1J7OA

Solution structure of calcium-calmodulin n-terminal domain
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
76
structure length
76
Chain Sequence
ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calmodulin
publication title Solution structure of Ca(2+)-calmodulin reveals flexible hand-like properties of its domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 24
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2001-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1j7oA00
3BQ3A 2G2BA 3CR4X 1PSBA 2LANA 1JC2A 5CSNA 2COLB 3VRNA 1WLZA 1KFUS 1PALA 1QVIZ 4N1GA 4I5KA 1TCFA 1GQMA 3BOWB 1KFUL 3I5IB 2CNPA 1SL8A 4MLWA 4USLA 1CTRA 1DTLA 1K90D 3KHEA 1SR6B 1S5GZ 1NX3A 2WORA 3D0YB 3FWBA 1BODA 2Y5IA 1R6PA 1V1FA 1YR5A 3AAKA 2HPSA 2M3WA 3DD4A 2DOQA 4YI9A 1A03A 1QLKA 3KF9A 3WHUB 2KYFA 3NXAA 1BR1B 4M2PA 3TDIA 2TN4A 3EVUA 2Q91A 4PHNA 3JVTC 1YURA 2ZRTA 3TS5C 1S6CA 1UHIA 2JULA 1NCZA 1CFFA 3FWCA 2JU0A 1XO5A 2IS9A 3SJSA 3I5GC 4XJKA 2F2OA 1EJ3A 4CPVA 2KSPA 4JWQA 1WRKA 4JQ0D 3GOFA 2WOSA 2BL0B 2LLUA 1CDLA 1QIVA 2KI4B 4MZJA 1XFXO 3KEVA 2ZKMX 3I5HB 1F71A 1B47A 1RROA 1TRFA 2F33A 4GGNA 4YGAA 1BJFA 3OX6A 1N65A 1UUSA 3PSRA 1SMGA 1E8AA 1MWNA 2QPTA 2BECA 4HREE 1U5IA 1CFDA 1L2OC 4FQOA 1CFPA 2LV7A 1K2HA 2BBMA 1NYAA 1IGVA 2KBMA 1RFJA 1WDCC 3C1VA 2JC2A 5CSFA 1C7VA 2ZRSA 3LCPC 4WQ2A 4PE0A 5K89A 3SG5A 1GGZA 1VRKA 2LP2A 1QTXA 2PASA 1NCYA 4ETOA 2KAVA 1UHHA 1AUIB 5I2OA 1OZSA 1M31A 2AMIA 2CT9A 1KQMB 3D10A 2B1UA 1ODBA 5KTYA 4OKHA 1DVIA 2JOJA 3PATA 1J7OA 1J55A 1FI5A 1W7IB 3CWGA 2A4JA 1YRTB 1NUBA 5HYDA 2O5GA 2PSRA 1LXFC 1J7RA 1AK8A 1M63B 1TTXA 1D1OA 1DJIA 2FJUB 3BXKA 3LL8B 3TDZA 3GK1A 1RJVA 3I5FB 4CIDA 1FPWA 3LLEA 2EC6B 1SY9A 2CXJA 2L50A 3TDUA 2NLNA 3HX4A 1KFXS 3NSKA 1AJ5A 2JPTA 1WLMA 4PALA 4ICBA 1KFXL 1SCMB 1X02A 1QX7A 1XFWO 4I5NB 1LVCD 3RM1A 2LVJA 3PM8A 2BCAA 2ZN8A 1PK0D 2L4HA 1FI6A 4M2OA 2K7BA 1WY9A 3SIAA 2NCPA 5F6TA 2BCXA 1K95A 2E6WA 3TUYB 2ZFDA 5DKRA 4CFRA 1QX2A 2KGBC 4OR9B 2JTZA 3FIAA 2AUCA 4GAOA 4PDZA 2LE9B 3CGAA 3KPXA 1MUXA 1IRJA 1Y1AA 1ZFSA 2BE6A 1N0YA 5HLVA 2M29A 1UHKA 1J7PA 1Y6WA 1A29A 2HETA 4GFTA 1IQ3A 3EK8A 1EL4A 1WRLA 1DJHA 1FBVA 1V1GA 2KDHA 4ORBB 1JFKA 1IG5A 1RK9A 4U8DA 1J1DA 4YBHB 2KI6D 2LVKA 2F3ZA 1J7QA 2V53A 1KSOA 1TNQA 1UWOA 3IQOA 4A4BA 2CTNA 4A4CA 2KGRA 2LM5A 3O4YA 1ZMZA 1DGUA 1TIZA 5CPVA 1NX2A 1K9PA 2OS8C 1RTP1 2PVBA 3GK2A 1KWOB 3LK0A 1MQ1A 3JVTB 3O2PA 1DMOA 2I18A 2LCPA 2M49B 1ZUZA 2VRGA 1PRWA 4I5JA 4QJ4B 1L7ZA 2ZNEA 1K96A 3FS7A 4F0ZB 2LMTA 1BR4B 1G4YR 3EK7A 2JT8A 4XJKB 1KK8C 3PN7C 2K7DA 5AANA 1GJYA 1BLQA 5CSJA 1QIWA 2JQ6A 1YVHA 1XFZO 3VRQA 1OZOA 2RGIA 2D8NA 3SG3A 1B8RA 1OOJA 1PVBA 1IJ5A 1SBJA 4GPLB 2MBXA 3TZ1A 4PE4A 2JRFA 4C0JA 1YUUA 1QV0A 2GGMA 2E30A 5AXIA 1KCYA 2L51A 2Q4UA 1DJXA 1NX1A 2GGZA 1U5IB 1S26D 3ICBA 1JSAA 2H61C 1DGVA 3BUWB 1PVAA 1DJYA 1FW4A 1AVSA 1QASA 1MR8A 1QV1A 1XFUO 3OB1B 1F8HA 5BPJA 2LHLA 1OQPA 3WNXB 2MLEC 3DVJA 4GGFA 1CMFA 4MN0A 3EK4A 1SR6C 4GGFC 1SCVA 1A2XA 1QJTA 1YUTA 1ZACA 4MRXA 2WCEA 5HKWA 2MA2A 1YVLA 1OMVA 1HT9A 1XVJA 5AFPA 4NDDA 3WHTB 4AOMA 2KHNA 1S3PA 1XYDA 4R1EA 2K7OA 4PCWA 1C7WA 3A4UB 3SG4A 1EG4A 2MJWB 4DUQA 4PE1A 1B9AA 4E68A 1H4BA 2M0RA 4OV2A 1CDPA 5I2QA 3AAJA 1QS7A 3M0WA 1CFCA 3GK4X 2KI4C 1XFVO 1DF0A 3ZNIA 2EGDA 1SNLA 2NXQA 3I5HC 2K0JA 1S36A 1DT7B 4GUKA 2L98A 1PULA 1H8BA 4JPZB 4MRYA 3SG2A 1OSAA 3EKHA 4NQGA 3K21A 2BKHB 5AEQA 1JWDA 1B7TZ 1MF8B 1CKKA 1ALVA 1DJWA 3HCMA 4HRHA 4C0KA 3O6BA 1J1EA 1MXEA 2H2KA 2KI6C 3EVRA 1G8IA 1Y1UA 2FCDA 1N2DA 1UHJA 2LAPA 2ZN9A 2LLTA 3RLZA 2K2FA 1BG1A 3H4SE 2F2PA 2KYCA 4P5OE 5B8IB 2L4IA 3SG6A 2KFGA 4BY5A 1F4QA 4Q04A 1R2UA 1NX0A 3DVMA 4WRIA 1KK7Z 2PRUA 4N5XA 1LA0A 2WCFA 1IH0A 4DCKA 1QATA 1KSMA 4OCIA 2I94A 1SW8A 1XK4A 2I7AA 2OS8B 4FTGA 4ORAB 5HKYA 1BT6A 4AQIA 1TNPA 1MXLC 1EG3A 5GQQC 5JJGA 1XK4C 2KAYA 1FF1A 1A75A 3AKAA 2LMUA 2ZNDA 3OX5A 3EVVA 2MLFC 1LKJA 1YX7A 4YGDB 1KK8B 1QXPA 1M46A 1OE9B 1SCMC 1UHNA 2K7CA 4ZCUA 2BBNA 2KOTA 1Y0VH 2LMVA 3DVKA 1AP4A 4OVNF 5PALA 1K94A 3AKBA 1IKUA 1SKTA 4MZKA 4UPGA 2BE4A 3ZWHA 3DF0A 3TS5B 1UURA 1IWQA 2MRDA 1OMDA 1YX8A 3I5GB 3PALA 1JFJA 4HSZA 1DJGA 3LK1A 1S6IA 2WNDA 4YGCB 1JBAA 4MSPA 4NDCA 4YGEB 2LP3A 2I2RE 2OPOA 2Y4QA 4YI8A 1W7JB 2FOTA 5CSIA 3OB2B 2KNEA 1TCOB 2KBIA 1EH2A 1JF0A 3NSOA 2GV5A 2G9BA 1KQVA 1NCXA 4YRUA 1Q80A 2JXCA 1SYMA 2JXLA 4WQ3A 1RWYA 1L2OB 1SL9A 3DVEA 1Y1XA 2H61A 3JTDC 1LA3A 3BUMB 5HKZA 1B7TY 2M7NA 2OTGC 2LNKA 2M1UA 1WDCB 1F55A 2M1KB 1AHRA 2LUXA 4PE7A 5KU1A 1S1EA 5D7FA 1WRZA 2QACA 3CR5X 3BOWA 2F3YA 3BUXB 4GNKB 1K9UA 3CTNA 1KWOC 3F45A 5FYXA 2F8PA 4L9MA 1C07A 2PMYA 3D0YA 1YRUB 1CLLA 3I5IC 4HRGA 3IQQA 3KO0A 4CLNA 1IQ5A 1B8CA 1NWDA 1KK7Y 2HF5A 1TOPA 5IBWA 2JWWA 2LVVA 1K9KA 1MHOA 1OMRA 2SCPA 1DF0B 2KQYA 1HQVA 2M8UA 2R2IA 3SG7A 2JZIA 1CNPA 4PHJA 2HQWA 2PALA 3VRPA 2KQ6A 1CLMA 2KFFA 2P6BB 4BY4A 4M2QA 2O60A 1TNWA 5AERA 1UP5A 2BL0C 4MEWA 2LUCA 5J3XA 2CBLA 3NSIA 3BYAA 2HQ8A 2FCEA 1XA5A 3BUNB 2M97A 1QX5B 1F54A 1BF5A 1A4PA 1QLSA 2L2EA 3WXAA 1BOCA 2Y1NA 1M45A 1K93D 3CZTX 3IF7A 2ISDA 1LINA 1RECA 4CFQA 1XFYO 2L0PA 2LVIA 4GBAA 2M7LA 2KFHA 2NCOA 3O78A 3NSLA 2K2AA 4DIRA 1CDMA 2LHIA 1ALWA 4QJ5B 3CLNA 4NDBA 2LLSA 3SIBA 3A8RA 1CMGA 1G33A 2NZ0A 4P2YB 3PLFB 3BUOB 4MBEA 1QVIY 1F70A 1S6JA 1AJ4A 5DKNA 2M9GA 1DJZA 2MAZA 5ER4X 5G08A 2AAOA 1KQMC 1IJ6A 4AQJA 1A75B 1JUOA 2WCBA 1B4CA 3CS1A 5JOLA 2JTTA 1CB1A 3E3RA 1S5GY 3MSEB 1BMOA 2JT0A 4TNCA 2JT3A 2JNXA 1NPQA 1BU3A 5HLOA 4ORCB 4D1EA 3CR2A 1TN4A 1K8UA 1PSRA 2K61A 2BKIB 1SPYA 3VGOA 3PFVA 4DS7A 3I5FC 1B8LA 1SK6D 4MVFA 4N1FA 4MZLA 2L5XB 3DF0B 1M39A 2EC6C 2MHHA 4YGBB 1SL7A 4I5LB 3PN7B 4PHMA 2EHBA 1F4OA 5I2LA 3VROA 1EXRA 1NP8A 1YUSA 1JF2A 4QJ3B 1B1GA 2SASA 2JNFA 1SRAA 3EKJA 3OHMB 3VRRA 1YTZC 2LC5A 4DRWA 5DKQA 3TUYC 1NSHA 2BCBA 4IL1A 4PHKA 5TNCA 4C0LA 3QRXA 2K8MB 2WC8A 4ZCVA 5ER5A 1TNXA 1NIWA 1GGWA 5KSZA 1CM1A 3JTDB 5D69A 2CCMA 2OTGB 1ZOTB 4XYNA 1CLBA 1CM4A 2Y1MA 5I8NA 1CDNA 2KAXA 3OP0A
chains in the Genus database with same CATH superfamily
3BQ3A 2G2BA 3CR4X 1PSBA 2LANA 1JC2A 5CSNA 2COLB 3VRNA 1WLZA 1XFRA 1QWVA 2H8VA 1KFUS 1PALA 1QVIZ 4N1GA 4I5KA 2FJYA 1TCFA 1GQMA 3BOWB 1KFUL 3S0EA 3I5IB 2CNPA 1SL8A 3NHTA 4MLWA 4USLA 1CTRA 1TUJA 1DTLA 1K90D 3KHEA 1SR6B 1S5GZ 1NX3A 2WORA 3D0YB 3FWBA 1BODA 2Y5IA 1R6PA 1V1FA 1YR5A 3AAKA 2HPSA 2M3WA 3DD4A 2DOQA 4YI9A 1A03A 1QLKA 3KF9A 3WHUB 2KYFA 3NXAA 3R1VA 1BR1B 4M2PA 3TDIA 2TN4A 3EVUA 2Q91A 4PHNA 3JVTC 1YURA 2ZRTA 3TS5C 1S6CA 1UHIA 2JULA 1NCZA 1CFFA 3FWCA 2JU0A 1XO5A 2IS9A 3SJSA 3I5GC 4XJKA 2F2OA 1EJ3A 3CYZA 4CPVA 2KSPA 4JWQA 1WRKA 4JQ0D 3B86A 3GOFA 2WOSA 2BL0B 2LLUA 1CDLA 1QIVA 2KI4B 4FQTA 1XFXO 2WC5A 4MZJA 3KEVA 2ZKMX 3I5HB 1F71A 1B47A 1RROA 1TRFA 2F33A 4GGNA 4YGAA 1BJFA 3OX6A 1N65A 1UUSA 3PSRA 1SMGA 1E8AA 1MWNA 2QPTA 2BECA 3CZ0A 4HREE 1U5IA 1CFDA 1L2OC 4FQOA 1CFPA 3B87A 2LV7A 1K2HA 1NYAA 1IGVA 2BBMA 2KBMA 1RFJA 1WDCC 3IVTA 3C1VA 2JC2A 5CSFA 1C7VA 2P70A 2ZRSA 3LCPC 4WQ2A 4PE0A 5K89A 3SG5A 1GGZA 1VRKA 2LP2A 1QTXA 2PASA 1NCYA 4ETOA 3OBVA 2KAVA 1UHHA 1AUIB 5I2OA 1OZSA 1M31A 2AMIA 2CT9A 1KQMB 3D10A 3B6XA 2B1UA 1ODBA 5KTYA 4OKHA 1DVIA 2JOJA 3PATA 1J7OA 1J55A 1FI5A 1W7IB 3CWGA 2A4JA 3D73A 1YRTB 1NUBA 5HYDA 2O5GA 2PSRA 3VB1A 1LXFC 1J7RA 2ERBA 1AK8A 1M63B 1TTXA 1D1OA 1DJIA 2FJUB 3BXKA 3LL8B 3TDZA 3GK1A 1RJVA 3I5FB 4CIDA 4JD9A 1FPWA 3LLEA 2EC6B 1SY9A 2CXJA 2L50A 3SS4A 3TDUA 2NLNA 3HX4A 1KFXS 3NSKA 1AJ5A 2JPTA 1WLMA 4PALA 4ICBA 1KFXL 1SCMB 1X02A 1QX7A 1XFWO 4I5NB 1IIOA 1LVCD 3RM1A 2LVJA 3PM8A 2BCAA 2ZN8A 1PK0D 2L4HA 1FI6A 4IJ7A 4M2OA 1TUZA 2K7BA 1WY9A 2QDIA 2NCPA 3CABA 5F6TA 3SIAA 2BCXA 1K95A 2E6WA 3EG5B 3TUYB 2ZFDA 5DKRA 4CFRA 1QX2A 2KGBC 4OR9B 2JTZA 3RZSA 2WC6A 3FIAA 2AUCA 4GAOA 4PDZA 2LE9B 3CGAA 3KPXA 1MUXA 1IRJA 1Y1AA 1ZFSA 2BE6A 1N0YA 5HLVA 2M29A 1UHKA 1J7PA 1Y6WA 1A29A 2HETA 4GFTA 1IQ3A 3EK8A 3R1OA 1EL4A 1WRLA 1DJHA 1FBVA 1V1GA 2KDHA 2P71A 2WCMA 4ORBB 1JFKA 1IG5A 1RK9A 4U8DA 1J1DA 4YBHB 2KI6D 2LVKA 2F3ZA 3D78A 1J7QA 2V53A 1KSOA 1TNQA 1UWOA 3IQOA 2BAPA 3S0GA 4A4BA 2CTNA 4A4CA 2KGRA 2LM5A 3O4YA 1ZMZA 1DGUA 1TIZA 1DELA 5CPVA 1NX2A 2PYQA 3D77A 1K9PA 2OS8C 1RTP1 2PVBA 3GK2A 1KWOB 3LK0A 1MQ1A 3JVTB 3O2PA 5FI6A 1DMOA 2I18A 2LCPA 2M49B 1ZUZA 2VRGA 1PRWA 4I5JA 4QJ4B 3S0AA 1L7ZA 2ZNEA 1K96A 3FS7A 4F0ZB 5EL2A 2LMTA 1BR4B 1G4YR 3EK7A 3S0DA 2JT8A 4PT1A 4XJKB 1DC1A 1KK8C 3PN7C 2K7DA 5AANA 1GJYA 3D75A 1BLQA 5CSJA 1QIWA 2JQ6A 1YVHA 1XFZO 3D74A 3VRQA 1OZOA 2RGIA 3N7HA 2D8NA 3SG3A 1B8RA 1OOJA 1PVBA 2L5YA 1T14A 1IJ5A 1SBJA 4GPLB 2MBXA 3TZ1A 4PE4A 2JRFA 2KPHA 3V2LA 2PQLA 4C0JA 1YUUA 1QV0A 2GGMA 2E30A 5AXIA 2YGUA 1KCYA 2L51A 4OZDA 2Q4UA 1C3ZA 1DJXA 2KLDA 1NX1A 2GGZA 1U5IB 2JPOA 3S0FA 1S26D 3ICBA 1JSAA 2H61C 1DGVA 3BUWB 1PVAA 5DICA 1DJYA 1FW4A 1AVSA 1QASA 1MR8A 1QV1A 1XFUO 3OB1B 1F8HA 5BPJA 2LHLA 1OQPA 3WNXB 2MLEC 2WCJA 3DVJA 4GGFA 3BFHA 1CMFA 3BFBA 4MN0A 1LS8A 3EK4A 1SR6C 4GGFC 1SCVA 1A2XA 1QJTA 1YUTA 1ZACA 2WCLA 4MRXA 2WCEA 2L2CA 5HKWA 2MA2A 1YVLA 1OMVA 1HT9A 1XVJA 5AFPA 4NDDA 3WHTB 4AOMA 2KHNA 1S3PA 1XYDA 4R1EA 2K7OA 4PCWA 3R72A 1C7WA 3A4UB 3SG4A 1EG4A 2MJWB 4DUQA 4PE1A 1B9AA 4E68A 1H4BA 2M0RA 4OV2A 1CDPA 5I2QA 3AAJA 5D3OA 3CZ2A 1QS7A 3M0WA 1CFCA 3GK4X 2KI4C 1XFVO 1DF0A 3ZNIA 2EGDA 2BNXA 1SNLA 2NXQA 3I5HC 3L4LA 1ORGA 2K0JA 1S36A 5I94A 4GUKA 2L98A 1DT7B 1PULA 1H8BA 2QEVA 3SS3A 4JPZB 4MRYA 3SG2A 1OSAA 3EKHA 4NQGA 3K21A 2BKHB 5AEQA 1JWDA 1B7TZ 1MF8B 1CKKA 1ALVA 1DJWA 3HCMA 4HRHA 4C0KA 3O6BA 1J1EA 1MXEA 2H2KA 2KI6C 3EVRA 1G8IA 1Y1UA 2FCDA 1N2DA 1UHJA 2LAPA 2ZN9A 2LLTA 3CDNA 3RLZA 5HL1A 2K2FA 1BG1A 3H4SE 2F2PA 2KYCA 4P5OE 5B8IB 2L4IA 3SG6A 2KFGA 4BY5A 1F4QA 4Q04A 3BJHA 1R2UA 1NX0A 3DVMA 4WRIA 1KK7Z 2PRUA 3L47A 4N5XA 1LA0A 2WCFA 1IH0A 4DCKA 1QATA 1KSMA 4OCIA 2I94A 1SW8A 1XK4A 2I7AA 2OS8B 4JKTA 1Z2CB 4FTGA 4ORAB 5HKYA 3NGVA 1BT6A 3OGNA 1TNPA 1MXLC 4AQIA 1EG3A 1OW4A 5GQQC 5JJGA 1XK4C 3UNWA 4INWA 2KAYA 1FF1A 1A75A 3AKAA 2LMUA 2ZNDA 3OX5A 3EVVA 2MLFC 1LKJA 1YX7A 4YGDB 1KK8B 1QXPA 1M46A 1OE9B 1SCMC 1UHNA 2K7CA 5FI2A 4ZCUA 2BBNA 2KOTA 1Y0VH 2LMVA 3DVKA 1AP4A 4OVNF 5PALA 1K94A 3AKBA 1IKUA 1SKTA 4MZKA 4UPGA 2BE4A 3ZWHA 1DQEA 3DF0A 1UURA 3TS5B 1IWQA 2MRDA 1OMDA 1YX8A 3I5GB 3PALA 1JFJA 4HSZA 1DJGA 3LK1A 1SSEB 1S6IA 2WNDA 4YGCB 1JBAA 4MSPA 1P28A 1DEKA 4NDCA 1OOIX 4YGEB 1TWOA 2I2RE 2LP3A 2OPOA 2Y4QA 1W7JB 2FOTA 3O4XA 3OB2B 2KNEA 4YI8A 5CSIA 1TCOB 2GTEA 2KBIA 1EH2A 1JF0A 1OOFA 3NSOA 2GV5A 2G9BA 1KQVA 1NCXA 1C3YA 4YRUA 1Q80A 2JXCA 1SYMA 2JXLA 4WQ3A 3Q8IA 1RWYA 1L2OB 1SL9A 3DVEA 1Y1XA 3QMEA 4KYNA 2H61A 3BFAA 1LA3A 3BUMB 3JTDC 1B7TY 2M7NA 5HKZA 2OTGC 2LNKA 2M1UA 1WDCB 1F55A 2M1KB 1AHRA 2LUXA 4PE7A 5KU1A 1S1EA 5D7FA 1WRZA 2QACA 3CZ1A 3CR5X 3BOWA 3FE9A 2F3YA 3BUXB 4GNKB 1K9UA 3CTNA 1KWOC 3F45A 5FYXA 2F8PA 4L9MA 1C07A 2PMYA 3D0YA 1YRUB 1CLLA 3I5IC 4HRGA 3IQQA 3KO0A 4CLNA 1IQ5A 1B8CA 1NWDA 1KK7Y 2HF5A 3K1EA 1TOPA 5IBWA 2JWWA 2LVVA 1K9KA 2WCKA 1MHOA 1OMRA 2SCPA 1DF0B 2KQYA 1HQVA 2M8UA 2R2IA 3SG7A 4INXA 2JZIA 3SS5A 1CNPA 3B7AA 4PHJA 2HQWA 2PALA 3VRPA 2KQ6A 3D76A 1CLMA 2KFFA 2P6BB 4BY4A 4M2QA 2O60A 1TNWA 5AERA 1UP5A 3UO9A 2BL0C 4MEWA 2LUCA 5J3XA 1Z4HA 3NHIA 2CBLA 3NSIA 3BYAA 2HQ8A 2FCEA 1XA5A 3BUNB 2M97A 1QX5B 1F54A 1BF5A 1A4PA 1QLSA 2L2EA 3WXAA 1BOCA 2Y1NA 1M45A 1K93D 2K60A 3CZTX 3IF7A 2ISDA 1LINA 1RECA 4CFQA 1XFYO 2L0PA 3PJIA 2LVIA 4GBAA 2M7LA 2KFHA 2NCOA 3O78A 3NSLA 3PM2A 2K2AA 4DIRA 1CDMA 2LHIA 1ALWA 4QJ5B 3B88A 3CLNA 4NDBA 2LLSA 3DZTA 3SIBA 3A8RA 1CMGA 1G33A 1GM0A 3R1PA 2NZ0A 1W9ZA 4P2YB 3PLFB 1OOGA 3BUOB 4MBEA 5FI7A 1QVIY 1F70A 1S6JA 1AJ4A 5DKNA 2KLEA 2M9GA 1DJZA 2MAZA 5ER4X 3DXLA 5G08A 2AAOA 1KQMC 1IJ6A 4AQJA 1A75B 1JUOA 2WCBA 1B4CA 3CS1A 5JOLA 2JTTA 2WCHA 1CB1A 3E3RA 1S5GY 3MSEB 1BMOA 3L4AA 2JT0A 4TNCA 2JT3A 2JNXA 1NPQA 1BU3A 3DY9A 5HLOA 4ORCB 4D1EA 3CR2A 1TN4A 1K8UA 1PSRA 2K61A 2BKIB 1SPYA 3VGOA 3PFVA 4DS7A 3I5FC 1B8LA 1SK6D 4MVFA 4N1FA 4MZLA 2L5XB 3DF0B 1M39A 2EC6C 2MHHA 4YGBB 1SL7A 4I5LB 3PN7B 4PHMA 2EHBA 3DYEA 2QEBA 1F4OA 5I2LA 3VROA 4F7FA 3FE6A 1EXRA 1NP8A 1YUSA 3FE8A 1JF2A 4QJ3B 1B1GA 2SASA 2JNFA 1SRAA 3EKJA 3OHMB 3VRRA 1YTZC 2QEHA 2LC5A 1OOHA 5DKQA 3S0BA 4DRWA 3TUYC 1NSHA 2BCBA 4IL1A 4PHKA 5TNCA 4C0LA 3QRXA 2K8MB 2WC8A 4ZCVA 5ER5A 1TNXA 2QEOA 1NIWA 1GGWA 5KSZA 1CM1A 3JTDB 5D69A 2CCMA 2OTGB 1ZOTB 4XYNA 1CLBA 1CM4A 2Y1MA 5I8NA 1CDNA 2KAXA 3OP0A
chains in the Genus database with same CATH topology
3BQ3A 2G2BA 3CR4X 1PSBA 2LANA 1JC2A 5CSNA 2COLB 3VRNA 1WLZA 1KFUS 1PALA 1QVIZ 4N1GA 4I5KA 1TCFA 1GQMA 3BOWB 1KFUL 3I5IB 2CNPA 1SL8A 4MLWA 4USLA 1CTRA 1DTLA 1K90D 3KHEA 1SR6B 1S5GZ 1NX3A 2WORA 3D0YB 3FWBA 1BODA 2Y5IA 1R6PA 1V1FA 1YR5A 3AAKA 2HPSA 2M3WA 3DD4A 2DOQA 4YI9A 1A03A 1QLKA 3KF9A 3WHUB 2KYFA 3NXAA 1BR1B 4M2PA 3TDIA 2TN4A 3EVUA 2Q91A 4PHNA 3JVTC 1YURA 2ZRTA 3TS5C 1S6CA 1UHIA 2JULA 1NCZA 1CFFA 3FWCA 2JU0A 1XO5A 2IS9A 3SJSA 3I5GC 4XJKA 2F2OA 1EJ3A 4CPVA 2KSPA 4JWQA 1WRKA 4JQ0D 3GOFA 2WOSA 2BL0B 2LLUA 1CDLA 1QIVA 2KI4B 4MZJA 1XFXO 3KEVA 2ZKMX 3I5HB 1F71A 1B47A 1RROA 1TRFA 2F33A 4GGNA 4YGAA 1BJFA 3OX6A 1N65A 1UUSA 3PSRA 1SMGA 1E8AA 1MWNA 2QPTA 2BECA 4HREE 1U5IA 1CFDA 1L2OC 4FQOA 1CFPA 2LV7A 1K2HA 2BBMA 1NYAA 1IGVA 2KBMA 1RFJA 1WDCC 3C1VA 2JC2A 5CSFA 1C7VA 2ZRSA 3LCPC 4WQ2A 4PE0A 5K89A 3SG5A 1GGZA 1VRKA 2LP2A 1QTXA 2PASA 1NCYA 4ETOA 2KAVA 1UHHA 1AUIB 5I2OA 1OZSA 1M31A 2AMIA 2CT9A 1KQMB 3D10A 2B1UA 1ODBA 5KTYA 4OKHA 1DVIA 2JOJA 3PATA 1J7OA 1J55A 1FI5A 1W7IB 3CWGA 2A4JA 1YRTB 1NUBA 5HYDA 2O5GA 2PSRA 1LXFC 1J7RA 1AK8A 1M63B 1TTXA 1D1OA 1DJIA 2FJUB 3BXKA 3LL8B 3TDZA 3GK1A 1RJVA 3I5FB 4CIDA 1FPWA 3LLEA 2EC6B 1SY9A 2CXJA 2L50A 3TDUA 2NLNA 3HX4A 1KFXS 3NSKA 1AJ5A 2JPTA 1WLMA 4PALA 4ICBA 1KFXL 1SCMB 1X02A 1QX7A 1XFWO 4I5NB 1LVCD 3RM1A 2LVJA 3PM8A 2BCAA 2ZN8A 1PK0D 2L4HA 1FI6A 4M2OA 2K7BA 1WY9A 3SIAA 2NCPA 5F6TA 2BCXA 1K95A 2E6WA 3TUYB 2ZFDA 5DKRA 4CFRA 1QX2A 2KGBC 4OR9B 2JTZA 3FIAA 2AUCA 4GAOA 4PDZA 2LE9B 3CGAA 3KPXA 1MUXA 1IRJA 1Y1AA 1ZFSA 2BE6A 1N0YA 5HLVA 2M29A 1UHKA 1J7PA 1Y6WA 1A29A 2HETA 4GFTA 1IQ3A 3EK8A 1EL4A 1WRLA 1DJHA 1FBVA 1V1GA 2KDHA 4ORBB 1JFKA 1IG5A 1RK9A 4U8DA 1J1DA 4YBHB 2KI6D 2LVKA 2F3ZA 1J7QA 2V53A 1KSOA 1TNQA 1UWOA 3IQOA 4A4BA 2CTNA 4A4CA 2KGRA 2LM5A 3O4YA 1ZMZA 1DGUA 1TIZA 5CPVA 1NX2A 1K9PA 2OS8C 1RTP1 2PVBA 3GK2A 1KWOB 3LK0A 1MQ1A 3JVTB 3O2PA 1DMOA 2I18A 2LCPA 2M49B 1ZUZA 2VRGA 1PRWA 4I5JA 4QJ4B 1L7ZA 2ZNEA 1K96A 3FS7A 4F0ZB 2LMTA 1BR4B 1G4YR 3EK7A 2JT8A 4XJKB 1KK8C 3PN7C 2K7DA 5AANA 1GJYA 1BLQA 5CSJA 1QIWA 2JQ6A 1YVHA 1XFZO 3VRQA 1OZOA 2RGIA 2D8NA 3SG3A 1B8RA 1OOJA 1PVBA 1IJ5A 1SBJA 4GPLB 2MBXA 3TZ1A 4PE4A 2JRFA 4C0JA 1YUUA 1QV0A 2GGMA 2E30A 5AXIA 1KCYA 2L51A 2Q4UA 1DJXA 1NX1A 2GGZA 1U5IB 1S26D 3ICBA 1JSAA 2H61C 1DGVA 3BUWB 1PVAA 1DJYA 1FW4A 1AVSA 1QASA 1MR8A 1QV1A 1XFUO 3OB1B 1F8HA 5BPJA 2LHLA 1OQPA 3WNXB 2MLEC 3DVJA 4GGFA 1CMFA 4MN0A 3EK4A 1SR6C 4GGFC 1SCVA 1A2XA 1QJTA 1YUTA 1ZACA 4MRXA 2WCEA 5HKWA 2MA2A 1YVLA 1OMVA 1HT9A 1XVJA 5AFPA 4NDDA 3WHTB 4AOMA 2KHNA 1S3PA 1XYDA 4R1EA 2K7OA 4PCWA 1C7WA 3A4UB 3SG4A 1EG4A 2MJWB 4DUQA 4PE1A 1B9AA 4E68A 1H4BA 2M0RA 4OV2A 1CDPA 5I2QA 3AAJA 1QS7A 3M0WA 1CFCA 3GK4X 2KI4C 1XFVO 1DF0A 3ZNIA 2EGDA 1SNLA 2NXQA 3I5HC 2K0JA 1S36A 1DT7B 4GUKA 2L98A 1PULA 1H8BA 4JPZB 4MRYA 3SG2A 1OSAA 3EKHA 4NQGA 3K21A 2BKHB 5AEQA 1JWDA 1B7TZ 1MF8B 1CKKA 1ALVA 1DJWA 3HCMA 4HRHA 4C0KA 3O6BA 1J1EA 1MXEA 2H2KA 2KI6C 3EVRA 1G8IA 1Y1UA 2FCDA 1N2DA 1UHJA 2LAPA 2ZN9A 2LLTA 3RLZA 2K2FA 1BG1A 3H4SE 2F2PA 2KYCA 4P5OE 5B8IB 2L4IA 3SG6A 2KFGA 4BY5A 1F4QA 4Q04A 1R2UA 1NX0A 3DVMA 4WRIA 1KK7Z 2PRUA 4N5XA 1LA0A 2WCFA 1IH0A 4DCKA 1QATA 1KSMA 4OCIA 2I94A 1SW8A 1XK4A 2I7AA 2OS8B 4FTGA 4ORAB 5HKYA 1BT6A 4AQIA 1TNPA 1MXLC 1EG3A 5GQQC 5JJGA 1XK4C 2KAYA 1FF1A 1A75A 3AKAA 2LMUA 2ZNDA 3OX5A 3EVVA 2MLFC 1LKJA 1YX7A 4YGDB 1KK8B 1QXPA 1M46A 1OE9B 1SCMC 1UHNA 2K7CA 4ZCUA 2BBNA 2KOTA 1Y0VH 2LMVA 3DVKA 1AP4A 4OVNF 5PALA 1K94A 3AKBA 1IKUA 1SKTA 4MZKA 4UPGA 2BE4A 3ZWHA 3DF0A 3TS5B 1UURA 1IWQA 2MRDA 1OMDA 1YX8A 3I5GB 3PALA 1JFJA 4HSZA 1DJGA 3LK1A 1S6IA 2WNDA 4YGCB 1JBAA 4MSPA 4NDCA 4YGEB 2LP3A 2I2RE 2OPOA 2Y4QA 4YI8A 1W7JB 2FOTA 5CSIA 3OB2B 2KNEA 1TCOB 2KBIA 1EH2A 1JF0A 3NSOA 2GV5A 2G9BA 1KQVA 1NCXA 4YRUA 1Q80A 2JXCA 1SYMA 2JXLA 4WQ3A 1RWYA 1L2OB 1SL9A 3DVEA 1Y1XA 2H61A 3JTDC 1LA3A 3BUMB 5HKZA 1B7TY 2M7NA 2OTGC 2LNKA 2M1UA 1WDCB 1F55A 2M1KB 1AHRA 2LUXA 4PE7A 5KU1A 1S1EA 5D7FA 1WRZA 2QACA 3CR5X 3BOWA 2F3YA 3BUXB 4GNKB 1K9UA 3CTNA 1KWOC 3F45A 5FYXA 2F8PA 4L9MA 1C07A 2PMYA 3D0YA 1YRUB 1CLLA 3I5IC 4HRGA 3IQQA 3KO0A 4CLNA 1IQ5A 1B8CA 1NWDA 1KK7Y 2HF5A 1TOPA 5IBWA 2JWWA 2LVVA 1K9KA 1MHOA 1OMRA 2SCPA 1DF0B 2KQYA 1HQVA 2M8UA 2R2IA 3SG7A 2JZIA 1CNPA 4PHJA 2HQWA 2PALA 3VRPA 2KQ6A 1CLMA 2KFFA 2P6BB 4BY4A 4M2QA 2O60A 1TNWA 5AERA 1UP5A 2BL0C 4MEWA 2LUCA 5J3XA 2CBLA 3NSIA 3BYAA 2HQ8A 2FCEA 1XA5A 3BUNB 2M97A 1QX5B 1F54A 1BF5A 1A4PA 1QLSA 2L2EA 3WXAA 1BOCA 2Y1NA 1M45A 1K93D 3CZTX 3IF7A 2ISDA 1LINA 1RECA 4CFQA 1XFYO 2L0PA 2LVIA 4GBAA 2M7LA 2KFHA 2NCOA 3O78A 3NSLA 2K2AA 4DIRA 1CDMA 2LHIA 1ALWA 4QJ5B 3CLNA 4NDBA 2LLSA 3SIBA 3A8RA 1CMGA 1G33A 2NZ0A 4P2YB 3PLFB 3BUOB 4MBEA 1QVIY 1F70A 1S6JA 1AJ4A 5DKNA 2M9GA 1DJZA 2MAZA 5ER4X 5G08A 2AAOA 1KQMC 1IJ6A 4AQJA 1A75B 1JUOA 2WCBA 1B4CA 3CS1A 5JOLA 2JTTA 1CB1A 3E3RA 1S5GY 3MSEB 1BMOA 2JT0A 4TNCA 2JT3A 2JNXA 1NPQA 1BU3A 5HLOA 4ORCB 4D1EA 3CR2A 1TN4A 1K8UA 1PSRA 2K61A 2BKIB 1SPYA 3VGOA 3PFVA 4DS7A 3I5FC 1B8LA 1SK6D 4MVFA 4N1FA 4MZLA 2L5XB 3DF0B 1M39A 2EC6C 2MHHA 4YGBB 1SL7A 4I5LB 3PN7B 4PHMA 2EHBA 1F4OA 5I2LA 3VROA 1EXRA 1NP8A 1YUSA 1JF2A 4QJ3B 1B1GA 2SASA 2JNFA 1SRAA 3EKJA 3OHMB 3VRRA 1YTZC 2LC5A 4DRWA 5DKQA 3TUYC 1NSHA 2BCBA 4IL1A 4PHKA 5TNCA 4C0LA 3QRXA 2K8MB 2WC8A 4ZCVA 5ER5A 1TNXA 1NIWA 1GGWA 5KSZA 1CM1A 3JTDB 5D69A 2CCMA 2OTGB 1ZOTB 4XYNA 1CLBA 1CM4A 2Y1MA 5I8NA 1CDNA 2KAXA 3OP0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BQ3 A;  2G2B A;  3CR4 X;  1PSB A;  2LAN A;  1JC2 A;  5CSN A;  2COL B;  3VRN A;  1WLZ A;  1KFU S;  1PAL A;  1QVI Z;  4N1G A;  4I5K A;  1TCF A;  1GQM A;  3BOW B;  1KFU L;  3I5I B;  2CNP A;  1SL8 A;  4MLW A;  4USL A;  1CTR A;  1DTL A;  1K90 D;  3KHE A;  1SR6 B;  1S5G Z;  1NX3 A;  2WOR A;  3D0Y B;  3FWB A;  1BOD A;  2Y5I A;  1R6P A;  1V1F A;  1YR5 A;  3AAK A;  2HPS A;  2M3W A;  3DD4 A;  2DOQ A;  4YI9 A;  1A03 A;  1QLK A;  3KF9 A;  3WHU B;  2KYF A;  3NXA A;  1BR1 B;  4M2P A;  3TDI A;  2TN4 A;  3EVU A;  2Q91 A;  4PHN A;  3JVT C;  1YUR A;  2ZRT A;  3TS5 C;  1S6C A;  1UHI A;  2JUL A;  1NCZ A;  1CFF A;  3FWC A;  2JU0 A;  1XO5 A;  2IS9 A;  3SJS A;  3I5G C;  4XJK A;  2F2O A;  1EJ3 A;  4CPV A;  2KSP A;  4JWQ A;  1WRK A;  4JQ0 D;  3GOF A;  2WOS A;  2BL0 B;  2LLU A;  1CDL A;  1QIV A;  2KI4 B;  4MZJ A;  1XFX O;  3KEV A;  2ZKM X;  3I5H B;  1F71 A;  1B47 A;  1RRO A;  1TRF A;  2F33 A;  4GGN A;  4YGA A;  1BJF A;  3OX6 A;  1N65 A;  1UUS A;  3PSR A;  1SMG A;  1E8A A;  1MWN A;  2QPT A;  2BEC A;  4HRE E;  1U5I A;  1CFD A;  1L2O C;  4FQO A;  1CFP A;  2LV7 A;  1K2H A;  2BBM A;  1NYA A;  1IGV A;  2KBM A;  1RFJ A;  1WDC C;  3C1V A;  2JC2 A;  5CSF A;  1C7V A;  2ZRS A;  3LCP C;  4WQ2 A;  4PE0 A;  5K89 A;  3SG5 A;  1GGZ A;  1VRK A;  2LP2 A;  1QTX A;  2PAS A;  1NCY A;  4ETO A;  2KAV A;  1UHH A;  1AUI B;  5I2O A;  1OZS A;  1M31 A;  2AMI A;  2CT9 A;  1KQM B;  3D10 A;  2B1U A;  1ODB A;  5KTY A;  4OKH A;  1DVI A;  2JOJ A;  3PAT A;  1J7O A;  1J55 A;  1FI5 A;  1W7I B;  3CWG A;  2A4J A;  1YRT B;  1NUB A;  5HYD A;  2O5G A;  2PSR A;  1LXF C;  1J7R A;  1AK8 A;  1M63 B;  1TTX A;  1D1O A;  1DJI A;  2FJU B;  3BXK A;  3LL8 B;  3TDZ A;  3GK1 A;  1RJV A;  3I5F B;  4CID A;  1FPW A;  3LLE A;  2EC6 B;  1SY9 A;  2CXJ A;  2L50 A;  3TDU A;  2NLN A;  3HX4 A;  1KFX S;  3NSK A;  1AJ5 A;  2JPT A;  1WLM A;  4PAL A;  4ICB A;  1KFX L;  1SCM B;  1X02 A;  1QX7 A;  1XFW O;  4I5N B;  1LVC D;  3RM1 A;  2LVJ A;  3PM8 A;  2BCA A;  2ZN8 A;  1PK0 D;  2L4H A;  1FI6 A;  4M2O A;  2K7B A;  1WY9 A;  3SIA A;  2NCP A;  5F6T A;  2BCX A;  1K95 A;  2E6W A;  3TUY B;  2ZFD A;  5DKR A;  4CFR A;  1QX2 A;  2KGB C;  4OR9 B;  2JTZ A;  3FIA A;  2AUC A;  4GAO A;  4PDZ A;  2LE9 B;  3CGA A;  3KPX A;  1MUX A;  1IRJ A;  1Y1A A;  1ZFS A;  2BE6 A;  1N0Y A;  5HLV A;  2M29 A;  1UHK A;  1J7P A;  1Y6W A;  1A29 A;  2HET A;  4GFT A;  1IQ3 A;  3EK8 A;  1EL4 A;  1WRL A;  1DJH A;  1FBV A;  1V1G A;  2KDH A;  4ORB B;  1JFK A;  1IG5 A;  1RK9 A;  4U8D A;  1J1D A;  4YBH B;  2KI6 D;  2LVK A;  2F3Z A;  1J7Q A;  2V53 A;  1KSO A;  1TNQ A;  1UWO A;  3IQO A;  4A4B A;  2CTN A;  4A4C A;  2KGR A;  2LM5 A;  3O4Y A;  1ZMZ A;  1DGU A;  1TIZ A;  5CPV A;  1NX2 A;  1K9P A;  2OS8 C;  1RTP 1;  2PVB A;  3GK2 A;  1KWO B;  3LK0 A;  1MQ1 A;  3JVT B;  3O2P A;  1DMO A;  2I18 A;  2LCP A;  2M49 B;  1ZUZ A;  2VRG A;  1PRW A;  4I5J A;  4QJ4 B;  1L7Z A;  2ZNE A;  1K96 A;  3FS7 A;  4F0Z B;  2LMT A;  1BR4 B;  1G4Y R;  3EK7 A;  2JT8 A;  4XJK B;  1KK8 C;  3PN7 C;  2K7D A;  5AAN A;  1GJY A;  1BLQ A;  5CSJ A;  1QIW A;  2JQ6 A;  1YVH A;  1XFZ O;  3VRQ A;  1OZO A;  2RGI A;  2D8N A;  3SG3 A;  1B8R A;  1OOJ A;  1PVB A;  1IJ5 A;  1SBJ A;  4GPL B;  2MBX A;  3TZ1 A;  4PE4 A;  2JRF A;  4C0J A;  1YUU A;  1QV0 A;  2GGM A;  2E30 A;  5AXI A;  1KCY A;  2L51 A;  2Q4U A;  1DJX A;  1NX1 A;  2GGZ A;  1U5I B;  1S26 D;  3ICB A;  1JSA A;  2H61 C;  1DGV A;  3BUW B;  1PVA A;  1DJY A;  1FW4 A;  1AVS A;  1QAS A;  1MR8 A;  1QV1 A;  1XFU O;  3OB1 B;  1F8H A;  5BPJ A;  2LHL A;  1OQP A;  3WNX B;  2MLE C;  3DVJ A;  4GGF A;  1CMF A;  4MN0 A;  3EK4 A;  1SR6 C;  4GGF C;  1SCV A;  1A2X A;  1QJT A;  1YUT A;  1ZAC A;  4MRX A;  2WCE A;  5HKW A;  2MA2 A;  1YVL A;  1OMV A;  1HT9 A;  1XVJ A;  5AFP A;  4NDD A;  3WHT B;  4AOM A;  2KHN A;  1S3P A;  1XYD A;  4R1E A;  2K7O A;  4PCW A;  1C7W A;  3A4U B;  3SG4 A;  1EG4 A;  2MJW B;  4DUQ A;  4PE1 A;  1B9A A;  4E68 A;  1H4B A;  2M0R A;  4OV2 A;  1CDP A;  5I2Q A;  3AAJ A;  1QS7 A;  3M0W A;  1CFC A;  3GK4 X;  2KI4 C;  1XFV O;  1DF0 A;  3ZNI A;  2EGD A;  1SNL A;  2NXQ A;  3I5H C;  2K0J A;  1S36 A;  1DT7 B;  4GUK A;  2L98 A;  1PUL A;  1H8B A;  4JPZ B;  4MRY A;  3SG2 A;  1OSA A;  3EKH A;  4NQG A;  3K21 A;  2BKH B;  5AEQ A;  1JWD A;  1B7T Z;  1MF8 B;  1CKK A;  1ALV A;  1DJW A;  3HCM A;  4HRH A;  4C0K A;  3O6B A;  1J1E A;  1MXE A;  2H2K A;  2KI6 C;  3EVR A;  1G8I A;  1Y1U A;  2FCD A;  1N2D A;  1UHJ A;  2LAP A;  2ZN9 A;  2LLT A;  3RLZ A;  2K2F A;  1BG1 A;  3H4S E;  2F2P A;  2KYC A;  4P5O E;  5B8I B;  2L4I A;  3SG6 A;  2KFG A;  4BY5 A;  1F4Q A;  4Q04 A;  1R2U A;  1NX0 A;  3DVM A;  4WRI A;  1KK7 Z;  2PRU A;  4N5X A;  1LA0 A;  2WCF A;  1IH0 A;  4DCK A;  1QAT A;  1KSM A;  4OCI A;  2I94 A;  1SW8 A;  1XK4 A;  2I7A A;  2OS8 B;  4FTG A;  4ORA B;  5HKY A;  1BT6 A;  4AQI A;  1TNP A;  1MXL C;  1EG3 A;  5GQQ C;  5JJG A;  1XK4 C;  2KAY A;  1FF1 A;  1A75 A;  3AKA A;  2LMU A;  2ZND A;  3OX5 A;  3EVV A;  2MLF C;  1LKJ A;  1YX7 A;  4YGD B;  1KK8 B;  1QXP A;  1M46 A;  1OE9 B;  1SCM C;  1UHN A;  2K7C A;  4ZCU A;  2BBN A;  2KOT A;  1Y0V H;  2LMV A;  3DVK A;  1AP4 A;  4OVN F;  5PAL A;  1K94 A;  3AKB A;  1IKU A;  1SKT A;  4MZK A;  4UPG A;  2BE4 A;  3ZWH A;  3DF0 A;  3TS5 B;  1UUR A;  1IWQ A;  2MRD A;  1OMD A;  1YX8 A;  3I5G B;  3PAL A;  1JFJ A;  4HSZ A;  1DJG A;  3LK1 A;  1S6I A;  2WND A;  4YGC B;  1JBA A;  4MSP A;  4NDC A;  4YGE B;  2LP3 A;  2I2R E;  2OPO A;  2Y4Q A;  4YI8 A;  1W7J B;  2FOT A;  5CSI A;  3OB2 B;  2KNE A;  1TCO B;  2KBI A;  1EH2 A;  1JF0 A;  3NSO A;  2GV5 A;  2G9B A;  1KQV A;  1NCX A;  4YRU A;  1Q80 A;  2JXC A;  1SYM A;  2JXL A;  4WQ3 A;  1RWY A;  1L2O B;  1SL9 A;  3DVE A;  1Y1X A;  2H61 A;  3JTD C;  1LA3 A;  3BUM B;  5HKZ A;  1B7T Y;  2M7N A;  2OTG C;  2LNK A;  2M1U A;  1WDC B;  1F55 A;  2M1K B;  1AHR A;  2LUX A;  4PE7 A;  5KU1 A;  1S1E A;  5D7F A;  1WRZ A;  2QAC A;  3CR5 X;  3BOW A;  2F3Y A;  3BUX B;  4GNK B;  1K9U A;  3CTN A;  1KWO C;  3F45 A;  5FYX A;  2F8P A;  4L9M A;  1C07 A;  2PMY A;  3D0Y A;  1YRU B;  1CLL A;  3I5I C;  4HRG A;  3IQQ A;  3KO0 A;  4CLN A;  1IQ5 A;  1B8C A;  1NWD A;  1KK7 Y;  2HF5 A;  1TOP A;  5IBW A;  2JWW A;  2LVV A;  1K9K A;  1MHO A;  1OMR A;  2SCP A;  1DF0 B;  2KQY A;  1HQV A;  2M8U A;  2R2I A;  3SG7 A;  2JZI A;  1CNP A;  4PHJ A;  2HQW A;  2PAL A;  3VRP A;  2KQ6 A;  1CLM A;  2KFF A;  2P6B B;  4BY4 A;  4M2Q A;  2O60 A;  1TNW A;  5AER A;  1UP5 A;  2BL0 C;  4MEW A;  2LUC A;  5J3X A;  2CBL A;  3NSI A;  3BYA A;  2HQ8 A;  2FCE A;  1XA5 A;  3BUN B;  2M97 A;  1QX5 B;  1F54 A;  1BF5 A;  1A4P A;  1QLS A;  2L2E A;  3WXA A;  1BOC A;  2Y1N A;  1M45 A;  1K93 D;  3CZT X;  3IF7 A;  2ISD A;  1LIN A;  1REC A;  4CFQ A;  1XFY O;  2L0P A;  2LVI A;  4GBA A;  2M7L A;  2KFH A;  2NCO A;  3O78 A;  3NSL A;  2K2A A;  4DIR A;  1CDM A;  2LHI A;  1ALW A;  4QJ5 B;  3CLN A;  4NDB A;  2LLS A;  3SIB A;  3A8R A;  1CMG A;  1G33 A;  2NZ0 A;  4P2Y B;  3PLF B;  3BUO B;  4MBE A;  1QVI Y;  1F70 A;  1S6J A;  1AJ4 A;  5DKN A;  2M9G A;  1DJZ A;  2MAZ A;  5ER4 X;  5G08 A;  2AAO A;  1KQM C;  1IJ6 A;  4AQJ A;  1A75 B;  1JUO A;  2WCB A;  1B4C A;  3CS1 A;  5JOL A;  2JTT A;  1CB1 A;  3E3R A;  1S5G Y;  3MSE B;  1BMO A;  2JT0 A;  4TNC A;  2JT3 A;  2JNX A;  1NPQ A;  1BU3 A;  5HLO A;  4ORC B;  4D1E A;  3CR2 A;  1TN4 A;  1K8U A;  1PSR A;  2K61 A;  2BKI B;  1SPY A;  3VGO A;  3PFV A;  4DS7 A;  3I5F C;  1B8L A;  1SK6 D;  4MVF A;  4N1F A;  4MZL A;  2L5X B;  3DF0 B;  1M39 A;  2EC6 C;  2MHH A;  4YGB B;  1SL7 A;  4I5L B;  3PN7 B;  4PHM A;  2EHB A;  1F4O A;  5I2L A;  3VRO A;  1EXR A;  1NP8 A;  1YUS A;  1JF2 A;  4QJ3 B;  1B1G A;  2SAS A;  2JNF A;  1SRA A;  3EKJ A;  3OHM B;  3VRR A;  1YTZ C;  2LC5 A;  4DRW A;  5DKQ A;  3TUY C;  1NSH A;  2BCB A;  4IL1 A;  4PHK A;  5TNC A;  4C0L A;  3QRX A;  2K8M B;  2WC8 A;  4ZCV A;  5ER5 A;  1TNX A;  1NIW A;  1GGW A;  5KSZ A;  1CM1 A;  3JTD B;  5D69 A;  2CCM A;  2OTG B;  1ZOT B;  4XYN A;  1CLB A;  1CM4 A;  2Y1M A;  5I8N A;  1CDN A;  2KAX A;  3OP0 A; 
#chains in the Genus database with same CATH topology
 3BQ3 A;  2G2B A;  3CR4 X;  1PSB A;  2LAN A;  1JC2 A;  5CSN A;  2COL B;  3VRN A;  1WLZ A;  1XFR A;  1QWV A;  2H8V A;  1KFU S;  1PAL A;  1QVI Z;  4N1G A;  4I5K A;  2FJY A;  1TCF A;  1GQM A;  3BOW B;  1KFU L;  3S0E A;  3I5I B;  2CNP A;  1SL8 A;  3NHT A;  4MLW A;  4USL A;  1CTR A;  1TUJ A;  1DTL A;  1K90 D;  3KHE A;  1SR6 B;  1S5G Z;  1NX3 A;  2WOR A;  3D0Y B;  3FWB A;  1BOD A;  2Y5I A;  1R6P A;  1V1F A;  1YR5 A;  3AAK A;  2HPS A;  2M3W A;  3DD4 A;  2DOQ A;  4YI9 A;  1A03 A;  1QLK A;  3KF9 A;  3WHU B;  2KYF A;  3NXA A;  3R1V A;  1BR1 B;  4M2P A;  3TDI A;  2TN4 A;  3EVU A;  2Q91 A;  4PHN A;  3JVT C;  1YUR A;  2ZRT A;  3TS5 C;  1S6C A;  1UHI A;  2JUL A;  1NCZ A;  1CFF A;  3FWC A;  2JU0 A;  1XO5 A;  2IS9 A;  3SJS A;  3I5G C;  4XJK A;  2F2O A;  1EJ3 A;  3CYZ A;  4CPV A;  2KSP A;  4JWQ A;  1WRK A;  4JQ0 D;  3B86 A;  3GOF A;  2WOS A;  2BL0 B;  2LLU A;  1CDL A;  1QIV A;  2KI4 B;  4FQT A;  1XFX O;  2WC5 A;  4MZJ A;  3KEV A;  2ZKM X;  3I5H B;  1F71 A;  1B47 A;  1RRO A;  1TRF A;  2F33 A;  4GGN A;  4YGA A;  1BJF A;  3OX6 A;  1N65 A;  1UUS A;  3PSR A;  1SMG A;  1E8A A;  1MWN A;  2QPT A;  2BEC A;  3CZ0 A;  4HRE E;  1U5I A;  1CFD A;  1L2O C;  4FQO A;  1CFP A;  3B87 A;  2LV7 A;  1K2H A;  1NYA A;  1IGV A;  2BBM A;  2KBM A;  1RFJ A;  1WDC C;  3IVT A;  3C1V A;  2JC2 A;  5CSF A;  1C7V A;  2P70 A;  2ZRS A;  3LCP C;  4WQ2 A;  4PE0 A;  5K89 A;  3SG5 A;  1GGZ A;  1VRK A;  2LP2 A;  1QTX A;  2PAS A;  1NCY A;  4ETO A;  3OBV A;  2KAV A;  1UHH A;  1AUI B;  5I2O A;  1OZS A;  1M31 A;  2AMI A;  2CT9 A;  1KQM B;  3D10 A;  3B6X A;  2B1U A;  1ODB A;  5KTY A;  4OKH A;  1DVI A;  2JOJ A;  3PAT A;  1J7O A;  1J55 A;  1FI5 A;  1W7I B;  3CWG A;  2A4J A;  3D73 A;  1YRT B;  1NUB A;  5HYD A;  2O5G A;  2PSR A;  3VB1 A;  1LXF C;  1J7R A;  2ERB A;  1AK8 A;  1M63 B;  1TTX A;  1D1O A;  1DJI A;  2FJU B;  3BXK A;  3LL8 B;  3TDZ A;  3GK1 A;  1RJV A;  3I5F B;  4CID A;  4JD9 A;  1FPW A;  3LLE A;  2EC6 B;  1SY9 A;  2CXJ A;  2L50 A;  3SS4 A;  3TDU A;  2NLN A;  3HX4 A;  1KFX S;  3NSK A;  1AJ5 A;  2JPT A;  1WLM A;  4PAL A;  4ICB A;  1KFX L;  1SCM B;  1X02 A;  1QX7 A;  1XFW O;  4I5N B;  1IIO A;  1LVC D;  3RM1 A;  2LVJ A;  3PM8 A;  2BCA A;  2ZN8 A;  1PK0 D;  2L4H A;  1FI6 A;  4IJ7 A;  4M2O A;  1TUZ A;  2K7B A;  1WY9 A;  2QDI A;  2NCP A;  3CAB A;  5F6T A;  3SIA A;  2BCX A;  1K95 A;  2E6W A;  3EG5 B;  3TUY B;  2ZFD A;  5DKR A;  4CFR A;  1QX2 A;  2KGB C;  4OR9 B;  2JTZ A;  3RZS A;  2WC6 A;  3FIA A;  2AUC A;  4GAO A;  4PDZ A;  2LE9 B;  3CGA A;  3KPX A;  1MUX A;  1IRJ A;  1Y1A A;  1ZFS A;  2BE6 A;  1N0Y A;  5HLV A;  2M29 A;  1UHK A;  1J7P A;  1Y6W A;  1A29 A;  2HET A;  4GFT A;  1IQ3 A;  3EK8 A;  3R1O A;  1EL4 A;  1WRL A;  1DJH A;  1FBV A;  1V1G A;  2KDH A;  2P71 A;  2WCM A;  4ORB B;  1JFK A;  1IG5 A;  1RK9 A;  4U8D A;  1J1D A;  4YBH B;  2KI6 D;  2LVK A;  2F3Z A;  3D78 A;  1J7Q A;  2V53 A;  1KSO A;  1TNQ A;  1UWO A;  3IQO A;  2BAP A;  3S0G A;  4A4B A;  2CTN A;  4A4C A;  2KGR A;  2LM5 A;  3O4Y A;  1ZMZ A;  1DGU A;  1TIZ A;  1DEL A;  5CPV A;  1NX2 A;  2PYQ A;  3D77 A;  1K9P A;  2OS8 C;  1RTP 1;  2PVB A;  3GK2 A;  1KWO B;  3LK0 A;  1MQ1 A;  3JVT B;  3O2P A;  5FI6 A;  1DMO A;  2I18 A;  2LCP A;  2M49 B;  1ZUZ A;  2VRG A;  1PRW A;  4I5J A;  4QJ4 B;  3S0A A;  1L7Z A;  2ZNE A;  1K96 A;  3FS7 A;  4F0Z B;  5EL2 A;  2LMT A;  1BR4 B;  1G4Y R;  3EK7 A;  3S0D A;  2JT8 A;  4PT1 A;  4XJK B;  1DC1 A;  1KK8 C;  3PN7 C;  2K7D A;  5AAN A;  1GJY A;  3D75 A;  1BLQ A;  5CSJ A;  1QIW A;  2JQ6 A;  1YVH A;  1XFZ O;  3D74 A;  3VRQ A;  1OZO A;  2RGI A;  3N7H A;  2D8N A;  3SG3 A;  1B8R A;  1OOJ A;  1PVB A;  2L5Y A;  1T14 A;  1IJ5 A;  1SBJ A;  4GPL B;  2MBX A;  3TZ1 A;  4PE4 A;  2JRF A;  2KPH A;  3V2L A;  2PQL A;  4C0J A;  1YUU A;  1QV0 A;  2GGM A;  2E30 A;  5AXI A;  2YGU A;  1KCY A;  2L51 A;  4OZD A;  2Q4U A;  1C3Z A;  1DJX A;  2KLD A;  1NX1 A;  2GGZ A;  1U5I B;  2JPO A;  3S0F A;  1S26 D;  3ICB A;  1JSA A;  2H61 C;  1DGV A;  3BUW B;  1PVA A;  5DIC A;  1DJY A;  1FW4 A;  1AVS A;  1QAS A;  1MR8 A;  1QV1 A;  1XFU O;  3OB1 B;  1F8H A;  5BPJ A;  2LHL A;  1OQP A;  3WNX B;  2MLE C;  2WCJ A;  3DVJ A;  4GGF A;  3BFH A;  1CMF A;  3BFB A;  4MN0 A;  1LS8 A;  3EK4 A;  1SR6 C;  4GGF C;  1SCV A;  1A2X A;  1QJT A;  1YUT A;  1ZAC A;  2WCL A;  4MRX A;  2WCE A;  2L2C A;  5HKW A;  2MA2 A;  1YVL A;  1OMV A;  1HT9 A;  1XVJ A;  5AFP A;  4NDD A;  3WHT B;  4AOM A;  2KHN A;  1S3P A;  1XYD A;  4R1E A;  2K7O A;  4PCW A;  3R72 A;  1C7W A;  3A4U B;  3SG4 A;  1EG4 A;  2MJW B;  4DUQ A;  4PE1 A;  1B9A A;  4E68 A;  1H4B A;  2M0R A;  4OV2 A;  1CDP A;  5I2Q A;  3AAJ A;  5D3O A;  3CZ2 A;  1QS7 A;  3M0W A;  1CFC A;  3GK4 X;  2KI4 C;  1XFV O;  1DF0 A;  3ZNI A;  2EGD A;  2BNX A;  1SNL A;  2NXQ A;  3I5H C;  3L4L A;  1ORG A;  2K0J A;  1S36 A;  5I94 A;  4GUK A;  2L98 A;  1DT7 B;  1PUL A;  1H8B A;  2QEV A;  3SS3 A;  4JPZ B;  4MRY A;  3SG2 A;  1OSA A;  3EKH A;  4NQG A;  3K21 A;  2BKH B;  5AEQ A;  1JWD A;  1B7T Z;  1MF8 B;  1CKK A;  1ALV A;  1DJW A;  3HCM A;  4HRH A;  4C0K A;  3O6B A;  1J1E A;  1MXE A;  2H2K A;  2KI6 C;  3EVR A;  1G8I A;  1Y1U A;  2FCD A;  1N2D A;  1UHJ A;  2LAP A;  2ZN9 A;  2LLT A;  3CDN A;  3RLZ A;  5HL1 A;  2K2F A;  1BG1 A;  3H4S E;  2F2P A;  2KYC A;  4P5O E;  5B8I B;  2L4I A;  3SG6 A;  2KFG A;  4BY5 A;  1F4Q A;  4Q04 A;  3BJH A;  1R2U A;  1NX0 A;  3DVM A;  4WRI A;  1KK7 Z;  2PRU A;  3L47 A;  4N5X A;  1LA0 A;  2WCF A;  1IH0 A;  4DCK A;  1QAT A;  1KSM A;  4OCI A;  2I94 A;  1SW8 A;  1XK4 A;  2I7A A;  2OS8 B;  4JKT A;  1Z2C B;  4FTG A;  4ORA B;  5HKY A;  3NGV A;  1BT6 A;  3OGN A;  1TNP A;  1MXL C;  4AQI A;  1EG3 A;  1OW4 A;  5GQQ C;  5JJG A;  1XK4 C;  3UNW A;  4INW A;  2KAY A;  1FF1 A;  1A75 A;  3AKA A;  2LMU A;  2ZND A;  3OX5 A;  3EVV A;  2MLF C;  1LKJ A;  1YX7 A;  4YGD B;  1KK8 B;  1QXP A;  1M46 A;  1OE9 B;  1SCM C;  1UHN A;  2K7C A;  5FI2 A;  4ZCU A;  2BBN A;  2KOT A;  1Y0V H;  2LMV A;  3DVK A;  1AP4 A;  4OVN F;  5PAL A;  1K94 A;  3AKB A;  1IKU A;  1SKT A;  4MZK A;  4UPG A;  2BE4 A;  3ZWH A;  1DQE A;  3DF0 A;  1UUR A;  3TS5 B;  1IWQ A;  2MRD A;  1OMD A;  1YX8 A;  3I5G B;  3PAL A;  1JFJ A;  4HSZ A;  1DJG A;  3LK1 A;  1SSE B;  1S6I A;  2WND A;  4YGC B;  1JBA A;  4MSP A;  1P28 A;  1DEK A;  4NDC A;  1OOI X;  4YGE B;  1TWO A;  2I2R E;  2LP3 A;  2OPO A;  2Y4Q A;  1W7J B;  2FOT A;  3O4X A;  3OB2 B;  2KNE A;  4YI8 A;  5CSI A;  1TCO B;  2GTE A;  2KBI A;  1EH2 A;  1JF0 A;  1OOF A;  3NSO A;  2GV5 A;  2G9B A;  1KQV A;  1NCX A;  1C3Y A;  4YRU A;  1Q80 A;  2JXC A;  1SYM A;  2JXL A;  4WQ3 A;  3Q8I A;  1RWY A;  1L2O B;  1SL9 A;  3DVE A;  1Y1X A;  3QME A;  4KYN A;  2H61 A;  3BFA A;  1LA3 A;  3BUM B;  3JTD C;  1B7T Y;  2M7N A;  5HKZ A;  2OTG C;  2LNK A;  2M1U A;  1WDC B;  1F55 A;  2M1K B;  1AHR A;  2LUX A;  4PE7 A;  5KU1 A;  1S1E A;  5D7F A;  1WRZ A;  2QAC A;  3CZ1 A;  3CR5 X;  3BOW A;  3FE9 A;  2F3Y A;  3BUX B;  4GNK B;  1K9U A;  3CTN A;  1KWO C;  3F45 A;  5FYX A;  2F8P A;  4L9M A;  1C07 A;  2PMY A;  3D0Y A;  1YRU B;  1CLL A;  3I5I C;  4HRG A;  3IQQ A;  3KO0 A;  4CLN A;  1IQ5 A;  1B8C A;  1NWD A;  1KK7 Y;  2HF5 A;  3K1E A;  1TOP A;  5IBW A;  2JWW A;  2LVV A;  1K9K A;  2WCK A;  1MHO A;  1OMR A;  2SCP A;  1DF0 B;  2KQY A;  1HQV A;  2M8U A;  2R2I A;  3SG7 A;  4INX A;  2JZI A;  3SS5 A;  1CNP A;  3B7A A;  4PHJ A;  2HQW A;  2PAL A;  3VRP A;  2KQ6 A;  3D76 A;  1CLM A;  2KFF A;  2P6B B;  4BY4 A;  4M2Q A;  2O60 A;  1TNW A;  5AER A;  1UP5 A;  3UO9 A;  2BL0 C;  4MEW A;  2LUC A;  5J3X A;  1Z4H A;  3NHI A;  2CBL A;  3NSI A;  3BYA A;  2HQ8 A;  2FCE A;  1XA5 A;  3BUN B;  2M97 A;  1QX5 B;  1F54 A;  1BF5 A;  1A4P A;  1QLS A;  2L2E A;  3WXA A;  1BOC A;  2Y1N A;  1M45 A;  1K93 D;  2K60 A;  3CZT X;  3IF7 A;  2ISD A;  1LIN A;  1REC A;  4CFQ A;  1XFY O;  2L0P A;  3PJI A;  2LVI A;  4GBA A;  2M7L A;  2KFH A;  2NCO A;  3O78 A;  3NSL A;  3PM2 A;  2K2A A;  4DIR A;  1CDM A;  2LHI A;  1ALW A;  4QJ5 B;  3B88 A;  3CLN A;  4NDB A;  2LLS A;  3DZT A;  3SIB A;  3A8R A;  1CMG A;  1G33 A;  1GM0 A;  3R1P A;  2NZ0 A;  1W9Z A;  4P2Y B;  3PLF B;  1OOG A;  3BUO B;  4MBE A;  5FI7 A;  1QVI Y;  1F70 A;  1S6J A;  1AJ4 A;  5DKN A;  2KLE A;  2M9G A;  1DJZ A;  2MAZ A;  5ER4 X;  3DXL A;  5G08 A;  2AAO A;  1KQM C;  1IJ6 A;  4AQJ A;  1A75 B;  1JUO A;  2WCB A;  1B4C A;  3CS1 A;  5JOL A;  2JTT A;  2WCH A;  1CB1 A;  3E3R A;  1S5G Y;  3MSE B;  1BMO A;  3L4A A;  2JT0 A;  4TNC A;  2JT3 A;  2JNX A;  1NPQ A;  1BU3 A;  3DY9 A;  5HLO A;  4ORC B;  4D1E A;  3CR2 A;  1TN4 A;  1K8U A;  1PSR A;  2K61 A;  2BKI B;  1SPY A;  3VGO A;  3PFV A;  4DS7 A;  3I5F C;  1B8L A;  1SK6 D;  4MVF A;  4N1F A;  4MZL A;  2L5X B;  3DF0 B;  1M39 A;  2EC6 C;  2MHH A;  4YGB B;  1SL7 A;  4I5L B;  3PN7 B;  4PHM A;  2EHB A;  3DYE A;  2QEB A;  1F4O A;  5I2L A;  3VRO A;  4F7F A;  3FE6 A;  1EXR A;  1NP8 A;  1YUS A;  3FE8 A;  1JF2 A;  4QJ3 B;  1B1G A;  2SAS A;  2JNF A;  1SRA A;  3EKJ A;  3OHM B;  3VRR A;  1YTZ C;  2QEH A;  2LC5 A;  1OOH A;  5DKQ A;  3S0B A;  4DRW A;  3TUY C;  1NSH A;  2BCB A;  4IL1 A;  4PHK A;  5TNC A;  4C0L A;  3QRX A;  2K8M B;  2WC8 A;  4ZCV A;  5ER5 A;  1TNX A;  2QEO A;  1NIW A;  1GGW A;  5KSZ A;  1CM1 A;  3JTD B;  5D69 A;  2CCM A;  2OTG B;  1ZOT B;  4XYN A;  1CLB A;  1CM4 A;  2Y1M A;  5I8N A;  1CDN A;  2KAX A;  3OP0 A; 
#chains in the Genus database with same CATH homology
 3BQ3 A;  2G2B A;  3CR4 X;  1PSB A;  2LAN A;  1JC2 A;  5CSN A;  2COL B;  3VRN A;  1WLZ A;  1KFU S;  1PAL A;  1QVI Z;  4N1G A;  4I5K A;  1TCF A;  1GQM A;  3BOW B;  1KFU L;  3I5I B;  2CNP A;  1SL8 A;  4MLW A;  4USL A;  1CTR A;  1DTL A;  1K90 D;  3KHE A;  1SR6 B;  1S5G Z;  1NX3 A;  2WOR A;  3D0Y B;  3FWB A;  1BOD A;  2Y5I A;  1R6P A;  1V1F A;  1YR5 A;  3AAK A;  2HPS A;  2M3W A;  3DD4 A;  2DOQ A;  4YI9 A;  1A03 A;  1QLK A;  3KF9 A;  3WHU B;  2KYF A;  3NXA A;  1BR1 B;  4M2P A;  3TDI A;  2TN4 A;  3EVU A;  2Q91 A;  4PHN A;  3JVT C;  1YUR A;  2ZRT A;  3TS5 C;  1S6C A;  1UHI A;  2JUL A;  1NCZ A;  1CFF A;  3FWC A;  2JU0 A;  1XO5 A;  2IS9 A;  3SJS A;  3I5G C;  4XJK A;  2F2O A;  1EJ3 A;  4CPV A;  2KSP A;  4JWQ A;  1WRK A;  4JQ0 D;  3GOF A;  2WOS A;  2BL0 B;  2LLU A;  1CDL A;  1QIV A;  2KI4 B;  4MZJ A;  1XFX O;  3KEV A;  2ZKM X;  3I5H B;  1F71 A;  1B47 A;  1RRO A;  1TRF A;  2F33 A;  4GGN A;  4YGA A;  1BJF A;  3OX6 A;  1N65 A;  1UUS A;  3PSR A;  1SMG A;  1E8A A;  1MWN A;  2QPT A;  2BEC A;  4HRE E;  1U5I A;  1CFD A;  1L2O C;  4FQO A;  1CFP A;  2LV7 A;  1K2H A;  2BBM A;  1NYA A;  1IGV A;  2KBM A;  1RFJ A;  1WDC C;  3C1V A;  2JC2 A;  5CSF A;  1C7V A;  2ZRS A;  3LCP C;  4WQ2 A;  4PE0 A;  5K89 A;  3SG5 A;  1GGZ A;  1VRK A;  2LP2 A;  1QTX A;  2PAS A;  1NCY A;  4ETO A;  2KAV A;  1UHH A;  1AUI B;  5I2O A;  1OZS A;  1M31 A;  2AMI A;  2CT9 A;  1KQM B;  3D10 A;  2B1U A;  1ODB A;  5KTY A;  4OKH A;  1DVI A;  2JOJ A;  3PAT A;  1J7O A;  1J55 A;  1FI5 A;  1W7I B;  3CWG A;  2A4J A;  1YRT B;  1NUB A;  5HYD A;  2O5G A;  2PSR A;  1LXF C;  1J7R A;  1AK8 A;  1M63 B;  1TTX A;  1D1O A;  1DJI A;  2FJU B;  3BXK A;  3LL8 B;  3TDZ A;  3GK1 A;  1RJV A;  3I5F B;  4CID A;  1FPW A;  3LLE A;  2EC6 B;  1SY9 A;  2CXJ A;  2L50 A;  3TDU A;  2NLN A;  3HX4 A;  1KFX S;  3NSK A;  1AJ5 A;  2JPT A;  1WLM A;  4PAL A;  4ICB A;  1KFX L;  1SCM B;  1X02 A;  1QX7 A;  1XFW O;  4I5N B;  1LVC D;  3RM1 A;  2LVJ A;  3PM8 A;  2BCA A;  2ZN8 A;  1PK0 D;  2L4H A;  1FI6 A;  4M2O A;  2K7B A;  1WY9 A;  3SIA A;  2NCP A;  5F6T A;  2BCX A;  1K95 A;  2E6W A;  3TUY B;  2ZFD A;  5DKR A;  4CFR A;  1QX2 A;  2KGB C;  4OR9 B;  2JTZ A;  3FIA A;  2AUC A;  4GAO A;  4PDZ A;  2LE9 B;  3CGA A;  3KPX A;  1MUX A;  1IRJ A;  1Y1A A;  1ZFS A;  2BE6 A;  1N0Y A;  5HLV A;  2M29 A;  1UHK A;  1J7P A;  1Y6W A;  1A29 A;  2HET A;  4GFT A;  1IQ3 A;  3EK8 A;  1EL4 A;  1WRL A;  1DJH A;  1FBV A;  1V1G A;  2KDH A;  4ORB B;  1JFK A;  1IG5 A;  1RK9 A;  4U8D A;  1J1D A;  4YBH B;  2KI6 D;  2LVK A;  2F3Z A;  1J7Q A;  2V53 A;  1KSO A;  1TNQ A;  1UWO A;  3IQO A;  4A4B A;  2CTN A;  4A4C A;  2KGR A;  2LM5 A;  3O4Y A;  1ZMZ A;  1DGU A;  1TIZ A;  5CPV A;  1NX2 A;  1K9P A;  2OS8 C;  1RTP 1;  2PVB A;  3GK2 A;  1KWO B;  3LK0 A;  1MQ1 A;  3JVT B;  3O2P A;  1DMO A;  2I18 A;  2LCP A;  2M49 B;  1ZUZ A;  2VRG A;  1PRW A;  4I5J A;  4QJ4 B;  1L7Z A;  2ZNE A;  1K96 A;  3FS7 A;  4F0Z B;  2LMT A;  1BR4 B;  1G4Y R;  3EK7 A;  2JT8 A;  4XJK B;  1KK8 C;  3PN7 C;  2K7D A;  5AAN A;  1GJY A;  1BLQ A;  5CSJ A;  1QIW A;  2JQ6 A;  1YVH A;  1XFZ O;  3VRQ A;  1OZO A;  2RGI A;  2D8N A;  3SG3 A;  1B8R A;  1OOJ A;  1PVB A;  1IJ5 A;  1SBJ A;  4GPL B;  2MBX A;  3TZ1 A;  4PE4 A;  2JRF A;  4C0J A;  1YUU A;  1QV0 A;  2GGM A;  2E30 A;  5AXI A;  1KCY A;  2L51 A;  2Q4U A;  1DJX A;  1NX1 A;  2GGZ A;  1U5I B;  1S26 D;  3ICB A;  1JSA A;  2H61 C;  1DGV A;  3BUW B;  1PVA A;  1DJY A;  1FW4 A;  1AVS A;  1QAS A;  1MR8 A;  1QV1 A;  1XFU O;  3OB1 B;  1F8H A;  5BPJ A;  2LHL A;  1OQP A;  3WNX B;  2MLE C;  3DVJ A;  4GGF A;  1CMF A;  4MN0 A;  3EK4 A;  1SR6 C;  4GGF C;  1SCV A;  1A2X A;  1QJT A;  1YUT A;  1ZAC A;  4MRX A;  2WCE A;  5HKW A;  2MA2 A;  1YVL A;  1OMV A;  1HT9 A;  1XVJ A;  5AFP A;  4NDD A;  3WHT B;  4AOM A;  2KHN A;  1S3P A;  1XYD A;  4R1E A;  2K7O A;  4PCW A;  1C7W A;  3A4U B;  3SG4 A;  1EG4 A;  2MJW B;  4DUQ A;  4PE1 A;  1B9A A;  4E68 A;  1H4B A;  2M0R A;  4OV2 A;  1CDP A;  5I2Q A;  3AAJ A;  1QS7 A;  3M0W A;  1CFC A;  3GK4 X;  2KI4 C;  1XFV O;  1DF0 A;  3ZNI A;  2EGD A;  1SNL A;  2NXQ A;  3I5H C;  2K0J A;  1S36 A;  1DT7 B;  4GUK A;  2L98 A;  1PUL A;  1H8B A;  4JPZ B;  4MRY A;  3SG2 A;  1OSA A;  3EKH A;  4NQG A;  3K21 A;  2BKH B;  5AEQ A;  1JWD A;  1B7T Z;  1MF8 B;  1CKK A;  1ALV A;  1DJW A;  3HCM A;  4HRH A;  4C0K A;  3O6B A;  1J1E A;  1MXE A;  2H2K A;  2KI6 C;  3EVR A;  1G8I A;  1Y1U A;  2FCD A;  1N2D A;  1UHJ A;  2LAP A;  2ZN9 A;  2LLT A;  3RLZ A;  2K2F A;  1BG1 A;  3H4S E;  2F2P A;  2KYC A;  4P5O E;  5B8I B;  2L4I A;  3SG6 A;  2KFG A;  4BY5 A;  1F4Q A;  4Q04 A;  1R2U A;  1NX0 A;  3DVM A;  4WRI A;  1KK7 Z;  2PRU A;  4N5X A;  1LA0 A;  2WCF A;  1IH0 A;  4DCK A;  1QAT A;  1KSM A;  4OCI A;  2I94 A;  1SW8 A;  1XK4 A;  2I7A A;  2OS8 B;  4FTG A;  4ORA B;  5HKY A;  1BT6 A;  4AQI A;  1TNP A;  1MXL C;  1EG3 A;  5GQQ C;  5JJG A;  1XK4 C;  2KAY A;  1FF1 A;  1A75 A;  3AKA A;  2LMU A;  2ZND A;  3OX5 A;  3EVV A;  2MLF C;  1LKJ A;  1YX7 A;  4YGD B;  1KK8 B;  1QXP A;  1M46 A;  1OE9 B;  1SCM C;  1UHN A;  2K7C A;  4ZCU A;  2BBN A;  2KOT A;  1Y0V H;  2LMV A;  3DVK A;  1AP4 A;  4OVN F;  5PAL A;  1K94 A;  3AKB A;  1IKU A;  1SKT A;  4MZK A;  4UPG A;  2BE4 A;  3ZWH A;  3DF0 A;  3TS5 B;  1UUR A;  1IWQ A;  2MRD A;  1OMD A;  1YX8 A;  3I5G B;  3PAL A;  1JFJ A;  4HSZ A;  1DJG A;  3LK1 A;  1S6I A;  2WND A;  4YGC B;  1JBA A;  4MSP A;  4NDC A;  4YGE B;  2LP3 A;  2I2R E;  2OPO A;  2Y4Q A;  4YI8 A;  1W7J B;  2FOT A;  5CSI A;  3OB2 B;  2KNE A;  1TCO B;  2KBI A;  1EH2 A;  1JF0 A;  3NSO A;  2GV5 A;  2G9B A;  1KQV A;  1NCX A;  4YRU A;  1Q80 A;  2JXC A;  1SYM A;  2JXL A;  4WQ3 A;  1RWY A;  1L2O B;  1SL9 A;  3DVE A;  1Y1X A;  2H61 A;  3JTD C;  1LA3 A;  3BUM B;  5HKZ A;  1B7T Y;  2M7N A;  2OTG C;  2LNK A;  2M1U A;  1WDC B;  1F55 A;  2M1K B;  1AHR A;  2LUX A;  4PE7 A;  5KU1 A;  1S1E A;  5D7F A;  1WRZ A;  2QAC A;  3CR5 X;  3BOW A;  2F3Y A;  3BUX B;  4GNK B;  1K9U A;  3CTN A;  1KWO C;  3F45 A;  5FYX A;  2F8P A;  4L9M A;  1C07 A;  2PMY A;  3D0Y A;  1YRU B;  1CLL A;  3I5I C;  4HRG A;  3IQQ A;  3KO0 A;  4CLN A;  1IQ5 A;  1B8C A;  1NWD A;  1KK7 Y;  2HF5 A;  1TOP A;  5IBW A;  2JWW A;  2LVV A;  1K9K A;  1MHO A;  1OMR A;  2SCP A;  1DF0 B;  2KQY A;  1HQV A;  2M8U A;  2R2I A;  3SG7 A;  2JZI A;  1CNP A;  4PHJ A;  2HQW A;  2PAL A;  3VRP A;  2KQ6 A;  1CLM A;  2KFF A;  2P6B B;  4BY4 A;  4M2Q A;  2O60 A;  1TNW A;  5AER A;  1UP5 A;  2BL0 C;  4MEW A;  2LUC A;  5J3X A;  2CBL A;  3NSI A;  3BYA A;  2HQ8 A;  2FCE A;  1XA5 A;  3BUN B;  2M97 A;  1QX5 B;  1F54 A;  1BF5 A;  1A4P A;  1QLS A;  2L2E A;  3WXA A;  1BOC A;  2Y1N A;  1M45 A;  1K93 D;  3CZT X;  3IF7 A;  2ISD A;  1LIN A;  1REC A;  4CFQ A;  1XFY O;  2L0P A;  2LVI A;  4GBA A;  2M7L A;  2KFH A;  2NCO A;  3O78 A;  3NSL A;  2K2A A;  4DIR A;  1CDM A;  2LHI A;  1ALW A;  4QJ5 B;  3CLN A;  4NDB A;  2LLS A;  3SIB A;  3A8R A;  1CMG A;  1G33 A;  2NZ0 A;  4P2Y B;  3PLF B;  3BUO B;  4MBE A;  1QVI Y;  1F70 A;  1S6J A;  1AJ4 A;  5DKN A;  2M9G A;  1DJZ A;  2MAZ A;  5ER4 X;  5G08 A;  2AAO A;  1KQM C;  1IJ6 A;  4AQJ A;  1A75 B;  1JUO A;  2WCB A;  1B4C A;  3CS1 A;  5JOL A;  2JTT A;  1CB1 A;  3E3R A;  1S5G Y;  3MSE B;  1BMO A;  2JT0 A;  4TNC A;  2JT3 A;  2JNX A;  1NPQ A;  1BU3 A;  5HLO A;  4ORC B;  4D1E A;  3CR2 A;  1TN4 A;  1K8U A;  1PSR A;  2K61 A;  2BKI B;  1SPY A;  3VGO A;  3PFV A;  4DS7 A;  3I5F C;  1B8L A;  1SK6 D;  4MVF A;  4N1F A;  4MZL A;  2L5X B;  3DF0 B;  1M39 A;  2EC6 C;  2MHH A;  4YGB B;  1SL7 A;  4I5L B;  3PN7 B;  4PHM A;  2EHB A;  1F4O A;  5I2L A;  3VRO A;  1EXR A;  1NP8 A;  1YUS A;  1JF2 A;  4QJ3 B;  1B1G A;  2SAS A;  2JNF A;  1SRA A;  3EKJ A;  3OHM B;  3VRR A;  1YTZ C;  2LC5 A;  4DRW A;  5DKQ A;  3TUY C;  1NSH A;  2BCB A;  4IL1 A;  4PHK A;  5TNC A;  4C0L A;  3QRX A;  2K8M B;  2WC8 A;  4ZCV A;  5ER5 A;  1TNX A;  1NIW A;  1GGW A;  5KSZ A;  1CM1 A;  3JTD B;  5D69 A;  2CCM A;  2OTG B;  1ZOT B;  4XYN A;  1CLB A;  1CM4 A;  2Y1M A;  5I8N A;  1CDN A;  2KAX A;  3OP0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...