4IJ7A

Crystal structure of odorant binding protein 48 from anopheles gambiae (agamobp48) with peg
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
172
structure length
172
Chain Sequence
GDNPCAAGPPVDTNPAECCPKPMLVDGTIMMDCYKKYGEQTKKQLQMDGIPRGCCIAECAMNATNMYADGMLKRDDLSKMFMDAVKDKPEWMSLVRDATNACFELAEKKMDEIEAGAKLEPSFEGEKICHPISGTILRCMGMMMFAQCPASVFNVNENCNKLREYGSICPMI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Odorant binding protein-8
publication title Crystal and Solution Studies of the "Plus-C" Odorant-binding Protein 48 from Anopheles gambiae: CONTROL OF BINDING SPECIFICITY THROUGH THREE-DIMENSIONAL DOMAIN SWAPPING.
pubmed doi rcsb
source organism Anopheles gambiae
molecule tags Transport protein
total genus 52
structure length 172
sequence length 172
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.270 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Recoverin; domain 1 4ij7A00
4KYNA 4IJ7A 3PM2A
chains in the Genus database with same CATH superfamily
3BXKA 1S6JA 2KYCA 2JZIA 1K9KA 1NCXA 1NPQA 1MXLC 1A75B 1UHHA 5K89A 1F4OA 2KQYA 1GGZA 5KTYA 1CTRA 1K9UA 1GM0A 1KQMB 2A4JA 2M9GA 1MQ1A 4AOMA 1Y0VH 2JT8A 3TZ1A 2JRFA 2VRGA 4ORAB 1JBAA 1G4YR 2K2AA 2ZNDA 1C3ZA 1JF0A 2JOJA 2JT0A 2BE4A 4XJKB 1B9AA 2CBLA 2E30A 3BUNB 2PASA 2KSPA 2EC6B 3BYAA 2JT3A 2H61C 4XYNA 1W9ZA 1DJWA 1LVCD 2KI6D 1RTP1 3DD4A 3R72A 4NQGA 3S0EA 2LMUA 2E6WA 4U8DA 5HLOA 1JFJA 4TNCA 3O4XA 1V1FA 2NXQA 2BCXA 2Y4QA 2NCOA 4I5NB 3WHUB 1M63B 2M29A 1YRUB 1PSBA 4PE4A 2I7AA 2LVKA 3LLEA 1J1DA 2I94A 3DVJA 3PALA 1XFYO 2BBNA 1IGVA 2OS8B 3AAKA 2OTGB 3NHTA 1DMOA 4QJ5B 1J55A 1WDCB 1XFRA 4MZKA 3GK2A 1A03A 3LK0A 1SBJA 1Y1AA 5I94A 2YGUA 3BOWB 1F8HA 3CZ2A 4PHKA 4CFRA 3I5IC 1KK8B 1CLLA 1YX8A 1BODA 2M1UA 1BU3A 2FOTA 1SCMB 2F8PA 1OOGA 3DXLA 3CZTX 1IJ5A 2RGIA 3EKHA 1KFXL 1K93D 4PCWA 2JC2A 1LKJA 4CLNA 1LA0A 2FCDA 5CSIA 2CTNA 1CFCA 1K90D 1OOJA 1JC2A 5HYDA 3TDUA 3V2LA 5HL1A 1X02A 4C0KA 1UURA 2K7OA 1FBVA 1B7TZ 1J7RA 4AQIA 2JQ6A 5DKQA 1YTZC 2AMIA 2L5XB 3CR5X 1LA3A 2EHBA 1YUSA 2IS9A 2JNXA 1GGWA 1CDLA 3IVTA 1CKKA 2WCJA 2WOSA 2I2RE 4MVFA 1N65A 1B7TY 4Q04A 1EXRA 2ZRTA 1K2HA 5EL2A 1OMDA 2K8MB 1RFJA 3SG5A 4M2QA 3BQ3A 3O2PA 3PSRA 3TUYB 2MJWB 1CFDA 2KI4C 4OR9B 1DF0A 2FCEA 3FS7A 2SASA 2PRUA 2P6BB 3SIBA 3ZNIA 3B6XA 2ZFDA 5AXIA 2LAPA 2GGMA 3CDNA 1DJIA 1HQVA 4ZCVA 2JWWA 2M97A 3FE8A 1BT6A 1TNXA 1S26D 1EJ3A 2G2BA 3D78A 3DVEA 3VRQA 1BG1A 4M2OA 2D8NA 3I5HC 4DRWA 1CLBA 1A2XA 3QRXA 3CZ1A 1B8LA 1BR1B 1Q80A 4PHNA 2L4IA 1AP4A 1SSEB 5AANA 5BPJA 1Y1XA 1SMGA 3CWGA 4ICBA 1PVBA 4DUQA 1PSRA 1EG4A 2MLEC 4PHJA 1S5GY 4A4BA 1YVHA 3CR2A 3GOFA 3JVTB 1OOFA 1IQ5A 1NX3A 1BOCA 3M0WA 1BR4B 2LHIA 1K8UA 1AK8A 1WY9A 2GTEA 2JTZA 4FQTA 2BKHB 4L9MA 1WLZA 3DF0A 3HCMA 5PALA 3FWBA 2WCKA 3E3RA 1H8BA 2L2EA 2TN4A 1YX7A 1EL4A 3RM1A 4CPVA 2NLNA 1IJ6A 4NDDA 2WCMA 1PRWA 2LP3A 3DF0B 4FTGA 3L4LA 4UPGA 2FJUB 5B8IB 2WCBA 1MF8B 3TS5C 1A75A 2K2FA 2O60A 3D77A 5ER4X 1CMFA 1CMGA 4MN0A 3CGAA 2LLUA 1DEKA 1QV1A 1W7JB 1F4QA 1SKTA 4OV2A 4MLWA 2PQLA 3JTDC 2L98A 4GPLB 3S0AA 2JU0A 2WORA 1WRLA 2ZRSA 2P70A 3I5GC 3EG5B 5J3XA 2HETA 2KDHA 3K21A 4XJKA 4DCKA 3CR4X 3K1EA 1SPYA 4GNKB 3PLFB 1NUBA 1TNQA 2HQWA 3QMEA 2M0RA 1NSHA 1QXPA 5HKWA 2K7CA 4N1FA 2CXJA 2L0PA 3WXAA 4C0JA 2LLTA 3HX4A 2WC5A 3LCPC 1ORGA 1B8CA 2Y1MA 5GQQC 1MWNA 1XK4A 1M39A 1AJ5A 2F2PA 2GV5A 2KGBC 5AERA 3BUXB 1KFUL 1WRZA 2JNFA 2ZN8A 3I5FC 2M7LA 1ALWA 1QVIY 4PE0A 1XA5A 1LXFC 2AAOA 3FIAA 2ZN9A 2JPOA 3I5IB 3D0YB 5CPVA 2KHNA 1XFVO 2LNKA 1J1EA 1RROA 4D1EA 1AVSA 3BOWA 2GGZA 2MHHA 4ETOA 2V53A 5D3OA 3WHTB 2LUXA 1B8RA 4WRIA 2R2IA 3LL8B 1QS7A 4QJ4B 1L7ZA 1NWDA 1CM4A 4R1EA 5HKZA 2Y5IA 1CFFA 1KQMC 4DIRA 1QATA 1SNLA 1Z2CB 1A29A 1TRFA 2LUCA 1QLKA 2HF5A 1S6CA 2KAYA 1ZACA 4ORCB 1MR8A 2LVVA 3AAJA 5G08A 1SK6D 2BAPA 1ODBA 2KBIA 4MZLA 3SS4A 1WLMA 1UUSA 1MHOA 1TOPA 2LHLA 1T14A 3GK4X 2WCFA 1CNPA 1S1EA 2H2KA 1UHKA 3B7AA 1NCYA 1MUXA 1OSAA 1WRKA 4PALA 1J7QA 1F55A 3EK4A 3EVRA 1KCYA 3NSIA 1Y6WA 3BUWB 3NHIA 4INXA 1V1GA 3NSOA 3VB1A 2MRDA 3SG6A 1C7VA 1JUOA 2G9BA 2QACA 2ZKMX 2M1KB 1QJTA 1RWYA 4HSZA 1NX2A 4YRUA 1CFPA 2KQ6A 2BBMA 3EKJA 5D69A 1C07A 1KFUS 3CYZA 5DKRA 2OTGC 4F7FA 1YUTA 2L5YA 1N0YA 3DVMA 2B1UA 1U5IB 1EH2A 4CFQA 4JD9A 1N2DA 3BFAA 3FE6A 2BNXA 3PN7B 5FYXA 1SL9A 3BUOB 2Q91A 3PM2A 5DKNA 2L4HA 2WCHA 1P28A 2KPHA 1TUJA 1K96A 2Q4UA 2KI6C 1H4BA 2LLSA 4FQOA 1R6PA 2F33A 2CNPA 5HLVA 4F0ZB 3FE9A 3EVVA 1XVJA 2KBMA 2JTTA 5CSFA 2LC5A 1BJFA 1KWOC 2WCLA 1QV0A 2PALA 1S5GZ 3S0GA 1SW8A 3OHMB 1B4CA 1DQEA 4GGFA 3OX6A 5D7FA 3OP0A 1IQ3A 4YI8A 1KFXS 1Y1UA 2K7BA 1C7WA 2BKIB 2QPTA 1ZFSA 4YGEB 1ZMZA 1KSOA 4YGAA 3SG4A 1BMOA 1YVLA 4ZCUA 2WCEA 3N7HA 2COLB 1W7IB 4I5JA 4MRXA 1QASA 3A4UB 1DJHA 1XYDA 5CSNA 4I5KA 2KLEA 1SL7A 5DICA 4GUKA 1OMRA 3D74A 2NZ0A 3O4YA 3R1OA 4C0LA 4YBHB 1GQMA 1S6IA 2ZNEA 3TUYC 1UHNA 2KOTA 4IJ7A 3NGVA 3S0DA 2KYFA 3ZWHA 4JWQA 3OB1B 4QJ3B 3KEVA 1BLQA 2JXCA 1B47A 1M46A 1PULA 1ZOTB 2ERBA 2PVBA 3JTDB 1PVAA 3SG7A 1F54A 3SG2A 3I5GB 2KFGA 1OZOA 2LVIA 3PFVA 4DS7A 1UWOA 4E68A 1DGVA 1YR5A 1UHJA 1F71A 1JSAA 4HRHA 2MBXA 1ALVA 2H61A 3CZ0A 2BE6A 2MAZA 3SG3A 1CDPA 2HPSA 1PALA 2QEVA 4PE7A 2I18A 5ER5A 1TCOB 5AFPA 5CSJA 1DC1A 3ICBA 1F70A 1YRTB 1IRJA 1XFWO 2BCAA 4BY5A 1VRKA 3KO0A 1G33A 3JVTC 1YURA 4JKTA 1L2OC 3KF9A 3TDIA 1BF5A 3I5FB 3L47A 2BL0C 1IG5A 4NDBA 1S36A 2F3YA 1OE9B 1QVIZ 1SL8A 1FPWA 2PMYA 4GFTA 1OW4A 4HREE 3TDZA 2K60A 2KGRA 5FI7A 2LV7A 2K61A 2LANA 3R1PA 1FF1A 4MZJA 1FI6A 1NIWA 3D0YA 3CS1A 1KSMA 1OOIX 4N5XA 1TNWA 3SIAA 1DJYA 1JWDA 2ISDA 2NCPA 5I2LA 1SR6C 4M2PA 4OKHA 2QEOA 4GAOA 3SJSA 4WQ3A 2BCBA 1AJ4A 4MSPA 1EG3A 3BUMB 1TIZA 2OPOA 3OBVA 1QWVA 2PYQA 1OOHA 3EK8A 4N1GA 5I2QA 1SYMA 2M8UA 3FWCA 1RK9A 1DJZA 3LK1A 1MXEA 5F6TA 3D10A 1CDNA 1QIVA 1OQPA 3B86A 1DJXA 2BECA 2P71A 1RJVA 2LP2A 2KLDA 1YUUA 3GK1A 3EVUA 1K94A 1J7OA 1XFZO 4AQJA 1FI5A 5AEQA 2LMVA 5FI2A 1Z4HA 1TN4A 2O5GA 3H4SE 1CB1A 1QX7A 2EC6C 4PE1A 3BJHA 2SCPA 1DVIA 1QIWA 1CM1A 4A4CA 1SY9A 4JPZB 1M45A 1DTLA 3DY9A 4OZDA 3S0BA 1XK4C 1K9PA 2AUCA 3PATA 1TCFA 1XO5A 4GGNA 1U5IA 2KI4B 2QEHA 1CDMA 3UO9A 2CT9A 1DELA 4YGBB 1IH0A 3D75A 4IL1A 4CIDA 1IWQA 2OS8C 4NDCA 3MSEB 3R1VA 2MA2A 2LE9B 5HKYA 1IIOA 1R2UA 1WDCC 3VGOA 1CLMA 3NSKA 4GBAA 5FI6A 3B87A 1KWOB 3OGNA 3VRNA 3S0FA 1OZSA 4YGCB 2JPTA 4USLA 1KK8C 1M31A 3I5HB 3OX5A 4I5LB 1DT7B 2LVJA 4WQ2A 1SCMC 2CCMA 1UP5A 2LCPA 3AKAA 1PK0D 1IKUA 1LINA 4PHMA 5JOLA 2L50A 2LMTA 2LM5A 3EK7A 2M7NA 2PSRA 1TWOA 5JJGA 1HT9A 3PM8A 3BFHA 2K7DA 4MRYA 1DGUA 3L4AA 3C1VA 2KAXA 1D1OA 4PT1A 1FW4A 1UHIA 1QLSA 1AHRA 1K95A 3A8RA 1SCVA 2KFFA 4MBEA 3DZTA 3VRPA 1GJYA 2MLFC 2Y1NA 2K0JA 3VROA 1J7PA 2L51A 3NXAA 1JFKA 2F2OA 3WNXB 4KYNA 5TNCA 2WC8A 4INWA 1OMVA 5I8NA 1DF0B 1NP8A 3TS5B 1XFXO 4HRGA 1TTXA 1NYAA 2JXLA 1SRAA 3B88A 3PN7C 3RZSA 3IQQA 5I2OA 1NX1A 1QTXA 2JULA 3CABA 2FJYA 4MEWA 1QX5B 2F3ZA 2L2CA 2EGDA 3CLNA 4OCIA 3RLZA 4P2YB 4BY4A 2KFHA 1KK7Z 3AKBA 3IF7A 2M49B 5KU1A 3NSLA 4YGDB 1RECA 2HQ8A 1AUIB 1LS8A 1L2OB 3O6BA 1A4PA 2M3WA 2QDIA 3D73A 5KSZA 1ZUZA 2BL0B 3SS5A 3F45A 4PDZA 1DJGA 3O78A 1KK7Y 1C3YA 1JF2A 3OB2B 2WNDA 1TNPA 1TUZA 3KPXA 4YI9A 1NX0A 1QX2A 2DOQA 2WC6A 3IQOA 3KHEA 4GGFC 5IBWA 1KQVA 3SS3A 3CTNA 4OVNF 3Q8IA 4ORBB 1G8IA 1E8AA 1SR6B 1S3PA 2QEBA 4JQ0D 4P5OE 1XFUO 2H8VA 3DVKA 3DYEA 3D76A 3PJIA 1NCZA 1B1GA 2KAVA 2KNEA 3UNWA 3BFBA 3VRRA
chains in the Genus database with same CATH topology
5FI2A 1DEKA 1Z4HA 4GBAA 5FI6A 3O4XA 2BNXA 4I5JA 4I5NB 3PM2A 3UNWA 4I5LB 3SS5A 4GAOA 4I5KA 2KLEA 5HL1A 4KYNA 1DC1A 3EG5B 3OBVA 5D3OA 4IJ7A 3SS3A 4JKTA 3KEVA 5I94A 2YGUA 3IVTA 4MEWA 3UO9A 1Z2CB 1DELA 2KLDA 2K60A 5FI7A 1W9ZA 2L5YA 3SS4A 2BAPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KYN A;  4IJ7 A;  3PM2 A; 
#chains in the Genus database with same CATH topology
 3BXK A;  1S6J A;  2KYC A;  2JZI A;  1K9K A;  1NCX A;  1NPQ A;  1MXL C;  1A75 B;  1UHH A;  5K89 A;  1F4O A;  2KQY A;  1GGZ A;  5KTY A;  1CTR A;  1K9U A;  1GM0 A;  1KQM B;  2A4J A;  2M9G A;  1MQ1 A;  4AOM A;  1Y0V H;  2JT8 A;  3TZ1 A;  2JRF A;  2VRG A;  4ORA B;  1JBA A;  1G4Y R;  2K2A A;  2ZND A;  1C3Z A;  1JF0 A;  2JOJ A;  2JT0 A;  2BE4 A;  4XJK B;  1B9A A;  2CBL A;  2E30 A;  3BUN B;  2PAS A;  2KSP A;  2EC6 B;  3BYA A;  2JT3 A;  2H61 C;  4XYN A;  1W9Z A;  1DJW A;  1LVC D;  2KI6 D;  1RTP 1;  3DD4 A;  3R72 A;  4NQG A;  3S0E A;  2LMU A;  2E6W A;  4U8D A;  5HLO A;  1JFJ A;  4TNC A;  3O4X A;  1V1F A;  2NXQ A;  2BCX A;  2Y4Q A;  2NCO A;  4I5N B;  3WHU B;  1M63 B;  2M29 A;  1YRU B;  1PSB A;  4PE4 A;  2I7A A;  2LVK A;  3LLE A;  1J1D A;  2I94 A;  3DVJ A;  3PAL A;  1XFY O;  2BBN A;  1IGV A;  2OS8 B;  3AAK A;  2OTG B;  3NHT A;  1DMO A;  4QJ5 B;  1J55 A;  1WDC B;  1XFR A;  4MZK A;  3GK2 A;  1A03 A;  3LK0 A;  1SBJ A;  1Y1A A;  5I94 A;  2YGU A;  3BOW B;  1F8H A;  3CZ2 A;  4PHK A;  4CFR A;  3I5I C;  1KK8 B;  1CLL A;  1YX8 A;  1BOD A;  2M1U A;  1BU3 A;  2FOT A;  1SCM B;  2F8P A;  1OOG A;  3DXL A;  3CZT X;  1IJ5 A;  2RGI A;  3EKH A;  1KFX L;  1K93 D;  4PCW A;  2JC2 A;  1LKJ A;  4CLN A;  1LA0 A;  2FCD A;  5CSI A;  2CTN A;  1CFC A;  1K90 D;  1OOJ A;  1JC2 A;  5HYD A;  3TDU A;  3V2L A;  5HL1 A;  1X02 A;  4C0K A;  1UUR A;  2K7O A;  1FBV A;  1B7T Z;  1J7R A;  4AQI A;  2JQ6 A;  5DKQ A;  1YTZ C;  2AMI A;  2L5X B;  3CR5 X;  1LA3 A;  2EHB A;  1YUS A;  2IS9 A;  2JNX A;  1GGW A;  1CDL A;  3IVT A;  1CKK A;  2WCJ A;  2WOS A;  2I2R E;  4MVF A;  1N65 A;  1B7T Y;  4Q04 A;  1EXR A;  2ZRT A;  1K2H A;  5EL2 A;  1OMD A;  2K8M B;  1RFJ A;  3SG5 A;  4M2Q A;  3BQ3 A;  3O2P A;  3PSR A;  3TUY B;  2MJW B;  1CFD A;  2KI4 C;  4OR9 B;  1DF0 A;  2FCE A;  3FS7 A;  2SAS A;  2PRU A;  2P6B B;  3SIB A;  3ZNI A;  3B6X A;  2ZFD A;  5AXI A;  2LAP A;  2GGM A;  3CDN A;  1DJI A;  1HQV A;  4ZCV A;  2JWW A;  2M97 A;  3FE8 A;  1BT6 A;  1TNX A;  1S26 D;  1EJ3 A;  2G2B A;  3D78 A;  3DVE A;  3VRQ A;  1BG1 A;  4M2O A;  2D8N A;  3I5H C;  4DRW A;  1CLB A;  1A2X A;  3QRX A;  3CZ1 A;  1B8L A;  1BR1 B;  1Q80 A;  4PHN A;  2L4I A;  1AP4 A;  1SSE B;  5AAN A;  5BPJ A;  1Y1X A;  1SMG A;  3CWG A;  4ICB A;  1PVB A;  4DUQ A;  1PSR A;  1EG4 A;  2MLE C;  4PHJ A;  1S5G Y;  4A4B A;  1YVH A;  3CR2 A;  3GOF A;  3JVT B;  1OOF A;  1IQ5 A;  1NX3 A;  1BOC A;  3M0W A;  1BR4 B;  2LHI A;  1K8U A;  1AK8 A;  1WY9 A;  2GTE A;  2JTZ A;  4FQT A;  2BKH B;  4L9M A;  1WLZ A;  3DF0 A;  3HCM A;  5PAL A;  3FWB A;  2WCK A;  3E3R A;  1H8B A;  2L2E A;  2TN4 A;  1YX7 A;  1EL4 A;  3RM1 A;  4CPV A;  2NLN A;  1IJ6 A;  4NDD A;  2WCM A;  1PRW A;  2LP3 A;  3DF0 B;  4FTG A;  3L4L A;  4UPG A;  2FJU B;  5B8I B;  2WCB A;  1MF8 B;  3TS5 C;  1A75 A;  2K2F A;  2O60 A;  3D77 A;  5ER4 X;  1CMF A;  1CMG A;  4MN0 A;  3CGA A;  2LLU A;  1DEK A;  1QV1 A;  1W7J B;  1F4Q A;  1SKT A;  4OV2 A;  4MLW A;  2PQL A;  3JTD C;  2L98 A;  4GPL B;  3S0A A;  2JU0 A;  2WOR A;  1WRL A;  2ZRS A;  2P70 A;  3I5G C;  3EG5 B;  5J3X A;  2HET A;  2KDH A;  3K21 A;  4XJK A;  4DCK A;  3CR4 X;  3K1E A;  1SPY A;  4GNK B;  3PLF B;  1NUB A;  1TNQ A;  2HQW A;  3QME A;  2M0R A;  1NSH A;  1QXP A;  5HKW A;  2K7C A;  4N1F A;  2CXJ A;  2L0P A;  3WXA A;  4C0J A;  2LLT A;  3HX4 A;  2WC5 A;  3LCP C;  1ORG A;  1B8C A;  2Y1M A;  5GQQ C;  1MWN A;  1XK4 A;  1M39 A;  1AJ5 A;  2F2P A;  2GV5 A;  2KGB C;  5AER A;  3BUX B;  1KFU L;  1WRZ A;  2JNF A;  2ZN8 A;  3I5F C;  2M7L A;  1ALW A;  1QVI Y;  4PE0 A;  1XA5 A;  1LXF C;  2AAO A;  3FIA A;  2ZN9 A;  2JPO A;  3I5I B;  3D0Y B;  5CPV A;  2KHN A;  1XFV O;  2LNK A;  1J1E A;  1RRO A;  4D1E A;  1AVS A;  3BOW A;  2GGZ A;  2MHH A;  4ETO A;  2V53 A;  5D3O A;  3WHT B;  2LUX A;  1B8R A;  4WRI A;  2R2I A;  3LL8 B;  1QS7 A;  4QJ4 B;  1L7Z A;  1NWD A;  1CM4 A;  4R1E A;  5HKZ A;  2Y5I A;  1CFF A;  1KQM C;  4DIR A;  1QAT A;  1SNL A;  1Z2C B;  1A29 A;  1TRF A;  2LUC A;  1QLK A;  2HF5 A;  1S6C A;  2KAY A;  1ZAC A;  4ORC B;  1MR8 A;  2LVV A;  3AAJ A;  5G08 A;  1SK6 D;  2BAP A;  1ODB A;  2KBI A;  4MZL A;  3SS4 A;  1WLM A;  1UUS A;  1MHO A;  1TOP A;  2LHL A;  1T14 A;  3GK4 X;  2WCF A;  1CNP A;  1S1E A;  2H2K A;  1UHK A;  3B7A A;  1NCY A;  1MUX A;  1OSA A;  1WRK A;  4PAL A;  1J7Q A;  1F55 A;  3EK4 A;  3EVR A;  1KCY A;  3NSI A;  1Y6W A;  3BUW B;  3NHI A;  4INX A;  1V1G A;  3NSO A;  3VB1 A;  2MRD A;  3SG6 A;  1C7V A;  1JUO A;  2G9B A;  2QAC A;  2ZKM X;  2M1K B;  1QJT A;  1RWY A;  4HSZ A;  1NX2 A;  4YRU A;  1CFP A;  2KQ6 A;  2BBM A;  3EKJ A;  5D69 A;  1C07 A;  1KFU S;  3CYZ A;  5DKR A;  2OTG C;  4F7F A;  1YUT A;  2L5Y A;  1N0Y A;  3DVM A;  2B1U A;  1U5I B;  1EH2 A;  4CFQ A;  4JD9 A;  1N2D A;  3BFA A;  3FE6 A;  2BNX A;  3PN7 B;  5FYX A;  1SL9 A;  3BUO B;  2Q91 A;  3PM2 A;  5DKN A;  2L4H A;  2WCH A;  1P28 A;  2KPH A;  1TUJ A;  1K96 A;  2Q4U A;  2KI6 C;  1H4B A;  2LLS A;  4FQO A;  1R6P A;  2F33 A;  2CNP A;  5HLV A;  4F0Z B;  3FE9 A;  3EVV A;  1XVJ A;  2KBM A;  2JTT A;  5CSF A;  2LC5 A;  1BJF A;  1KWO C;  2WCL A;  1QV0 A;  2PAL A;  1S5G Z;  3S0G A;  1SW8 A;  3OHM B;  1B4C A;  1DQE A;  4GGF A;  3OX6 A;  5D7F A;  3OP0 A;  1IQ3 A;  4YI8 A;  1KFX S;  1Y1U A;  2K7B A;  1C7W A;  2BKI B;  2QPT A;  1ZFS A;  4YGE B;  1ZMZ A;  1KSO A;  4YGA A;  3SG4 A;  1BMO A;  1YVL A;  4ZCU A;  2WCE A;  3N7H A;  2COL B;  1W7I B;  4I5J A;  4MRX A;  1QAS A;  3A4U B;  1DJH A;  1XYD A;  5CSN A;  4I5K A;  2KLE A;  1SL7 A;  5DIC A;  4GUK A;  1OMR A;  3D74 A;  2NZ0 A;  3O4Y A;  3R1O A;  4C0L A;  4YBH B;  1GQM A;  1S6I A;  2ZNE A;  3TUY C;  1UHN A;  2KOT A;  4IJ7 A;  3NGV A;  3S0D A;  2KYF A;  3ZWH A;  4JWQ A;  3OB1 B;  4QJ3 B;  3KEV A;  1BLQ A;  2JXC A;  1B47 A;  1M46 A;  1PUL A;  1ZOT B;  2ERB A;  2PVB A;  3JTD B;  1PVA A;  3SG7 A;  1F54 A;  3SG2 A;  3I5G B;  2KFG A;  1OZO A;  2LVI A;  3PFV A;  4DS7 A;  1UWO A;  4E68 A;  1DGV A;  1YR5 A;  1UHJ A;  1F71 A;  1JSA A;  4HRH A;  2MBX A;  1ALV A;  2H61 A;  3CZ0 A;  2BE6 A;  2MAZ A;  3SG3 A;  1CDP A;  2HPS A;  1PAL A;  2QEV A;  4PE7 A;  2I18 A;  5ER5 A;  1TCO B;  5AFP A;  5CSJ A;  1DC1 A;  3ICB A;  1F70 A;  1YRT B;  1IRJ A;  1XFW O;  2BCA A;  4BY5 A;  1VRK A;  3KO0 A;  1G33 A;  3JVT C;  1YUR A;  4JKT A;  1L2O C;  3KF9 A;  3TDI A;  1BF5 A;  3I5F B;  3L47 A;  2BL0 C;  1IG5 A;  4NDB A;  1S36 A;  2F3Y A;  1OE9 B;  1QVI Z;  1SL8 A;  1FPW A;  2PMY A;  4GFT A;  1OW4 A;  4HRE E;  3TDZ A;  2K60 A;  2KGR A;  5FI7 A;  2LV7 A;  2K61 A;  2LAN A;  3R1P A;  1FF1 A;  4MZJ A;  1FI6 A;  1NIW A;  3D0Y A;  3CS1 A;  1KSM A;  1OOI X;  4N5X A;  1TNW A;  3SIA A;  1DJY A;  1JWD A;  2ISD A;  2NCP A;  5I2L A;  1SR6 C;  4M2P A;  4OKH A;  2QEO A;  4GAO A;  3SJS A;  4WQ3 A;  2BCB A;  1AJ4 A;  4MSP A;  1EG3 A;  3BUM B;  1TIZ A;  2OPO A;  3OBV A;  1QWV A;  2PYQ A;  1OOH A;  3EK8 A;  4N1G A;  5I2Q A;  1SYM A;  2M8U A;  3FWC A;  1RK9 A;  1DJZ A;  3LK1 A;  1MXE A;  5F6T A;  3D10 A;  1CDN A;  1QIV A;  1OQP A;  3B86 A;  1DJX A;  2BEC A;  2P71 A;  1RJV A;  2LP2 A;  2KLD A;  1YUU A;  3GK1 A;  3EVU A;  1K94 A;  1J7O A;  1XFZ O;  4AQJ A;  1FI5 A;  5AEQ A;  2LMV A;  5FI2 A;  1Z4H A;  1TN4 A;  2O5G A;  3H4S E;  1CB1 A;  1QX7 A;  2EC6 C;  4PE1 A;  3BJH A;  2SCP A;  1DVI A;  1QIW A;  1CM1 A;  4A4C A;  1SY9 A;  4JPZ B;  1M45 A;  1DTL A;  3DY9 A;  4OZD A;  3S0B A;  1XK4 C;  1K9P A;  2AUC A;  3PAT A;  1TCF A;  1XO5 A;  4GGN A;  1U5I A;  2KI4 B;  2QEH A;  1CDM A;  3UO9 A;  2CT9 A;  1DEL A;  4YGB B;  1IH0 A;  3D75 A;  4IL1 A;  4CID A;  1IWQ A;  2OS8 C;  4NDC A;  3MSE B;  3R1V A;  2MA2 A;  2LE9 B;  5HKY A;  1IIO A;  1R2U A;  1WDC C;  3VGO A;  1CLM A;  3NSK A;  4GBA A;  5FI6 A;  3B87 A;  1KWO B;  3OGN A;  3VRN A;  3S0F A;  1OZS A;  4YGC B;  2JPT A;  4USL A;  1KK8 C;  1M31 A;  3I5H B;  3OX5 A;  4I5L B;  1DT7 B;  2LVJ A;  4WQ2 A;  1SCM C;  2CCM A;  1UP5 A;  2LCP A;  3AKA A;  1PK0 D;  1IKU A;  1LIN A;  4PHM A;  5JOL A;  2L50 A;  2LMT A;  2LM5 A;  3EK7 A;  2M7N A;  2PSR A;  1TWO A;  5JJG A;  1HT9 A;  3PM8 A;  3BFH A;  2K7D A;  4MRY A;  1DGU A;  3L4A A;  3C1V A;  2KAX A;  1D1O A;  4PT1 A;  1FW4 A;  1UHI A;  1QLS A;  1AHR A;  1K95 A;  3A8R A;  1SCV A;  2KFF A;  4MBE A;  3DZT A;  3VRP A;  1GJY A;  2MLF C;  2Y1N A;  2K0J A;  3VRO A;  1J7P A;  2L51 A;  3NXA A;  1JFK A;  2F2O A;  3WNX B;  4KYN A;  5TNC A;  2WC8 A;  4INW A;  1OMV A;  5I8N A;  1DF0 B;  1NP8 A;  3TS5 B;  1XFX O;  4HRG A;  1TTX A;  1NYA A;  2JXL A;  1SRA A;  3B88 A;  3PN7 C;  3RZS A;  3IQQ A;  5I2O A;  1NX1 A;  1QTX A;  2JUL A;  3CAB A;  2FJY A;  4MEW A;  1QX5 B;  2F3Z A;  2L2C A;  2EGD A;  3CLN A;  4OCI A;  3RLZ A;  4P2Y B;  4BY4 A;  2KFH A;  1KK7 Z;  3AKB A;  3IF7 A;  2M49 B;  5KU1 A;  3NSL A;  4YGD B;  1REC A;  2HQ8 A;  1AUI B;  1LS8 A;  1L2O B;  3O6B A;  1A4P A;  2M3W A;  2QDI A;  3D73 A;  5KSZ A;  1ZUZ A;  2BL0 B;  3SS5 A;  3F45 A;  4PDZ A;  1DJG A;  3O78 A;  1KK7 Y;  1C3Y A;  1JF2 A;  3OB2 B;  2WND A;  1TNP A;  1TUZ A;  3KPX A;  4YI9 A;  1NX0 A;  1QX2 A;  2DOQ A;  2WC6 A;  3IQO A;  3KHE A;  4GGF C;  5IBW A;  1KQV A;  3SS3 A;  3CTN A;  4OVN F;  3Q8I A;  4ORB B;  1G8I A;  1E8A A;  1SR6 B;  1S3P A;  2QEB A;  4JQ0 D;  4P5O E;  1XFU O;  2H8V A;  3DVK A;  3DYE A;  3D76 A;  3PJI A;  1NCZ A;  1B1G A;  2KAV A;  2KNE A;  3UNW A;  3BFB A;  3VRR A; 
#chains in the Genus database with same CATH homology
 5FI2 A;  1DEK A;  1Z4H A;  4GBA A;  5FI6 A;  3O4X A;  2BNX A;  4I5J A;  4I5N B;  3PM2 A;  3UNW A;  4I5L B;  3SS5 A;  4GAO A;  4I5K A;  2KLE A;  5HL1 A;  4KYN A;  1DC1 A;  3EG5 B;  3OBV A;  5D3O A;  4IJ7 A;  3SS3 A;  4JKT A;  3KEV A;  5I94 A;  2YGU A;  3IVT A;  4MEW A;  3UO9 A;  1Z2C B;  1DEL A;  2KLD A;  2K60 A;  5FI7 A;  1W9Z A;  2L5Y A;  3SS4 A;  2BAP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...