 3O78A 1UHNA 1WRKA 3JTDB 3IQQA 5I2LA 2AUCA 1XFWO 1YTZC 1KQMB 3JTDC 2KQ6A 2LLSA 1WLMA 2FCEA 3EVVA 1KQMC 1M39A 1DF0A 1LINA 3AKAA 1CMGA 1DJWA 2KYFA 3GOFA 3OHMB 1SL7A 2JRFA 3DD4A 1RK9A 2CNPA 1K90D 3DVJA 1K94A 1NX1A 2L50A 4MZJA 3WXAA 2LHIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DJX A;  2MLF C;  2RGI A;  5AAN A;  2OPO A;  3PLF B;  4NDB A;  4L9M A;  3CR4 X;  5K89 A;  1ZAC A;  3K21 A;  1Y1X A;  2MRD A;  1J1D A;  2F2P A;  1UHK A;  2H2K A;  3D0Y B;  3FWB A;  1TNQ A;  1FF1 A;  3EK4 A;  3VGO A;  2R2I A;  4ORB B;  1WRL A;  1K93 D;  1SR6 B;  3SG2 A;  1SCM B;  1TCO B;  1JWD A;  3O4Y A;  1Y0V H;  1SR6 C;  1SCM C;  1JC2 A;  1N65 A;  2JNX A;  2LMV A;  1F4Q A;  2BBN A;  3ZNI A;  1S3P A;  3D10 A;  1KCY A;  3F45 A;  4HSZ A;  3LK0 A;  4AQI A;  2JNF A;  3D0Y A;  1YVH A;  5G08 A;  4YI9 A;  1U5I A;  1FI6 A;  4CFR A;  1SPY A;  2JT0 A;  4HRE E;  2GV5 A;  3VRO A;  4PHN A;  4P2Y B;  1DJH A;  1J7O A;  1D1O A;  1ZFS A;  1XA5 A;  1A75 B;  1QX7 A;  2EGD A;  4JQ0 D;  3DF0 B;  2M7L A;  2PAS A;  3SG5 A;  1H4B A;  4A4C A;  2LP3 A;  1NX2 A;  2BCA A;  1HQV A;  1CDL A;  1KFX L;  3BUN B;  2K2A A;  4ORA B;  1F55 A;  3BOW B;  2ZRT A;  4HRH A;  2KHN A;  3PAT A;  3BUM B;  4GGN A;  1GQM A;  2M1U A;  1A2X A;  3SG4 A;  1TN4 A;  3PAL A;  1CB1 A;  1CMF A;  1BOD A;  1K9P A;  1WLZ A;  1QIV A;  2E30 A;  2KGB C;  2NLN A;  4PDZ A;  2K8M B;  4OVN F;  4PHK A;  2EC6 B;  4MBE A;  2LAN A;  4PE7 A;  2EC6 C;  1KQV A;  1CM1 A;  1KFU S;  1CDP A;  1LVC D;  4DS7 A;  2KSP A;  1HT9 A;  5KTY A;  1IQ5 A;  4GBA A;  1IG5 A;  1NYA A;  1V1G A;  1J7R A;  2KFF A;  1OZO A;  3CWG A;  5JJG A;  1CFF A;  2KFH A;  5ER5 A;  2I2R E;  2P6B B;  2K7B A;  2ZN9 A;  4QJ4 B;  5GQQ C;  2LLU A;  2PAL A;  1OMV A;  3CGA A;  2KFG A;  1JF2 A;  1LA0 A;  1JF0 A;  5HLO A;  1QV0 A;  2FOT A;  2COL B;  3M0W A;  3LCP C;  5AXI A;  5CSJ A;  2VRG A;  3EK8 A;  3SG3 A;  1R6P A;  2BCX A;  4R1E A;  5I2Q A;  1BR4 B;  1YUT A;  5HKZ A;  4OCI A;  1AVS A;  2MHH A;  2IS9 A;  4PE0 A;  1G4Y R;  2MJW B;  4FTG A;  1UHH A;  3O6B A;  1S5G Z;  1AHR A;  4PE4 A;  1B1G A;  4QJ5 B;  1IH0 A;  2Q4U A;  1XFX O;  4ORC B;  2K61 A;  2HQ8 A;  1S36 A;  2L5X B;  3VRP A;  1FW4 A;  1IKU A;  2KGR A;  1A29 A;  1C7W A;  2M7N A;  2L4H A;  4D1E A;  1QLK A;  1NX0 A;  1RTP 1;  1PSR A;  2ZRS A;  3BUO B;  2ZKM X;  4MRY A;  2ZNE A;  1B7T Y;  1VRK A;  3TS5 B;  2Y4Q A;  3NSO A;  2H61 C;  3OB2 B;  1CDN A;  1S6C A;  1XYD A;  4YGE B;  4ETO A;  1OSA A;  1EJ3 A;  1B7T Z;  1MUX A;  1YRT B;  2M0R A;  3CTN A;  3I5H C;  1PRW A;  2M29 A;  1S6I A;  2GGZ A;  1OMR A;  3WNX B;  2F3Y A;  1OZS A;  2LHL A;  1M31 A;  2ISD A;  2O60 A;  2WOS A;  1JFK A;  2M9G A;  4MZK A;  1L2O B;  2LLT A;  4NQG A;  1TNP A;  2ZND A;  1X02 A;  2K7C A;  1L2O C;  1AJ4 A;  3JVT B;  1CFD A;  3JVT C;  1QTX A;  1DGV A;  1DGU A;  2CCM A;  1J7Q A;  2QPT A;  1WY9 A;  1RRO A;  4PAL A;  1SL8 A;  1GJY A;  2LMT A;  3VRQ A;  3NSL A;  4N1F A;  1B8L A;  1BR1 B;  1YUS A;  1XFY O;  2CXJ A;  4OR9 B;  3GK4 X;  2WC8 A;  1QAT A;  3KPX A;  2K7D A;  3LLE A;  2I18 A;  2BE6 A;  3QRX A;  2G9B A;  1FBV A;  2BBM A;  4GPL B;  1NSH A;  5CSN A;  2ZFD A;  3EK7 A;  2LC5 A;  3GK1 A;  1AUI B;  3ZWH A;  3RM1 A;  1BF5 A;  1C07 A;  2KI6 C;  3DVK A;  1OMD A;  3NSI A;  1B8C A;  1RWY A;  4F0Z B;  4HRG A;  2A4J A;  2MAZ A;  2O5G A;  3DVM A;  4GFT A;  1GGZ A;  5HLV A;  2LM5 A;  1DJZ A;  3A8R A;  2KQY A;  2WCE A;  3BUW B;  5D69 A;  1LKJ A;  1MHO A;  1E8A A;  1M45 A;  2LVI A;  2F8P A;  1JUO A;  1MQ1 A;  3FS7 A;  3VRN A;  2JWW A;  1YUR A;  4MVF A;  1UP5 A;  1B9A A;  1N2D A;  2WCF A;  2KBM A;  3TUY B;  3TDZ A;  1NP8 A;  5ER4 X;  3TUY C;  1A75 A;  1YX7 A;  1TCF A;  4GNK B;  2JTZ A;  2LVJ A;  5AFP A;  1KSM A;  1NWD A;  1Y1U A;  3DF0 A;  1MXL C;  2K2F A;  5D7F A;  4DIR A;  3DVE A;  1QX2 A;  3AAJ A;  1ALW A;  1SRA A;  1QVI Y;  2TN4 A;  3NSK A;  4YI8 A;  2LP2 A;  3PM8 A;  1XFV O;  4CID A;  2CT9 A;  3BOW A;  4U8D A;  1BOC A;  1Y1A A;  1NIW A;  2JU0 A;  2KAX A;  4MLW A;  1ZOT B;  4DUQ A;  3I5G B;  2BKH B;  1QVI Z;  2JQ6 A;  1S1E A;  3I5G C;  1XK4 C;  2B1U A;  2PVB A;  1DTL A;  2E6W A;  1IQ3 A;  1UHI A;  5HKW A;  3EVR A;  2K0J A;  4PCW A;  2FJU B;  1KFU L;  1DJI A;  5J3X A;  2L2E A;  4M2O A;  1M46 A;  1AK8 A;  4DCK A;  4ICB A;  1KK7 Y;  4N5X A;  2KI4 B;  1FI5 A;  2M8U A;  4GAO A;  2KI4 C;  1QX5 B;  4USL A;  3EKJ A;  4PHJ A;  3CS1 A;  1KK7 Z;  1S6J A;  2LVV A;  1AP4 A;  1DVI A;  3C1V A;  1J7P A;  5KU1 A;  1IJ5 A;  1EG3 A;  4I5J A;  4P5O E;  4TNC A;  5CPV A;  4C0J A;  4N1G A;  2L4I A;  3I5F B;  1R2U A;  4PE1 A;  4AOM A;  5CSI A;  4A4B A;  4YRU A;  2BCB A;  3I5F C;  4AQJ A;  1J1E A;  1TTX A;  2BL0 B;  3CLN A;  1YR5 A;  5F6T A;  1CLL A;  2PMY A;  1K95 A;  2BL0 C;  2NZ0 A;  1DJY A;  3CZT X;  1XFZ O;  1PAL A;  1LA3 A;  2JC2 A;  2SCP A;  2M97 A;  3WHT B;  3FWC A;  1CLB A;  4WRI A;  1A03 A;  4YBH B;  4GGF C;  1CLM A;  4Q04 A;  1TOP A;  1CNP A;  1TIZ A;  4GUK A;  4FQO A;  2HET A;  2JOJ A;  1KK8 B;  1QAS A;  2PRU A;  5HKY A;  1MWN A;  1F71 A;  1KK8 C;  2AAO A;  3EVU A;  3IF7 A;  3I5H B;  1SNL A;  4I5K A;  3PFV A;  1EH2 A;  5B8I B;  1XO5 A;  2LE9 B;  1IGV A;  4IL1 A;  2KYC A;  2LV7 A;  1NX3 A;  2H61 A;  2LAP A;  2HF5 A;  3SG6 A;  2V53 A;  1QIW A;  1IRJ A;  1CFC A;  1MXE A;  1GGW A;  2LMU A;  4ZCV A;  1NCX A;  2LUC A;  1B8R A;  1W7I B;  2PSR A;  2Y1M A;  3CR2 A;  3ICB A;  2FCD A;  2WCB A;  3SIA A;  5HYD A;  1BG1 A;  3SJS A;  1NCY A;  4YGC B;  4I5L B;  3BXK A;  4C0K A;  1YUU A;  4OV2 A;  5KSZ A;  4YGA A;  1SYM A;  1EL4 A;  4BY5 A;  1F70 A;  3HX4 A;  1WDC C;  2MA2 A;  1JBA A;  3TDU A;  1CFP A;  2Y1N A;  3OX5 A;  5PAL A;  1REC A;  3KO0 A;  4OKH A;  2OS8 B;  3NXA A;  1ZMZ A;  2GGM A;  4XYN A;  2JXC A;  2OS8 C;  1ODB A;  4DRW A;  1IJ6 A;  5AEQ A;  4NDC A;  1CKK A;  5CSF A;  1J55 A;  4JPZ B;  3AKB A;  1BLQ A;  3OB1 B;  2MBX A;  1MR8 A;  3KHE A;  3FIA A;  2I7A A;  2BE4 A;  1K8U A;  2HPS A;  5DKN A;  5TNC A;  1U5I B;  2KAV A;  2M49 B;  5JOL A;  1S26 D;  1UUS A;  1BMO A;  1NUB A;  4MEW A;  1JSA A;  3RLZ A;  1SBJ A;  2KI6 D;  1SKT A;  1BJF A;  3O2P A;  1YX8 A;  4MSP A;  4M2P A;  2LVK A;  3PSR A;  1N0Y A;  1K96 A;  1ALV A;  4PHM A;  2WND A;  1L7Z A;  2WOR A;  2Q91 A;  4C0L A;  1W7J B;  3KF9 A;  1PSB A;  5I2O A;  1F4O A;  3EKH A;  1KFX S;  2F33 A;  1H8B A;  3LL8 B;  1QS7 A;  3CR5 X;  2M3W A;  1K9U A;  1EXR A;  4ZCU A;  4XJK B;  3E3R A;  1M63 B;  2CBL A;  1QJT A;  2K7O A;  2JT8 A;  1PUL A;  4CFQ A;  1C7V A;  4BY4 A;  1UUR A;  3A4U B;  3VRR A;  1TNX A;  2HQW A;  1K9K A;  2NCO A;  1IWQ A;  3OP0 A;  2LNK A;  5I8N A;  1QLS A;  1SCV A;  2JPT A;  1TNW A;  4XJK A;  1MF8 B;  5FYX A;  4JWQ A;  4MRX A;  1DJG A;  2LCP A;  1LXF C;  2NCP A;  3HCM A;  3AAK A;  1CM4 A;  2SAS A;  3TDI A;  1XK4 A;  2AMI A;  1NCZ A;  2BKI B;  5DKQ A;  5DKR A;  1CTR A;  4CLN A;  2M1K B;  1B4C A;  1BU3 A;  1SY9 A;  2Y5I A;  5AER A;  2KAY A;  2LUX A;  4NDD A;  3H4S E;  1DMO A;  4I5N B;  2DOQ A;  2I94 A;  1PK0 D;  3LK1 A;  1QV1 A;  1SW8 A;  2F3Z A;  2KBI A;  2KOT A;  1PVB A;  3BUX B;  1F54 A;  4UPG A;  1ZUZ A;  4WQ2 A;  2L51 A;  3PN7 B;  3GK2 A;  1Q80 A;  3OX6 A;  1FPW A;  1K2H A;  3PN7 C;  1JFJ A;  1WRZ A;  1OE9 B;  1S5G Y;  2L0P A;  1UWO A;  3SIB A;  1UHJ A;  4WQ3 A;  4E68 A;  1AJ5 A;  1QXP A;  3SG7 A;  3MSE B;  1YRU B;  1XVJ A;  1SK6 D;  1KSO A;  4CPV A;  2JUL A;  2JXL A;  2MLE C;  4MN0 A;  2EHB A;  1PVA A;  4QJ3 B;  1CDM A;  2KNE A;  1DT7 B;  2BEC A;  5BPJ A;  1SMG A;  4GGF A;  4M2Q A;  1B47 A;  1TRF A;  4YGD B;  1OOJ A;  1KWO B;  3I5I B;  3KEV A;  1RFJ A;  1RJV A;  1SL9 A;  4MZL A;  3WHU B;  3I5I C;  1KWO C;  5IBW A;  2JTT A;  2D8N A;  1Y6W A;  1EG4 A;  2ZN8 A;  2QAC A;  2G2B A;  1G33 A;  4YGB B;  1A4P A;  2JT3 A;  3IQO A;  3TS5 C;  1BT6 A;  1DF0 B;  3BQ3 A;  1OQP A;  2CTN A;  2KDH A;  2NXQ A;  2OTG B;  1F8H A;  2OTG C;  2JZI A;  2L98 A;  3BYA A;  1NPQ A;  1WDC B;  1YVL A;  2F2O A;  3TZ1 A;  1G8I A;  1V1F A;  1XFU O;  3O78 A;  1UHN A;  1WRK A;  3JTD B;  3IQQ A;  5I2L A;  2AUC A;  1XFW O;  1YTZ C;  1KQM B;  3JTD C;  2KQ6 A;  2LLS A;  1WLM A;  2FCE A;  3EVV A;  1KQM C;  1M39 A;  1DF0 A;  1LIN A;  3AKA A;  1CMG A;  1DJW A;  2KYF A;  3GOF A;  3OHM B;  1SL7 A;  2JRF A;  3DD4 A;  1RK9 A;  2CNP A;  1K90 D;  3DVJ A;  1K94 A;  1NX1 A;  2L50 A;  4MZJ A;  3WXA A;  2LHI A; 
#chains in the Genus database with same CATH topology
 1DJX A;  2MLF C;  2RGI A;  1OOI X;  5AAN A;  2OPO A;  3PLF B;  4NDB A;  4L9M A;  3CR4 X;  3DYE A;  5K89 A;  1ZAC A;  3K21 A;  4OZD A;  1Y1X A;  2MRD A;  1J1D A;  2F2P A;  1UHK A;  2H2K A;  3D0Y B;  3FWB A;  1TNQ A;  1FF1 A;  3EK4 A;  3VGO A;  2R2I A;  3L4A A;  1WRL A;  4ORB B;  1K93 D;  2ERB A;  1SR6 B;  3SG2 A;  1SCM B;  1TCO B;  1JWD A;  2WC6 A;  3O4Y A;  1Y0V H;  1SR6 C;  1SCM C;  1JC2 A;  1N65 A;  2JNX A;  2LMV A;  1F4Q A;  2BBN A;  3ZNI A;  1S3P A;  3D10 A;  1KCY A;  3F45 A;  4HSZ A;  3LK0 A;  1TUJ A;  4AQI A;  2JNF A;  3D0Y A;  1YVH A;  5G08 A;  4YI9 A;  1U5I A;  1FI6 A;  4CFR A;  1SPY A;  2PQL A;  2JT0 A;  4HRE E;  2GV5 A;  3VRO A;  4PHN A;  4P2Y B;  1DJH A;  2K60 A;  3PJI A;  1J7O A;  1D1O A;  1ZFS A;  1XA5 A;  1A75 B;  1QX7 A;  2EGD A;  4JQ0 D;  3DF0 B;  3DY9 A;  2M7L A;  2PAS A;  3SG5 A;  1H4B A;  4A4C A;  2LP3 A;  1NX2 A;  2BCA A;  5FI7 A;  1HQV A;  1CDL A;  1KFX L;  3BUN B;  3S0A A;  2K2A A;  4ORA B;  2WCL A;  3BOW B;  2ZRT A;  1F55 A;  4HRH A;  2KHN A;  3PAT A;  1DQE A;  3BUM B;  4GGN A;  4PT1 A;  1GQM A;  2M1U A;  1A2X A;  3SG4 A;  1TN4 A;  3PAL A;  1CB1 A;  1CMF A;  1BOD A;  1K9P A;  1WLZ A;  1QIV A;  2E30 A;  2KGB C;  2NLN A;  4PDZ A;  2K8M B;  4OVN F;  4PHK A;  2EC6 B;  3NHI A;  3D76 A;  2LAN A;  4MBE A;  4PE7 A;  3S0B A;  5FI6 A;  2EC6 C;  3OGN A;  1KQV A;  1CM1 A;  1KFU S;  1CDP A;  1LVC D;  4DS7 A;  2KSP A;  1HT9 A;  3QME A;  5KTY A;  1IQ5 A;  4GBA A;  1IG5 A;  1NYA A;  1V1G A;  1J7R A;  3BJH A;  2KFF A;  1OZO A;  3CWG A;  5JJG A;  1CFF A;  2KFH A;  3B7A A;  2I2R E;  2P6B B;  2K7B A;  2ZN9 A;  5ER5 A;  4QJ4 B;  5GQQ C;  2LLU A;  2PAL A;  1OMV A;  3CGA A;  2KFG A;  1JF2 A;  1LA0 A;  1JF0 A;  5HLO A;  3CZ1 A;  1QV0 A;  2FOT A;  2COL B;  3L4L A;  3M0W A;  3LCP C;  5AXI A;  5CSJ A;  1GM0 A;  3D73 A;  2VRG A;  1OOG A;  3EK8 A;  3SG3 A;  1SSE B;  1Z4H A;  1R6P A;  2WCH A;  2BCX A;  2QEB A;  4R1E A;  5I2Q A;  1BR4 B;  1YUT A;  5HKZ A;  4OCI A;  1AVS A;  2MHH A;  2IS9 A;  4PE0 A;  1G4Y R;  2MJW B;  4FTG A;  3VB1 A;  1UHH A;  3O6B A;  1S5G Z;  1AHR A;  4PE4 A;  1B1G A;  4QJ5 B;  1IH0 A;  2Q4U A;  1XFX O;  4ORC B;  2K61 A;  2HQ8 A;  1S36 A;  2L5X B;  3VRP A;  1FW4 A;  3B86 A;  1IKU A;  2KGR A;  1A29 A;  3S0F A;  1C7W A;  2M7N A;  2L4H A;  4D1E A;  1QLK A;  1NX0 A;  1RTP 1;  1PSR A;  2ZRS A;  3BUO B;  2KPH A;  3DZT A;  2ZKM X;  2WCM A;  4MRY A;  2ZNE A;  2FJY A;  1B7T Y;  1VRK A;  3TS5 B;  2Y4Q A;  3NSO A;  2H61 C;  3OB2 B;  1CDN A;  1S6C A;  1XYD A;  2H8V A;  4YGE B;  3UNW A;  4ETO A;  3N7H A;  1OSA A;  1EJ3 A;  1B7T Z;  1MUX A;  1YRT B;  2M0R A;  3CTN A;  3I5H C;  4JKT A;  1PRW A;  1T14 A;  1S6I A;  2M29 A;  2GGZ A;  1OMR A;  3WNX B;  2F3Y A;  1OZS A;  2KLD A;  2LHL A;  1M31 A;  2ISD A;  1DC1 A;  2O60 A;  2WOS A;  1JFK A;  2M9G A;  4MZK A;  1L2O B;  2LLT A;  4NQG A;  1TNP A;  2ZND A;  1X02 A;  2K7C A;  5D3O A;  1L2O C;  1AJ4 A;  3JVT B;  1CFD A;  3JVT C;  1QTX A;  1DGV A;  1DGU A;  2CCM A;  1J7Q A;  2QPT A;  1WY9 A;  1RRO A;  4PAL A;  1SL8 A;  1GJY A;  2LMT A;  3VRQ A;  3NSL A;  4N1F A;  1B8L A;  1BR1 B;  1YUS A;  1XFY O;  2CXJ A;  4OR9 B;  3GK4 X;  2WC8 A;  3BFH A;  1QAT A;  3KPX A;  1OOF A;  2K7D A;  3LLE A;  2I18 A;  2BE6 A;  3QRX A;  2G9B A;  1FBV A;  4FQT A;  5FI2 A;  2BBM A;  4GPL B;  1NSH A;  5CSN A;  2ZFD A;  3EK7 A;  2LC5 A;  3GK1 A;  1C3Z A;  1AUI B;  3ZWH A;  3RM1 A;  1BF5 A;  1C07 A;  2KI6 C;  3DVK A;  1OMD A;  3NSI A;  1B8C A;  1RWY A;  4F7F A;  4F0Z B;  4HRG A;  2A4J A;  2MAZ A;  3NGV A;  1OW4 A;  2O5G A;  3DVM A;  4GFT A;  1GGZ A;  5HLV A;  2LM5 A;  1DJZ A;  3A8R A;  2KQY A;  2WCE A;  3BUW B;  5D69 A;  1LKJ A;  1MHO A;  1E8A A;  1M45 A;  2LVI A;  2F8P A;  1JUO A;  1MQ1 A;  3FS7 A;  3V2L A;  3VRN A;  2JWW A;  5I94 A;  1YUR A;  4MVF A;  1UP5 A;  1B9A A;  1N2D A;  2WCF A;  2KBM A;  3TUY B;  3TDZ A;  1NP8 A;  5ER4 X;  3TUY C;  1A75 A;  1YX7 A;  1TCF A;  4GNK B;  2BNX A;  2JTZ A;  2LVJ A;  3R72 A;  5AFP A;  1KSM A;  1NWD A;  1Y1U A;  3DF0 A;  1MXL C;  2K2F A;  5D7F A;  4DIR A;  5HL1 A;  3DVE A;  1QX2 A;  3SS5 A;  3AAJ A;  1ALW A;  1SRA A;  1QVI Y;  2TN4 A;  2GTE A;  3NSK A;  4YI8 A;  2LP2 A;  3PM8 A;  1XFV O;  4CID A;  2CT9 A;  3BOW A;  4U8D A;  1BOC A;  1Y1A A;  1NIW A;  2JU0 A;  2KAX A;  4MLW A;  1ZOT B;  4DUQ A;  3I5G B;  2BKH B;  1QVI Z;  2JQ6 A;  1S1E A;  3I5G C;  4INW A;  1DEL A;  1XK4 C;  2B1U A;  2PVB A;  1DTL A;  2E6W A;  1IQ3 A;  3EG5 B;  1UHI A;  5HKW A;  3EVR A;  2K0J A;  4PCW A;  2FJU B;  1KFU L;  1DJI A;  5J3X A;  2L2E A;  4M2O A;  1M46 A;  1AK8 A;  4DCK A;  4ICB A;  1KK7 Y;  2QEO A;  4N5X A;  2KI4 B;  1FI5 A;  2M8U A;  4GAO A;  2KI4 C;  1QX5 B;  2QEV A;  4USL A;  3EKJ A;  4PHJ A;  1W9Z A;  3CS1 A;  1KK7 Z;  1S6J A;  2LVV A;  1TUZ A;  1AP4 A;  1DVI A;  3C1V A;  3UO9 A;  1J7P A;  5KU1 A;  5DIC A;  3R1V A;  1IJ5 A;  1EG3 A;  3SS4 A;  4I5J A;  4P5O E;  4TNC A;  2JPO A;  5CPV A;  4C0J A;  4N1G A;  2L4I A;  3I5F B;  1R2U A;  4PE1 A;  4AOM A;  5CSI A;  4A4B A;  4YRU A;  2BCB A;  3I5F C;  3D75 A;  4AQJ A;  1J1E A;  1TTX A;  2BL0 B;  3CLN A;  1YR5 A;  5F6T A;  1CLL A;  2PMY A;  1K95 A;  2BL0 C;  2NZ0 A;  1DJY A;  3DXL A;  3CZT X;  1XFZ O;  2L5Y A;  4JD9 A;  1PAL A;  1LA3 A;  2JC2 A;  2SCP A;  3BFB A;  2M97 A;  3WHT B;  3FWC A;  3NHT A;  1OOH A;  1CLB A;  4WRI A;  1A03 A;  4YBH B;  1Z2C B;  1CLM A;  4GGF C;  4Q04 A;  1TOP A;  1CNP A;  1TIZ A;  4GUK A;  4FQO A;  2HET A;  2JOJ A;  1KK8 B;  1QAS A;  2PRU A;  5HKY A;  1MWN A;  1F71 A;  1KK8 C;  2AAO A;  2BAP A;  3EVU A;  3IF7 A;  3I5H B;  1SNL A;  3S0G A;  4I5K A;  3PFV A;  1EH2 A;  5B8I B;  1XO5 A;  2LE9 B;  3BFA A;  2WC5 A;  1IGV A;  4IL1 A;  2KYC A;  2LV7 A;  1NX3 A;  2WCJ A;  2H61 A;  3K1E A;  2LAP A;  2HF5 A;  3SG6 A;  2V53 A;  1QIW A;  2KLE A;  1DEK A;  1IRJ A;  1CFC A;  1MXE A;  1GGW A;  2LMU A;  3R1P A;  4ZCV A;  1NCX A;  2PYQ A;  2LUC A;  1B8R A;  1W7I B;  2PSR A;  2Y1M A;  3CR2 A;  3FE6 A;  2FCD A;  2WCB A;  3ICB A;  3SIA A;  5HYD A;  3SJS A;  1BG1 A;  1NCY A;  4YGC B;  4I5L B;  3FE9 A;  3BXK A;  4C0K A;  1YUU A;  4OV2 A;  3Q8I A;  4YGA A;  1SYM A;  1EL4 A;  5KSZ A;  4BY5 A;  1F70 A;  3HX4 A;  1WDC C;  2MA2 A;  1JBA A;  3B87 A;  3TDU A;  1CFP A;  2Y1N A;  3OX5 A;  5PAL A;  1REC A;  2QEH A;  3KO0 A;  4OKH A;  2OS8 B;  3NXA A;  1ZMZ A;  2GGM A;  4XYN A;  2JXC A;  2OS8 C;  1ODB A;  3D78 A;  4DRW A;  1IJ6 A;  5AEQ A;  3FE8 A;  4NDC A;  1C3Y A;  5CSF A;  1J55 A;  1CKK A;  4JPZ B;  3AKB A;  3B88 A;  3PM2 A;  1BLQ A;  3OB1 B;  2MBX A;  1MR8 A;  3KHE A;  3FIA A;  2I7A A;  2BE4 A;  1K8U A;  2HPS A;  5DKN A;  5TNC A;  1U5I B;  2KAV A;  2M49 B;  5JOL A;  1S26 D;  1UUS A;  1BMO A;  1NUB A;  4MEW A;  1JSA A;  3RLZ A;  1SBJ A;  2KI6 D;  1SKT A;  1BJF A;  3O2P A;  1YX8 A;  4MSP A;  4M2P A;  2LVK A;  3PSR A;  1N0Y A;  1K96 A;  1ALV A;  4PHM A;  2L2C A;  2WND A;  1L7Z A;  2WOR A;  1LS8 A;  2Q91 A;  4C0L A;  1W7J B;  3KF9 A;  1PSB A;  5I2O A;  1F4O A;  3EKH A;  3S0D A;  1KFX S;  1ORG A;  2F33 A;  1H8B A;  3LL8 B;  1QS7 A;  3CR5 X;  2M3W A;  1K9U A;  1EXR A;  3CDN A;  4ZCU A;  4XJK B;  3E3R A;  3D74 A;  1M63 B;  2CBL A;  1QJT A;  2K7O A;  2JT8 A;  1PUL A;  4CFQ A;  1C7V A;  4BY4 A;  1UUR A;  3A4U B;  3VRR A;  1TNX A;  2HQW A;  1K9K A;  2NCO A;  1IWQ A;  3OP0 A;  2LNK A;  5I8N A;  1QLS A;  1SCV A;  2JPT A;  1TNW A;  4XJK A;  1MF8 B;  5FYX A;  4IJ7 A;  4JWQ A;  4MRX A;  1DJG A;  2LCP A;  1LXF C;  2NCP A;  3HCM A;  3AAK A;  1CM4 A;  2SAS A;  3TDI A;  1XK4 A;  2AMI A;  1NCZ A;  2BKI B;  5DKQ A;  5DKR A;  1CTR A;  3CZ2 A;  4CLN A;  2M1K B;  1B4C A;  1BU3 A;  1SY9 A;  2Y5I A;  5AER A;  2KAY A;  2LUX A;  4NDD A;  3H4S E;  1DMO A;  4I5N B;  2DOQ A;  3R1O A;  2I94 A;  1PK0 D;  2WCK A;  1TWO A;  1QV1 A;  3LK1 A;  1SW8 A;  2F3Z A;  2KBI A;  2KOT A;  1PVB A;  3BUX B;  3IVT A;  4UPG A;  1F54 A;  1ZUZ A;  4WQ2 A;  1XFR A;  2L51 A;  3PN7 B;  4KYN A;  3GK2 A;  1Q80 A;  3OX6 A;  1FPW A;  1K2H A;  3PN7 C;  3CZ0 A;  3SS3 A;  1JFJ A;  3RZS A;  1WRZ A;  1OE9 B;  1S5G Y;  2L0P A;  3CYZ A;  1UWO A;  2YGU A;  3SIB A;  3S0E A;  1UHJ A;  4WQ3 A;  4E68 A;  1AJ5 A;  1QXP A;  3SG7 A;  3MSE B;  1YRU B;  1XVJ A;  1SK6 D;  1KSO A;  3D77 A;  4CPV A;  2JUL A;  2JXL A;  2MLE C;  4MN0 A;  2EHB A;  1PVA A;  4QJ3 B;  1CDM A;  2KNE A;  1DT7 B;  2BEC A;  5EL2 A;  5BPJ A;  1SMG A;  4GGF A;  4M2Q A;  1B47 A;  1TRF A;  4YGD B;  1OOJ A;  1KWO B;  3I5I B;  3KEV A;  1RFJ A;  1P28 A;  1RJV A;  1SL9 A;  4MZL A;  3WHU B;  3I5I C;  1KWO C;  5IBW A;  2JTT A;  2D8N A;  1Y6W A;  1EG4 A;  2ZN8 A;  2QAC A;  3B6X A;  3L47 A;  2G2B A;  1G33 A;  4YGB B;  1A4P A;  2JT3 A;  3IQO A;  3TS5 C;  1BT6 A;  1DF0 B;  3BQ3 A;  1OQP A;  2CTN A;  2KDH A;  2NXQ A;  2OTG B;  2P71 A;  1F8H A;  2OTG C;  2JZI A;  2L98 A;  3OBV A;  1QWV A;  4INX A;  3BYA A;  1NPQ A;  1WDC B;  1YVL A;  2F2O A;  3TZ1 A;  1G8I A;  1V1F A;  1XFU O;  3O78 A;  1UHN A;  1WRK A;  3JTD B;  3IQQ A;  5I2L A;  2AUC A;  2P70 A;  1XFW O;  1YTZ C;  1KQM B;  3O4X A;  3JTD C;  2KQ6 A;  2LLS A;  1WLM A;  2FCE A;  3EVV A;  1KQM C;  1M39 A;  1DF0 A;  1LIN A;  3AKA A;  1CMG A;  1DJW A;  2KYF A;  3GOF A;  2QDI A;  3OHM B;  1SL7 A;  2JRF A;  1IIO A;  3DD4 A;  1RK9 A;  2CNP A;  1K90 D;  3CAB A;  3DVJ A;  1K94 A;  1NX1 A;  2L50 A;  4MZJ A;  3WXA A;  2LHI A; 
#chains in the Genus database with same CATH homology
 1DJX A;  2MLF C;  2RGI A;  5AAN A;  2OPO A;  3PLF B;  4NDB A;  4L9M A;  3CR4 X;  5K89 A;  1ZAC A;  3K21 A;  1Y1X A;  2MRD A;  1J1D A;  2F2P A;  1UHK A;  2H2K A;  3D0Y B;  3FWB A;  1TNQ A;  1FF1 A;  3EK4 A;  3VGO A;  2R2I A;  4ORB B;  1WRL A;  1K93 D;  1SR6 B;  3SG2 A;  1SCM B;  1TCO B;  1JWD A;  3O4Y A;  1Y0V H;  1SR6 C;  1SCM C;  1JC2 A;  1N65 A;  2JNX A;  2LMV A;  1F4Q A;  2BBN A;  3ZNI A;  1S3P A;  3D10 A;  1KCY A;  3F45 A;  4HSZ A;  3LK0 A;  4AQI A;  2JNF A;  3D0Y A;  1YVH A;  5G08 A;  4YI9 A;  1U5I A;  1FI6 A;  4CFR A;  1SPY A;  2JT0 A;  4HRE E;  2GV5 A;  3VRO A;  4PHN A;  4P2Y B;  1DJH A;  1J7O A;  1D1O A;  1ZFS A;  1XA5 A;  1A75 B;  1QX7 A;  2EGD A;  4JQ0 D;  3DF0 B;  2M7L A;  2PAS A;  3SG5 A;  1H4B A;  4A4C A;  2LP3 A;  1NX2 A;  2BCA A;  1HQV A;  1CDL A;  1KFX L;  3BUN B;  2K2A A;  4ORA B;  1F55 A;  3BOW B;  2ZRT A;  4HRH A;  2KHN A;  3PAT A;  3BUM B;  4GGN A;  1GQM A;  2M1U A;  1A2X A;  3SG4 A;  1TN4 A;  3PAL A;  1CB1 A;  1CMF A;  1BOD A;  1K9P A;  1WLZ A;  1QIV A;  2E30 A;  2KGB C;  2NLN A;  4PDZ A;  2K8M B;  4OVN F;  4PHK A;  2EC6 B;  4MBE A;  2LAN A;  4PE7 A;  2EC6 C;  1KQV A;  1CM1 A;  1KFU S;  1CDP A;  1LVC D;  4DS7 A;  2KSP A;  1HT9 A;  5KTY A;  1IQ5 A;  4GBA A;  1IG5 A;  1NYA A;  1V1G A;  1J7R A;  2KFF A;  1OZO A;  3CWG A;  5JJG A;  1CFF A;  2KFH A;  5ER5 A;  2I2R E;  2P6B B;  2K7B A;  2ZN9 A;  4QJ4 B;  5GQQ C;  2LLU A;  2PAL A;  1OMV A;  3CGA A;  2KFG A;  1JF2 A;  1LA0 A;  1JF0 A;  5HLO A;  1QV0 A;  2FOT A;  2COL B;  3M0W A;  3LCP C;  5AXI A;  5CSJ A;  2VRG A;  3EK8 A;  3SG3 A;  1R6P A;  2BCX A;  4R1E A;  5I2Q A;  1BR4 B;  1YUT A;  5HKZ A;  4OCI A;  1AVS A;  2MHH A;  2IS9 A;  4PE0 A;  1G4Y R;  2MJW B;  4FTG A;  1UHH A;  3O6B A;  1S5G Z;  1AHR A;  4PE4 A;  1B1G A;  4QJ5 B;  1IH0 A;  2Q4U A;  1XFX O;  4ORC B;  2K61 A;  2HQ8 A;  1S36 A;  2L5X B;  3VRP A;  1FW4 A;  1IKU A;  2KGR A;  1A29 A;  1C7W A;  2M7N A;  2L4H A;  4D1E A;  1QLK A;  1NX0 A;  1RTP 1;  1PSR A;  2ZRS A;  3BUO B;  2ZKM X;  4MRY A;  2ZNE A;  1B7T Y;  1VRK A;  3TS5 B;  2Y4Q A;  3NSO A;  2H61 C;  3OB2 B;  1CDN A;  1S6C A;  1XYD A;  4YGE B;  4ETO A;  1OSA A;  1EJ3 A;  1B7T Z;  1MUX A;  1YRT B;  2M0R A;  3CTN A;  3I5H C;  1PRW A;  2M29 A;  1S6I A;  2GGZ A;  1OMR A;  3WNX B;  2F3Y A;  1OZS A;  2LHL A;  1M31 A;  2ISD A;  2O60 A;  2WOS A;  1JFK A;  2M9G A;  4MZK A;  1L2O B;  2LLT A;  4NQG A;  1TNP A;  2ZND A;  1X02 A;  2K7C A;  1L2O C;  1AJ4 A;  3JVT B;  1CFD A;  3JVT C;  1QTX A;  1DGV A;  1DGU A;  2CCM A;  1J7Q A;  2QPT A;  1WY9 A;  1RRO A;  4PAL A;  1SL8 A;  1GJY A;  2LMT A;  3VRQ A;  3NSL A;  4N1F A;  1B8L A;  1BR1 B;  1YUS A;  1XFY O;  2CXJ A;  4OR9 B;  3GK4 X;  2WC8 A;  1QAT A;  3KPX A;  2K7D A;  3LLE A;  2I18 A;  2BE6 A;  3QRX A;  2G9B A;  1FBV A;  2BBM A;  4GPL B;  1NSH A;  5CSN A;  2ZFD A;  3EK7 A;  2LC5 A;  3GK1 A;  1AUI B;  3ZWH A;  3RM1 A;  1BF5 A;  1C07 A;  2KI6 C;  3DVK A;  1OMD A;  3NSI A;  1B8C A;  1RWY A;  4F0Z B;  4HRG A;  2A4J A;  2MAZ A;  2O5G A;  3DVM A;  4GFT A;  1GGZ A;  5HLV A;  2LM5 A;  1DJZ A;  3A8R A;  2KQY A;  2WCE A;  3BUW B;  5D69 A;  1LKJ A;  1MHO A;  1E8A A;  1M45 A;  2LVI A;  2F8P A;  1JUO A;  1MQ1 A;  3FS7 A;  3VRN A;  2JWW A;  1YUR A;  4MVF A;  1UP5 A;  1B9A A;  1N2D A;  2WCF A;  2KBM A;  3TUY B;  3TDZ A;  1NP8 A;  5ER4 X;  3TUY C;  1A75 A;  1YX7 A;  1TCF A;  4GNK B;  2JTZ A;  2LVJ A;  5AFP A;  1KSM A;  1NWD A;  1Y1U A;  3DF0 A;  1MXL C;  2K2F A;  5D7F A;  4DIR A;  3DVE A;  1QX2 A;  3AAJ A;  1ALW A;  1SRA A;  1QVI Y;  2TN4 A;  3NSK A;  4YI8 A;  2LP2 A;  3PM8 A;  1XFV O;  4CID A;  2CT9 A;  3BOW A;  4U8D A;  1BOC A;  1Y1A A;  1NIW A;  2JU0 A;  2KAX A;  4MLW A;  1ZOT B;  4DUQ A;  3I5G B;  2BKH B;  1QVI Z;  2JQ6 A;  1S1E A;  3I5G C;  1XK4 C;  2B1U A;  2PVB A;  1DTL A;  2E6W A;  1IQ3 A;  1UHI A;  5HKW A;  3EVR A;  2K0J A;  4PCW A;  2FJU B;  1KFU L;  1DJI A;  5J3X A;  2L2E A;  4M2O A;  1M46 A;  1AK8 A;  4DCK A;  4ICB A;  1KK7 Y;  4N5X A;  2KI4 B;  1FI5 A;  2M8U A;  4GAO A;  2KI4 C;  1QX5 B;  4USL A;  3EKJ A;  4PHJ A;  3CS1 A;  1KK7 Z;  1S6J A;  2LVV A;  1AP4 A;  1DVI A;  3C1V A;  1J7P A;  5KU1 A;  1IJ5 A;  1EG3 A;  4I5J A;  4P5O E;  4TNC A;  5CPV A;  4C0J A;  4N1G A;  2L4I A;  3I5F B;  1R2U A;  4PE1 A;  4AOM A;  5CSI A;  4A4B A;  4YRU A;  2BCB A;  3I5F C;  4AQJ A;  1J1E A;  1TTX A;  2BL0 B;  3CLN A;  1YR5 A;  5F6T A;  1CLL A;  2PMY A;  1K95 A;  2BL0 C;  2NZ0 A;  1DJY A;  3CZT X;  1XFZ O;  1PAL A;  1LA3 A;  2JC2 A;  2SCP A;  2M97 A;  3WHT B;  3FWC A;  1CLB A;  4WRI A;  1A03 A;  4YBH B;  4GGF C;  1CLM A;  4Q04 A;  1TOP A;  1CNP A;  1TIZ A;  4GUK A;  4FQO A;  2HET A;  2JOJ A;  1KK8 B;  1QAS A;  2PRU A;  5HKY A;  1MWN A;  1F71 A;  1KK8 C;  2AAO A;  3EVU A;  3IF7 A;  3I5H B;  1SNL A;  4I5K A;  3PFV A;  1EH2 A;  5B8I B;  1XO5 A;  2LE9 B;  1IGV A;  4IL1 A;  2KYC A;  2LV7 A;  1NX3 A;  2H61 A;  2LAP A;  2HF5 A;  3SG6 A;  2V53 A;  1QIW A;  1IRJ A;  1CFC A;  1MXE A;  1GGW A;  2LMU A;  4ZCV A;  1NCX A;  2LUC A;  1B8R A;  1W7I B;  2PSR A;  2Y1M A;  3CR2 A;  3ICB A;  2FCD A;  2WCB A;  3SIA A;  5HYD A;  1BG1 A;  3SJS A;  1NCY A;  4YGC B;  4I5L B;  3BXK A;  4C0K A;  1YUU A;  4OV2 A;  5KSZ A;  4YGA A;  1SYM A;  1EL4 A;  4BY5 A;  1F70 A;  3HX4 A;  1WDC C;  2MA2 A;  1JBA A;  3TDU A;  1CFP A;  2Y1N A;  3OX5 A;  5PAL A;  1REC A;  3KO0 A;  4OKH A;  2OS8 B;  3NXA A;  1ZMZ A;  2GGM A;  4XYN A;  2JXC A;  2OS8 C;  1ODB A;  4DRW A;  1IJ6 A;  5AEQ A;  4NDC A;  1CKK A;  5CSF A;  1J55 A;  4JPZ B;  3AKB A;  1BLQ A;  3OB1 B;  2MBX A;  1MR8 A;  3KHE A;  3FIA A;  2I7A A;  2BE4 A;  1K8U A;  2HPS A;  5DKN A;  5TNC A;  1U5I B;  2KAV A;  2M49 B;  5JOL A;  1S26 D;  1UUS A;  1BMO A;  1NUB A;  4MEW A;  1JSA A;  3RLZ A;  1SBJ A;  2KI6 D;  1SKT A;  1BJF A;  3O2P A;  1YX8 A;  4MSP A;  4M2P A;  2LVK A;  3PSR A;  1N0Y A;  1K96 A;  1ALV A;  4PHM A;  2WND A;  1L7Z A;  2WOR A;  2Q91 A;  4C0L A;  1W7J B;  3KF9 A;  1PSB A;  5I2O A;  1F4O A;  3EKH A;  1KFX S;  2F33 A;  1H8B A;  3LL8 B;  1QS7 A;  3CR5 X;  2M3W A;  1K9U A;  1EXR A;  4ZCU A;  4XJK B;  3E3R A;  1M63 B;  2CBL A;  1QJT A;  2K7O A;  2JT8 A;  1PUL A;  4CFQ A;  1C7V A;  4BY4 A;  1UUR A;  3A4U B;  3VRR A;  1TNX A;  2HQW A;  1K9K A;  2NCO A;  1IWQ A;  3OP0 A;  2LNK A;  5I8N A;  1QLS A;  1SCV A;  2JPT A;  1TNW A;  4XJK A;  1MF8 B;  5FYX A;  4JWQ A;  4MRX A;  1DJG A;  2LCP A;  1LXF C;  2NCP A;  3HCM A;  3AAK A;  1CM4 A;  2SAS A;  3TDI A;  1XK4 A;  2AMI A;  1NCZ A;  2BKI B;  5DKQ A;  5DKR A;  1CTR A;  4CLN A;  2M1K B;  1B4C A;  1BU3 A;  1SY9 A;  2Y5I A;  5AER A;  2KAY A;  2LUX A;  4NDD A;  3H4S E;  1DMO A;  4I5N B;  2DOQ A;  2I94 A;  1PK0 D;  3LK1 A;  1QV1 A;  1SW8 A;  2F3Z A;  2KBI A;  2KOT A;  1PVB A;  3BUX B;  1F54 A;  4UPG A;  1ZUZ A;  4WQ2 A;  2L51 A;  3PN7 B;  3GK2 A;  1Q80 A;  3OX6 A;  1FPW A;  1K2H A;  3PN7 C;  1JFJ A;  1WRZ A;  1OE9 B;  1S5G Y;  2L0P A;  1UWO A;  3SIB A;  1UHJ A;  4WQ3 A;  4E68 A;  1AJ5 A;  1QXP A;  3SG7 A;  3MSE B;  1YRU B;  1XVJ A;  1SK6 D;  1KSO A;  4CPV A;  2JUL A;  2JXL A;  2MLE C;  4MN0 A;  2EHB A;  1PVA A;  4QJ3 B;  1CDM A;  2KNE A;  1DT7 B;  2BEC A;  5BPJ A;  1SMG A;  4GGF A;  4M2Q A;  1B47 A;  1TRF A;  4YGD B;  1OOJ A;  1KWO B;  3I5I B;  3KEV A;  1RFJ A;  1RJV A;  1SL9 A;  4MZL A;  3WHU B;  3I5I C;  1KWO C;  5IBW A;  2JTT A;  2D8N A;  1Y6W A;  1EG4 A;  2ZN8 A;  2QAC A;  2G2B A;  1G33 A;  4YGB B;  1A4P A;  2JT3 A;  3IQO A;  3TS5 C;  1BT6 A;  1DF0 B;  3BQ3 A;  1OQP A;  2CTN A;  2KDH A;  2NXQ A;  2OTG B;  1F8H A;  2OTG C;  2JZI A;  2L98 A;  3BYA A;  1NPQ A;  1WDC B;  1YVL A;  2F2O A;  3TZ1 A;  1G8I A;  1V1F A;  1XFU O;  3O78 A;  1UHN A;  1WRK A;  3JTD B;  3IQQ A;  5I2L A;  2AUC A;  1XFW O;  1YTZ C;  1KQM B;  3JTD C;  2KQ6 A;  2LLS A;  1WLM A;  2FCE A;  3EVV A;  1KQM C;  1M39 A;  1DF0 A;  1LIN A;  3AKA A;  1CMG A;  1DJW A;  2KYF A;  3GOF A;  3OHM B;  1SL7 A;  2JRF A;  3DD4 A;  1RK9 A;  2CNP A;  1K90 D;  3DVJ A;  1K94 A;  1NX1 A;  2L50 A;  4MZJ A;  3WXA A;  2LHI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...