1J7OA

Solution structure of calcium-calmodulin n-terminal domain
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
76
structure length
76
Chain Sequence
ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Calmodulin
publication title Solution structure of Ca(2+)-calmodulin reveals flexible hand-like properties of its domains.
pubmed doi rcsb
source organism Homo sapiens
total genus 24
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2001-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1j7oA00
1KFXS 2KSPA 1F55A 2BE6A 1EH2A 2LMUA 2P6BB 4GUKA 1CMFA 1IKUA 3KEVA 2A4JA 1M39A 2K61A 3ZNIA 4GBAA 4NDDA 1NIWA 2HF5A 4YGDB 1CLBA 3KO0A 1Y1UA 1L2OC 1BG1A 4ORCB 3BUXB 1G8IA 2KBMA 2EC6B 3AAKA 1S5GY 3LK1A 4JWQA 2L5XB 3I5FB 3DVMA 2BKHB 1B8CA 1BT6A 2IS9A 1OMVA 1LA3A 1UURA 2WOSA 3VRRA 1SR6C 2O5GA 3PN7C 4NDBA 4WRIA 5I2OA 1KK8C 3RM1A 1DF0B 4I5LB 4XJKB 1C07A 1XK4C 2SASA 3CGAA 1XVJA 3CTNA 1WRKA 4A4BA 1W7JB 1OSAA 2JRFA 1QXPA 2LLUA 1PSRA 1CFCA 1CFFA 1W7IB 1FF1A 1VRKA 2F3YA 3SG4A 1DJZA 3WNXB 1V1GA 4GAOA 2LM5A 1UHKA 4PDZA 1CM4A 2PSRA 1FI6A 1TNPA 3FWBA 2KI6D 4XYNA 5K89A 3FWCA 1WDCB 3DF0B 3DVKA 5CSNA 1SYMA 2F33A 3TUYB 1B7TY 1Y1AA 2NZ0A 3HCMA 2EC6C 1SBJA 5KTYA 1KK7Z 2KI4C 2PVBA 4WQ2A 1TNXA 1AUIB 2NCOA 1KFUS 2COLB 1NP8A 2KYFA 3PFVA 2KBIA 4CPVA 4YI8A 1UHHA 1QIVA 1IQ5A 1XFYO 4P5OE 3PLFB 1KWOB 5B8IB 2NLNA 2CCMA 1IJ5A 3GK1A 4CLNA 2KGBC 4HREE 1CDLA 3KHEA 1BMOA 1L7ZA 2HQWA 1C7WA 2LVJA 3BUOB 4FQOA 5HKZA 1N2DA 2MRDA 1GQMA 2CNPA 3AKBA 1XO5A 1A29A 2K8MB 3VRQA 2JXLA 1JF0A 2BBNA 3RLZA 3NXAA 1F4OA 4GNKB 5I2QA 1QASA 2K7CA 1WDCC 3TZ1A 1QATA 2PMYA 1TOPA 4CFRA 1JC2A 5J3XA 3TUYC 5PALA 1KQMB 3WHTB 1M45A 1TCOB 2PALA 3OP0A 1CLMA 1QVIY 2JOJA 2WCEA 1YURA 5AANA 1UHJA 2MAZA 1NSHA 3PALA 2M7NA 4HRHA 1K90D 2WORA 2AUCA 3KF9A 4I5KA 1CDMA 4P2YB 1V1FA 3BYAA 3TS5B 1KWOC 1CFDA 1YX8A 2LLSA 1NPQA 5IBWA 1WY9A 1UHNA 1YTZC 4AQIA 5I8NA 1DGUA 1SMGA 1UWOA 1PK0D 1X02A 1QX2A 2JT8A 1TNWA 3CLNA 1NX1A 5JOLA 2PASA 1R2UA 3DVJA 1BF5A 1S1EA 1BJFA 1J7RA 3O6BA 1HQVA 2LCPA 4AOMA 1CB1A 2KDHA 2TN4A 5HYDA 2NXQA 1RK9A 1A75A 1U5IA 2MBXA 1E8AA 2Y4QA 1YVHA 3VRNA 1QLKA 2LUCA 2FCDA 3D10A 1QIWA 1G33A 1UHIA 2JWWA 3I5GB 5AFPA 2RGIA 4ICBA 1KQMC 5HKYA 1AJ5A 1MXEA 2LAPA 2AAOA 1Q80A 2CTNA 2Q91A 1KQVA 3I5IC 1FPWA 4E68A 2I2RE 3LCPC 4MVFA 1AK8A 1QV0A 2JPTA 1MQ1A 3FS7A 2K2AA 2OPOA 3FIAA 2CXJA 1N65A 1NX0A 2BL0B 2KNEA 3TS5C 2F3ZA 4OCIA 4PE0A 5AERA 2KHNA 2BCAA 1OE9B 4C0KA 1G4YR 2LVVA 2ZRTA 4MRXA 1DT7B 2WCBA 2JC2A 1OZSA 2JULA 1UUSA 3LK0A 1B8LA 2LP2A 1IGVA 3PATA 4BY5A 4C0LA 4MZKA 2L4IA 2ZNEA 3M0WA 2L2EA 4I5NB 3NSIA 1IG5A 2KI4B 2K0JA 1WLZA 3BUMB 3DD4A 4YBHB 1QLSA 1RFJA 3EVRA 3I5GC 1OZOA 4OVNF 1Y1XA 4OKHA 4PHKA 1TNQA 1JFJA 3JTDB 1B9AA 1BODA 1DJWA 1F71A 1A75B 1A2XA 4U8DA 5JJGA 1GGWA 4GFTA 1J7PA 1ZFSA 2K2FA 3OB1B 4MN0A 3F45A 4YGBB 3O4YA 2M3WA 4TNCA 1SL8A 4A4CA 2BL0C 1EL4A 4GGFA 3ZWHA 3NSOA 1RTP1 3QRXA 1NYAA 1XFUO 1K9KA 1K93D 1KSMA 2M1KB 1NWDA 2JT3A 5DKQA 1Y6WA 1CMGA 3CZTX 4N1FA 3AKAA 3I5HB 2Y1NA 4ETOA 2HQ8A 2JU0A 3EK7A 2M9GA 1TIZA 1DJHA 3GOFA 3GK4X 1SNLA 2BBMA 2D8NA 2LNKA 2I94A 1K2HA 2KAXA 1OQPA 3JTDC 3EVVA 4ORAB 1S5GZ 2HETA 1AP4A 1AHRA 2F2PA 1J7QA 1QX7A 4Q04A 4I5JA 2B1UA 1HT9A 5HKWA 1SPYA 1DMOA 1MHOA 3CR2A 1YRTB 2CBLA 1BU3A 3CWGA 3SG7A 1OMDA 3PSRA 2KQ6A 5CSIA 2KFGA 3HX4A 3IQOA 4YRUA 1CTRA 2Y5IA 2LP3A 3BXKA 3I5HC 1PALA 1XFZO 2SCPA 1M31A 1SKTA 1YR5A 2OTGC 2FOTA 5CSFA 1DTLA 4QJ5B 1JUOA 1SCMC 3EVUA 2JTZA 4MLWA 3I5IB 1JFKA 1JWDA 2F8PA 1S26D 1NCZA 1BLQA 1DGVA 1B7TZ 1YX7A 1F4QA 1ZMZA 1UP5A 2L0PA 1ALVA 2M0RA 1OMRA 1NX3A 4C0JA 1PVBA 1RJVA 2NCPA 1SL7A 2KGRA 2MHHA 4NQGA 3BOWA 4QJ4B 1YUSA 5KU1A 1LXFC 1K94A 1GJYA 1WLMA 3OX5A 4F0ZB 3CR4X 3AAJA 4MZLA 4PHMA 2LVKA 5G08A 1CKKA 1CDPA 1CM1A 4JQ0D 2JNXA 4DS7A 1F70A 2KI6C 4PE4A 5CSJA 3VGOA 4WQ3A 1KCYA 2R2IA 1KFXL 3BUNB 2KOTA 4GGFC 1B8RA 1J55A 3DVEA 4IL1A 3NSLA 4N1GA 4OR9B 2ZRSA 3SG6A 2KFHA 1DJXA 3WXAA 3EK4A 1RROA 3O78A 1CFPA 2FJUB 1PRWA 4PE7A 2LLTA 1PULA 1ALWA 5BPJA 1IWQA 4FTGA 2HPSA 4HSZA 3TDZA 1SL9A 2BE4A 1MWNA 2BECA 1MR8A 2LHIA 2Y1MA 2JTTA 3OB2B 5I2LA 2ISDA 1FW4A 1XFWO 4GGNA 1YRUB 5GQQC 3JVTB 4D1EA 3BUWB 2VRGA 2KAVA 3LL8B 1IQ3A 2K7OA 1QX5B 1IJ6A 3BOWB 5CPVA 1D1OA 4OV2A 1B4CA 4MRYA 4N5XA 1YUTA 1F8HA 5DKRA 3OHMB 2V53A 2OS8B 4YI9A 1DJGA 1H8BA 5F6TA 3BQ3A 4L9MA 1MUXA 3A8RA 2M29A 1PVAA 1U5IB 2H61A 1LKJA 1GGZA 1KK7Y 1KSOA 4MSPA 1S6IA 4DIRA 4PALA 3CS1A 1KFUL 4YGCB 2ZN9A 4M2QA 1C7VA 2CT9A 1EG4A 2JZIA 5DKNA 2JNFA 4PE1A 1EG3A 1QTXA 4ZCUA 1CNPA 4DCKA 2K7DA 1AVSA 1NUBA 4NDCA 2L51A 5ER4X 1RECA 2OTGB 5D7FA 1BR1B 3JVTC 1SRAA 1YUUA 2KAYA 1SCMB 4YGEB 2ZN8A 1S36A 3GK2A 1EXRA 3EKHA 1S6CA 3NSKA 1FI5A 2K7BA 4PCWA 1TCFA 3EKJA 1DVIA 4ZCVA 2JXCA 1ZACA 2OS8C 2KFFA 2MA2A 1BR4B 1J1DA 1XFXO 3VRPA 1A03A 5HLOA 3D0YA 1YVLA 2QACA 3SG2A 1J1EA 4DUQA 3OX6A 2WNDA 1J7OA 1XFVO 2M8UA 3SG3A 2EGDA 3LLEA 1S6JA 3H4SE 1LVCD 1SCVA 4ORBB 1NCYA 3CR5X 1TN4A 2E30A 4DRWA 1CDNA 3KPXA 1LA0A 3I5FC 3MSEB 4R1EA 2EHBA 1LINA 2DOQA 4CIDA 1K96A 1MXLC 1ZUZA 2L98A 2GGMA 2JT0A 2MJWB 2ZFDA 4PHJA 4CFQA 2L4HA 5AEQA 3A4UB 2PRUA 2M97A 1XYDA 3VROA 1BOCA 2F2OA 3SIBA 2MLEC 2LHLA 1JSAA 1IRJA 1R6PA 2E6WA 2KYCA 2O60A 4MEWA 1K9UA 3PM8A 1QJTA 1WRLA 3K21A 1ODBA 1K95A 2Q4UA 3WHUB 1XK4A 4USLA 4M2OA 4GPLB 1Y0VH 1TRFA 1AJ4A 4M2PA 2M7LA 1XA5A 2ZNDA 1DJYA 4HRGA 1K8UA 4YGAA 1PSBA 3D0YB 4AQJA 2G9BA 3O2PA 2LUXA 4QJ3B 2H61C 1CLLA 1NCXA 2MLFC 2KQYA 1EJ3A 1QV1A 1M63B 1SW8A 2AMIA 2QPTA 1M46A 4MBEA 1F54A 4MZJA 2BKIB 3SJSA 1DJIA 1QS7A 2M1UA 1H4BA 2WCFA 1JBAA 1NX2A 4UPGA 2H2KA 1N0YA 3IQQA 2BCXA 1S3PA 1QVIZ 1TTXA 3E3RA 2LANA 2I7AA 1MF8B 1L2OB 1SY9A 1FBVA 2LMTA 1B47A 1RWYA 1ZOTB 2L50A 2M49B 3SIAA 5FYXA 2G2BA 5HLVA 1DF0A 1B1GA 4XJKA 1WRZA 3ICBA 1SK6D 2I18A 2LMVA 5D69A 5TNCA 4PHNA 1OOJA 2LVIA 2LE9B 1A4PA 2ZKMX 5ER5A 4JPZB 5KSZA 1K9PA 4BY4A 1SR6B 3PN7B 2GV5A 2LV7A 3TDUA 2GGZA 1KK8B 3IF7A 3TDIA 2WC8A 2JQ6A 3EK8A 3C1VA 1IH0A 2LC5A 3SG5A 3DF0A 5AXIA 2FCEA 2BCBA 1JF2A
chains in the Genus database with same CATH superfamily
1KFXS 2KSPA 1F55A 2BE6A 1EH2A 2WCLA 2LMUA 2P6BB 4GUKA 1CMFA 4JKTA 1IKUA 3KEVA 2A4JA 1M39A 3OBVA 3BJHA 2K61A 4IJ7A 4GBAA 1OW4A 4NDDA 1NIWA 2HF5A 4YGDB 3ZNIA 1CLBA 3KO0A 1Y1UA 1L2OC 1BG1A 4ORCB 3BUXB 1G8IA 2KBMA 2EC6B 3AAKA 2QEHA 1S5GY 3LK1A 4JWQA 2L5XB 3B7AA 3I5FB 3DVMA 1B8CA 2BKHB 1BT6A 2IS9A 1OMVA 1LA3A 1UURA 2WOSA 3VRRA 1SR6C 2O5GA 3PN7C 4NDBA 4WRIA 4F7FA 2K60A 5I2OA 1KK8C 2WC5A 3RM1A 3NHTA 1DF0B 2WCMA 4I5LB 4XJKB 1C07A 1XK4C 2SASA 1Z2CB 3CGAA 1XVJA 3CTNA 1WRKA 4A4BA 1W7JB 1OSAA 2JRFA 1QXPA 2LLUA 1PSRA 1CFCA 1CFFA 1W7IB 1FF1A 1VRKA 2F3YA 3SG4A 1DJZA 3WNXB 1V1GA 3D78A 4GAOA 2LM5A 1UHKA 4PDZA 1CM4A 2PSRA 1FI6A 1TNPA 3FWBA 2KI6D 4XYNA 5K89A 3FWCA 3D77A 1WDCB 3DF0B 3DY9A 3DVKA 3R1PA 5CSNA 1SYMA 2F33A 3TUYB 1B7TY 1Y1AA 2NZ0A 3HCMA 2EC6C 1SBJA 5KTYA 1KK7Z 2KI4C 2PVBA 1C3ZA 2P70A 1TNXA 4WQ2A 1AUIB 2NCOA 1KFUS 2COLB 1NP8A 2KYFA 3PFVA 2KBIA 4CPVA 4YI8A 1UHHA 3CDNA 1QIVA 1IQ5A 1XFYO 4P5OE 3PLFB 1KWOB 5B8IB 2NLNA 2CCMA 1IJ5A 3GK1A 4CLNA 3QMEA 2KGBC 4HREE 1CDLA 3KHEA 1BMOA 1L7ZA 2HQWA 1C7WA 2LVJA 3BUOB 4FQOA 5HKZA 1N2DA 2MRDA 4FQTA 1GQMA 2CNPA 3AKBA 1XO5A 1A29A 2K8MB 3VRQA 2JXLA 1JF0A 2BBNA 3RLZA 3NXAA 1F4OA 4GNKB 2BNXA 3OGNA 5I2QA 1QASA 2K7CA 1WDCC 3TZ1A 1QATA 2PMYA 3BFHA 1TOPA 4CFRA 1JC2A 5J3XA 3TUYC 5PALA 1KQMB 3WHTB 1M45A 1TCOB 2PALA 3OP0A 1CLMA 2GTEA 1QVIY 3B6XA 2JOJA 2WCEA 1YURA 5AANA 1UHJA 2MAZA 1W9ZA 1NSHA 3CZ1A 3PALA 2M7NA 4HRHA 1K90D 2WORA 2AUCA 3KF9A 4I5KA 5FI7A 1CDMA 4P2YB 1V1FA 3BYAA 3TS5B 1KWOC 1CFDA 2PYQA 1YX8A 2LLSA 1NPQA 5IBWA 1WY9A 1UHNA 1YTZC 4AQIA 5I8NA 1DGUA 1SMGA 1UWOA 1PK0D 1X02A 1QX2A 2JT8A 1TNWA 3CLNA 1NX1A 5JOLA 2QEBA 2PASA 2QEOA 1R2UA 3DVJA 1BF5A 1S1EA 1BJFA 1J7RA 3O6BA 1HQVA 2LCPA 4AOMA 1CB1A 2KDHA 2TN4A 5HYDA 1OOIX 2NXQA 1RK9A 1A75A 1U5IA 2MBXA 1E8AA 2Y4QA 2KPHA 2YGUA 1YVHA 3VRNA 1QLKA 2LUCA 2FCDA 3D10A 1QIWA 1G33A 1UHIA 2JWWA 3I5GB 5AFPA 3BFAA 2RGIA 4ICBA 1KQMC 5HKYA 1AJ5A 1MXEA 2LAPA 2AAOA 1Q80A 2CTNA 2Q91A 1KQVA 3IVTA 2H8VA 3I5IC 1FPWA 4E68A 2I2RE 3BFBA 3LCPC 4MVFA 3UO9A 1AK8A 1QV0A 2JPTA 1MQ1A 3FS7A 2K2AA 2OPOA 3FIAA 2CXJA 3NGVA 1N65A 1NX0A 2BL0B 2KNEA 3O4XA 3TS5C 2F3ZA 4OCIA 4PE0A 3L47A 2KHNA 5AERA 2BCAA 1OE9B 4C0KA 1P28A 1G4YR 2LVVA 2ZRTA 4MRXA 1DT7B 3SS5A 2WCBA 2JC2A 1OZSA 2JULA 1UUSA 3LK0A 1B8LA 2LP2A 1IGVA 3PATA 4BY5A 4C0LA 4MZKA 2L4IA 2ZNEA 3M0WA 1GM0A 3VB1A 5EL2A 2L2EA 4I5NB 3NSIA 1C3YA 1IG5A 2KI4B 2K0JA 1WLZA 3BUMB 3DD4A 4YBHB 1QLSA 1RFJA 3EVRA 3I5GC 1OZOA 4OVNF 1Y1XA 4OKHA 4PHKA 1TNQA 1JFJA 3JTDB 1B9AA 2QEVA 1BODA 1DJWA 1F71A 1SSEB 3S0GA 1A75B 1A2XA 4U8DA 5JJGA 1GGWA 4GFTA 1J7PA 1ZFSA 2K2FA 2KLDA 3OB1B 3F45A 4MN0A 3O4YA 2FJYA 2M3WA 4TNCA 1SL8A 4YGBB 4A4CA 2BL0C 2WC6A 1QWVA 1EL4A 4GGFA 3ZWHA 3NSOA 1RTP1 3QRXA 3N7HA 1NYAA 1XFUO 1K9KA 1K93D 1KSMA 2M1KB 1NWDA 3DZTA 2JT3A 5DKQA 1IIOA 2P71A 1Y6WA 1CMGA 3SS3A 3CZTX 4N1FA 3AKAA 3I5HB 2Y1NA 4ETOA 2HQ8A 2JU0A 3EK7A 2M9GA 1TIZA 1DJHA 3GOFA 3GK4X 1SNLA 2BBMA 3PM2A 2D8NA 2LNKA 1OOFA 2I94A 1K2HA 2KAXA 1OQPA 3JTDC 3EVVA 4ORAB 1S5GZ 2ERBA 2HETA 1AP4A 1AHRA 2F2PA 1J7QA 1QX7A 3R1OA 4Q04A 4I5JA 2B1UA 1OOGA 1HT9A 5HKWA 1SPYA 5I94A 1DMOA 1MHOA 3CR2A 1YRTB 2CBLA 1BU3A 3CWGA 3SG7A 1OMDA 3PSRA 2KQ6A 5CSIA 2KFGA 3HX4A 3IQOA 3K1EA 4YRUA 1CTRA 3B86A 2Y5IA 5D3OA 2LP3A 3BXKA 3S0BA 3I5HC 3S0AA 1PALA 1XFZO 2SCPA 1M31A 1SKTA 1YR5A 2OTGC 2FOTA 5CSFA 1DTLA 4QJ5B 1JUOA 1SCMC 3EVUA 2JTZA 4MLWA 3I5IB 1JFKA 3PJIA 1JWDA 2F8PA 1S26D 1NCZA 4OZDA 1BLQA 1DGVA 3D76A 3CYZA 3UNWA 1B7TZ 1YX7A 1F4QA 1ZMZA 1UP5A 2L0PA 1ALVA 5HL1A 2M0RA 1OMRA 1NX3A 4C0JA 1PVBA 1RJVA 2NCPA 1SL7A 2KGRA 2MHHA 4NQGA 3BOWA 4QJ4B 1YUSA 5FI2A 5KU1A 4INXA 1LXFC 3FE9A 1K94A 1GJYA 1WLMA 3OX5A 4F0ZB 3CR4X 3AAJA 4MZLA 4PHMA 2LVKA 5G08A 1CKKA 1CDPA 1CM1A 4JQ0D 2JNXA 4DS7A 1F70A 2KI6C 4PE4A 1ORGA 5CSJA 3VGOA 4WQ3A 1KCYA 2QDIA 2R2IA 1KFXL 3BUNB 4PT1A 2KOTA 4GGFC 1B8RA 1J55A 3DVEA 4IL1A 3NSLA 4N1GA 4OR9B 2ZRSA 3SG6A 2KFHA 1DJXA 3WXAA 3EK4A 1RROA 3DXLA 3O78A 1CFPA 2FJUB 1PRWA 1T14A 4PE7A 2LLTA 1PULA 1ALWA 3NHIA 5BPJA 1IWQA 4FTGA 2HPSA 3B87A 4HSZA 3TDZA 1SL9A 1Z4HA 2BE4A 1MWNA 2BECA 1MR8A 2LHIA 2Y1MA 2JTTA 3OB2B 5I2LA 2ISDA 1FW4A 1XFWO 4GGNA 1YRUB 5GQQC 3JVTB 4D1EA 3BUWB 2VRGA 1XFRA 2KAVA 3LL8B 1IQ3A 3CABA 2JPOA 2K7OA 1QX5B 1IJ6A 3BOWB 5CPVA 1D1OA 4OV2A 1B4CA 4MRYA 4N5XA 1YUTA 1F8HA 2BAPA 5DKRA 1TWOA 2PQLA 3OHMB 2V53A 2OS8B 4YI9A 1DJGA 1H8BA 5F6TA 3BQ3A 4L9MA 1MUXA 3A8RA 2M29A 3L4AA 1PVAA 1U5IB 3V2LA 2H61A 1LKJA 1GGZA 1KK7Y 1KSOA 4MSPA 1S6IA 4DIRA 4PALA 3CS1A 1KFUL 1TUJA 2KLEA 4YGCB 3SS4A 2ZN9A 4M2QA 1C7VA 2CT9A 1EG4A 2JZIA 5DKNA 2JNFA 4PE1A 1EG3A 1QTXA 4ZCUA 1CNPA 4DCKA 2WCKA 2K7DA 1AVSA 1NUBA 4NDCA 2L51A 5ER4X 3CZ2A 1RECA 2OTGB 5D7FA 1BR1B 3JVTC 1SRAA 1YUUA 2KAYA 1SCMB 4YGEB 1LS8A 2ZN8A 1S36A 3S0EA 3GK2A 1EXRA 3EKHA 1S6CA 1OOHA 3NSKA 1FI5A 2K7BA 4PCWA 1TCFA 3EKJA 1DVIA 4ZCVA 2JXCA 1ZACA 2OS8C 2KFFA 5DICA 2MA2A 1BR4B 1J1DA 1XFXO 3VRPA 1A03A 5HLOA 3D0YA 1YVLA 2QACA 3SG2A 1J1EA 4DUQA 3OX6A 2WNDA 1J7OA 1XFVO 2M8UA 3SG3A 2EGDA 3LLEA 1S6JA 3H4SE 4INWA 1LVCD 1SCVA 4ORBB 1NCYA 3CR5X 1TN4A 2E30A 3L4LA 4DRWA 1CDNA 3KPXA 1LA0A 3I5FC 3MSEB 4R1EA 2EHBA 1LINA 3FE8A 2DOQA 4CIDA 1K96A 3RZSA 1MXLC 1ZUZA 3FE6A 2L98A 2GGMA 2JT0A 2MJWB 2ZFDA 4PHJA 4CFQA 2L4HA 5AEQA 3A4UB 5FI6A 2PRUA 2M97A 1XYDA 3R1VA 3VROA 1BOCA 2F2OA 3SIBA 2MLEC 2LHLA 1JSAA 1IRJA 1R6PA 2E6WA 2KYCA 2O60A 4MEWA 3D73A 1K9UA 3PM8A 1QJTA 1WRLA 3K21A 1ODBA 1K95A 2Q4UA 3WHUB 1XK4A 4USLA 4M2OA 4GPLB 1Y0VH 1TRFA 1AJ4A 4M2PA 2M7LA 1XA5A 2ZNDA 1DJYA 4HRGA 3B88A 1K8UA 4YGAA 1PSBA 3D0YB 4AQJA 2G9BA 3O2PA 2LUXA 4QJ3B 2H61C 1CLLA 1NCXA 2MLFC 3Q8IA 2KQYA 1TUZA 1DC1A 1DEKA 1QV1A 1EJ3A 1SW8A 1M63B 2AMIA 1M46A 2QPTA 4MBEA 1F54A 1DQEA 4MZJA 2BKIB 3SJSA 1DJIA 1QS7A 2M1UA 1H4BA 3D75A 2WCFA 1JBAA 1NX2A 4UPGA 2H2KA 2WCHA 1N0YA 3IQQA 2BCXA 1S3PA 4JD9A 1QVIZ 1TTXA 3E3RA 2LANA 2I7AA 1MF8B 1L2OB 3S0DA 3S0FA 1SY9A 1FBVA 2LMTA 1B47A 1RWYA 1ZOTB 2L50A 2M49B 3CZ0A 3SIAA 1DELA 5FYXA 2G2BA 5HLVA 1DF0A 1B1GA 4XJKA 1WRZA 3ICBA 1SK6D 2I18A 2LMVA 5D69A 5TNCA 4PHNA 1OOJA 2LVIA 2LE9B 1A4PA 2ZKMX 4KYNA 5ER5A 4JPZB 5KSZA 1K9PA 3DYEA 3EG5B 4BY4A 3D74A 2WCJA 1SR6B 3PN7B 2GV5A 2L2CA 2LV7A 3TDUA 2GGZA 1KK8B 3IF7A 3R72A 3TDIA 2WC8A 2JQ6A 3EK8A 3C1VA 1IH0A 2LC5A 3SG5A 3DF0A 5AXIA 2FCEA 2L5YA 2BCBA 1JF2A
chains in the Genus database with same CATH topology
1KFXS 2KSPA 1F55A 2BE6A 1EH2A 2LMUA 2P6BB 4GUKA 1CMFA 1IKUA 3KEVA 2A4JA 1M39A 2K61A 3ZNIA 4GBAA 4NDDA 1NIWA 2HF5A 4YGDB 1CLBA 3KO0A 1Y1UA 1L2OC 1BG1A 4ORCB 3BUXB 1G8IA 2KBMA 2EC6B 3AAKA 1S5GY 3LK1A 4JWQA 2L5XB 3I5FB 3DVMA 2BKHB 1B8CA 1BT6A 2IS9A 1OMVA 1LA3A 1UURA 2WOSA 3VRRA 1SR6C 2O5GA 3PN7C 4NDBA 4WRIA 5I2OA 1KK8C 3RM1A 1DF0B 4I5LB 4XJKB 1C07A 1XK4C 2SASA 3CGAA 1XVJA 3CTNA 1WRKA 4A4BA 1W7JB 1OSAA 2JRFA 1QXPA 2LLUA 1PSRA 1CFCA 1CFFA 1W7IB 1FF1A 1VRKA 2F3YA 3SG4A 1DJZA 3WNXB 1V1GA 4GAOA 2LM5A 1UHKA 4PDZA 1CM4A 2PSRA 1FI6A 1TNPA 3FWBA 2KI6D 4XYNA 5K89A 3FWCA 1WDCB 3DF0B 3DVKA 5CSNA 1SYMA 2F33A 3TUYB 1B7TY 1Y1AA 2NZ0A 3HCMA 2EC6C 1SBJA 5KTYA 1KK7Z 2KI4C 2PVBA 4WQ2A 1TNXA 1AUIB 2NCOA 1KFUS 2COLB 1NP8A 2KYFA 3PFVA 2KBIA 4CPVA 4YI8A 1UHHA 1QIVA 1IQ5A 1XFYO 4P5OE 3PLFB 1KWOB 5B8IB 2NLNA 2CCMA 1IJ5A 3GK1A 4CLNA 2KGBC 4HREE 1CDLA 3KHEA 1BMOA 1L7ZA 2HQWA 1C7WA 2LVJA 3BUOB 4FQOA 5HKZA 1N2DA 2MRDA 1GQMA 2CNPA 3AKBA 1XO5A 1A29A 2K8MB 3VRQA 2JXLA 1JF0A 2BBNA 3RLZA 3NXAA 1F4OA 4GNKB 5I2QA 1QASA 2K7CA 1WDCC 3TZ1A 1QATA 2PMYA 1TOPA 4CFRA 1JC2A 5J3XA 3TUYC 5PALA 1KQMB 3WHTB 1M45A 1TCOB 2PALA 3OP0A 1CLMA 1QVIY 2JOJA 2WCEA 1YURA 5AANA 1UHJA 2MAZA 1NSHA 3PALA 2M7NA 4HRHA 1K90D 2WORA 2AUCA 3KF9A 4I5KA 1CDMA 4P2YB 1V1FA 3BYAA 3TS5B 1KWOC 1CFDA 1YX8A 2LLSA 1NPQA 5IBWA 1WY9A 1UHNA 1YTZC 4AQIA 5I8NA 1DGUA 1SMGA 1UWOA 1PK0D 1X02A 1QX2A 2JT8A 1TNWA 3CLNA 1NX1A 5JOLA 2PASA 1R2UA 3DVJA 1BF5A 1S1EA 1BJFA 1J7RA 3O6BA 1HQVA 2LCPA 4AOMA 1CB1A 2KDHA 2TN4A 5HYDA 2NXQA 1RK9A 1A75A 1U5IA 2MBXA 1E8AA 2Y4QA 1YVHA 3VRNA 1QLKA 2LUCA 2FCDA 3D10A 1QIWA 1G33A 1UHIA 2JWWA 3I5GB 5AFPA 2RGIA 4ICBA 1KQMC 5HKYA 1AJ5A 1MXEA 2LAPA 2AAOA 1Q80A 2CTNA 2Q91A 1KQVA 3I5IC 1FPWA 4E68A 2I2RE 3LCPC 4MVFA 1AK8A 1QV0A 2JPTA 1MQ1A 3FS7A 2K2AA 2OPOA 3FIAA 2CXJA 1N65A 1NX0A 2BL0B 2KNEA 3TS5C 2F3ZA 4OCIA 4PE0A 5AERA 2KHNA 2BCAA 1OE9B 4C0KA 1G4YR 2LVVA 2ZRTA 4MRXA 1DT7B 2WCBA 2JC2A 1OZSA 2JULA 1UUSA 3LK0A 1B8LA 2LP2A 1IGVA 3PATA 4BY5A 4C0LA 4MZKA 2L4IA 2ZNEA 3M0WA 2L2EA 4I5NB 3NSIA 1IG5A 2KI4B 2K0JA 1WLZA 3BUMB 3DD4A 4YBHB 1QLSA 1RFJA 3EVRA 3I5GC 1OZOA 4OVNF 1Y1XA 4OKHA 4PHKA 1TNQA 1JFJA 3JTDB 1B9AA 1BODA 1DJWA 1F71A 1A75B 1A2XA 4U8DA 5JJGA 1GGWA 4GFTA 1J7PA 1ZFSA 2K2FA 3OB1B 4MN0A 3F45A 4YGBB 3O4YA 2M3WA 4TNCA 1SL8A 4A4CA 2BL0C 1EL4A 4GGFA 3ZWHA 3NSOA 1RTP1 3QRXA 1NYAA 1XFUO 1K9KA 1K93D 1KSMA 2M1KB 1NWDA 2JT3A 5DKQA 1Y6WA 1CMGA 3CZTX 4N1FA 3AKAA 3I5HB 2Y1NA 4ETOA 2HQ8A 2JU0A 3EK7A 2M9GA 1TIZA 1DJHA 3GOFA 3GK4X 1SNLA 2BBMA 2D8NA 2LNKA 2I94A 1K2HA 2KAXA 1OQPA 3JTDC 3EVVA 4ORAB 1S5GZ 2HETA 1AP4A 1AHRA 2F2PA 1J7QA 1QX7A 4Q04A 4I5JA 2B1UA 1HT9A 5HKWA 1SPYA 1DMOA 1MHOA 3CR2A 1YRTB 2CBLA 1BU3A 3CWGA 3SG7A 1OMDA 3PSRA 2KQ6A 5CSIA 2KFGA 3HX4A 3IQOA 4YRUA 1CTRA 2Y5IA 2LP3A 3BXKA 3I5HC 1PALA 1XFZO 2SCPA 1M31A 1SKTA 1YR5A 2OTGC 2FOTA 5CSFA 1DTLA 4QJ5B 1JUOA 1SCMC 3EVUA 2JTZA 4MLWA 3I5IB 1JFKA 1JWDA 2F8PA 1S26D 1NCZA 1BLQA 1DGVA 1B7TZ 1YX7A 1F4QA 1ZMZA 1UP5A 2L0PA 1ALVA 2M0RA 1OMRA 1NX3A 4C0JA 1PVBA 1RJVA 2NCPA 1SL7A 2KGRA 2MHHA 4NQGA 3BOWA 4QJ4B 1YUSA 5KU1A 1LXFC 1K94A 1GJYA 1WLMA 3OX5A 4F0ZB 3CR4X 3AAJA 4MZLA 4PHMA 2LVKA 5G08A 1CKKA 1CDPA 1CM1A 4JQ0D 2JNXA 4DS7A 1F70A 2KI6C 4PE4A 5CSJA 3VGOA 4WQ3A 1KCYA 2R2IA 1KFXL 3BUNB 2KOTA 4GGFC 1B8RA 1J55A 3DVEA 4IL1A 3NSLA 4N1GA 4OR9B 2ZRSA 3SG6A 2KFHA 1DJXA 3WXAA 3EK4A 1RROA 3O78A 1CFPA 2FJUB 1PRWA 4PE7A 2LLTA 1PULA 1ALWA 5BPJA 1IWQA 4FTGA 2HPSA 4HSZA 3TDZA 1SL9A 2BE4A 1MWNA 2BECA 1MR8A 2LHIA 2Y1MA 2JTTA 3OB2B 5I2LA 2ISDA 1FW4A 1XFWO 4GGNA 1YRUB 5GQQC 3JVTB 4D1EA 3BUWB 2VRGA 2KAVA 3LL8B 1IQ3A 2K7OA 1QX5B 1IJ6A 3BOWB 5CPVA 1D1OA 4OV2A 1B4CA 4MRYA 4N5XA 1YUTA 1F8HA 5DKRA 3OHMB 2V53A 2OS8B 4YI9A 1DJGA 1H8BA 5F6TA 3BQ3A 4L9MA 1MUXA 3A8RA 2M29A 1PVAA 1U5IB 2H61A 1LKJA 1GGZA 1KK7Y 1KSOA 4MSPA 1S6IA 4DIRA 4PALA 3CS1A 1KFUL 4YGCB 2ZN9A 4M2QA 1C7VA 2CT9A 1EG4A 2JZIA 5DKNA 2JNFA 4PE1A 1EG3A 1QTXA 4ZCUA 1CNPA 4DCKA 2K7DA 1AVSA 1NUBA 4NDCA 2L51A 5ER4X 1RECA 2OTGB 5D7FA 1BR1B 3JVTC 1SRAA 1YUUA 2KAYA 1SCMB 4YGEB 2ZN8A 1S36A 3GK2A 1EXRA 3EKHA 1S6CA 3NSKA 1FI5A 2K7BA 4PCWA 1TCFA 3EKJA 1DVIA 4ZCVA 2JXCA 1ZACA 2OS8C 2KFFA 2MA2A 1BR4B 1J1DA 1XFXO 3VRPA 1A03A 5HLOA 3D0YA 1YVLA 2QACA 3SG2A 1J1EA 4DUQA 3OX6A 2WNDA 1J7OA 1XFVO 2M8UA 3SG3A 2EGDA 3LLEA 1S6JA 3H4SE 1LVCD 1SCVA 4ORBB 1NCYA 3CR5X 1TN4A 2E30A 4DRWA 1CDNA 3KPXA 1LA0A 3I5FC 3MSEB 4R1EA 2EHBA 1LINA 2DOQA 4CIDA 1K96A 1MXLC 1ZUZA 2L98A 2GGMA 2JT0A 2MJWB 2ZFDA 4PHJA 4CFQA 2L4HA 5AEQA 3A4UB 2PRUA 2M97A 1XYDA 3VROA 1BOCA 2F2OA 3SIBA 2MLEC 2LHLA 1JSAA 1IRJA 1R6PA 2E6WA 2KYCA 2O60A 4MEWA 1K9UA 3PM8A 1QJTA 1WRLA 3K21A 1ODBA 1K95A 2Q4UA 3WHUB 1XK4A 4USLA 4M2OA 4GPLB 1Y0VH 1TRFA 1AJ4A 4M2PA 2M7LA 1XA5A 2ZNDA 1DJYA 4HRGA 1K8UA 4YGAA 1PSBA 3D0YB 4AQJA 2G9BA 3O2PA 2LUXA 4QJ3B 2H61C 1CLLA 1NCXA 2MLFC 2KQYA 1EJ3A 1QV1A 1M63B 1SW8A 2AMIA 2QPTA 1M46A 4MBEA 1F54A 4MZJA 2BKIB 3SJSA 1DJIA 1QS7A 2M1UA 1H4BA 2WCFA 1JBAA 1NX2A 4UPGA 2H2KA 1N0YA 3IQQA 2BCXA 1S3PA 1QVIZ 1TTXA 3E3RA 2LANA 2I7AA 1MF8B 1L2OB 1SY9A 1FBVA 2LMTA 1B47A 1RWYA 1ZOTB 2L50A 2M49B 3SIAA 5FYXA 2G2BA 5HLVA 1DF0A 1B1GA 4XJKA 1WRZA 3ICBA 1SK6D 2I18A 2LMVA 5D69A 5TNCA 4PHNA 1OOJA 2LVIA 2LE9B 1A4PA 2ZKMX 5ER5A 4JPZB 5KSZA 1K9PA 4BY4A 1SR6B 3PN7B 2GV5A 2LV7A 3TDUA 2GGZA 1KK8B 3IF7A 3TDIA 2WC8A 2JQ6A 3EK8A 3C1VA 1IH0A 2LC5A 3SG5A 3DF0A 5AXIA 2FCEA 2BCBA 1JF2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KFX S;  2KSP A;  1F55 A;  2BE6 A;  1EH2 A;  2LMU A;  2P6B B;  4GUK A;  1CMF A;  1IKU A;  3KEV A;  2A4J A;  1M39 A;  2K61 A;  3ZNI A;  4GBA A;  4NDD A;  1NIW A;  2HF5 A;  4YGD B;  1CLB A;  3KO0 A;  1Y1U A;  1L2O C;  1BG1 A;  4ORC B;  3BUX B;  1G8I A;  2KBM A;  2EC6 B;  3AAK A;  1S5G Y;  3LK1 A;  4JWQ A;  2L5X B;  3I5F B;  3DVM A;  2BKH B;  1B8C A;  1BT6 A;  2IS9 A;  1OMV A;  1LA3 A;  1UUR A;  2WOS A;  3VRR A;  1SR6 C;  2O5G A;  3PN7 C;  4NDB A;  4WRI A;  5I2O A;  1KK8 C;  3RM1 A;  1DF0 B;  4I5L B;  4XJK B;  1C07 A;  1XK4 C;  2SAS A;  3CGA A;  1XVJ A;  3CTN A;  1WRK A;  4A4B A;  1W7J B;  1OSA A;  2JRF A;  1QXP A;  2LLU A;  1PSR A;  1CFC A;  1CFF A;  1W7I B;  1FF1 A;  1VRK A;  2F3Y A;  3SG4 A;  1DJZ A;  3WNX B;  1V1G A;  4GAO A;  2LM5 A;  1UHK A;  4PDZ A;  1CM4 A;  2PSR A;  1FI6 A;  1TNP A;  3FWB A;  2KI6 D;  4XYN A;  5K89 A;  3FWC A;  1WDC B;  3DF0 B;  3DVK A;  5CSN A;  1SYM A;  2F33 A;  3TUY B;  1B7T Y;  1Y1A A;  2NZ0 A;  3HCM A;  2EC6 C;  1SBJ A;  5KTY A;  1KK7 Z;  2KI4 C;  2PVB A;  4WQ2 A;  1TNX A;  1AUI B;  2NCO A;  1KFU S;  2COL B;  1NP8 A;  2KYF A;  3PFV A;  2KBI A;  4CPV A;  4YI8 A;  1UHH A;  1QIV A;  1IQ5 A;  1XFY O;  4P5O E;  3PLF B;  1KWO B;  5B8I B;  2NLN A;  2CCM A;  1IJ5 A;  3GK1 A;  4CLN A;  2KGB C;  4HRE E;  1CDL A;  3KHE A;  1BMO A;  1L7Z A;  2HQW A;  1C7W A;  2LVJ A;  3BUO B;  4FQO A;  5HKZ A;  1N2D A;  2MRD A;  1GQM A;  2CNP A;  3AKB A;  1XO5 A;  1A29 A;  2K8M B;  3VRQ A;  2JXL A;  1JF0 A;  2BBN A;  3RLZ A;  3NXA A;  1F4O A;  4GNK B;  5I2Q A;  1QAS A;  2K7C A;  1WDC C;  3TZ1 A;  1QAT A;  2PMY A;  1TOP A;  4CFR A;  1JC2 A;  5J3X A;  3TUY C;  5PAL A;  1KQM B;  3WHT B;  1M45 A;  1TCO B;  2PAL A;  3OP0 A;  1CLM A;  1QVI Y;  2JOJ A;  2WCE A;  1YUR A;  5AAN A;  1UHJ A;  2MAZ A;  1NSH A;  3PAL A;  2M7N A;  4HRH A;  1K90 D;  2WOR A;  2AUC A;  3KF9 A;  4I5K A;  1CDM A;  4P2Y B;  1V1F A;  3BYA A;  3TS5 B;  1KWO C;  1CFD A;  1YX8 A;  2LLS A;  1NPQ A;  5IBW A;  1WY9 A;  1UHN A;  1YTZ C;  4AQI A;  5I8N A;  1DGU A;  1SMG A;  1UWO A;  1PK0 D;  1X02 A;  1QX2 A;  2JT8 A;  1TNW A;  3CLN A;  1NX1 A;  5JOL A;  2PAS A;  1R2U A;  3DVJ A;  1BF5 A;  1S1E A;  1BJF A;  1J7R A;  3O6B A;  1HQV A;  2LCP A;  4AOM A;  1CB1 A;  2KDH A;  2TN4 A;  5HYD A;  2NXQ A;  1RK9 A;  1A75 A;  1U5I A;  2MBX A;  1E8A A;  2Y4Q A;  1YVH A;  3VRN A;  1QLK A;  2LUC A;  2FCD A;  3D10 A;  1QIW A;  1G33 A;  1UHI A;  2JWW A;  3I5G B;  5AFP A;  2RGI A;  4ICB A;  1KQM C;  5HKY A;  1AJ5 A;  1MXE A;  2LAP A;  2AAO A;  1Q80 A;  2CTN A;  2Q91 A;  1KQV A;  3I5I C;  1FPW A;  4E68 A;  2I2R E;  3LCP C;  4MVF A;  1AK8 A;  1QV0 A;  2JPT A;  1MQ1 A;  3FS7 A;  2K2A A;  2OPO A;  3FIA A;  2CXJ A;  1N65 A;  1NX0 A;  2BL0 B;  2KNE A;  3TS5 C;  2F3Z A;  4OCI A;  4PE0 A;  5AER A;  2KHN A;  2BCA A;  1OE9 B;  4C0K A;  1G4Y R;  2LVV A;  2ZRT A;  4MRX A;  1DT7 B;  2WCB A;  2JC2 A;  1OZS A;  2JUL A;  1UUS A;  3LK0 A;  1B8L A;  2LP2 A;  1IGV A;  3PAT A;  4BY5 A;  4C0L A;  4MZK A;  2L4I A;  2ZNE A;  3M0W A;  2L2E A;  4I5N B;  3NSI A;  1IG5 A;  2KI4 B;  2K0J A;  1WLZ A;  3BUM B;  3DD4 A;  4YBH B;  1QLS A;  1RFJ A;  3EVR A;  3I5G C;  1OZO A;  4OVN F;  1Y1X A;  4OKH A;  4PHK A;  1TNQ A;  1JFJ A;  3JTD B;  1B9A A;  1BOD A;  1DJW A;  1F71 A;  1A75 B;  1A2X A;  4U8D A;  5JJG A;  1GGW A;  4GFT A;  1J7P A;  1ZFS A;  2K2F A;  3OB1 B;  4MN0 A;  3F45 A;  4YGB B;  3O4Y A;  2M3W A;  4TNC A;  1SL8 A;  4A4C A;  2BL0 C;  1EL4 A;  4GGF A;  3ZWH A;  3NSO A;  1RTP 1;  3QRX A;  1NYA A;  1XFU O;  1K9K A;  1K93 D;  1KSM A;  2M1K B;  1NWD A;  2JT3 A;  5DKQ A;  1Y6W A;  1CMG A;  3CZT X;  4N1F A;  3AKA A;  3I5H B;  2Y1N A;  4ETO A;  2HQ8 A;  2JU0 A;  3EK7 A;  2M9G A;  1TIZ A;  1DJH A;  3GOF A;  3GK4 X;  1SNL A;  2BBM A;  2D8N A;  2LNK A;  2I94 A;  1K2H A;  2KAX A;  1OQP A;  3JTD C;  3EVV A;  4ORA B;  1S5G Z;  2HET A;  1AP4 A;  1AHR A;  2F2P A;  1J7Q A;  1QX7 A;  4Q04 A;  4I5J A;  2B1U A;  1HT9 A;  5HKW A;  1SPY A;  1DMO A;  1MHO A;  3CR2 A;  1YRT B;  2CBL A;  1BU3 A;  3CWG A;  3SG7 A;  1OMD A;  3PSR A;  2KQ6 A;  5CSI A;  2KFG A;  3HX4 A;  3IQO A;  4YRU A;  1CTR A;  2Y5I A;  2LP3 A;  3BXK A;  3I5H C;  1PAL A;  1XFZ O;  2SCP A;  1M31 A;  1SKT A;  1YR5 A;  2OTG C;  2FOT A;  5CSF A;  1DTL A;  4QJ5 B;  1JUO A;  1SCM C;  3EVU A;  2JTZ A;  4MLW A;  3I5I B;  1JFK A;  1JWD A;  2F8P A;  1S26 D;  1NCZ A;  1BLQ A;  1DGV A;  1B7T Z;  1YX7 A;  1F4Q A;  1ZMZ A;  1UP5 A;  2L0P A;  1ALV A;  2M0R A;  1OMR A;  1NX3 A;  4C0J A;  1PVB A;  1RJV A;  2NCP A;  1SL7 A;  2KGR A;  2MHH A;  4NQG A;  3BOW A;  4QJ4 B;  1YUS A;  5KU1 A;  1LXF C;  1K94 A;  1GJY A;  1WLM A;  3OX5 A;  4F0Z B;  3CR4 X;  3AAJ A;  4MZL A;  4PHM A;  2LVK A;  5G08 A;  1CKK A;  1CDP A;  1CM1 A;  4JQ0 D;  2JNX A;  4DS7 A;  1F70 A;  2KI6 C;  4PE4 A;  5CSJ A;  3VGO A;  4WQ3 A;  1KCY A;  2R2I A;  1KFX L;  3BUN B;  2KOT A;  4GGF C;  1B8R A;  1J55 A;  3DVE A;  4IL1 A;  3NSL A;  4N1G A;  4OR9 B;  2ZRS A;  3SG6 A;  2KFH A;  1DJX A;  3WXA A;  3EK4 A;  1RRO A;  3O78 A;  1CFP A;  2FJU B;  1PRW A;  4PE7 A;  2LLT A;  1PUL A;  1ALW A;  5BPJ A;  1IWQ A;  4FTG A;  2HPS A;  4HSZ A;  3TDZ A;  1SL9 A;  2BE4 A;  1MWN A;  2BEC A;  1MR8 A;  2LHI A;  2Y1M A;  2JTT A;  3OB2 B;  5I2L A;  2ISD A;  1FW4 A;  1XFW O;  4GGN A;  1YRU B;  5GQQ C;  3JVT B;  4D1E A;  3BUW B;  2VRG A;  2KAV A;  3LL8 B;  1IQ3 A;  2K7O A;  1QX5 B;  1IJ6 A;  3BOW B;  5CPV A;  1D1O A;  4OV2 A;  1B4C A;  4MRY A;  4N5X A;  1YUT A;  1F8H A;  5DKR A;  3OHM B;  2V53 A;  2OS8 B;  4YI9 A;  1DJG A;  1H8B A;  5F6T A;  3BQ3 A;  4L9M A;  1MUX A;  3A8R A;  2M29 A;  1PVA A;  1U5I B;  2H61 A;  1LKJ A;  1GGZ A;  1KK7 Y;  1KSO A;  4MSP A;  1S6I A;  4DIR A;  4PAL A;  3CS1 A;  1KFU L;  4YGC B;  2ZN9 A;  4M2Q A;  1C7V A;  2CT9 A;  1EG4 A;  2JZI A;  5DKN A;  2JNF A;  4PE1 A;  1EG3 A;  1QTX A;  4ZCU A;  1CNP A;  4DCK A;  2K7D A;  1AVS A;  1NUB A;  4NDC A;  2L51 A;  5ER4 X;  1REC A;  2OTG B;  5D7F A;  1BR1 B;  3JVT C;  1SRA A;  1YUU A;  2KAY A;  1SCM B;  4YGE B;  2ZN8 A;  1S36 A;  3GK2 A;  1EXR A;  3EKH A;  1S6C A;  3NSK A;  1FI5 A;  2K7B A;  4PCW A;  1TCF A;  3EKJ A;  1DVI A;  4ZCV A;  2JXC A;  1ZAC A;  2OS8 C;  2KFF A;  2MA2 A;  1BR4 B;  1J1D A;  1XFX O;  3VRP A;  1A03 A;  5HLO A;  3D0Y A;  1YVL A;  2QAC A;  3SG2 A;  1J1E A;  4DUQ A;  3OX6 A;  2WND A;  1J7O A;  1XFV O;  2M8U A;  3SG3 A;  2EGD A;  3LLE A;  1S6J A;  3H4S E;  1LVC D;  1SCV A;  4ORB B;  1NCY A;  3CR5 X;  1TN4 A;  2E30 A;  4DRW A;  1CDN A;  3KPX A;  1LA0 A;  3I5F C;  3MSE B;  4R1E A;  2EHB A;  1LIN A;  2DOQ A;  4CID A;  1K96 A;  1MXL C;  1ZUZ A;  2L98 A;  2GGM A;  2JT0 A;  2MJW B;  2ZFD A;  4PHJ A;  4CFQ A;  2L4H A;  5AEQ A;  3A4U B;  2PRU A;  2M97 A;  1XYD A;  3VRO A;  1BOC A;  2F2O A;  3SIB A;  2MLE C;  2LHL A;  1JSA A;  1IRJ A;  1R6P A;  2E6W A;  2KYC A;  2O60 A;  4MEW A;  1K9U A;  3PM8 A;  1QJT A;  1WRL A;  3K21 A;  1ODB A;  1K95 A;  2Q4U A;  3WHU B;  1XK4 A;  4USL A;  4M2O A;  4GPL B;  1Y0V H;  1TRF A;  1AJ4 A;  4M2P A;  2M7L A;  1XA5 A;  2ZND A;  1DJY A;  4HRG A;  1K8U A;  4YGA A;  1PSB A;  3D0Y B;  4AQJ A;  2G9B A;  3O2P A;  2LUX A;  4QJ3 B;  2H61 C;  1CLL A;  1NCX A;  2MLF C;  2KQY A;  1EJ3 A;  1QV1 A;  1M63 B;  1SW8 A;  2AMI A;  2QPT A;  1M46 A;  4MBE A;  1F54 A;  4MZJ A;  2BKI B;  3SJS A;  1DJI A;  1QS7 A;  2M1U A;  1H4B A;  2WCF A;  1JBA A;  1NX2 A;  4UPG A;  2H2K A;  1N0Y A;  3IQQ A;  2BCX A;  1S3P A;  1QVI Z;  1TTX A;  3E3R A;  2LAN A;  2I7A A;  1MF8 B;  1L2O B;  1SY9 A;  1FBV A;  2LMT A;  1B47 A;  1RWY A;  1ZOT B;  2L50 A;  2M49 B;  3SIA A;  5FYX A;  2G2B A;  5HLV A;  1DF0 A;  1B1G A;  4XJK A;  1WRZ A;  3ICB A;  1SK6 D;  2I18 A;  2LMV A;  5D69 A;  5TNC A;  4PHN A;  1OOJ A;  2LVI A;  2LE9 B;  1A4P A;  2ZKM X;  5ER5 A;  4JPZ B;  5KSZ A;  1K9P A;  4BY4 A;  1SR6 B;  3PN7 B;  2GV5 A;  2LV7 A;  3TDU A;  2GGZ A;  1KK8 B;  3IF7 A;  3TDI A;  2WC8 A;  2JQ6 A;  3EK8 A;  3C1V A;  1IH0 A;  2LC5 A;  3SG5 A;  3DF0 A;  5AXI A;  2FCE A;  2BCB A;  1JF2 A; 
#chains in the Genus database with same CATH topology
 1KFX S;  2KSP A;  1F55 A;  2BE6 A;  1EH2 A;  2WCL A;  2LMU A;  2P6B B;  4GUK A;  1CMF A;  4JKT A;  1IKU A;  3KEV A;  2A4J A;  1M39 A;  3OBV A;  3BJH A;  2K61 A;  4IJ7 A;  4GBA A;  1OW4 A;  4NDD A;  1NIW A;  2HF5 A;  4YGD B;  3ZNI A;  1CLB A;  3KO0 A;  1Y1U A;  1L2O C;  1BG1 A;  4ORC B;  3BUX B;  1G8I A;  2KBM A;  2EC6 B;  3AAK A;  2QEH A;  1S5G Y;  3LK1 A;  4JWQ A;  2L5X B;  3B7A A;  3I5F B;  3DVM A;  1B8C A;  2BKH B;  1BT6 A;  2IS9 A;  1OMV A;  1LA3 A;  1UUR A;  2WOS A;  3VRR A;  1SR6 C;  2O5G A;  3PN7 C;  4NDB A;  4WRI A;  4F7F A;  2K60 A;  5I2O A;  1KK8 C;  2WC5 A;  3RM1 A;  3NHT A;  1DF0 B;  2WCM A;  4I5L B;  4XJK B;  1C07 A;  1XK4 C;  2SAS A;  1Z2C B;  3CGA A;  1XVJ A;  3CTN A;  1WRK A;  4A4B A;  1W7J B;  1OSA A;  2JRF A;  1QXP A;  2LLU A;  1PSR A;  1CFC A;  1CFF A;  1W7I B;  1FF1 A;  1VRK A;  2F3Y A;  3SG4 A;  1DJZ A;  3WNX B;  1V1G A;  3D78 A;  4GAO A;  2LM5 A;  1UHK A;  4PDZ A;  1CM4 A;  2PSR A;  1FI6 A;  1TNP A;  3FWB A;  2KI6 D;  4XYN A;  5K89 A;  3FWC A;  3D77 A;  1WDC B;  3DF0 B;  3DY9 A;  3DVK A;  3R1P A;  5CSN A;  1SYM A;  2F33 A;  3TUY B;  1B7T Y;  1Y1A A;  2NZ0 A;  3HCM A;  2EC6 C;  1SBJ A;  5KTY A;  1KK7 Z;  2KI4 C;  2PVB A;  1C3Z A;  2P70 A;  1TNX A;  4WQ2 A;  1AUI B;  2NCO A;  1KFU S;  2COL B;  1NP8 A;  2KYF A;  3PFV A;  2KBI A;  4CPV A;  4YI8 A;  1UHH A;  3CDN A;  1QIV A;  1IQ5 A;  1XFY O;  4P5O E;  3PLF B;  1KWO B;  5B8I B;  2NLN A;  2CCM A;  1IJ5 A;  3GK1 A;  4CLN A;  3QME A;  2KGB C;  4HRE E;  1CDL A;  3KHE A;  1BMO A;  1L7Z A;  2HQW A;  1C7W A;  2LVJ A;  3BUO B;  4FQO A;  5HKZ A;  1N2D A;  2MRD A;  4FQT A;  1GQM A;  2CNP A;  3AKB A;  1XO5 A;  1A29 A;  2K8M B;  3VRQ A;  2JXL A;  1JF0 A;  2BBN A;  3RLZ A;  3NXA A;  1F4O A;  4GNK B;  2BNX A;  3OGN A;  5I2Q A;  1QAS A;  2K7C A;  1WDC C;  3TZ1 A;  1QAT A;  2PMY A;  3BFH A;  1TOP A;  4CFR A;  1JC2 A;  5J3X A;  3TUY C;  5PAL A;  1KQM B;  3WHT B;  1M45 A;  1TCO B;  2PAL A;  3OP0 A;  1CLM A;  2GTE A;  1QVI Y;  3B6X A;  2JOJ A;  2WCE A;  1YUR A;  5AAN A;  1UHJ A;  2MAZ A;  1W9Z A;  1NSH A;  3CZ1 A;  3PAL A;  2M7N A;  4HRH A;  1K90 D;  2WOR A;  2AUC A;  3KF9 A;  4I5K A;  5FI7 A;  1CDM A;  4P2Y B;  1V1F A;  3BYA A;  3TS5 B;  1KWO C;  1CFD A;  2PYQ A;  1YX8 A;  2LLS A;  1NPQ A;  5IBW A;  1WY9 A;  1UHN A;  1YTZ C;  4AQI A;  5I8N A;  1DGU A;  1SMG A;  1UWO A;  1PK0 D;  1X02 A;  1QX2 A;  2JT8 A;  1TNW A;  3CLN A;  1NX1 A;  5JOL A;  2QEB A;  2PAS A;  2QEO A;  1R2U A;  3DVJ A;  1BF5 A;  1S1E A;  1BJF A;  1J7R A;  3O6B A;  1HQV A;  2LCP A;  4AOM A;  1CB1 A;  2KDH A;  2TN4 A;  5HYD A;  1OOI X;  2NXQ A;  1RK9 A;  1A75 A;  1U5I A;  2MBX A;  1E8A A;  2Y4Q A;  2KPH A;  2YGU A;  1YVH A;  3VRN A;  1QLK A;  2LUC A;  2FCD A;  3D10 A;  1QIW A;  1G33 A;  1UHI A;  2JWW A;  3I5G B;  5AFP A;  3BFA A;  2RGI A;  4ICB A;  1KQM C;  5HKY A;  1AJ5 A;  1MXE A;  2LAP A;  2AAO A;  1Q80 A;  2CTN A;  2Q91 A;  1KQV A;  3IVT A;  2H8V A;  3I5I C;  1FPW A;  4E68 A;  2I2R E;  3BFB A;  3LCP C;  4MVF A;  3UO9 A;  1AK8 A;  1QV0 A;  2JPT A;  1MQ1 A;  3FS7 A;  2K2A A;  2OPO A;  3FIA A;  2CXJ A;  3NGV A;  1N65 A;  1NX0 A;  2BL0 B;  2KNE A;  3O4X A;  3TS5 C;  2F3Z A;  4OCI A;  4PE0 A;  3L47 A;  2KHN A;  5AER A;  2BCA A;  1OE9 B;  4C0K A;  1P28 A;  1G4Y R;  2LVV A;  2ZRT A;  4MRX A;  1DT7 B;  3SS5 A;  2WCB A;  2JC2 A;  1OZS A;  2JUL A;  1UUS A;  3LK0 A;  1B8L A;  2LP2 A;  1IGV A;  3PAT A;  4BY5 A;  4C0L A;  4MZK A;  2L4I A;  2ZNE A;  3M0W A;  1GM0 A;  3VB1 A;  5EL2 A;  2L2E A;  4I5N B;  3NSI A;  1C3Y A;  1IG5 A;  2KI4 B;  2K0J A;  1WLZ A;  3BUM B;  3DD4 A;  4YBH B;  1QLS A;  1RFJ A;  3EVR A;  3I5G C;  1OZO A;  4OVN F;  1Y1X A;  4OKH A;  4PHK A;  1TNQ A;  1JFJ A;  3JTD B;  1B9A A;  2QEV A;  1BOD A;  1DJW A;  1F71 A;  1SSE B;  3S0G A;  1A75 B;  1A2X A;  4U8D A;  5JJG A;  1GGW A;  4GFT A;  1J7P A;  1ZFS A;  2K2F A;  2KLD A;  3OB1 B;  3F45 A;  4MN0 A;  3O4Y A;  2FJY A;  2M3W A;  4TNC A;  1SL8 A;  4YGB B;  4A4C A;  2BL0 C;  2WC6 A;  1QWV A;  1EL4 A;  4GGF A;  3ZWH A;  3NSO A;  1RTP 1;  3QRX A;  3N7H A;  1NYA A;  1XFU O;  1K9K A;  1K93 D;  1KSM A;  2M1K B;  1NWD A;  3DZT A;  2JT3 A;  5DKQ A;  1IIO A;  2P71 A;  1Y6W A;  1CMG A;  3SS3 A;  3CZT X;  4N1F A;  3AKA A;  3I5H B;  2Y1N A;  4ETO A;  2HQ8 A;  2JU0 A;  3EK7 A;  2M9G A;  1TIZ A;  1DJH A;  3GOF A;  3GK4 X;  1SNL A;  2BBM A;  3PM2 A;  2D8N A;  2LNK A;  1OOF A;  2I94 A;  1K2H A;  2KAX A;  1OQP A;  3JTD C;  3EVV A;  4ORA B;  1S5G Z;  2ERB A;  2HET A;  1AP4 A;  1AHR A;  2F2P A;  1J7Q A;  1QX7 A;  3R1O A;  4Q04 A;  4I5J A;  2B1U A;  1OOG A;  1HT9 A;  5HKW A;  1SPY A;  5I94 A;  1DMO A;  1MHO A;  3CR2 A;  1YRT B;  2CBL A;  1BU3 A;  3CWG A;  3SG7 A;  1OMD A;  3PSR A;  2KQ6 A;  5CSI A;  2KFG A;  3HX4 A;  3IQO A;  3K1E A;  4YRU A;  1CTR A;  3B86 A;  2Y5I A;  5D3O A;  2LP3 A;  3BXK A;  3S0B A;  3I5H C;  3S0A A;  1PAL A;  1XFZ O;  2SCP A;  1M31 A;  1SKT A;  1YR5 A;  2OTG C;  2FOT A;  5CSF A;  1DTL A;  4QJ5 B;  1JUO A;  1SCM C;  3EVU A;  2JTZ A;  4MLW A;  3I5I B;  1JFK A;  3PJI A;  1JWD A;  2F8P A;  1S26 D;  1NCZ A;  4OZD A;  1BLQ A;  1DGV A;  3D76 A;  3CYZ A;  3UNW A;  1B7T Z;  1YX7 A;  1F4Q A;  1ZMZ A;  1UP5 A;  2L0P A;  1ALV A;  5HL1 A;  2M0R A;  1OMR A;  1NX3 A;  4C0J A;  1PVB A;  1RJV A;  2NCP A;  1SL7 A;  2KGR A;  2MHH A;  4NQG A;  3BOW A;  4QJ4 B;  1YUS A;  5FI2 A;  5KU1 A;  4INX A;  1LXF C;  3FE9 A;  1K94 A;  1GJY A;  1WLM A;  3OX5 A;  4F0Z B;  3CR4 X;  3AAJ A;  4MZL A;  4PHM A;  2LVK A;  5G08 A;  1CKK A;  1CDP A;  1CM1 A;  4JQ0 D;  2JNX A;  4DS7 A;  1F70 A;  2KI6 C;  4PE4 A;  1ORG A;  5CSJ A;  3VGO A;  4WQ3 A;  1KCY A;  2QDI A;  2R2I A;  1KFX L;  3BUN B;  4PT1 A;  2KOT A;  4GGF C;  1B8R A;  1J55 A;  3DVE A;  4IL1 A;  3NSL A;  4N1G A;  4OR9 B;  2ZRS A;  3SG6 A;  2KFH A;  1DJX A;  3WXA A;  3EK4 A;  1RRO A;  3DXL A;  3O78 A;  1CFP A;  2FJU B;  1PRW A;  1T14 A;  4PE7 A;  2LLT A;  1PUL A;  1ALW A;  3NHI A;  5BPJ A;  1IWQ A;  4FTG A;  2HPS A;  3B87 A;  4HSZ A;  3TDZ A;  1SL9 A;  1Z4H A;  2BE4 A;  1MWN A;  2BEC A;  1MR8 A;  2LHI A;  2Y1M A;  2JTT A;  3OB2 B;  5I2L A;  2ISD A;  1FW4 A;  1XFW O;  4GGN A;  1YRU B;  5GQQ C;  3JVT B;  4D1E A;  3BUW B;  2VRG A;  1XFR A;  2KAV A;  3LL8 B;  1IQ3 A;  3CAB A;  2JPO A;  2K7O A;  1QX5 B;  1IJ6 A;  3BOW B;  5CPV A;  1D1O A;  4OV2 A;  1B4C A;  4MRY A;  4N5X A;  1YUT A;  1F8H A;  2BAP A;  5DKR A;  1TWO A;  2PQL A;  3OHM B;  2V53 A;  2OS8 B;  4YI9 A;  1DJG A;  1H8B A;  5F6T A;  3BQ3 A;  4L9M A;  1MUX A;  3A8R A;  2M29 A;  3L4A A;  1PVA A;  1U5I B;  3V2L A;  2H61 A;  1LKJ A;  1GGZ A;  1KK7 Y;  1KSO A;  4MSP A;  1S6I A;  4DIR A;  4PAL A;  3CS1 A;  1KFU L;  1TUJ A;  2KLE A;  4YGC B;  3SS4 A;  2ZN9 A;  4M2Q A;  1C7V A;  2CT9 A;  1EG4 A;  2JZI A;  5DKN A;  2JNF A;  4PE1 A;  1EG3 A;  1QTX A;  4ZCU A;  1CNP A;  4DCK A;  2WCK A;  2K7D A;  1AVS A;  1NUB A;  4NDC A;  2L51 A;  5ER4 X;  3CZ2 A;  1REC A;  2OTG B;  5D7F A;  1BR1 B;  3JVT C;  1SRA A;  1YUU A;  2KAY A;  1SCM B;  4YGE B;  1LS8 A;  2ZN8 A;  1S36 A;  3S0E A;  3GK2 A;  1EXR A;  3EKH A;  1S6C A;  1OOH A;  3NSK A;  1FI5 A;  2K7B A;  4PCW A;  1TCF A;  3EKJ A;  1DVI A;  4ZCV A;  2JXC A;  1ZAC A;  2OS8 C;  2KFF A;  5DIC A;  2MA2 A;  1BR4 B;  1J1D A;  1XFX O;  3VRP A;  1A03 A;  5HLO A;  3D0Y A;  1YVL A;  2QAC A;  3SG2 A;  1J1E A;  4DUQ A;  3OX6 A;  2WND A;  1J7O A;  1XFV O;  2M8U A;  3SG3 A;  2EGD A;  3LLE A;  1S6J A;  3H4S E;  4INW A;  1LVC D;  1SCV A;  4ORB B;  1NCY A;  3CR5 X;  1TN4 A;  2E30 A;  3L4L A;  4DRW A;  1CDN A;  3KPX A;  1LA0 A;  3I5F C;  3MSE B;  4R1E A;  2EHB A;  1LIN A;  3FE8 A;  2DOQ A;  4CID A;  1K96 A;  3RZS A;  1MXL C;  1ZUZ A;  3FE6 A;  2L98 A;  2GGM A;  2JT0 A;  2MJW B;  2ZFD A;  4PHJ A;  4CFQ A;  2L4H A;  5AEQ A;  3A4U B;  5FI6 A;  2PRU A;  2M97 A;  1XYD A;  3R1V A;  3VRO A;  1BOC A;  2F2O A;  3SIB A;  2MLE C;  2LHL A;  1JSA A;  1IRJ A;  1R6P A;  2E6W A;  2KYC A;  2O60 A;  4MEW A;  3D73 A;  1K9U A;  3PM8 A;  1QJT A;  1WRL A;  3K21 A;  1ODB A;  1K95 A;  2Q4U A;  3WHU B;  1XK4 A;  4USL A;  4M2O A;  4GPL B;  1Y0V H;  1TRF A;  1AJ4 A;  4M2P A;  2M7L A;  1XA5 A;  2ZND A;  1DJY A;  4HRG A;  3B88 A;  1K8U A;  4YGA A;  1PSB A;  3D0Y B;  4AQJ A;  2G9B A;  3O2P A;  2LUX A;  4QJ3 B;  2H61 C;  1CLL A;  1NCX A;  2MLF C;  3Q8I A;  2KQY A;  1TUZ A;  1DC1 A;  1DEK A;  1QV1 A;  1EJ3 A;  1SW8 A;  1M63 B;  2AMI A;  1M46 A;  2QPT A;  4MBE A;  1F54 A;  1DQE A;  4MZJ A;  2BKI B;  3SJS A;  1DJI A;  1QS7 A;  2M1U A;  1H4B A;  3D75 A;  2WCF A;  1JBA A;  1NX2 A;  4UPG A;  2H2K A;  2WCH A;  1N0Y A;  3IQQ A;  2BCX A;  1S3P A;  4JD9 A;  1QVI Z;  1TTX A;  3E3R A;  2LAN A;  2I7A A;  1MF8 B;  1L2O B;  3S0D A;  3S0F A;  1SY9 A;  1FBV A;  2LMT A;  1B47 A;  1RWY A;  1ZOT B;  2L50 A;  2M49 B;  3CZ0 A;  3SIA A;  1DEL A;  5FYX A;  2G2B A;  5HLV A;  1DF0 A;  1B1G A;  4XJK A;  1WRZ A;  3ICB A;  1SK6 D;  2I18 A;  2LMV A;  5D69 A;  5TNC A;  4PHN A;  1OOJ A;  2LVI A;  2LE9 B;  1A4P A;  2ZKM X;  4KYN A;  5ER5 A;  4JPZ B;  5KSZ A;  1K9P A;  3DYE A;  3EG5 B;  4BY4 A;  3D74 A;  2WCJ A;  1SR6 B;  3PN7 B;  2GV5 A;  2L2C A;  2LV7 A;  3TDU A;  2GGZ A;  1KK8 B;  3IF7 A;  3R72 A;  3TDI A;  2WC8 A;  2JQ6 A;  3EK8 A;  3C1V A;  1IH0 A;  2LC5 A;  3SG5 A;  3DF0 A;  5AXI A;  2FCE A;  2L5Y A;  2BCB A;  1JF2 A; 
#chains in the Genus database with same CATH homology
 1KFX S;  2KSP A;  1F55 A;  2BE6 A;  1EH2 A;  2LMU A;  2P6B B;  4GUK A;  1CMF A;  1IKU A;  3KEV A;  2A4J A;  1M39 A;  2K61 A;  3ZNI A;  4GBA A;  4NDD A;  1NIW A;  2HF5 A;  4YGD B;  1CLB A;  3KO0 A;  1Y1U A;  1L2O C;  1BG1 A;  4ORC B;  3BUX B;  1G8I A;  2KBM A;  2EC6 B;  3AAK A;  1S5G Y;  3LK1 A;  4JWQ A;  2L5X B;  3I5F B;  3DVM A;  2BKH B;  1B8C A;  1BT6 A;  2IS9 A;  1OMV A;  1LA3 A;  1UUR A;  2WOS A;  3VRR A;  1SR6 C;  2O5G A;  3PN7 C;  4NDB A;  4WRI A;  5I2O A;  1KK8 C;  3RM1 A;  1DF0 B;  4I5L B;  4XJK B;  1C07 A;  1XK4 C;  2SAS A;  3CGA A;  1XVJ A;  3CTN A;  1WRK A;  4A4B A;  1W7J B;  1OSA A;  2JRF A;  1QXP A;  2LLU A;  1PSR A;  1CFC A;  1CFF A;  1W7I B;  1FF1 A;  1VRK A;  2F3Y A;  3SG4 A;  1DJZ A;  3WNX B;  1V1G A;  4GAO A;  2LM5 A;  1UHK A;  4PDZ A;  1CM4 A;  2PSR A;  1FI6 A;  1TNP A;  3FWB A;  2KI6 D;  4XYN A;  5K89 A;  3FWC A;  1WDC B;  3DF0 B;  3DVK A;  5CSN A;  1SYM A;  2F33 A;  3TUY B;  1B7T Y;  1Y1A A;  2NZ0 A;  3HCM A;  2EC6 C;  1SBJ A;  5KTY A;  1KK7 Z;  2KI4 C;  2PVB A;  4WQ2 A;  1TNX A;  1AUI B;  2NCO A;  1KFU S;  2COL B;  1NP8 A;  2KYF A;  3PFV A;  2KBI A;  4CPV A;  4YI8 A;  1UHH A;  1QIV A;  1IQ5 A;  1XFY O;  4P5O E;  3PLF B;  1KWO B;  5B8I B;  2NLN A;  2CCM A;  1IJ5 A;  3GK1 A;  4CLN A;  2KGB C;  4HRE E;  1CDL A;  3KHE A;  1BMO A;  1L7Z A;  2HQW A;  1C7W A;  2LVJ A;  3BUO B;  4FQO A;  5HKZ A;  1N2D A;  2MRD A;  1GQM A;  2CNP A;  3AKB A;  1XO5 A;  1A29 A;  2K8M B;  3VRQ A;  2JXL A;  1JF0 A;  2BBN A;  3RLZ A;  3NXA A;  1F4O A;  4GNK B;  5I2Q A;  1QAS A;  2K7C A;  1WDC C;  3TZ1 A;  1QAT A;  2PMY A;  1TOP A;  4CFR A;  1JC2 A;  5J3X A;  3TUY C;  5PAL A;  1KQM B;  3WHT B;  1M45 A;  1TCO B;  2PAL A;  3OP0 A;  1CLM A;  1QVI Y;  2JOJ A;  2WCE A;  1YUR A;  5AAN A;  1UHJ A;  2MAZ A;  1NSH A;  3PAL A;  2M7N A;  4HRH A;  1K90 D;  2WOR A;  2AUC A;  3KF9 A;  4I5K A;  1CDM A;  4P2Y B;  1V1F A;  3BYA A;  3TS5 B;  1KWO C;  1CFD A;  1YX8 A;  2LLS A;  1NPQ A;  5IBW A;  1WY9 A;  1UHN A;  1YTZ C;  4AQI A;  5I8N A;  1DGU A;  1SMG A;  1UWO A;  1PK0 D;  1X02 A;  1QX2 A;  2JT8 A;  1TNW A;  3CLN A;  1NX1 A;  5JOL A;  2PAS A;  1R2U A;  3DVJ A;  1BF5 A;  1S1E A;  1BJF A;  1J7R A;  3O6B A;  1HQV A;  2LCP A;  4AOM A;  1CB1 A;  2KDH A;  2TN4 A;  5HYD A;  2NXQ A;  1RK9 A;  1A75 A;  1U5I A;  2MBX A;  1E8A A;  2Y4Q A;  1YVH A;  3VRN A;  1QLK A;  2LUC A;  2FCD A;  3D10 A;  1QIW A;  1G33 A;  1UHI A;  2JWW A;  3I5G B;  5AFP A;  2RGI A;  4ICB A;  1KQM C;  5HKY A;  1AJ5 A;  1MXE A;  2LAP A;  2AAO A;  1Q80 A;  2CTN A;  2Q91 A;  1KQV A;  3I5I C;  1FPW A;  4E68 A;  2I2R E;  3LCP C;  4MVF A;  1AK8 A;  1QV0 A;  2JPT A;  1MQ1 A;  3FS7 A;  2K2A A;  2OPO A;  3FIA A;  2CXJ A;  1N65 A;  1NX0 A;  2BL0 B;  2KNE A;  3TS5 C;  2F3Z A;  4OCI A;  4PE0 A;  5AER A;  2KHN A;  2BCA A;  1OE9 B;  4C0K A;  1G4Y R;  2LVV A;  2ZRT A;  4MRX A;  1DT7 B;  2WCB A;  2JC2 A;  1OZS A;  2JUL A;  1UUS A;  3LK0 A;  1B8L A;  2LP2 A;  1IGV A;  3PAT A;  4BY5 A;  4C0L A;  4MZK A;  2L4I A;  2ZNE A;  3M0W A;  2L2E A;  4I5N B;  3NSI A;  1IG5 A;  2KI4 B;  2K0J A;  1WLZ A;  3BUM B;  3DD4 A;  4YBH B;  1QLS A;  1RFJ A;  3EVR A;  3I5G C;  1OZO A;  4OVN F;  1Y1X A;  4OKH A;  4PHK A;  1TNQ A;  1JFJ A;  3JTD B;  1B9A A;  1BOD A;  1DJW A;  1F71 A;  1A75 B;  1A2X A;  4U8D A;  5JJG A;  1GGW A;  4GFT A;  1J7P A;  1ZFS A;  2K2F A;  3OB1 B;  4MN0 A;  3F45 A;  4YGB B;  3O4Y A;  2M3W A;  4TNC A;  1SL8 A;  4A4C A;  2BL0 C;  1EL4 A;  4GGF A;  3ZWH A;  3NSO A;  1RTP 1;  3QRX A;  1NYA A;  1XFU O;  1K9K A;  1K93 D;  1KSM A;  2M1K B;  1NWD A;  2JT3 A;  5DKQ A;  1Y6W A;  1CMG A;  3CZT X;  4N1F A;  3AKA A;  3I5H B;  2Y1N A;  4ETO A;  2HQ8 A;  2JU0 A;  3EK7 A;  2M9G A;  1TIZ A;  1DJH A;  3GOF A;  3GK4 X;  1SNL A;  2BBM A;  2D8N A;  2LNK A;  2I94 A;  1K2H A;  2KAX A;  1OQP A;  3JTD C;  3EVV A;  4ORA B;  1S5G Z;  2HET A;  1AP4 A;  1AHR A;  2F2P A;  1J7Q A;  1QX7 A;  4Q04 A;  4I5J A;  2B1U A;  1HT9 A;  5HKW A;  1SPY A;  1DMO A;  1MHO A;  3CR2 A;  1YRT B;  2CBL A;  1BU3 A;  3CWG A;  3SG7 A;  1OMD A;  3PSR A;  2KQ6 A;  5CSI A;  2KFG A;  3HX4 A;  3IQO A;  4YRU A;  1CTR A;  2Y5I A;  2LP3 A;  3BXK A;  3I5H C;  1PAL A;  1XFZ O;  2SCP A;  1M31 A;  1SKT A;  1YR5 A;  2OTG C;  2FOT A;  5CSF A;  1DTL A;  4QJ5 B;  1JUO A;  1SCM C;  3EVU A;  2JTZ A;  4MLW A;  3I5I B;  1JFK A;  1JWD A;  2F8P A;  1S26 D;  1NCZ A;  1BLQ A;  1DGV A;  1B7T Z;  1YX7 A;  1F4Q A;  1ZMZ A;  1UP5 A;  2L0P A;  1ALV A;  2M0R A;  1OMR A;  1NX3 A;  4C0J A;  1PVB A;  1RJV A;  2NCP A;  1SL7 A;  2KGR A;  2MHH A;  4NQG A;  3BOW A;  4QJ4 B;  1YUS A;  5KU1 A;  1LXF C;  1K94 A;  1GJY A;  1WLM A;  3OX5 A;  4F0Z B;  3CR4 X;  3AAJ A;  4MZL A;  4PHM A;  2LVK A;  5G08 A;  1CKK A;  1CDP A;  1CM1 A;  4JQ0 D;  2JNX A;  4DS7 A;  1F70 A;  2KI6 C;  4PE4 A;  5CSJ A;  3VGO A;  4WQ3 A;  1KCY A;  2R2I A;  1KFX L;  3BUN B;  2KOT A;  4GGF C;  1B8R A;  1J55 A;  3DVE A;  4IL1 A;  3NSL A;  4N1G A;  4OR9 B;  2ZRS A;  3SG6 A;  2KFH A;  1DJX A;  3WXA A;  3EK4 A;  1RRO A;  3O78 A;  1CFP A;  2FJU B;  1PRW A;  4PE7 A;  2LLT A;  1PUL A;  1ALW A;  5BPJ A;  1IWQ A;  4FTG A;  2HPS A;  4HSZ A;  3TDZ A;  1SL9 A;  2BE4 A;  1MWN A;  2BEC A;  1MR8 A;  2LHI A;  2Y1M A;  2JTT A;  3OB2 B;  5I2L A;  2ISD A;  1FW4 A;  1XFW O;  4GGN A;  1YRU B;  5GQQ C;  3JVT B;  4D1E A;  3BUW B;  2VRG A;  2KAV A;  3LL8 B;  1IQ3 A;  2K7O A;  1QX5 B;  1IJ6 A;  3BOW B;  5CPV A;  1D1O A;  4OV2 A;  1B4C A;  4MRY A;  4N5X A;  1YUT A;  1F8H A;  5DKR A;  3OHM B;  2V53 A;  2OS8 B;  4YI9 A;  1DJG A;  1H8B A;  5F6T A;  3BQ3 A;  4L9M A;  1MUX A;  3A8R A;  2M29 A;  1PVA A;  1U5I B;  2H61 A;  1LKJ A;  1GGZ A;  1KK7 Y;  1KSO A;  4MSP A;  1S6I A;  4DIR A;  4PAL A;  3CS1 A;  1KFU L;  4YGC B;  2ZN9 A;  4M2Q A;  1C7V A;  2CT9 A;  1EG4 A;  2JZI A;  5DKN A;  2JNF A;  4PE1 A;  1EG3 A;  1QTX A;  4ZCU A;  1CNP A;  4DCK A;  2K7D A;  1AVS A;  1NUB A;  4NDC A;  2L51 A;  5ER4 X;  1REC A;  2OTG B;  5D7F A;  1BR1 B;  3JVT C;  1SRA A;  1YUU A;  2KAY A;  1SCM B;  4YGE B;  2ZN8 A;  1S36 A;  3GK2 A;  1EXR A;  3EKH A;  1S6C A;  3NSK A;  1FI5 A;  2K7B A;  4PCW A;  1TCF A;  3EKJ A;  1DVI A;  4ZCV A;  2JXC A;  1ZAC A;  2OS8 C;  2KFF A;  2MA2 A;  1BR4 B;  1J1D A;  1XFX O;  3VRP A;  1A03 A;  5HLO A;  3D0Y A;  1YVL A;  2QAC A;  3SG2 A;  1J1E A;  4DUQ A;  3OX6 A;  2WND A;  1J7O A;  1XFV O;  2M8U A;  3SG3 A;  2EGD A;  3LLE A;  1S6J A;  3H4S E;  1LVC D;  1SCV A;  4ORB B;  1NCY A;  3CR5 X;  1TN4 A;  2E30 A;  4DRW A;  1CDN A;  3KPX A;  1LA0 A;  3I5F C;  3MSE B;  4R1E A;  2EHB A;  1LIN A;  2DOQ A;  4CID A;  1K96 A;  1MXL C;  1ZUZ A;  2L98 A;  2GGM A;  2JT0 A;  2MJW B;  2ZFD A;  4PHJ A;  4CFQ A;  2L4H A;  5AEQ A;  3A4U B;  2PRU A;  2M97 A;  1XYD A;  3VRO A;  1BOC A;  2F2O A;  3SIB A;  2MLE C;  2LHL A;  1JSA A;  1IRJ A;  1R6P A;  2E6W A;  2KYC A;  2O60 A;  4MEW A;  1K9U A;  3PM8 A;  1QJT A;  1WRL A;  3K21 A;  1ODB A;  1K95 A;  2Q4U A;  3WHU B;  1XK4 A;  4USL A;  4M2O A;  4GPL B;  1Y0V H;  1TRF A;  1AJ4 A;  4M2P A;  2M7L A;  1XA5 A;  2ZND A;  1DJY A;  4HRG A;  1K8U A;  4YGA A;  1PSB A;  3D0Y B;  4AQJ A;  2G9B A;  3O2P A;  2LUX A;  4QJ3 B;  2H61 C;  1CLL A;  1NCX A;  2MLF C;  2KQY A;  1EJ3 A;  1QV1 A;  1M63 B;  1SW8 A;  2AMI A;  2QPT A;  1M46 A;  4MBE A;  1F54 A;  4MZJ A;  2BKI B;  3SJS A;  1DJI A;  1QS7 A;  2M1U A;  1H4B A;  2WCF A;  1JBA A;  1NX2 A;  4UPG A;  2H2K A;  1N0Y A;  3IQQ A;  2BCX A;  1S3P A;  1QVI Z;  1TTX A;  3E3R A;  2LAN A;  2I7A A;  1MF8 B;  1L2O B;  1SY9 A;  1FBV A;  2LMT A;  1B47 A;  1RWY A;  1ZOT B;  2L50 A;  2M49 B;  3SIA A;  5FYX A;  2G2B A;  5HLV A;  1DF0 A;  1B1G A;  4XJK A;  1WRZ A;  3ICB A;  1SK6 D;  2I18 A;  2LMV A;  5D69 A;  5TNC A;  4PHN A;  1OOJ A;  2LVI A;  2LE9 B;  1A4P A;  2ZKM X;  5ER5 A;  4JPZ B;  5KSZ A;  1K9P A;  4BY4 A;  1SR6 B;  3PN7 B;  2GV5 A;  2LV7 A;  3TDU A;  2GGZ A;  1KK8 B;  3IF7 A;  3TDI A;  2WC8 A;  2JQ6 A;  3EK8 A;  3C1V A;  1IH0 A;  2LC5 A;  3SG5 A;  3DF0 A;  5AXI A;  2FCE A;  2BCB A;  1JF2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...