1J7OA

Solution structure of calcium-calmodulin n-terminal domain
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
76
structure length
76
Chain Sequence
ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of Ca(2+)-calmodulin reveals flexible hand-like properties of its domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords Calmodulin
total genus 24
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2001-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1j7oA00
1BLQA 2JT8A 2FCEA 3ZWHA 1J7QA 2FCDA 2M1KB 2LUCA 1S6CA 1SNLA 2GGZA 3PFVA 2LP3A 1OMVA 2KGRA 3OX5A 1XFYO 3VRQA 1ZACA 1K95A 2JT0A 1CDLA 2OPOA 4PHJA 1N0YA 2CCMA 1QTXA 2I18A 1GJYA 1PULA 3BUNB 1NX2A 1KFXL 4M2QA 3SG5A 3VRRA 5G08A 2KAYA 3DVJA 2L2EA 1B7TZ 3PN7B 1W7JB 5HKYA 2OTGC 4MEWA 2KNEA 1A75A 2L51A 1WY9A 1ZOTB 1L7ZA 3EVRA 3CWGA 4P2YB 5DKRA 1RFJA 1UHIA 5TNCA 1XA5A 3KPXA 5HKWA 4MVFA 2KAVA 1FI5A 1EG4A 4PE4A 4PDZA 4MBEA 3BUMB 2KI6D 1K90D 1QX7A 1CM1A 1KQVA 1QX5B 3CS1A 2KFGA 2PASA 2DOQA 2JWWA 2Q91A 4OV2A 5AXIA 2LCPA 2PRUA 2L4IA 1J7PA 1IQ5A 5HYDA 4D1EA 2FJUB 3D10A 5ER4X 1DGUA 1F4QA 4WQ2A 1QVIY 1NIWA 1F55A 3LL8B 4QJ4B 2F8PA 1FF1A 2K7DA 1AVSA 3I5IB 4MZJA 5JOLA 3DVEA 2E6WA 2M29A 4PHMA 1CNPA 4HRGA 3DD4A 4OKHA 1UHKA 4OCIA 5CSJA 1SYMA 1B8LA 4AOMA 4C0JA 1SY9A 1GQMA 2KBMA 2K7OA 2G9BA 1YUSA 1SPYA 1F54A 1DJIA 3H4SE 1MUXA 2MLEC 1QJTA 2AMIA 4N1GA 2WNDA 3BYAA 1M46A 4HREE 3NSLA 2QPTA 1F4OA 3HCMA 1EH2A 2MHHA 1TNWA 4E68A 1NCYA 5AFPA 1YTZC 3GK1A 2BKHB 1RROA 3WXAA 1IH0A 1WLZA 1UWOA 1B47A 1N65A 4BY5A 3TDIA 4YGCB 1RK9A 5D7FA 1JC2A 2I7AA 3CR5X 2Y1NA 3FWBA 5CPVA 2B1UA 4GGFA 2ISDA 1EG3A 2QACA 3JVTB 2KI4B 1OE9B 2K2AA 3KO0A 4R1EA 1IRJA 3EK4A 1DTLA 2F2PA 2WORA 4NDBA 1XYDA 1YX7A 1JWDA 1BU3A 1HQVA 2EC6B 1S36A 1XFXO 1PK0D 1Q80A 3EVUA 2Y4QA 1XFWO 1YRTB 2Q4UA 1CLBA 3D0YB 2ZRSA 5CSFA 4A4CA 1QATA 2JPTA 1LA0A 1WDCB 1YVLA 4MZKA 4OVNF 1QLSA 3E3RA 2LVIA 3EKJA 2JXLA 3CZTX 3MSEB 3VRNA 1DJZA 2BE4A 1M31A 4FTGA 1UUSA 2M9GA 4CFRA 2KYCA 2K0JA 3DVKA 1OZSA 1F70A 1AJ4A 3C1VA 4XJKB 1S6JA 5HLVA 2O5GA 2KBIA 3FWCA 1YRUB 2KDHA 2F33A 3TS5B 1PSBA 5B8IB 1RWYA 1QS7A 2V53A 2MAZA 4IL1A 1F71A 2I94A 1KWOC 1LKJA 2JXCA 2KQYA 2JZIA 3EK8A 4NDDA 3ICBA 4FQOA 2LC5A 1S5GZ 2LE9B 2LM5A 1FW4A 2LVJA 2MBXA 5HLOA 4GGFC 1B4CA 1BOCA 3LCPC 1A2XA 1LVCD 1TCFA 1ZUZA 2F3YA 4L9MA 1NPQA 4PE0A 1VRKA 2BKIB 3CR4X 5I2OA 1DT7B 4XJKA 1M45A 3LK1A 1LXFC 2KYFA 1J7RA 2NZ0A 3BOWB 2M8UA 3F45A 1NSHA 4ICBA 1CLMA 2JRFA 2HPSA 1OQPA 2AUCA 4YRUA 5BPJA 1Y1AA 2M7NA 3TZ1A 1FI6A 1H4BA 4ZCVA 1IGVA 1YX8A 1DJXA 2ZNDA 2ZRTA 2LANA 5J3XA 4USLA 4P5OE 2KGBC 1TOPA 2TN4A 1XK4C 1DVIA 1KSOA 1JF2A 4GPLB 1K96A 1JF0A 1V1GA 2COLB 2K7BA 2KQ6A 3TUYB 4YGEB 2NLNA 1SKTA 1K9UA 1OMDA 1DGVA 5I2LA 1TIZA 2LAPA 4PE1A 1R2UA 1Y0VH 1WRLA 1CFCA 1AHRA 1MQ1A 1XFZO 1Y6WA 2L50A 2LNKA 4A4BA 4NQGA 3PLFB 1NUBA 2JNXA 1S1EA 1K2HA 3VROA 3GK4X 5KTYA 3BUOB 1MXLC 1ALWA 2M97A 1KK8B 1UURA 3I5HC 2LLUA 5KSZA 3DVMA 3RLZA 3LLEA 4JWQA 4ORCB 1UP5A 2HF5A 3EKHA 1KSMA 1UHJA 2AAOA 1SL7A 1WDCC 1DJWA 1TNXA 2KI6C 1TCOB 4PALA 1RTP1 3ZNIA 2FOTA 4JPZB 1S6IA 1SL9A 1TRFA 2M1UA 1KK7Y 1J55A 1MHOA 3AAKA 4DRWA 1R6PA 3I5GC 5D69A 4CFQA 1RJVA 4I5LB 3SG7A 1L2OC 1LINA 1C7WA 1QLKA 1TNQA 1IG5A 2M3WA 3BXKA 1KCYA 2GGMA 4ZCUA 2LP2A 2R2IA 1WLMA 2OTGB 1NX0A 3BUWB 1HT9A 1X02A 3I5GB 1EL4A 3SIAA 1CB1A 2A4JA 1AJ5A 1IWQA 1QASA 1U5IA 2H2KA 2WC8A 2L4HA 4M2OA 4YGBB 5IBWA 4TNCA 1JUOA 3PN7C 1JFJA 2BL0C 2JC2A 2LV7A 3TS5C 1LA3A 4YBHB 1TN4A 2LLSA 4I5KA 3O6BA 1XFVO 2O60A 1SCVA 3NSOA 1F8HA 3HX4A 5F6TA 1UHNA 1BMOA 1IKUA 2HQWA 1SR6B 1YR5A 1SCMB 2ZN8A 3WNXB 1CFDA 4UPGA 3CLNA 2WCEA 1CDNA 2JT3A 2H61A 5KU1A 3IQQA 5AANA 2K2FA 2BE6A 2P6BB 1Y1UA 1J7OA 1QV0A 3PM8A 1CDMA 1NYAA 2SASA 3I5FB 2KFFA 1DJHA 1GGZA 3KF9A 1CTRA 1G33A 3NSKA 1TNPA 3AKAA 4GBAA 1CM4A 1L2OB 5AEQA 1YUUA 1MWNA 2PALA 2LHLA 4QJ3B 4MRXA 1B1GA 1BF5A 2MJWB 1BODA 1NCZA 4ORAB 2LHIA 1ZFSA 1N2DA 1SMGA 2JTTA 1A03A 1QXPA 1B8RA 4ETOA 3SJSA 2M0RA 1ZMZA 5ER5A 2EGDA 1CKKA 4MRYA 1A29A 1Y1XA 2BECA 4YI9A 2D8NA 2CBLA 1DF0A 3SIBA 1XK4A 4F0ZB 2E30A 1S5GY 2ZN9A 1XVJA 1YVHA 4XYNA 2MLFC 1KQMC 2K8MB 3FS7A 2KAXA 2LMVA 3PALA 2JQ6A 1CFPA 1NP8A 4MN0A 2JULA 1A75B 3M0WA 4GGNA 2ZKMX 3K21A 1D1OA 4MLWA 4C0KA 3BQ3A 3VRPA 4WRIA 2CT9A 2OS8C 2PMYA 2L98A 4QJ5B 1CFFA 2KSPA 1QIVA 2VRGA 3DF0A 3AKBA 4AQJA 1ALVA 2H61C 1K9KA 4AQIA 1K93D 2BBMA 1IJ6A 2OS8B 4PCWA 2ZFDA 5CSIA 3A4UB 2KI4C 2BBNA 3BOWA 5DKQA 5K89A 1MF8B 2F3ZA 1KFUS 3O78A 4PHNA 1S3PA 2LUXA 4DS7A 1JSAA 2L5XB 2F2OA 4MZLA 4C0LA 4CLNA 1BR1B 2ZNEA 3I5HB 1DMOA 4DUQA 4I5JA 3KEVA 5JJGA 1BT6A 3NSIA 5FYXA 2SCPA 1CLLA 1NWDA 2JOJA 2L0PA 3I5IC 1K94A 3A8RA 5I8NA 1NX3A 4I5NB 2PVBA 3SG3A 1JBAA 1M63B 4N5XA 3WHUB 1BR4B 1PSRA 5AERA 2HQ8A 1NCXA 1XO5A 2EHBA 1OSAA 2CXJA 4GAOA 1IQ3A 3SG4A 2JNFA 4DCKA 1KQMB 1PRWA 1PVBA 4CPVA 4DIRA 1CMGA 3GOFA 3OB2B 1DJYA 1EJ3A 3GK2A 3O4YA 2RGIA 2KOTA 4U8DA 1B7TY 1K9PA 1SL8A 1AK8A 1CMFA 3AAJA 1GGWA 3BUXB 3DF0B 3LK0A 4HRHA 4GNKB 2BCAA 2NXQA 4JQ0D 1AUIB 3WHTB 1BG1A 1H8BA 3CR2A 1SW8A 1WRZA 3D0YA 2JTZA 2LMUA 1WRKA 1XFUO 3QRXA 5HKZA 1G8IA 1FPWA 3CTNA 1RECA 3FIAA 1B8CA 2MA2A 1CDPA 2LVVA 1M39A 1KK7Z 2BCXA 1JFKA 1SCMC 1KK8C 1PVAA 5PALA 1IJ5A 2I2RE 2WCFA 4YGAA 1PALA 1NX1A 4ORBB 2KHNA 3NXAA 1FBVA 3PSRA 2IS9A 1KFXS 5I2QA 3PATA 3EVVA 1SK6D 2HETA 4PE7A 2GV5A 4YI8A 1U5IB 1OZOA 3SG2A 1UHHA 2G2BA 2EC6C 1KFUL 2LLTA 3OP0A 2NCPA 1BJFA 3KHEA 2KFHA 3OX6A 1DJGA 4HSZA 3TUYC 3CGAA 2CNPA 4N1FA 2Y5IA 1TTXA 2BL0B 4WQ3A 4Q04A 1QV1A 5GQQC 3OHMB 3EK7A 3JTDB 1MXEA 2BCBA 1A4PA 4PHKA 2LVKA 4M2PA 2M7LA 2WOSA 1V1FA 3O2PA 2LMTA 1SR6C 3SG6A 1C07A 4CIDA 1ODBA 2M49B 2PSRA 2MRDA 1E8AA 1OMRA 1KWOB 3JTDC 1QIWA 3RM1A 1EXRA 2CTNA 5DKNA 2NCOA 3TDZA 3IQOA 1SRAA 2Y1MA 5CSNA 4GFTA 1J1EA 3OB1B 3VGOA 1B9AA 1W7IB 1AP4A 3IF7A 4NDCA 3TDUA 1S26D 2K7CA 2WCBA 1OOJA 3JVTC 4YGDB 4OR9B 4MSPA 1G4YR 1YUTA 2JU0A 1J1DA 3I5FC 1QVIZ 1QX2A 4GUKA 1DF0B 1K8UA 1C7VA 4BY4A 1YURA 1SBJA 1MR8A 2K61A
chains in the Genus database with same CATH superfamily
1BLQA 1OOGA 2FCEA 2JT8A 3ZWHA 1J7QA 2FCDA 2M1KB 2LUCA 1S6CA 1SNLA 1Z2CB 2GGZA 3DZTA 3PFVA 2LP3A 1OMVA 2KGRA 3OX5A 1XFYO 3VRQA 1ZACA 1K95A 2JT0A 1CDLA 2OPOA 3D75A 4PHJA 1N0YA 2CCMA 1QTXA 2I18A 1GJYA 1PULA 3BUNB 1NX2A 1KFXL 4M2QA 3SG5A 3VRRA 5G08A 2KAYA 2FJYA 3DVJA 1W9ZA 2L2EA 1B7TZ 3PN7B 1W7JB 5HKYA 2OTGC 4MEWA 1OOIX 2KNEA 3B86A 1A75A 2L51A 1WY9A 1ZOTB 1L7ZA 3EVRA 3B88A 3CWGA 3D77A 4P2YB 5DKRA 1RFJA 3VB1A 1UHIA 5TNCA 1XA5A 3KPXA 5HKWA 3L47A 4MVFA 2KAVA 1FI5A 2WCJA 1EG4A 4PE4A 4PDZA 4MBEA 2PYQA 3BUMB 2KI6D 1K90D 1QX7A 1CM1A 1OW4A 1KQVA 1QX5B 3CS1A 2KFGA 2PASA 2DOQA 2JWWA 2Q91A 4OV2A 5AXIA 2LCPA 2PRUA 2L4IA 1J7PA 1IQ5A 5HYDA 4D1EA 1SSEB 2FJUB 3D10A 5ER4X 1DGUA 1F4QA 4WQ2A 1QVIY 1NIWA 1F55A 3LL8B 4QJ4B 2F8PA 1FF1A 2K7DA 1AVSA 3I5IB 4MZJA 3CABA 5JOLA 3DVEA 2WCKA 2E6WA 2M29A 4PHMA 1CNPA 4HRGA 3DD4A 3QMEA 4OKHA 1UHKA 4OCIA 3PJIA 5CSJA 1C3YA 1SYMA 2QEBA 1B8LA 4AOMA 3UNWA 4C0JA 1SY9A 1GQMA 2KBMA 3CZ2A 2K7OA 2G9BA 1YUSA 1SPYA 1F54A 1DJIA 3H4SE 3EG5B 1MUXA 2MLEC 1QJTA 2AMIA 4N1GA 2WNDA 3BYAA 1M46A 3DY9A 3NSLA 3CDNA 4HREE 2QPTA 1F4OA 3HCMA 1EH2A 2MHHA 1TNWA 4E68A 1NCYA 5AFPA 1YTZC 3GK1A 2BKHB 1RROA 3FE8A 3WXAA 3B87A 1IH0A 1TWOA 3SS3A 1WLZA 1UWOA 1B47A 1N65A 4BY5A 2QEVA 3D76A 4YGCB 1RK9A 3TDIA 5D7FA 1JC2A 2I7AA 3CR5X 2Y1NA 3FWBA 5CPVA 2B1UA 4GGFA 2ISDA 1EG3A 2QACA 3JVTB 2KI4B 1OE9B 2K2AA 3KO0A 4R1EA 1IRJA 3EK4A 1DTLA 2F2PA 2WC5A 2WORA 4NDBA 1XYDA 1YX7A 3UO9A 3OBVA 1JWDA 1BU3A 1HQVA 2EC6B 1S36A 1XFXO 4OZDA 1PK0D 1Q80A 3EVUA 2Y4QA 1XFWO 1YRTB 2Q4UA 4IJ7A 1CLBA 3D0YB 2ZRSA 5CSFA 4A4CA 1QATA 2JPTA 1LA0A 1WDCB 1YVLA 4MZKA 4OVNF 1QLSA 3E3RA 2LVIA 3EKJA 2JXLA 3CZTX 3MSEB 3VRNA 3BJHA 1DJZA 2BE4A 1M31A 4FTGA 1UUSA 2M9GA 4CFRA 2KYCA 2K0JA 3DVKA 1OZSA 1F70A 1AJ4A 3C1VA 2WCMA 4XJKB 1S6JA 5HLVA 2O5GA 2KBIA 3FWCA 1YRUB 2KDHA 2F33A 3TS5B 1PSBA 5B8IB 1RWYA 1QS7A 2V53A 3S0DA 2MAZA 4IL1A 1F71A 2I94A 1KWOC 1LKJA 2JXCA 1P28A 2KQYA 4INWA 2JZIA 3EK8A 4NDDA 3ICBA 4FQOA 2LC5A 1S5GZ 2LE9B 2LM5A 1FW4A 2LVJA 3FE9A 2MBXA 1GM0A 5HLOA 4GGFC 1B4CA 1BOCA 3LCPC 1A2XA 1LVCD 1TCFA 1ZUZA 2F3YA 4L9MA 1NPQA 1T14A 1VRKA 4PE0A 2BKIB 3CR4X 3DYEA 5I2OA 1DT7B 4XJKA 2L5YA 1M45A 3LK1A 1LXFC 2KYFA 1J7RA 2NZ0A 3BOWB 2M8UA 3F45A 1DC1A 1NSHA 4JKTA 4ICBA 1CLMA 3V2LA 2JRFA 2WCLA 2HPSA 1OQPA 2AUCA 3CZ1A 4YRUA 5BPJA 1Y1AA 2M7NA 3TZ1A 4PT1A 1FI6A 1H4BA 4ZCVA 1IGVA 1YX8A 1DJXA 2ZNDA 2KLDA 2ZRTA 2LANA 5J3XA 4USLA 4P5OE 2KGBC 1TOPA 2TN4A 1XK4C 1DVIA 3Q8IA 1KSOA 4FQTA 1JF2A 4GPLB 1K96A 3OGNA 1JF0A 1V1GA 2COLB 2K7BA 2KQ6A 3L4AA 3TUYB 4YGEB 2NLNA 2KLEA 1SKTA 1K9UA 4JD9A 1OMDA 1DGVA 5I2LA 1TIZA 2LAPA 4PE1A 1R2UA 1Y0VH 3N7HA 1WRLA 1CFCA 1AHRA 1MQ1A 1XFZO 1OOFA 1Y6WA 2L50A 2LNKA 4A4BA 3NHIA 4NQGA 3PLFB 1NUBA 2JNXA 1S1EA 1K2HA 3VROA 3GK4X 5KTYA 3BUOB 1MXLC 1ALWA 2M97A 1KK8B 1UURA 3I5HC 2LLUA 5KSZA 2H8VA 3R72A 2QDIA 3DXLA 3DVMA 3K1EA 3RLZA 1DEKA 3LLEA 4JWQA 4ORCB 1UP5A 2HF5A 3EKHA 1KSMA 1UHJA 2AAOA 1SL7A 1WDCC 1DJWA 1TNXA 2KI6C 1TCOB 4PALA 1RTP1 3ZNIA 2FOTA 4JPZB 1S6IA 1SL9A 1TRFA 2M1UA 5FI7A 1KK7Y 1J55A 1MHOA 3AAKA 3D73A 4DRWA 1R6PA 3I5GC 5D69A 4CFQA 1RJVA 4I5LB 3SG7A 1L2OC 1LINA 1C7WA 1QLKA 1TNQA 1IG5A 2M3WA 3BXKA 3IVTA 3S0EA 1KCYA 2GGMA 4ZCUA 2LP2A 2R2IA 1WLMA 2OTGB 1NX0A 3PM2A 3BUWB 1HT9A 1X02A 3I5GB 1EL4A 5FI6A 3SIAA 1CB1A 2A4JA 2KPHA 1AJ5A 1IWQA 1QASA 1U5IA 3S0GA 2H2KA 2WC8A 2L4HA 4M2OA 4YGBB 5IBWA 4TNCA 1JUOA 3PN7C 1JFJA 2BL0C 2JC2A 2LV7A 3TS5C 1LA3A 4YBHB 1TN4A 2LLSA 4I5KA 3O6BA 1XFVO 2O60A 4INXA 1SCVA 3NSOA 1F8HA 3HX4A 2QEHA 5F6TA 1UHNA 1BMOA 1IKUA 2HQWA 1SR6B 1YR5A 1SCMB 2ZN8A 3WNXB 1CFDA 4UPGA 3CLNA 2WCEA 1CDNA 2JT3A 2H61A 5KU1A 3IQQA 5AANA 2K2FA 3NHTA 2BE6A 2P6BB 1Y1UA 1J7OA 1QV0A 3PM8A 1CDMA 1NYAA 2SASA 3I5FB 2KFFA 1DJHA 1GGZA 3KF9A 1CTRA 1G33A 3NSKA 3SS5A 1TNPA 5HL1A 3AKAA 4GBAA 1CM4A 1L2OB 5AEQA 1YUUA 1MWNA 2PALA 2LHLA 5DICA 4QJ3B 5I94A 4MRXA 1B1GA 1BF5A 2MJWB 1BODA 1NCZA 4ORAB 2LHIA 2QEOA 1IIOA 1ZFSA 1N2DA 1SMGA 2JTTA 1A03A 1QXPA 1B8RA 4ETOA 3SJSA 3S0AA 2M0RA 1ZMZA 5ER5A 2EGDA 1CKKA 4MRYA 1DQEA 1A29A 1Y1XA 2BECA 3D78A 2D8NA 2CBLA 4YI9A 3S0FA 1DF0A 3SIBA 1XK4A 4F0ZB 2E30A 1S5GY 2ZN9A 1XVJA 1YVHA 4XYNA 2MLFC 1KQMC 2K8MB 3FS7A 1Z4HA 2KAXA 2LMVA 3PALA 2JQ6A 1CFPA 4KYNA 1NP8A 4MN0A 2JULA 1A75B 2PQLA 3M0WA 4GGNA 2ZKMX 3K21A 1D1OA 4MLWA 4C0KA 2GTEA 3BQ3A 3VRPA 4WRIA 1QWVA 2CT9A 2OS8C 2PMYA 2L98A 3CZ0A 3FE6A 4QJ5B 1CFFA 2KSPA 5FI2A 1QIVA 2VRGA 3DF0A 3AKBA 4AQJA 1ALVA 2H61C 1K9KA 4AQIA 1K93D 2BBMA 1IJ6A 3BFBA 2OS8B 4PCWA 2ZFDA 5CSIA 3A4UB 2KI4C 2BBNA 3BOWA 5DKQA 5K89A 1MF8B 2F3ZA 1KFUS 3O78A 4PHNA 1S3PA 2LUXA 4DS7A 1JSAA 1TUJA 2L5XB 2F2OA 4MZLA 4C0LA 4CLNA 1BR1B 2ZNEA 3I5HB 2BNXA 1DMOA 5EL2A 4DUQA 4I5JA 3KEVA 5JJGA 2P70A 1BT6A 3NSIA 5FYXA 2SCPA 1CLLA 1NWDA 2JOJA 2L0PA 3I5IC 1K94A 1DELA 3A8RA 2K60A 5I8NA 1NX3A 4I5NB 3RZSA 2PVBA 3SG3A 3R1PA 1JBAA 2YGUA 3S0BA 1M63B 2BAPA 4N5XA 3WHUB 1BR4B 1PSRA 5AERA 2HQ8A 1NCXA 1XO5A 2EHBA 1OSAA 2CXJA 4GAOA 1IQ3A 2JPOA 3SG4A 2JNFA 2WCHA 4DCKA 1KQMB 1PRWA 1PVBA 3R1OA 4CPVA 4DIRA 1CMGA 3GOFA 3OB2B 1DJYA 1EJ3A 3GK2A 3O4YA 2RGIA 2KOTA 4U8DA 1B7TY 1K9PA 1SL8A 1AK8A 1CMFA 3AAJA 1GGWA 3BUXB 3DF0B 3LK0A 4HRHA 4GNKB 2BCAA 2WC6A 2NXQA 3NGVA 4JQ0D 1AUIB 3WHTB 1BG1A 1H8BA 3CR2A 1SW8A 1WRZA 1ORGA 2JTZA 2LMUA 3D0YA 1WRKA 1XFUO 3QRXA 3B7AA 5HKZA 1G8IA 1FPWA 3CTNA 1RECA 3FIAA 1B8CA 4F7FA 2MA2A 1CDPA 2LVVA 1M39A 1OOHA 5D3OA 1KK7Z 2BCXA 1JFKA 1SCMC 1KK8C 1PVAA 5PALA 1IJ5A 2I2RE 2WCFA 4YGAA 1PALA 1NX1A 3CYZA 2L2CA 4ORBB 2KHNA 3NXAA 1FBVA 3PSRA 2IS9A 1KFXS 5I2QA 3PATA 3EVVA 3O4XA 1SK6D 2HETA 4PE7A 2GV5A 4YI8A 1U5IB 1XFRA 1OZOA 3SG2A 1UHHA 2G2BA 2EC6C 1KFUL 2LLTA 3OP0A 3SS4A 2NCPA 1BJFA 3KHEA 2KFHA 1C3ZA 3OX6A 1DJGA 4HSZA 3TUYC 3CGAA 2CNPA 4N1FA 2Y5IA 1TUZA 1TTXA 2BL0B 4WQ3A 4Q04A 1QV1A 5GQQC 3OHMB 3EK7A 3JTDB 1MXEA 2BCBA 3D74A 1A4PA 4PHKA 2LVKA 4M2PA 2M7LA 2WOSA 1V1FA 3O2PA 2LMTA 1SR6C 3SG6A 1C07A 4CIDA 1LS8A 1ODBA 2M49B 2PSRA 2MRDA 1E8AA 1OMRA 1KWOB 2ERBA 2P71A 3JTDC 1QIWA 3RM1A 1EXRA 2CTNA 3BFHA 5DKNA 2NCOA 3TDZA 3IQOA 1SRAA 2Y1MA 5CSNA 3L4LA 4GFTA 3BFAA 1J1EA 3OB1B 3VGOA 1B9AA 1W7IB 1AP4A 3IF7A 3B6XA 4NDCA 3TDUA 1S26D 2K7CA 2WCBA 1OOJA 3JVTC 4YGDB 4OR9B 3R1VA 4MSPA 1G4YR 1YUTA 2JU0A 1J1DA 3I5FC 1QVIZ 1QX2A 4GUKA 1DF0B 1K8UA 1C7VA 4BY4A 1YURA 1SBJA 1MR8A 2K61A
chains in the Genus database with same CATH topology
1BLQA 2JT8A 2FCEA 3ZWHA 1J7QA 2FCDA 2M1KB 2LUCA 1S6CA 1SNLA 2GGZA 3PFVA 2LP3A 1OMVA 2KGRA 3OX5A 1XFYO 3VRQA 1ZACA 1K95A 2JT0A 1CDLA 2OPOA 4PHJA 1N0YA 2CCMA 1QTXA 2I18A 1GJYA 1PULA 3BUNB 1NX2A 1KFXL 4M2QA 3SG5A 3VRRA 5G08A 2KAYA 3DVJA 2L2EA 1B7TZ 3PN7B 1W7JB 5HKYA 2OTGC 4MEWA 2KNEA 1A75A 2L51A 1WY9A 1ZOTB 1L7ZA 3EVRA 3CWGA 4P2YB 5DKRA 1RFJA 1UHIA 5TNCA 1XA5A 3KPXA 5HKWA 4MVFA 2KAVA 1FI5A 1EG4A 4PE4A 4PDZA 4MBEA 3BUMB 2KI6D 1K90D 1QX7A 1CM1A 1KQVA 1QX5B 3CS1A 2KFGA 2PASA 2DOQA 2JWWA 2Q91A 4OV2A 5AXIA 2LCPA 2PRUA 2L4IA 1J7PA 1IQ5A 5HYDA 4D1EA 2FJUB 3D10A 5ER4X 1DGUA 1F4QA 4WQ2A 1QVIY 1NIWA 1F55A 3LL8B 4QJ4B 2F8PA 1FF1A 2K7DA 1AVSA 3I5IB 4MZJA 5JOLA 3DVEA 2E6WA 2M29A 4PHMA 1CNPA 4HRGA 3DD4A 4OKHA 1UHKA 4OCIA 5CSJA 1SYMA 1B8LA 4AOMA 4C0JA 1SY9A 1GQMA 2KBMA 2K7OA 2G9BA 1YUSA 1SPYA 1F54A 1DJIA 3H4SE 1MUXA 2MLEC 1QJTA 2AMIA 4N1GA 2WNDA 3BYAA 1M46A 4HREE 3NSLA 2QPTA 1F4OA 3HCMA 1EH2A 2MHHA 1TNWA 4E68A 1NCYA 5AFPA 1YTZC 3GK1A 2BKHB 1RROA 3WXAA 1IH0A 1WLZA 1UWOA 1B47A 1N65A 4BY5A 3TDIA 4YGCB 1RK9A 5D7FA 1JC2A 2I7AA 3CR5X 2Y1NA 3FWBA 5CPVA 2B1UA 4GGFA 2ISDA 1EG3A 2QACA 3JVTB 2KI4B 1OE9B 2K2AA 3KO0A 4R1EA 1IRJA 3EK4A 1DTLA 2F2PA 2WORA 4NDBA 1XYDA 1YX7A 1JWDA 1BU3A 1HQVA 2EC6B 1S36A 1XFXO 1PK0D 1Q80A 3EVUA 2Y4QA 1XFWO 1YRTB 2Q4UA 1CLBA 3D0YB 2ZRSA 5CSFA 4A4CA 1QATA 2JPTA 1LA0A 1WDCB 1YVLA 4MZKA 4OVNF 1QLSA 3E3RA 2LVIA 3EKJA 2JXLA 3CZTX 3MSEB 3VRNA 1DJZA 2BE4A 1M31A 4FTGA 1UUSA 2M9GA 4CFRA 2KYCA 2K0JA 3DVKA 1OZSA 1F70A 1AJ4A 3C1VA 4XJKB 1S6JA 5HLVA 2O5GA 2KBIA 3FWCA 1YRUB 2KDHA 2F33A 3TS5B 1PSBA 5B8IB 1RWYA 1QS7A 2V53A 2MAZA 4IL1A 1F71A 2I94A 1KWOC 1LKJA 2JXCA 2KQYA 2JZIA 3EK8A 4NDDA 3ICBA 4FQOA 2LC5A 1S5GZ 2LE9B 2LM5A 1FW4A 2LVJA 2MBXA 5HLOA 4GGFC 1B4CA 1BOCA 3LCPC 1A2XA 1LVCD 1TCFA 1ZUZA 2F3YA 4L9MA 1NPQA 4PE0A 1VRKA 2BKIB 3CR4X 5I2OA 1DT7B 4XJKA 1M45A 3LK1A 1LXFC 2KYFA 1J7RA 2NZ0A 3BOWB 2M8UA 3F45A 1NSHA 4ICBA 1CLMA 2JRFA 2HPSA 1OQPA 2AUCA 4YRUA 5BPJA 1Y1AA 2M7NA 3TZ1A 1FI6A 1H4BA 4ZCVA 1IGVA 1YX8A 1DJXA 2ZNDA 2ZRTA 2LANA 5J3XA 4USLA 4P5OE 2KGBC 1TOPA 2TN4A 1XK4C 1DVIA 1KSOA 1JF2A 4GPLB 1K96A 1JF0A 1V1GA 2COLB 2K7BA 2KQ6A 3TUYB 4YGEB 2NLNA 1SKTA 1K9UA 1OMDA 1DGVA 5I2LA 1TIZA 2LAPA 4PE1A 1R2UA 1Y0VH 1WRLA 1CFCA 1AHRA 1MQ1A 1XFZO 1Y6WA 2L50A 2LNKA 4A4BA 4NQGA 3PLFB 1NUBA 2JNXA 1S1EA 1K2HA 3VROA 3GK4X 5KTYA 3BUOB 1MXLC 1ALWA 2M97A 1KK8B 1UURA 3I5HC 2LLUA 5KSZA 3DVMA 3RLZA 3LLEA 4JWQA 4ORCB 1UP5A 2HF5A 3EKHA 1KSMA 1UHJA 2AAOA 1SL7A 1WDCC 1DJWA 1TNXA 2KI6C 1TCOB 4PALA 1RTP1 3ZNIA 2FOTA 4JPZB 1S6IA 1SL9A 1TRFA 2M1UA 1KK7Y 1J55A 1MHOA 3AAKA 4DRWA 1R6PA 3I5GC 5D69A 4CFQA 1RJVA 4I5LB 3SG7A 1L2OC 1LINA 1C7WA 1QLKA 1TNQA 1IG5A 2M3WA 3BXKA 1KCYA 2GGMA 4ZCUA 2LP2A 2R2IA 1WLMA 2OTGB 1NX0A 3BUWB 1HT9A 1X02A 3I5GB 1EL4A 3SIAA 1CB1A 2A4JA 1AJ5A 1IWQA 1QASA 1U5IA 2H2KA 2WC8A 2L4HA 4M2OA 4YGBB 5IBWA 4TNCA 1JUOA 3PN7C 1JFJA 2BL0C 2JC2A 2LV7A 3TS5C 1LA3A 4YBHB 1TN4A 2LLSA 4I5KA 3O6BA 1XFVO 2O60A 1SCVA 3NSOA 1F8HA 3HX4A 5F6TA 1UHNA 1BMOA 1IKUA 2HQWA 1SR6B 1YR5A 1SCMB 2ZN8A 3WNXB 1CFDA 4UPGA 3CLNA 2WCEA 1CDNA 2JT3A 2H61A 5KU1A 3IQQA 5AANA 2K2FA 2BE6A 2P6BB 1Y1UA 1J7OA 1QV0A 3PM8A 1CDMA 1NYAA 2SASA 3I5FB 2KFFA 1DJHA 1GGZA 3KF9A 1CTRA 1G33A 3NSKA 1TNPA 3AKAA 4GBAA 1CM4A 1L2OB 5AEQA 1YUUA 1MWNA 2PALA 2LHLA 4QJ3B 4MRXA 1B1GA 1BF5A 2MJWB 1BODA 1NCZA 4ORAB 2LHIA 1ZFSA 1N2DA 1SMGA 2JTTA 1A03A 1QXPA 1B8RA 4ETOA 3SJSA 2M0RA 1ZMZA 5ER5A 2EGDA 1CKKA 4MRYA 1A29A 1Y1XA 2BECA 4YI9A 2D8NA 2CBLA 1DF0A 3SIBA 1XK4A 4F0ZB 2E30A 1S5GY 2ZN9A 1XVJA 1YVHA 4XYNA 2MLFC 1KQMC 2K8MB 3FS7A 2KAXA 2LMVA 3PALA 2JQ6A 1CFPA 1NP8A 4MN0A 2JULA 1A75B 3M0WA 4GGNA 2ZKMX 3K21A 1D1OA 4MLWA 4C0KA 3BQ3A 3VRPA 4WRIA 2CT9A 2OS8C 2PMYA 2L98A 4QJ5B 1CFFA 2KSPA 1QIVA 2VRGA 3DF0A 3AKBA 4AQJA 1ALVA 2H61C 1K9KA 4AQIA 1K93D 2BBMA 1IJ6A 2OS8B 4PCWA 2ZFDA 5CSIA 3A4UB 2KI4C 2BBNA 3BOWA 5DKQA 5K89A 1MF8B 2F3ZA 1KFUS 3O78A 4PHNA 1S3PA 2LUXA 4DS7A 1JSAA 2L5XB 2F2OA 4MZLA 4C0LA 4CLNA 1BR1B 2ZNEA 3I5HB 1DMOA 4DUQA 4I5JA 3KEVA 5JJGA 1BT6A 3NSIA 5FYXA 2SCPA 1CLLA 1NWDA 2JOJA 2L0PA 3I5IC 1K94A 3A8RA 5I8NA 1NX3A 4I5NB 2PVBA 3SG3A 1JBAA 1M63B 4N5XA 3WHUB 1BR4B 1PSRA 5AERA 2HQ8A 1NCXA 1XO5A 2EHBA 1OSAA 2CXJA 4GAOA 1IQ3A 3SG4A 2JNFA 4DCKA 1KQMB 1PRWA 1PVBA 4CPVA 4DIRA 1CMGA 3GOFA 3OB2B 1DJYA 1EJ3A 3GK2A 3O4YA 2RGIA 2KOTA 4U8DA 1B7TY 1K9PA 1SL8A 1AK8A 1CMFA 3AAJA 1GGWA 3BUXB 3DF0B 3LK0A 4HRHA 4GNKB 2BCAA 2NXQA 4JQ0D 1AUIB 3WHTB 1BG1A 1H8BA 3CR2A 1SW8A 1WRZA 3D0YA 2JTZA 2LMUA 1WRKA 1XFUO 3QRXA 5HKZA 1G8IA 1FPWA 3CTNA 1RECA 3FIAA 1B8CA 2MA2A 1CDPA 2LVVA 1M39A 1KK7Z 2BCXA 1JFKA 1SCMC 1KK8C 1PVAA 5PALA 1IJ5A 2I2RE 2WCFA 4YGAA 1PALA 1NX1A 4ORBB 2KHNA 3NXAA 1FBVA 3PSRA 2IS9A 1KFXS 5I2QA 3PATA 3EVVA 1SK6D 2HETA 4PE7A 2GV5A 4YI8A 1U5IB 1OZOA 3SG2A 1UHHA 2G2BA 2EC6C 1KFUL 2LLTA 3OP0A 2NCPA 1BJFA 3KHEA 2KFHA 3OX6A 1DJGA 4HSZA 3TUYC 3CGAA 2CNPA 4N1FA 2Y5IA 1TTXA 2BL0B 4WQ3A 4Q04A 1QV1A 5GQQC 3OHMB 3EK7A 3JTDB 1MXEA 2BCBA 1A4PA 4PHKA 2LVKA 4M2PA 2M7LA 2WOSA 1V1FA 3O2PA 2LMTA 1SR6C 3SG6A 1C07A 4CIDA 1ODBA 2M49B 2PSRA 2MRDA 1E8AA 1OMRA 1KWOB 3JTDC 1QIWA 3RM1A 1EXRA 2CTNA 5DKNA 2NCOA 3TDZA 3IQOA 1SRAA 2Y1MA 5CSNA 4GFTA 1J1EA 3OB1B 3VGOA 1B9AA 1W7IB 1AP4A 3IF7A 4NDCA 3TDUA 1S26D 2K7CA 2WCBA 1OOJA 3JVTC 4YGDB 4OR9B 4MSPA 1G4YR 1YUTA 2JU0A 1J1DA 3I5FC 1QVIZ 1QX2A 4GUKA 1DF0B 1K8UA 1C7VA 4BY4A 1YURA 1SBJA 1MR8A 2K61A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BLQ A;  2JT8 A;  2FCE A;  3ZWH A;  1J7Q A;  2FCD A;  2M1K B;  2LUC A;  1S6C A;  1SNL A;  2GGZ A;  3PFV A;  2LP3 A;  1OMV A;  2KGR A;  3OX5 A;  1XFY O;  3VRQ A;  1ZAC A;  1K95 A;  2JT0 A;  1CDL A;  2OPO A;  4PHJ A;  1N0Y A;  2CCM A;  1QTX A;  2I18 A;  1GJY A;  1PUL A;  3BUN B;  1NX2 A;  1KFX L;  4M2Q A;  3SG5 A;  3VRR A;  5G08 A;  2KAY A;  3DVJ A;  2L2E A;  1B7T Z;  3PN7 B;  1W7J B;  5HKY A;  2OTG C;  4MEW A;  2KNE A;  1A75 A;  2L51 A;  1WY9 A;  1ZOT B;  1L7Z A;  3EVR A;  3CWG A;  4P2Y B;  5DKR A;  1RFJ A;  1UHI A;  5TNC A;  1XA5 A;  3KPX A;  5HKW A;  4MVF A;  2KAV A;  1FI5 A;  1EG4 A;  4PE4 A;  4PDZ A;  4MBE A;  3BUM B;  2KI6 D;  1K90 D;  1QX7 A;  1CM1 A;  1KQV A;  1QX5 B;  3CS1 A;  2KFG A;  2PAS A;  2DOQ A;  2JWW A;  2Q91 A;  4OV2 A;  5AXI A;  2LCP A;  2PRU A;  2L4I A;  1J7P A;  1IQ5 A;  5HYD A;  4D1E A;  2FJU B;  3D10 A;  5ER4 X;  1DGU A;  1F4Q A;  4WQ2 A;  1QVI Y;  1NIW A;  1F55 A;  3LL8 B;  4QJ4 B;  2F8P A;  1FF1 A;  2K7D A;  1AVS A;  3I5I B;  4MZJ A;  5JOL A;  3DVE A;  2E6W A;  2M29 A;  4PHM A;  1CNP A;  4HRG A;  3DD4 A;  4OKH A;  1UHK A;  4OCI A;  5CSJ A;  1SYM A;  1B8L A;  4AOM A;  4C0J A;  1SY9 A;  1GQM A;  2KBM A;  2K7O A;  2G9B A;  1YUS A;  1SPY A;  1F54 A;  1DJI A;  3H4S E;  1MUX A;  2MLE C;  1QJT A;  2AMI A;  4N1G A;  2WND A;  3BYA A;  1M46 A;  4HRE E;  3NSL A;  2QPT A;  1F4O A;  3HCM A;  1EH2 A;  2MHH A;  1TNW A;  4E68 A;  1NCY A;  5AFP A;  1YTZ C;  3GK1 A;  2BKH B;  1RRO A;  3WXA A;  1IH0 A;  1WLZ A;  1UWO A;  1B47 A;  1N65 A;  4BY5 A;  3TDI A;  4YGC B;  1RK9 A;  5D7F A;  1JC2 A;  2I7A A;  3CR5 X;  2Y1N A;  3FWB A;  5CPV A;  2B1U A;  4GGF A;  2ISD A;  1EG3 A;  2QAC A;  3JVT B;  2KI4 B;  1OE9 B;  2K2A A;  3KO0 A;  4R1E A;  1IRJ A;  3EK4 A;  1DTL A;  2F2P A;  2WOR A;  4NDB A;  1XYD A;  1YX7 A;  1JWD A;  1BU3 A;  1HQV A;  2EC6 B;  1S36 A;  1XFX O;  1PK0 D;  1Q80 A;  3EVU A;  2Y4Q A;  1XFW O;  1YRT B;  2Q4U A;  1CLB A;  3D0Y B;  2ZRS A;  5CSF A;  4A4C A;  1QAT A;  2JPT A;  1LA0 A;  1WDC B;  1YVL A;  4MZK A;  4OVN F;  1QLS A;  3E3R A;  2LVI A;  3EKJ A;  2JXL A;  3CZT X;  3MSE B;  3VRN A;  1DJZ A;  2BE4 A;  1M31 A;  4FTG A;  1UUS A;  2M9G A;  4CFR A;  2KYC A;  2K0J A;  3DVK A;  1OZS A;  1F70 A;  1AJ4 A;  3C1V A;  4XJK B;  1S6J A;  5HLV A;  2O5G A;  2KBI A;  3FWC A;  1YRU B;  2KDH A;  2F33 A;  3TS5 B;  1PSB A;  5B8I B;  1RWY A;  1QS7 A;  2V53 A;  2MAZ A;  4IL1 A;  1F71 A;  2I94 A;  1KWO C;  1LKJ A;  2JXC A;  2KQY A;  2JZI A;  3EK8 A;  4NDD A;  3ICB A;  4FQO A;  2LC5 A;  1S5G Z;  2LE9 B;  2LM5 A;  1FW4 A;  2LVJ A;  2MBX A;  5HLO A;  4GGF C;  1B4C A;  1BOC A;  3LCP C;  1A2X A;  1LVC D;  1TCF A;  1ZUZ A;  2F3Y A;  4L9M A;  1NPQ A;  4PE0 A;  1VRK A;  2BKI B;  3CR4 X;  5I2O A;  1DT7 B;  4XJK A;  1M45 A;  3LK1 A;  1LXF C;  2KYF A;  1J7R A;  2NZ0 A;  3BOW B;  2M8U A;  3F45 A;  1NSH A;  4ICB A;  1CLM A;  2JRF A;  2HPS A;  1OQP A;  2AUC A;  4YRU A;  5BPJ A;  1Y1A A;  2M7N A;  3TZ1 A;  1FI6 A;  1H4B A;  4ZCV A;  1IGV A;  1YX8 A;  1DJX A;  2ZND A;  2ZRT A;  2LAN A;  5J3X A;  4USL A;  4P5O E;  2KGB C;  1TOP A;  2TN4 A;  1XK4 C;  1DVI A;  1KSO A;  1JF2 A;  4GPL B;  1K96 A;  1JF0 A;  1V1G A;  2COL B;  2K7B A;  2KQ6 A;  3TUY B;  4YGE B;  2NLN A;  1SKT A;  1K9U A;  1OMD A;  1DGV A;  5I2L A;  1TIZ A;  2LAP A;  4PE1 A;  1R2U A;  1Y0V H;  1WRL A;  1CFC A;  1AHR A;  1MQ1 A;  1XFZ O;  1Y6W A;  2L50 A;  2LNK A;  4A4B A;  4NQG A;  3PLF B;  1NUB A;  2JNX A;  1S1E A;  1K2H A;  3VRO A;  3GK4 X;  5KTY A;  3BUO B;  1MXL C;  1ALW A;  2M97 A;  1KK8 B;  1UUR A;  3I5H C;  2LLU A;  5KSZ A;  3DVM A;  3RLZ A;  3LLE A;  4JWQ A;  4ORC B;  1UP5 A;  2HF5 A;  3EKH A;  1KSM A;  1UHJ A;  2AAO A;  1SL7 A;  1WDC C;  1DJW A;  1TNX A;  2KI6 C;  1TCO B;  4PAL A;  1RTP 1;  3ZNI A;  2FOT A;  4JPZ B;  1S6I A;  1SL9 A;  1TRF A;  2M1U A;  1KK7 Y;  1J55 A;  1MHO A;  3AAK A;  4DRW A;  1R6P A;  3I5G C;  5D69 A;  4CFQ A;  1RJV A;  4I5L B;  3SG7 A;  1L2O C;  1LIN A;  1C7W A;  1QLK A;  1TNQ A;  1IG5 A;  2M3W A;  3BXK A;  1KCY A;  2GGM A;  4ZCU A;  2LP2 A;  2R2I A;  1WLM A;  2OTG B;  1NX0 A;  3BUW B;  1HT9 A;  1X02 A;  3I5G B;  1EL4 A;  3SIA A;  1CB1 A;  2A4J A;  1AJ5 A;  1IWQ A;  1QAS A;  1U5I A;  2H2K A;  2WC8 A;  2L4H A;  4M2O A;  4YGB B;  5IBW A;  4TNC A;  1JUO A;  3PN7 C;  1JFJ A;  2BL0 C;  2JC2 A;  2LV7 A;  3TS5 C;  1LA3 A;  4YBH B;  1TN4 A;  2LLS A;  4I5K A;  3O6B A;  1XFV O;  2O60 A;  1SCV A;  3NSO A;  1F8H A;  3HX4 A;  5F6T A;  1UHN A;  1BMO A;  1IKU A;  2HQW A;  1SR6 B;  1YR5 A;  1SCM B;  2ZN8 A;  3WNX B;  1CFD A;  4UPG A;  3CLN A;  2WCE A;  1CDN A;  2JT3 A;  2H61 A;  5KU1 A;  3IQQ A;  5AAN A;  2K2F A;  2BE6 A;  2P6B B;  1Y1U A;  1J7O A;  1QV0 A;  3PM8 A;  1CDM A;  1NYA A;  2SAS A;  3I5F B;  2KFF A;  1DJH A;  1GGZ A;  3KF9 A;  1CTR A;  1G33 A;  3NSK A;  1TNP A;  3AKA A;  4GBA A;  1CM4 A;  1L2O B;  5AEQ A;  1YUU A;  1MWN A;  2PAL A;  2LHL A;  4QJ3 B;  4MRX A;  1B1G A;  1BF5 A;  2MJW B;  1BOD A;  1NCZ A;  4ORA B;  2LHI A;  1ZFS A;  1N2D A;  1SMG A;  2JTT A;  1A03 A;  1QXP A;  1B8R A;  4ETO A;  3SJS A;  2M0R A;  1ZMZ A;  5ER5 A;  2EGD A;  1CKK A;  4MRY A;  1A29 A;  1Y1X A;  2BEC A;  4YI9 A;  2D8N A;  2CBL A;  1DF0 A;  3SIB A;  1XK4 A;  4F0Z B;  2E30 A;  1S5G Y;  2ZN9 A;  1XVJ A;  1YVH A;  4XYN A;  2MLF C;  1KQM C;  2K8M B;  3FS7 A;  2KAX A;  2LMV A;  3PAL A;  2JQ6 A;  1CFP A;  1NP8 A;  4MN0 A;  2JUL A;  1A75 B;  3M0W A;  4GGN A;  2ZKM X;  3K21 A;  1D1O A;  4MLW A;  4C0K A;  3BQ3 A;  3VRP A;  4WRI A;  2CT9 A;  2OS8 C;  2PMY A;  2L98 A;  4QJ5 B;  1CFF A;  2KSP A;  1QIV A;  2VRG A;  3DF0 A;  3AKB A;  4AQJ A;  1ALV A;  2H61 C;  1K9K A;  4AQI A;  1K93 D;  2BBM A;  1IJ6 A;  2OS8 B;  4PCW A;  2ZFD A;  5CSI A;  3A4U B;  2KI4 C;  2BBN A;  3BOW A;  5DKQ A;  5K89 A;  1MF8 B;  2F3Z A;  1KFU S;  3O78 A;  4PHN A;  1S3P A;  2LUX A;  4DS7 A;  1JSA A;  2L5X B;  2F2O A;  4MZL A;  4C0L A;  4CLN A;  1BR1 B;  2ZNE A;  3I5H B;  1DMO A;  4DUQ A;  4I5J A;  3KEV A;  5JJG A;  1BT6 A;  3NSI A;  5FYX A;  2SCP A;  1CLL A;  1NWD A;  2JOJ A;  2L0P A;  3I5I C;  1K94 A;  3A8R A;  5I8N A;  1NX3 A;  4I5N B;  2PVB A;  3SG3 A;  1JBA A;  1M63 B;  4N5X A;  3WHU B;  1BR4 B;  1PSR A;  5AER A;  2HQ8 A;  1NCX A;  1XO5 A;  2EHB A;  1OSA A;  2CXJ A;  4GAO A;  1IQ3 A;  3SG4 A;  2JNF A;  4DCK A;  1KQM B;  1PRW A;  1PVB A;  4CPV A;  4DIR A;  1CMG A;  3GOF A;  3OB2 B;  1DJY A;  1EJ3 A;  3GK2 A;  3O4Y A;  2RGI A;  2KOT A;  4U8D A;  1B7T Y;  1K9P A;  1SL8 A;  1AK8 A;  1CMF A;  3AAJ A;  1GGW A;  3BUX B;  3DF0 B;  3LK0 A;  4HRH A;  4GNK B;  2BCA A;  2NXQ A;  4JQ0 D;  1AUI B;  3WHT B;  1BG1 A;  1H8B A;  3CR2 A;  1SW8 A;  1WRZ A;  3D0Y A;  2JTZ A;  2LMU A;  1WRK A;  1XFU O;  3QRX A;  5HKZ A;  1G8I A;  1FPW A;  3CTN A;  1REC A;  3FIA A;  1B8C A;  2MA2 A;  1CDP A;  2LVV A;  1M39 A;  1KK7 Z;  2BCX A;  1JFK A;  1SCM C;  1KK8 C;  1PVA A;  5PAL A;  1IJ5 A;  2I2R E;  2WCF A;  4YGA A;  1PAL A;  1NX1 A;  4ORB B;  2KHN A;  3NXA A;  1FBV A;  3PSR A;  2IS9 A;  1KFX S;  5I2Q A;  3PAT A;  3EVV A;  1SK6 D;  2HET A;  4PE7 A;  2GV5 A;  4YI8 A;  1U5I B;  1OZO A;  3SG2 A;  1UHH A;  2G2B A;  2EC6 C;  1KFU L;  2LLT A;  3OP0 A;  2NCP A;  1BJF A;  3KHE A;  2KFH A;  3OX6 A;  1DJG A;  4HSZ A;  3TUY C;  3CGA A;  2CNP A;  4N1F A;  2Y5I A;  1TTX A;  2BL0 B;  4WQ3 A;  4Q04 A;  1QV1 A;  5GQQ C;  3OHM B;  3EK7 A;  3JTD B;  1MXE A;  2BCB A;  1A4P A;  4PHK A;  2LVK A;  4M2P A;  2M7L A;  2WOS A;  1V1F A;  3O2P A;  2LMT A;  1SR6 C;  3SG6 A;  1C07 A;  4CID A;  1ODB A;  2M49 B;  2PSR A;  2MRD A;  1E8A A;  1OMR A;  1KWO B;  3JTD C;  1QIW A;  3RM1 A;  1EXR A;  2CTN A;  5DKN A;  2NCO A;  3TDZ A;  3IQO A;  1SRA A;  2Y1M A;  5CSN A;  4GFT A;  1J1E A;  3OB1 B;  3VGO A;  1B9A A;  1W7I B;  1AP4 A;  3IF7 A;  4NDC A;  3TDU A;  1S26 D;  2K7C A;  2WCB A;  1OOJ A;  3JVT C;  4YGD B;  4OR9 B;  4MSP A;  1G4Y R;  1YUT A;  2JU0 A;  1J1D A;  3I5F C;  1QVI Z;  1QX2 A;  4GUK A;  1DF0 B;  1K8U A;  1C7V A;  4BY4 A;  1YUR A;  1SBJ A;  1MR8 A;  2K61 A; 
#chains in the Genus database with same CATH topology
 1BLQ A;  1OOG A;  2FCE A;  2JT8 A;  3ZWH A;  1J7Q A;  2FCD A;  2M1K B;  2LUC A;  1S6C A;  1SNL A;  1Z2C B;  2GGZ A;  3DZT A;  3PFV A;  2LP3 A;  1OMV A;  2KGR A;  3OX5 A;  1XFY O;  3VRQ A;  1ZAC A;  1K95 A;  2JT0 A;  1CDL A;  2OPO A;  3D75 A;  4PHJ A;  1N0Y A;  2CCM A;  1QTX A;  2I18 A;  1GJY A;  1PUL A;  3BUN B;  1NX2 A;  1KFX L;  4M2Q A;  3SG5 A;  3VRR A;  5G08 A;  2KAY A;  2FJY A;  3DVJ A;  1W9Z A;  2L2E A;  1B7T Z;  3PN7 B;  1W7J B;  5HKY A;  2OTG C;  4MEW A;  1OOI X;  2KNE A;  3B86 A;  1A75 A;  2L51 A;  1WY9 A;  1ZOT B;  1L7Z A;  3EVR A;  3B88 A;  3CWG A;  3D77 A;  4P2Y B;  5DKR A;  1RFJ A;  3VB1 A;  1UHI A;  5TNC A;  1XA5 A;  3KPX A;  5HKW A;  3L47 A;  4MVF A;  2KAV A;  1FI5 A;  2WCJ A;  1EG4 A;  4PE4 A;  4PDZ A;  4MBE A;  2PYQ A;  3BUM B;  2KI6 D;  1K90 D;  1QX7 A;  1CM1 A;  1OW4 A;  1KQV A;  1QX5 B;  3CS1 A;  2KFG A;  2PAS A;  2DOQ A;  2JWW A;  2Q91 A;  4OV2 A;  5AXI A;  2LCP A;  2PRU A;  2L4I A;  1J7P A;  1IQ5 A;  5HYD A;  4D1E A;  1SSE B;  2FJU B;  3D10 A;  5ER4 X;  1DGU A;  1F4Q A;  4WQ2 A;  1QVI Y;  1NIW A;  1F55 A;  3LL8 B;  4QJ4 B;  2F8P A;  1FF1 A;  2K7D A;  1AVS A;  3I5I B;  4MZJ A;  3CAB A;  5JOL A;  3DVE A;  2WCK A;  2E6W A;  2M29 A;  4PHM A;  1CNP A;  4HRG A;  3DD4 A;  3QME A;  4OKH A;  1UHK A;  4OCI A;  3PJI A;  5CSJ A;  1C3Y A;  1SYM A;  2QEB A;  1B8L A;  4AOM A;  3UNW A;  4C0J A;  1SY9 A;  1GQM A;  2KBM A;  3CZ2 A;  2K7O A;  2G9B A;  1YUS A;  1SPY A;  1F54 A;  1DJI A;  3H4S E;  3EG5 B;  1MUX A;  2MLE C;  1QJT A;  2AMI A;  4N1G A;  2WND A;  3BYA A;  1M46 A;  3DY9 A;  3NSL A;  3CDN A;  4HRE E;  2QPT A;  1F4O A;  3HCM A;  1EH2 A;  2MHH A;  1TNW A;  4E68 A;  1NCY A;  5AFP A;  1YTZ C;  3GK1 A;  2BKH B;  1RRO A;  3FE8 A;  3WXA A;  3B87 A;  1IH0 A;  1TWO A;  3SS3 A;  1WLZ A;  1UWO A;  1B47 A;  1N65 A;  4BY5 A;  2QEV A;  3D76 A;  4YGC B;  1RK9 A;  3TDI A;  5D7F A;  1JC2 A;  2I7A A;  3CR5 X;  2Y1N A;  3FWB A;  5CPV A;  2B1U A;  4GGF A;  2ISD A;  1EG3 A;  2QAC A;  3JVT B;  2KI4 B;  1OE9 B;  2K2A A;  3KO0 A;  4R1E A;  1IRJ A;  3EK4 A;  1DTL A;  2F2P A;  2WC5 A;  2WOR A;  4NDB A;  1XYD A;  1YX7 A;  3UO9 A;  3OBV A;  1JWD A;  1BU3 A;  1HQV A;  2EC6 B;  1S36 A;  1XFX O;  4OZD A;  1PK0 D;  1Q80 A;  3EVU A;  2Y4Q A;  1XFW O;  1YRT B;  2Q4U A;  4IJ7 A;  1CLB A;  3D0Y B;  2ZRS A;  5CSF A;  4A4C A;  1QAT A;  2JPT A;  1LA0 A;  1WDC B;  1YVL A;  4MZK A;  4OVN F;  1QLS A;  3E3R A;  2LVI A;  3EKJ A;  2JXL A;  3CZT X;  3MSE B;  3VRN A;  3BJH A;  1DJZ A;  2BE4 A;  1M31 A;  4FTG A;  1UUS A;  2M9G A;  4CFR A;  2KYC A;  2K0J A;  3DVK A;  1OZS A;  1F70 A;  1AJ4 A;  3C1V A;  2WCM A;  4XJK B;  1S6J A;  5HLV A;  2O5G A;  2KBI A;  3FWC A;  1YRU B;  2KDH A;  2F33 A;  3TS5 B;  1PSB A;  5B8I B;  1RWY A;  1QS7 A;  2V53 A;  3S0D A;  2MAZ A;  4IL1 A;  1F71 A;  2I94 A;  1KWO C;  1LKJ A;  2JXC A;  1P28 A;  2KQY A;  4INW A;  2JZI A;  3EK8 A;  4NDD A;  3ICB A;  4FQO A;  2LC5 A;  1S5G Z;  2LE9 B;  2LM5 A;  1FW4 A;  2LVJ A;  3FE9 A;  2MBX A;  1GM0 A;  5HLO A;  4GGF C;  1B4C A;  1BOC A;  3LCP C;  1A2X A;  1LVC D;  1TCF A;  1ZUZ A;  2F3Y A;  4L9M A;  1NPQ A;  1T14 A;  1VRK A;  4PE0 A;  2BKI B;  3CR4 X;  3DYE A;  5I2O A;  1DT7 B;  4XJK A;  2L5Y A;  1M45 A;  3LK1 A;  1LXF C;  2KYF A;  1J7R A;  2NZ0 A;  3BOW B;  2M8U A;  3F45 A;  1DC1 A;  1NSH A;  4JKT A;  4ICB A;  1CLM A;  3V2L A;  2JRF A;  2WCL A;  2HPS A;  1OQP A;  2AUC A;  3CZ1 A;  4YRU A;  5BPJ A;  1Y1A A;  2M7N A;  3TZ1 A;  4PT1 A;  1FI6 A;  1H4B A;  4ZCV A;  1IGV A;  1YX8 A;  1DJX A;  2ZND A;  2KLD A;  2ZRT A;  2LAN A;  5J3X A;  4USL A;  4P5O E;  2KGB C;  1TOP A;  2TN4 A;  1XK4 C;  1DVI A;  3Q8I A;  1KSO A;  4FQT A;  1JF2 A;  4GPL B;  1K96 A;  3OGN A;  1JF0 A;  1V1G A;  2COL B;  2K7B A;  2KQ6 A;  3L4A A;  3TUY B;  4YGE B;  2NLN A;  2KLE A;  1SKT A;  1K9U A;  4JD9 A;  1OMD A;  1DGV A;  5I2L A;  1TIZ A;  2LAP A;  4PE1 A;  1R2U A;  1Y0V H;  3N7H A;  1WRL A;  1CFC A;  1AHR A;  1MQ1 A;  1XFZ O;  1OOF A;  1Y6W A;  2L50 A;  2LNK A;  4A4B A;  3NHI A;  4NQG A;  3PLF B;  1NUB A;  2JNX A;  1S1E A;  1K2H A;  3VRO A;  3GK4 X;  5KTY A;  3BUO B;  1MXL C;  1ALW A;  2M97 A;  1KK8 B;  1UUR A;  3I5H C;  2LLU A;  5KSZ A;  2H8V A;  3R72 A;  2QDI A;  3DXL A;  3DVM A;  3K1E A;  3RLZ A;  1DEK A;  3LLE A;  4JWQ A;  4ORC B;  1UP5 A;  2HF5 A;  3EKH A;  1KSM A;  1UHJ A;  2AAO A;  1SL7 A;  1WDC C;  1DJW A;  1TNX A;  2KI6 C;  1TCO B;  4PAL A;  1RTP 1;  3ZNI A;  2FOT A;  4JPZ B;  1S6I A;  1SL9 A;  1TRF A;  2M1U A;  5FI7 A;  1KK7 Y;  1J55 A;  1MHO A;  3AAK A;  3D73 A;  4DRW A;  1R6P A;  3I5G C;  5D69 A;  4CFQ A;  1RJV A;  4I5L B;  3SG7 A;  1L2O C;  1LIN A;  1C7W A;  1QLK A;  1TNQ A;  1IG5 A;  2M3W A;  3BXK A;  3IVT A;  3S0E A;  1KCY A;  2GGM A;  4ZCU A;  2LP2 A;  2R2I A;  1WLM A;  2OTG B;  1NX0 A;  3PM2 A;  3BUW B;  1HT9 A;  1X02 A;  3I5G B;  1EL4 A;  5FI6 A;  3SIA A;  1CB1 A;  2A4J A;  2KPH A;  1AJ5 A;  1IWQ A;  1QAS A;  1U5I A;  3S0G A;  2H2K A;  2WC8 A;  2L4H A;  4M2O A;  4YGB B;  5IBW A;  4TNC A;  1JUO A;  3PN7 C;  1JFJ A;  2BL0 C;  2JC2 A;  2LV7 A;  3TS5 C;  1LA3 A;  4YBH B;  1TN4 A;  2LLS A;  4I5K A;  3O6B A;  1XFV O;  2O60 A;  4INX A;  1SCV A;  3NSO A;  1F8H A;  3HX4 A;  2QEH A;  5F6T A;  1UHN A;  1BMO A;  1IKU A;  2HQW A;  1SR6 B;  1YR5 A;  1SCM B;  2ZN8 A;  3WNX B;  1CFD A;  4UPG A;  3CLN A;  2WCE A;  1CDN A;  2JT3 A;  2H61 A;  5KU1 A;  3IQQ A;  5AAN A;  2K2F A;  3NHT A;  2BE6 A;  2P6B B;  1Y1U A;  1J7O A;  1QV0 A;  3PM8 A;  1CDM A;  1NYA A;  2SAS A;  3I5F B;  2KFF A;  1DJH A;  1GGZ A;  3KF9 A;  1CTR A;  1G33 A;  3NSK A;  3SS5 A;  1TNP A;  5HL1 A;  3AKA A;  4GBA A;  1CM4 A;  1L2O B;  5AEQ A;  1YUU A;  1MWN A;  2PAL A;  2LHL A;  5DIC A;  4QJ3 B;  5I94 A;  4MRX A;  1B1G A;  1BF5 A;  2MJW B;  1BOD A;  1NCZ A;  4ORA B;  2LHI A;  2QEO A;  1IIO A;  1ZFS A;  1N2D A;  1SMG A;  2JTT A;  1A03 A;  1QXP A;  1B8R A;  4ETO A;  3SJS A;  3S0A A;  2M0R A;  1ZMZ A;  5ER5 A;  2EGD A;  1CKK A;  4MRY A;  1DQE A;  1A29 A;  1Y1X A;  2BEC A;  3D78 A;  2D8N A;  2CBL A;  4YI9 A;  3S0F A;  1DF0 A;  3SIB A;  1XK4 A;  4F0Z B;  2E30 A;  1S5G Y;  2ZN9 A;  1XVJ A;  1YVH A;  4XYN A;  2MLF C;  1KQM C;  2K8M B;  3FS7 A;  1Z4H A;  2KAX A;  2LMV A;  3PAL A;  2JQ6 A;  1CFP A;  4KYN A;  1NP8 A;  4MN0 A;  2JUL A;  1A75 B;  2PQL A;  3M0W A;  4GGN A;  2ZKM X;  3K21 A;  1D1O A;  4MLW A;  4C0K A;  2GTE A;  3BQ3 A;  3VRP A;  4WRI A;  1QWV A;  2CT9 A;  2OS8 C;  2PMY A;  2L98 A;  3CZ0 A;  3FE6 A;  4QJ5 B;  1CFF A;  2KSP A;  5FI2 A;  1QIV A;  2VRG A;  3DF0 A;  3AKB A;  4AQJ A;  1ALV A;  2H61 C;  1K9K A;  4AQI A;  1K93 D;  2BBM A;  1IJ6 A;  3BFB A;  2OS8 B;  4PCW A;  2ZFD A;  5CSI A;  3A4U B;  2KI4 C;  2BBN A;  3BOW A;  5DKQ A;  5K89 A;  1MF8 B;  2F3Z A;  1KFU S;  3O78 A;  4PHN A;  1S3P A;  2LUX A;  4DS7 A;  1JSA A;  1TUJ A;  2L5X B;  2F2O A;  4MZL A;  4C0L A;  4CLN A;  1BR1 B;  2ZNE A;  3I5H B;  2BNX A;  1DMO A;  5EL2 A;  4DUQ A;  4I5J A;  3KEV A;  5JJG A;  2P70 A;  1BT6 A;  3NSI A;  5FYX A;  2SCP A;  1CLL A;  1NWD A;  2JOJ A;  2L0P A;  3I5I C;  1K94 A;  1DEL A;  3A8R A;  2K60 A;  5I8N A;  1NX3 A;  4I5N B;  3RZS A;  2PVB A;  3SG3 A;  3R1P A;  1JBA A;  2YGU A;  3S0B A;  1M63 B;  2BAP A;  4N5X A;  3WHU B;  1BR4 B;  1PSR A;  5AER A;  2HQ8 A;  1NCX A;  1XO5 A;  2EHB A;  1OSA A;  2CXJ A;  4GAO A;  1IQ3 A;  2JPO A;  3SG4 A;  2JNF A;  2WCH A;  4DCK A;  1KQM B;  1PRW A;  1PVB A;  3R1O A;  4CPV A;  4DIR A;  1CMG A;  3GOF A;  3OB2 B;  1DJY A;  1EJ3 A;  3GK2 A;  3O4Y A;  2RGI A;  2KOT A;  4U8D A;  1B7T Y;  1K9P A;  1SL8 A;  1AK8 A;  1CMF A;  3AAJ A;  1GGW A;  3BUX B;  3DF0 B;  3LK0 A;  4HRH A;  4GNK B;  2BCA A;  2WC6 A;  2NXQ A;  3NGV A;  4JQ0 D;  1AUI B;  3WHT B;  1BG1 A;  1H8B A;  3CR2 A;  1SW8 A;  1WRZ A;  1ORG A;  2JTZ A;  2LMU A;  3D0Y A;  1WRK A;  1XFU O;  3QRX A;  3B7A A;  5HKZ A;  1G8I A;  1FPW A;  3CTN A;  1REC A;  3FIA A;  1B8C A;  4F7F A;  2MA2 A;  1CDP A;  2LVV A;  1M39 A;  1OOH A;  5D3O A;  1KK7 Z;  2BCX A;  1JFK A;  1SCM C;  1KK8 C;  1PVA A;  5PAL A;  1IJ5 A;  2I2R E;  2WCF A;  4YGA A;  1PAL A;  1NX1 A;  3CYZ A;  2L2C A;  4ORB B;  2KHN A;  3NXA A;  1FBV A;  3PSR A;  2IS9 A;  1KFX S;  5I2Q A;  3PAT A;  3EVV A;  3O4X A;  1SK6 D;  2HET A;  4PE7 A;  2GV5 A;  4YI8 A;  1U5I B;  1XFR A;  1OZO A;  3SG2 A;  1UHH A;  2G2B A;  2EC6 C;  1KFU L;  2LLT A;  3OP0 A;  3SS4 A;  2NCP A;  1BJF A;  3KHE A;  2KFH A;  1C3Z A;  3OX6 A;  1DJG A;  4HSZ A;  3TUY C;  3CGA A;  2CNP A;  4N1F A;  2Y5I A;  1TUZ A;  1TTX A;  2BL0 B;  4WQ3 A;  4Q04 A;  1QV1 A;  5GQQ C;  3OHM B;  3EK7 A;  3JTD B;  1MXE A;  2BCB A;  3D74 A;  1A4P A;  4PHK A;  2LVK A;  4M2P A;  2M7L A;  2WOS A;  1V1F A;  3O2P A;  2LMT A;  1SR6 C;  3SG6 A;  1C07 A;  4CID A;  1LS8 A;  1ODB A;  2M49 B;  2PSR A;  2MRD A;  1E8A A;  1OMR A;  1KWO B;  2ERB A;  2P71 A;  3JTD C;  1QIW A;  3RM1 A;  1EXR A;  2CTN A;  3BFH A;  5DKN A;  2NCO A;  3TDZ A;  3IQO A;  1SRA A;  2Y1M A;  5CSN A;  3L4L A;  4GFT A;  3BFA A;  1J1E A;  3OB1 B;  3VGO A;  1B9A A;  1W7I B;  1AP4 A;  3IF7 A;  3B6X A;  4NDC A;  3TDU A;  1S26 D;  2K7C A;  2WCB A;  1OOJ A;  3JVT C;  4YGD B;  4OR9 B;  3R1V A;  4MSP A;  1G4Y R;  1YUT A;  2JU0 A;  1J1D A;  3I5F C;  1QVI Z;  1QX2 A;  4GUK A;  1DF0 B;  1K8U A;  1C7V A;  4BY4 A;  1YUR A;  1SBJ A;  1MR8 A;  2K61 A; 
#chains in the Genus database with same CATH homology
 1BLQ A;  2JT8 A;  2FCE A;  3ZWH A;  1J7Q A;  2FCD A;  2M1K B;  2LUC A;  1S6C A;  1SNL A;  2GGZ A;  3PFV A;  2LP3 A;  1OMV A;  2KGR A;  3OX5 A;  1XFY O;  3VRQ A;  1ZAC A;  1K95 A;  2JT0 A;  1CDL A;  2OPO A;  4PHJ A;  1N0Y A;  2CCM A;  1QTX A;  2I18 A;  1GJY A;  1PUL A;  3BUN B;  1NX2 A;  1KFX L;  4M2Q A;  3SG5 A;  3VRR A;  5G08 A;  2KAY A;  3DVJ A;  2L2E A;  1B7T Z;  3PN7 B;  1W7J B;  5HKY A;  2OTG C;  4MEW A;  2KNE A;  1A75 A;  2L51 A;  1WY9 A;  1ZOT B;  1L7Z A;  3EVR A;  3CWG A;  4P2Y B;  5DKR A;  1RFJ A;  1UHI A;  5TNC A;  1XA5 A;  3KPX A;  5HKW A;  4MVF A;  2KAV A;  1FI5 A;  1EG4 A;  4PE4 A;  4PDZ A;  4MBE A;  3BUM B;  2KI6 D;  1K90 D;  1QX7 A;  1CM1 A;  1KQV A;  1QX5 B;  3CS1 A;  2KFG A;  2PAS A;  2DOQ A;  2JWW A;  2Q91 A;  4OV2 A;  5AXI A;  2LCP A;  2PRU A;  2L4I A;  1J7P A;  1IQ5 A;  5HYD A;  4D1E A;  2FJU B;  3D10 A;  5ER4 X;  1DGU A;  1F4Q A;  4WQ2 A;  1QVI Y;  1NIW A;  1F55 A;  3LL8 B;  4QJ4 B;  2F8P A;  1FF1 A;  2K7D A;  1AVS A;  3I5I B;  4MZJ A;  5JOL A;  3DVE A;  2E6W A;  2M29 A;  4PHM A;  1CNP A;  4HRG A;  3DD4 A;  4OKH A;  1UHK A;  4OCI A;  5CSJ A;  1SYM A;  1B8L A;  4AOM A;  4C0J A;  1SY9 A;  1GQM A;  2KBM A;  2K7O A;  2G9B A;  1YUS A;  1SPY A;  1F54 A;  1DJI A;  3H4S E;  1MUX A;  2MLE C;  1QJT A;  2AMI A;  4N1G A;  2WND A;  3BYA A;  1M46 A;  4HRE E;  3NSL A;  2QPT A;  1F4O A;  3HCM A;  1EH2 A;  2MHH A;  1TNW A;  4E68 A;  1NCY A;  5AFP A;  1YTZ C;  3GK1 A;  2BKH B;  1RRO A;  3WXA A;  1IH0 A;  1WLZ A;  1UWO A;  1B47 A;  1N65 A;  4BY5 A;  3TDI A;  4YGC B;  1RK9 A;  5D7F A;  1JC2 A;  2I7A A;  3CR5 X;  2Y1N A;  3FWB A;  5CPV A;  2B1U A;  4GGF A;  2ISD A;  1EG3 A;  2QAC A;  3JVT B;  2KI4 B;  1OE9 B;  2K2A A;  3KO0 A;  4R1E A;  1IRJ A;  3EK4 A;  1DTL A;  2F2P A;  2WOR A;  4NDB A;  1XYD A;  1YX7 A;  1JWD A;  1BU3 A;  1HQV A;  2EC6 B;  1S36 A;  1XFX O;  1PK0 D;  1Q80 A;  3EVU A;  2Y4Q A;  1XFW O;  1YRT B;  2Q4U A;  1CLB A;  3D0Y B;  2ZRS A;  5CSF A;  4A4C A;  1QAT A;  2JPT A;  1LA0 A;  1WDC B;  1YVL A;  4MZK A;  4OVN F;  1QLS A;  3E3R A;  2LVI A;  3EKJ A;  2JXL A;  3CZT X;  3MSE B;  3VRN A;  1DJZ A;  2BE4 A;  1M31 A;  4FTG A;  1UUS A;  2M9G A;  4CFR A;  2KYC A;  2K0J A;  3DVK A;  1OZS A;  1F70 A;  1AJ4 A;  3C1V A;  4XJK B;  1S6J A;  5HLV A;  2O5G A;  2KBI A;  3FWC A;  1YRU B;  2KDH A;  2F33 A;  3TS5 B;  1PSB A;  5B8I B;  1RWY A;  1QS7 A;  2V53 A;  2MAZ A;  4IL1 A;  1F71 A;  2I94 A;  1KWO C;  1LKJ A;  2JXC A;  2KQY A;  2JZI A;  3EK8 A;  4NDD A;  3ICB A;  4FQO A;  2LC5 A;  1S5G Z;  2LE9 B;  2LM5 A;  1FW4 A;  2LVJ A;  2MBX A;  5HLO A;  4GGF C;  1B4C A;  1BOC A;  3LCP C;  1A2X A;  1LVC D;  1TCF A;  1ZUZ A;  2F3Y A;  4L9M A;  1NPQ A;  4PE0 A;  1VRK A;  2BKI B;  3CR4 X;  5I2O A;  1DT7 B;  4XJK A;  1M45 A;  3LK1 A;  1LXF C;  2KYF A;  1J7R A;  2NZ0 A;  3BOW B;  2M8U A;  3F45 A;  1NSH A;  4ICB A;  1CLM A;  2JRF A;  2HPS A;  1OQP A;  2AUC A;  4YRU A;  5BPJ A;  1Y1A A;  2M7N A;  3TZ1 A;  1FI6 A;  1H4B A;  4ZCV A;  1IGV A;  1YX8 A;  1DJX A;  2ZND A;  2ZRT A;  2LAN A;  5J3X A;  4USL A;  4P5O E;  2KGB C;  1TOP A;  2TN4 A;  1XK4 C;  1DVI A;  1KSO A;  1JF2 A;  4GPL B;  1K96 A;  1JF0 A;  1V1G A;  2COL B;  2K7B A;  2KQ6 A;  3TUY B;  4YGE B;  2NLN A;  1SKT A;  1K9U A;  1OMD A;  1DGV A;  5I2L A;  1TIZ A;  2LAP A;  4PE1 A;  1R2U A;  1Y0V H;  1WRL A;  1CFC A;  1AHR A;  1MQ1 A;  1XFZ O;  1Y6W A;  2L50 A;  2LNK A;  4A4B A;  4NQG A;  3PLF B;  1NUB A;  2JNX A;  1S1E A;  1K2H A;  3VRO A;  3GK4 X;  5KTY A;  3BUO B;  1MXL C;  1ALW A;  2M97 A;  1KK8 B;  1UUR A;  3I5H C;  2LLU A;  5KSZ A;  3DVM A;  3RLZ A;  3LLE A;  4JWQ A;  4ORC B;  1UP5 A;  2HF5 A;  3EKH A;  1KSM A;  1UHJ A;  2AAO A;  1SL7 A;  1WDC C;  1DJW A;  1TNX A;  2KI6 C;  1TCO B;  4PAL A;  1RTP 1;  3ZNI A;  2FOT A;  4JPZ B;  1S6I A;  1SL9 A;  1TRF A;  2M1U A;  1KK7 Y;  1J55 A;  1MHO A;  3AAK A;  4DRW A;  1R6P A;  3I5G C;  5D69 A;  4CFQ A;  1RJV A;  4I5L B;  3SG7 A;  1L2O C;  1LIN A;  1C7W A;  1QLK A;  1TNQ A;  1IG5 A;  2M3W A;  3BXK A;  1KCY A;  2GGM A;  4ZCU A;  2LP2 A;  2R2I A;  1WLM A;  2OTG B;  1NX0 A;  3BUW B;  1HT9 A;  1X02 A;  3I5G B;  1EL4 A;  3SIA A;  1CB1 A;  2A4J A;  1AJ5 A;  1IWQ A;  1QAS A;  1U5I A;  2H2K A;  2WC8 A;  2L4H A;  4M2O A;  4YGB B;  5IBW A;  4TNC A;  1JUO A;  3PN7 C;  1JFJ A;  2BL0 C;  2JC2 A;  2LV7 A;  3TS5 C;  1LA3 A;  4YBH B;  1TN4 A;  2LLS A;  4I5K A;  3O6B A;  1XFV O;  2O60 A;  1SCV A;  3NSO A;  1F8H A;  3HX4 A;  5F6T A;  1UHN A;  1BMO A;  1IKU A;  2HQW A;  1SR6 B;  1YR5 A;  1SCM B;  2ZN8 A;  3WNX B;  1CFD A;  4UPG A;  3CLN A;  2WCE A;  1CDN A;  2JT3 A;  2H61 A;  5KU1 A;  3IQQ A;  5AAN A;  2K2F A;  2BE6 A;  2P6B B;  1Y1U A;  1J7O A;  1QV0 A;  3PM8 A;  1CDM A;  1NYA A;  2SAS A;  3I5F B;  2KFF A;  1DJH A;  1GGZ A;  3KF9 A;  1CTR A;  1G33 A;  3NSK A;  1TNP A;  3AKA A;  4GBA A;  1CM4 A;  1L2O B;  5AEQ A;  1YUU A;  1MWN A;  2PAL A;  2LHL A;  4QJ3 B;  4MRX A;  1B1G A;  1BF5 A;  2MJW B;  1BOD A;  1NCZ A;  4ORA B;  2LHI A;  1ZFS A;  1N2D A;  1SMG A;  2JTT A;  1A03 A;  1QXP A;  1B8R A;  4ETO A;  3SJS A;  2M0R A;  1ZMZ A;  5ER5 A;  2EGD A;  1CKK A;  4MRY A;  1A29 A;  1Y1X A;  2BEC A;  4YI9 A;  2D8N A;  2CBL A;  1DF0 A;  3SIB A;  1XK4 A;  4F0Z B;  2E30 A;  1S5G Y;  2ZN9 A;  1XVJ A;  1YVH A;  4XYN A;  2MLF C;  1KQM C;  2K8M B;  3FS7 A;  2KAX A;  2LMV A;  3PAL A;  2JQ6 A;  1CFP A;  1NP8 A;  4MN0 A;  2JUL A;  1A75 B;  3M0W A;  4GGN A;  2ZKM X;  3K21 A;  1D1O A;  4MLW A;  4C0K A;  3BQ3 A;  3VRP A;  4WRI A;  2CT9 A;  2OS8 C;  2PMY A;  2L98 A;  4QJ5 B;  1CFF A;  2KSP A;  1QIV A;  2VRG A;  3DF0 A;  3AKB A;  4AQJ A;  1ALV A;  2H61 C;  1K9K A;  4AQI A;  1K93 D;  2BBM A;  1IJ6 A;  2OS8 B;  4PCW A;  2ZFD A;  5CSI A;  3A4U B;  2KI4 C;  2BBN A;  3BOW A;  5DKQ A;  5K89 A;  1MF8 B;  2F3Z A;  1KFU S;  3O78 A;  4PHN A;  1S3P A;  2LUX A;  4DS7 A;  1JSA A;  2L5X B;  2F2O A;  4MZL A;  4C0L A;  4CLN A;  1BR1 B;  2ZNE A;  3I5H B;  1DMO A;  4DUQ A;  4I5J A;  3KEV A;  5JJG A;  1BT6 A;  3NSI A;  5FYX A;  2SCP A;  1CLL A;  1NWD A;  2JOJ A;  2L0P A;  3I5I C;  1K94 A;  3A8R A;  5I8N A;  1NX3 A;  4I5N B;  2PVB A;  3SG3 A;  1JBA A;  1M63 B;  4N5X A;  3WHU B;  1BR4 B;  1PSR A;  5AER A;  2HQ8 A;  1NCX A;  1XO5 A;  2EHB A;  1OSA A;  2CXJ A;  4GAO A;  1IQ3 A;  3SG4 A;  2JNF A;  4DCK A;  1KQM B;  1PRW A;  1PVB A;  4CPV A;  4DIR A;  1CMG A;  3GOF A;  3OB2 B;  1DJY A;  1EJ3 A;  3GK2 A;  3O4Y A;  2RGI A;  2KOT A;  4U8D A;  1B7T Y;  1K9P A;  1SL8 A;  1AK8 A;  1CMF A;  3AAJ A;  1GGW A;  3BUX B;  3DF0 B;  3LK0 A;  4HRH A;  4GNK B;  2BCA A;  2NXQ A;  4JQ0 D;  1AUI B;  3WHT B;  1BG1 A;  1H8B A;  3CR2 A;  1SW8 A;  1WRZ A;  3D0Y A;  2JTZ A;  2LMU A;  1WRK A;  1XFU O;  3QRX A;  5HKZ A;  1G8I A;  1FPW A;  3CTN A;  1REC A;  3FIA A;  1B8C A;  2MA2 A;  1CDP A;  2LVV A;  1M39 A;  1KK7 Z;  2BCX A;  1JFK A;  1SCM C;  1KK8 C;  1PVA A;  5PAL A;  1IJ5 A;  2I2R E;  2WCF A;  4YGA A;  1PAL A;  1NX1 A;  4ORB B;  2KHN A;  3NXA A;  1FBV A;  3PSR A;  2IS9 A;  1KFX S;  5I2Q A;  3PAT A;  3EVV A;  1SK6 D;  2HET A;  4PE7 A;  2GV5 A;  4YI8 A;  1U5I B;  1OZO A;  3SG2 A;  1UHH A;  2G2B A;  2EC6 C;  1KFU L;  2LLT A;  3OP0 A;  2NCP A;  1BJF A;  3KHE A;  2KFH A;  3OX6 A;  1DJG A;  4HSZ A;  3TUY C;  3CGA A;  2CNP A;  4N1F A;  2Y5I A;  1TTX A;  2BL0 B;  4WQ3 A;  4Q04 A;  1QV1 A;  5GQQ C;  3OHM B;  3EK7 A;  3JTD B;  1MXE A;  2BCB A;  1A4P A;  4PHK A;  2LVK A;  4M2P A;  2M7L A;  2WOS A;  1V1F A;  3O2P A;  2LMT A;  1SR6 C;  3SG6 A;  1C07 A;  4CID A;  1ODB A;  2M49 B;  2PSR A;  2MRD A;  1E8A A;  1OMR A;  1KWO B;  3JTD C;  1QIW A;  3RM1 A;  1EXR A;  2CTN A;  5DKN A;  2NCO A;  3TDZ A;  3IQO A;  1SRA A;  2Y1M A;  5CSN A;  4GFT A;  1J1E A;  3OB1 B;  3VGO A;  1B9A A;  1W7I B;  1AP4 A;  3IF7 A;  4NDC A;  3TDU A;  1S26 D;  2K7C A;  2WCB A;  1OOJ A;  3JVT C;  4YGD B;  4OR9 B;  4MSP A;  1G4Y R;  1YUT A;  2JU0 A;  1J1D A;  3I5F C;  1QVI Z;  1QX2 A;  4GUK A;  1DF0 B;  1K8U A;  1C7V A;  4BY4 A;  1YUR A;  1SBJ A;  1MR8 A;  2K61 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...