4IJ7A

Crystal structure of odorant binding protein 48 from anopheles gambiae (agamobp48) with peg
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
172
structure length
172
Chain Sequence
GDNPCAAGPPVDTNPAECCPKPMLVDGTIMMDCYKKYGEQTKKQLQMDGIPRGCCIAECAMNATNMYADGMLKRDDLSKMFMDAVKDKPEWMSLVRDATNACFELAEKKMDEIEAGAKLEPSFEGEKICHPISGTILRCMGMMMFAQCPASVFNVNENCNKLREYGSICPMI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Odorant binding protein-8
publication title Crystal and Solution Studies of the "Plus-C" Odorant-binding Protein 48 from Anopheles gambiae: CONTROL OF BINDING SPECIFICITY THROUGH THREE-DIMENSIONAL DOMAIN SWAPPING.
pubmed doi rcsb
source organism Anopheles gambiae
total genus 52
structure length 172
sequence length 172
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.270 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Recoverin; domain 1 4ij7A00
4IJ7A 4KYNA 3PM2A
chains in the Genus database with same CATH superfamily
1QIWA 1NWDA 2SASA 3KPXA 1J7QA 1NX0A 4DUQA 1D1OA 2L98A 2KGRA 1OMVA 3SIAA 2EC6C 5FI7A 3EK8A 1JF0A 3LK0A 5CSJA 2JNFA 1IRJA 2JU0A 3E3RA 3DYEA 2KQYA 5CPVA 5DKQA 3S0DA 3EVUA 1QASA 2JXLA 2F33A 2LV7A 4HREE 3I5IC 4E68A 3B87A 4OKHA 1TTXA 1CLMA 2WCKA 1QVIY 4M2OA 4NDDA 1OSAA 1DJIA 5B8IB 3TUYC 1N2DA 2QEVA 2WOSA 3CTNA 3VRQA 1NCXA 2WCFA 4M2QA 1BT6A 2ZN8A 1XVJA 1Q80A 4INXA 3KF9A 1AK8A 1LS8A 3CZTX 1JFJA 1GGWA 3B86A 1OOFA 3D77A 1EG4A 3LLEA 3PFVA 4OVNF 4HRGA 2HF5A 2G2BA 1T14A 2JT8A 3CS1A 4GGFA 4L9MA 2QEBA 1DJGA 2WCMA 1B47A 3R72A 4C0KA 1B8LA 1XO5A 3I5HB 3OB2B 4MLWA 1QTXA 4YGAA 4CFQA 1UHNA 2ZRTA 3WNXB 1F54A 1UHIA 1SCVA 3NSOA 1W7JB 1NCZA 1XFRA 1BU3A 3JTDB 2BECA 1XFXO 2CCMA 1F70A 1SKTA 1TNXA 1IJ6A 1LA0A 2I2RE 4ORAB 2H61A 1EL4A 1NX3A 2F2OA 5ER4X 2FJUB 1GM0A 1DQEA 4N1FA 1AUIB 4MBEA 3SJSA 4DCKA 1QWVA 3CLNA 3DF0B 4MVFA 3RM1A 1XFWO 3VRPA 2JPTA 2K2AA 3CYZA 4GBAA 4WQ3A 1S6JA 3PALA 5AERA 1S26D 2L50A 3NHIA 2F3YA 1TUZA 4INWA 2KQ6A 4MRXA 2P70A 5JJGA 2IS9A 3D0YA 3DZTA 1RJVA 3BUNB 4PDZA 1F55A 1OOJA 1BF5A 1YURA 1AJ4A 1QJTA 1H4BA 3EG5B 3QRXA 2KFHA 1QXPA 4PHJA 3BJHA 1C07A 5DICA 5BPJA 2Y1MA 1SSEB 4F0ZB 4MN0A 5I2QA 2Y5IA 2KAVA 3SS5A 2LLSA 1PVAA 4NDCA 1SRAA 1SR6B 1CM4A 1CM1A 1OW4A 2KBIA 2LHIA 4HRHA 5G08A 3L4LA 1DJWA 3R1VA 1CB1A 1ZOTB 1IKUA 4I5NB 4P5OE 1WDCC 2CXJA 2D8NA 3DVJA 4P2YB 1AP4A 3I5FC 2HQ8A 1IQ3A 3JTDC 2KI6C 2M49B 5DKRA 2WCEA 1ODBA 1CDNA 1DMOA 1CDMA 2HETA 1QX5B 1FF1A 3QMEA 3JVTC 1KSMA 4GUKA 1EXRA 5HLOA 1MHOA 2K60A 2LE9B 4QJ5B 1X02A 5CSFA 3DVEA 1WY9A 2WORA 1FI6A 4GNKB 2LMUA 2JULA 4JD9A 1PSRA 1YR5A 2B1UA 1S5GZ 5HKWA 2M9GA 1UP5A 1YUSA 2GGMA 1JF2A 2JTTA 1J7OA 3K1EA 2WC6A 1B8CA 3NGVA 1QS7A 4PE4A 2ZNDA 1OMDA 1J1DA 1RROA 1U5IA 1J7PA 4YI8A 2OTGB 4CPVA 3RZSA 1WLZA 4PE1A 2LAPA 1DELA 1F8HA 1DF0A 4D1EA 2TN4A 3SG2A 1J7RA 1GQMA 2OS8C 2FOTA 3BXKA 3PJIA 4WRIA 2QEOA 5AXIA 5GQQC 3OHMB 3GK2A 1S5GY 1P28A 2L4HA 5I2LA 1CLLA 1Y6WA 1YX8A 1K95A 3N7HA 2KGBC 3WHUB 1YTZC 1KQMB 2LUCA 2JQ6A 2MHHA 2MLEC 5EL2A 4A4CA 5KU1A 1JC2A 4OZDA 2MBXA 1QIVA 2BBNA 2GV5A 2PALA 1K9KA 1XFUO 4PHKA 2ZFDA 1B8RA 5HLVA 1M31A 3D76A 2BAPA 2KOTA 5D7FA 1SCMB 5J3XA 2BNXA 1DJYA 3GK1A 4XJKB 1LXFC 2KI4B 1A75A 1OOHA 4OCIA 3GK4X 4ZCUA 1YVHA 1K8UA 2O60A 4OV2A 3I5GB 2KFFA 1N65A 1KWOB 2KI6D 1SBJA 3K21A 3NHTA 4PALA 3D75A 4MEWA 4MSPA 1M63B 1U5IB 1VRKA 3ZNIA 1AJ5A 1DGVA 4IL1A 1KK8C 3GOFA 1NX1A 3O6BA 3NSIA 2BBMA 2AMIA 2WCBA 1TN4A 3PN7B 2F3ZA 2JC2A 3CGAA 1IQ5A 3OP0A 1OZSA 1CMFA 4PE0A 2JXCA 3EKHA 1CFFA 3FE9A 1NX2A 2KAYA 5KSZA 3B88A 1CLBA 1MXLC 3NSLA 3AKAA 1S6CA 1SPYA 1J1EA 1AVSA 2LHLA 1FBVA 1A2XA 3SG5A 4USLA 5HL1A 1XK4C 2BE4A 2LVIA 3IQQA 3IVTA 4YGEB 2LVVA 4ORBB 1QX7A 1K9UA 1DJZA 4GPLB 4QJ4B 3A4UB 1DJHA 1K2HA 4KYNA 1M39A 1K9PA 3EKJA 2WCHA 2LMTA 1JFKA 2I18A 2QEHA 4CLNA 3EK7A 1MUXA 3OX5A 3TS5B 2MRDA 4IJ7A 2SCPA 3S0BA 1L2OB 2CT9A 4DS7A 2BL0B 2PSRA 1DT7B 1OQPA 4XYNA 3OB1B 1PRWA 2PVBA 2R2IA 3IQOA 1BLQA 3D78A 1XYDA 4GFTA 1DJXA 1S3PA 2LM5A 2L4IA 4I5LB 2KI4C 4PE7A 3S0GA 1N0YA 1TNPA 2JT0A 2KLEA 1ALVA 3AKBA 1B4CA 3C1VA 2K7DA 1KWOC 5TNCA 1G8IA 2NCOA 1AHRA 1PSBA 3BOWA 2M0RA 3I5HC 1CMGA 3DXLA 1MR8A 3D73A 1V1FA 2FCEA 1KFUL 3D74A 1LKJA 4YGBB 3L47A 4CFRA 3EVRA 1LVCD 3BUOB 3PN7C 1F4QA 1TNWA 1MWNA 1IWQA 3KHEA 3SS3A 1RK9A 3PM2A 3Q8IA 5K89A 2LCPA 4F7FA 1KQVA 1YRTB 1EJ3A 1YX7A 4JQ0D 2MAZA 2QPTA 2LP3A 3DVKA 1FI5A 1KFXS 1W7IB 2BCXA 1B1GA 2JNXA 1PALA 2LLTA 4ORCB 1XFYO 2LVKA 3CR2A 1KFXL 2EC6B 2M1KB 1MQ1A 3D0YB 3FE6A 4DIRA 2HPSA 1PULA 1SL7A 1V1GA 3OX6A 3OBVA 5CSIA 3SG3A 3D10A 1BG1A 1K96A 3TS5C 1PK0D 3HCMA 1HQVA 2F2PA 1ALWA 3CWGA 4A4BA 4ETOA 1G33A 3BUWB 2M97A 2H8VA 2M29A 4GGFC 1EH2A 1IGVA 1NP8A 1TOPA 2L0PA 4R1EA 4WQ2A 4JPZB 2L5YA 2O5GA 3BOWB 1XFZO 2EHBA 1WRKA 3R1PA 2KHNA 3PLFB 4GAOA 3CABA 2KBMA 1Y1XA 3TDUA 3CZ1A 3VRRA 3MSEB 2WNDA 1WRZA 3CZ2A 1OMRA 2KFGA 2PASA 1SR6C 1A29A 3FWBA 3BUXB 4C0LA 2JWWA 3KO0A 3L4AA 1ZUZA 2Q4UA 2ZN9A 1CDPA 1TCOB 3V2LA 5I8NA 1CDLA 1J55A 1DVIA 2JT3A 2KAXA 2EGDA 2WCLA 4MZLA 5AEQA 1DEKA 1NIWA 2AAOA 3HX4A 3UO9A 1UHKA 2K7CA 5IBWA 1UWOA 1ZMZA 1SL9A 3WHTB 2BCAA 3ICBA 4QJ3B 4YBHB 1Y1AA 2K7OA 2ZKMX 3VROA 2BKIB 3UNWA 2ISDA 1B7TZ 2CBLA 2G9BA 2KYFA 2GTEA 2FCDA 5HYDA 5FI2A 4PT1A 3TZ1A 1GJYA 2L5XB 3CZ0A 3SS4A 3KEVA 2CNPA 3VB1A 2JTZA 2RGIA 5I94A 1OOGA 1FPWA 3BFHA 2LP2A 2GGZA 3DF0A 1R2UA 4PHNA 1A03A 2DOQA 4NDBA 3EVVA 2I94A 4PHMA 1XFVO 1Z2CB 3FWCA 2JZIA 2VRGA 2BE6A 1QLSA 2KYCA 1DF0B 3IF7A 3PM8A 5HKZA 2M7LA 1IIOA 3A8RA 1A4PA 1SY9A 2OTGC 1TIZA 2PMYA 4ICBA 3RLZA 1CTRA 4M2PA 2YGUA 2LC5A 4NQGA 1IG5A 3H4SE 1NYAA 3SG6A 1S36A 1B7TY 1TCFA 2NXQA 3F45A 2L2EA 2LMVA 4JKTA 4YGDB 5D3OA 4BY5A 3EK4A 4FQTA 2M3WA 1NSHA 1C3ZA 3AAJA 1F71A 2BCBA 4Q04A 5PALA 1OZOA 2K7BA 3O2PA 2K2FA 4JWQA 4MZJA 4YI9A 3SG7A 1KQMC 2QDIA 3FS7A 2NCPA 1MF8B 1SNLA 1WDCB 3NSKA 4TNCA 1W9ZA 2PRUA 1LA3A 1M46A 3I5FB 3CR4X 1NPQA 4AQJA 1JWDA 3BQ3A 1A75B 1DGUA 1ORGA 4UPGA 1Z4HA 1RWYA 1S1EA 2LNKA 1C7VA 2Y4QA 3JVTB 2LANA 2MJWB 1SK6D 1SCMC 4GGNA 2KSPA 1G4YR 4ZCVA 3BFAA 3ZWHA 1NUBA 1OOIX 1K90D 3LCPC 5HKYA 3I5GC 1BR4B 1SMGA 4YRUA 1IH0A 1KFUS 4AQIA 3PATA 3TDIA 1QX2A 1KK7Z 1S6IA 2KNEA 2JPOA 2NZ0A 1TRFA 2JOJA 1ZFSA 4MRYA 2CTNA 2A4JA 1QV1A 1F4OA 1BOCA 1C7WA 1BMOA 3O4XA 3NXAA 2LLUA 2WC5A 3AAKA 2ZRSA 4PCWA 1YUTA 2WCJA 1JUOA 3SIBA 1CFCA 3FE8A 4YGCB 1Y1UA 2E6WA 5FYXA 1IJ5A 2M8UA 4FQOA 4DRWA 3BYAA 2M1UA 3BUMB 4MZKA 2K61A 2M7NA 1Y0VH 3SG4A 4OR9B 2I7AA 1TUJA 1YVLA 1YUUA 1SL8A 4C0JA 4CIDA 1CKKA 2Q91A 4I5KA 2K0JA 3O4YA 2PYQA 3VGOA 3B6XA 2MA2A 2OS8B 1R6PA 1GGZA 3BFBA 2KDHA 1UHHA 1KK7Y 2L51A 1CFPA 1UURA 3PSRA 5JOLA 2MLFC 5AFPA 1E8AA 1K94A 1XK4A 3S0AA 3CR5X 3I5IB 1L2OC 1WRLA 3WXAA 2WC8A 2BL0C 2HQWA 4FTGA 1DTLA 3LK1A 3TUYB 1QLKA 1XA5A 2F8PA 1K93D 3DY9A 1L7ZA 1B9AA 5CSNA 1KSOA 5FI6A 2E30A 1TWOA 3S0EA 1SW8A 1C3YA 2AUCA 1RECA 3DD4A 5KTYA 2P71A 4AOMA 5AANA 4N1GA 1TNQA 2K8MB 2LVJA 1PVBA 1RFJA 2LUXA 1OE9B 4I5JA 5F6TA 5I2OA 1UHJA 1CNPA 2BKHB 1YRUB 1JBAA 3O78A 3M0WA 3VRNA 1FW4A 2FJYA 2P6BB 3OGNA 4N5XA 1MXEA 2H2KA 1JSAA 2PQLA 1QATA 1H8BA 1KCYA 3DVMA 1M45A 1QV0A 2ZNEA 4XJKA 1HT9A 1SYMA 3TDZA 1WLMA 2KLDA 1KK8B 2COLB 2H61C 3B7AA 1ZACA 4U8DA 1RTP1 1QVIZ 2NLNA 3R1OA 4HSZA 2OPOA 3FIAA 1BODA 1NCYA 1EG3A 1BR1B 2JRFA 3LL8B 1CFDA 5D69A 5ER5A 2L2CA 3CDNA 2QACA 1UUSA 2V53A 2KPHA 1DC1A 1BJFA 2Y1NA 3S0FA 1LINA 2ERBA 5DKNA 4BY4A
chains in the Genus database with same CATH topology
1DELA 4GAOA 4I5LB 3UNWA 2BNXA 4I5JA 2K60A 2KLEA 5HL1A 3IVTA 4I5KA 4JKTA 5D3OA 5FI2A 3SS4A 3SS5A 5FI7A 3KEVA 4GBAA 4KYNA 5I94A 4MEWA 3OBVA 4I5NB 2KLDA 3O4XA 4IJ7A 1W9ZA 1Z2CB 1DEKA 3UO9A 3SS3A 5FI6A 2L5YA 3PM2A 3EG5B 1Z4HA 1DC1A 2YGUA 2BAPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IJ7 A;  4KYN A;  3PM2 A; 
#chains in the Genus database with same CATH topology
 1QIW A;  1NWD A;  2SAS A;  3KPX A;  1J7Q A;  1NX0 A;  4DUQ A;  1D1O A;  2L98 A;  2KGR A;  1OMV A;  3SIA A;  2EC6 C;  5FI7 A;  3EK8 A;  1JF0 A;  3LK0 A;  5CSJ A;  2JNF A;  1IRJ A;  2JU0 A;  3E3R A;  3DYE A;  2KQY A;  5CPV A;  5DKQ A;  3S0D A;  3EVU A;  1QAS A;  2JXL A;  2F33 A;  2LV7 A;  4HRE E;  3I5I C;  4E68 A;  3B87 A;  4OKH A;  1TTX A;  1CLM A;  2WCK A;  1QVI Y;  4M2O A;  4NDD A;  1OSA A;  1DJI A;  5B8I B;  3TUY C;  1N2D A;  2QEV A;  2WOS A;  3CTN A;  3VRQ A;  1NCX A;  2WCF A;  4M2Q A;  1BT6 A;  2ZN8 A;  1XVJ A;  1Q80 A;  4INX A;  3KF9 A;  1AK8 A;  1LS8 A;  3CZT X;  1JFJ A;  1GGW A;  3B86 A;  1OOF A;  3D77 A;  1EG4 A;  3LLE A;  3PFV A;  4OVN F;  4HRG A;  2HF5 A;  2G2B A;  1T14 A;  2JT8 A;  3CS1 A;  4GGF A;  4L9M A;  2QEB A;  1DJG A;  2WCM A;  1B47 A;  3R72 A;  4C0K A;  1B8L A;  1XO5 A;  3I5H B;  3OB2 B;  4MLW A;  1QTX A;  4YGA A;  4CFQ A;  1UHN A;  2ZRT A;  3WNX B;  1F54 A;  1UHI A;  1SCV A;  3NSO A;  1W7J B;  1NCZ A;  1XFR A;  1BU3 A;  3JTD B;  2BEC A;  1XFX O;  2CCM A;  1F70 A;  1SKT A;  1TNX A;  1IJ6 A;  1LA0 A;  2I2R E;  4ORA B;  2H61 A;  1EL4 A;  1NX3 A;  2F2O A;  5ER4 X;  2FJU B;  1GM0 A;  1DQE A;  4N1F A;  1AUI B;  4MBE A;  3SJS A;  4DCK A;  1QWV A;  3CLN A;  3DF0 B;  4MVF A;  3RM1 A;  1XFW O;  3VRP A;  2JPT A;  2K2A A;  3CYZ A;  4GBA A;  4WQ3 A;  1S6J A;  3PAL A;  5AER A;  1S26 D;  2L50 A;  3NHI A;  2F3Y A;  1TUZ A;  4INW A;  2KQ6 A;  4MRX A;  2P70 A;  5JJG A;  2IS9 A;  3D0Y A;  3DZT A;  1RJV A;  3BUN B;  4PDZ A;  1F55 A;  1OOJ A;  1BF5 A;  1YUR A;  1AJ4 A;  1QJT A;  1H4B A;  3EG5 B;  3QRX A;  2KFH A;  1QXP A;  4PHJ A;  3BJH A;  1C07 A;  5DIC A;  5BPJ A;  2Y1M A;  1SSE B;  4F0Z B;  4MN0 A;  5I2Q A;  2Y5I A;  2KAV A;  3SS5 A;  2LLS A;  1PVA A;  4NDC A;  1SRA A;  1SR6 B;  1CM4 A;  1CM1 A;  1OW4 A;  2KBI A;  2LHI A;  4HRH A;  5G08 A;  3L4L A;  1DJW A;  3R1V A;  1CB1 A;  1ZOT B;  1IKU A;  4I5N B;  4P5O E;  1WDC C;  2CXJ A;  2D8N A;  3DVJ A;  4P2Y B;  1AP4 A;  3I5F C;  2HQ8 A;  1IQ3 A;  3JTD C;  2KI6 C;  2M49 B;  5DKR A;  2WCE A;  1ODB A;  1CDN A;  1DMO A;  1CDM A;  2HET A;  1QX5 B;  1FF1 A;  3QME A;  3JVT C;  1KSM A;  4GUK A;  1EXR A;  5HLO A;  1MHO A;  2K60 A;  2LE9 B;  4QJ5 B;  1X02 A;  5CSF A;  3DVE A;  1WY9 A;  2WOR A;  1FI6 A;  4GNK B;  2LMU A;  2JUL A;  4JD9 A;  1PSR A;  1YR5 A;  2B1U A;  1S5G Z;  5HKW A;  2M9G A;  1UP5 A;  1YUS A;  2GGM A;  1JF2 A;  2JTT A;  1J7O A;  3K1E A;  2WC6 A;  1B8C A;  3NGV A;  1QS7 A;  4PE4 A;  2ZND A;  1OMD A;  1J1D A;  1RRO A;  1U5I A;  1J7P A;  4YI8 A;  2OTG B;  4CPV A;  3RZS A;  1WLZ A;  4PE1 A;  2LAP A;  1DEL A;  1F8H A;  1DF0 A;  4D1E A;  2TN4 A;  3SG2 A;  1J7R A;  1GQM A;  2OS8 C;  2FOT A;  3BXK A;  3PJI A;  4WRI A;  2QEO A;  5AXI A;  5GQQ C;  3OHM B;  3GK2 A;  1S5G Y;  1P28 A;  2L4H A;  5I2L A;  1CLL A;  1Y6W A;  1YX8 A;  1K95 A;  3N7H A;  2KGB C;  3WHU B;  1YTZ C;  1KQM B;  2LUC A;  2JQ6 A;  2MHH A;  2MLE C;  5EL2 A;  4A4C A;  5KU1 A;  1JC2 A;  4OZD A;  2MBX A;  1QIV A;  2BBN A;  2GV5 A;  2PAL A;  1K9K A;  1XFU O;  4PHK A;  2ZFD A;  1B8R A;  5HLV A;  1M31 A;  3D76 A;  2BAP A;  2KOT A;  5D7F A;  1SCM B;  5J3X A;  2BNX A;  1DJY A;  3GK1 A;  4XJK B;  1LXF C;  2KI4 B;  1A75 A;  1OOH A;  4OCI A;  3GK4 X;  4ZCU A;  1YVH A;  1K8U A;  2O60 A;  4OV2 A;  3I5G B;  2KFF A;  1N65 A;  1KWO B;  2KI6 D;  1SBJ A;  3K21 A;  3NHT A;  4PAL A;  3D75 A;  4MEW A;  4MSP A;  1M63 B;  1U5I B;  1VRK A;  3ZNI A;  1AJ5 A;  1DGV A;  4IL1 A;  1KK8 C;  3GOF A;  1NX1 A;  3O6B A;  3NSI A;  2BBM A;  2AMI A;  2WCB A;  1TN4 A;  3PN7 B;  2F3Z A;  2JC2 A;  3CGA A;  1IQ5 A;  3OP0 A;  1OZS A;  1CMF A;  4PE0 A;  2JXC A;  3EKH A;  1CFF A;  3FE9 A;  1NX2 A;  2KAY A;  5KSZ A;  3B88 A;  1CLB A;  1MXL C;  3NSL A;  3AKA A;  1S6C A;  1SPY A;  1J1E A;  1AVS A;  2LHL A;  1FBV A;  1A2X A;  3SG5 A;  4USL A;  5HL1 A;  1XK4 C;  2BE4 A;  2LVI A;  3IQQ A;  3IVT A;  4YGE B;  2LVV A;  4ORB B;  1QX7 A;  1K9U A;  1DJZ A;  4GPL B;  4QJ4 B;  3A4U B;  1DJH A;  1K2H A;  4KYN A;  1M39 A;  1K9P A;  3EKJ A;  2WCH A;  2LMT A;  1JFK A;  2I18 A;  2QEH A;  4CLN A;  3EK7 A;  1MUX A;  3OX5 A;  3TS5 B;  2MRD A;  4IJ7 A;  2SCP A;  3S0B A;  1L2O B;  2CT9 A;  4DS7 A;  2BL0 B;  2PSR A;  1DT7 B;  1OQP A;  4XYN A;  3OB1 B;  1PRW A;  2PVB A;  2R2I A;  3IQO A;  1BLQ A;  3D78 A;  1XYD A;  4GFT A;  1DJX A;  1S3P A;  2LM5 A;  2L4I A;  4I5L B;  2KI4 C;  4PE7 A;  3S0G A;  1N0Y A;  1TNP A;  2JT0 A;  2KLE A;  1ALV A;  3AKB A;  1B4C A;  3C1V A;  2K7D A;  1KWO C;  5TNC A;  1G8I A;  2NCO A;  1AHR A;  1PSB A;  3BOW A;  2M0R A;  3I5H C;  1CMG A;  3DXL A;  1MR8 A;  3D73 A;  1V1F A;  2FCE A;  1KFU L;  3D74 A;  1LKJ A;  4YGB B;  3L47 A;  4CFR A;  3EVR A;  1LVC D;  3BUO B;  3PN7 C;  1F4Q A;  1TNW A;  1MWN A;  1IWQ A;  3KHE A;  3SS3 A;  1RK9 A;  3PM2 A;  3Q8I A;  5K89 A;  2LCP A;  4F7F A;  1KQV A;  1YRT B;  1EJ3 A;  1YX7 A;  4JQ0 D;  2MAZ A;  2QPT A;  2LP3 A;  3DVK A;  1FI5 A;  1KFX S;  1W7I B;  2BCX A;  1B1G A;  2JNX A;  1PAL A;  2LLT A;  4ORC B;  1XFY O;  2LVK A;  3CR2 A;  1KFX L;  2EC6 B;  2M1K B;  1MQ1 A;  3D0Y B;  3FE6 A;  4DIR A;  2HPS A;  1PUL A;  1SL7 A;  1V1G A;  3OX6 A;  3OBV A;  5CSI A;  3SG3 A;  3D10 A;  1BG1 A;  1K96 A;  3TS5 C;  1PK0 D;  3HCM A;  1HQV A;  2F2P A;  1ALW A;  3CWG A;  4A4B A;  4ETO A;  1G33 A;  3BUW B;  2M97 A;  2H8V A;  2M29 A;  4GGF C;  1EH2 A;  1IGV A;  1NP8 A;  1TOP A;  2L0P A;  4R1E A;  4WQ2 A;  4JPZ B;  2L5Y A;  2O5G A;  3BOW B;  1XFZ O;  2EHB A;  1WRK A;  3R1P A;  2KHN A;  3PLF B;  4GAO A;  3CAB A;  2KBM A;  1Y1X A;  3TDU A;  3CZ1 A;  3VRR A;  3MSE B;  2WND A;  1WRZ A;  3CZ2 A;  1OMR A;  2KFG A;  2PAS A;  1SR6 C;  1A29 A;  3FWB A;  3BUX B;  4C0L A;  2JWW A;  3KO0 A;  3L4A A;  1ZUZ A;  2Q4U A;  2ZN9 A;  1CDP A;  1TCO B;  3V2L A;  5I8N A;  1CDL A;  1J55 A;  1DVI A;  2JT3 A;  2KAX A;  2EGD A;  2WCL A;  4MZL A;  5AEQ A;  1DEK A;  1NIW A;  2AAO A;  3HX4 A;  3UO9 A;  1UHK A;  2K7C A;  5IBW A;  1UWO A;  1ZMZ A;  1SL9 A;  3WHT B;  2BCA A;  3ICB A;  4QJ3 B;  4YBH B;  1Y1A A;  2K7O A;  2ZKM X;  3VRO A;  2BKI B;  3UNW A;  2ISD A;  1B7T Z;  2CBL A;  2G9B A;  2KYF A;  2GTE A;  2FCD A;  5HYD A;  5FI2 A;  4PT1 A;  3TZ1 A;  1GJY A;  2L5X B;  3CZ0 A;  3SS4 A;  3KEV A;  2CNP A;  3VB1 A;  2JTZ A;  2RGI A;  5I94 A;  1OOG A;  1FPW A;  3BFH A;  2LP2 A;  2GGZ A;  3DF0 A;  1R2U A;  4PHN A;  1A03 A;  2DOQ A;  4NDB A;  3EVV A;  2I94 A;  4PHM A;  1XFV O;  1Z2C B;  3FWC A;  2JZI A;  2VRG A;  2BE6 A;  1QLS A;  2KYC A;  1DF0 B;  3IF7 A;  3PM8 A;  5HKZ A;  2M7L A;  1IIO A;  3A8R A;  1A4P A;  1SY9 A;  2OTG C;  1TIZ A;  2PMY A;  4ICB A;  3RLZ A;  1CTR A;  4M2P A;  2YGU A;  2LC5 A;  4NQG A;  1IG5 A;  3H4S E;  1NYA A;  3SG6 A;  1S36 A;  1B7T Y;  1TCF A;  2NXQ A;  3F45 A;  2L2E A;  2LMV A;  4JKT A;  4YGD B;  5D3O A;  4BY5 A;  3EK4 A;  4FQT A;  2M3W A;  1NSH A;  1C3Z A;  3AAJ A;  1F71 A;  2BCB A;  4Q04 A;  5PAL A;  1OZO A;  2K7B A;  3O2P A;  2K2F A;  4JWQ A;  4MZJ A;  4YI9 A;  3SG7 A;  1KQM C;  2QDI A;  3FS7 A;  2NCP A;  1MF8 B;  1SNL A;  1WDC B;  3NSK A;  4TNC A;  1W9Z A;  2PRU A;  1LA3 A;  1M46 A;  3I5F B;  3CR4 X;  1NPQ A;  4AQJ A;  1JWD A;  3BQ3 A;  1A75 B;  1DGU A;  1ORG A;  4UPG A;  1Z4H A;  1RWY A;  1S1E A;  2LNK A;  1C7V A;  2Y4Q A;  3JVT B;  2LAN A;  2MJW B;  1SK6 D;  1SCM C;  4GGN A;  2KSP A;  1G4Y R;  4ZCV A;  3BFA A;  3ZWH A;  1NUB A;  1OOI X;  1K90 D;  3LCP C;  5HKY A;  3I5G C;  1BR4 B;  1SMG A;  4YRU A;  1IH0 A;  1KFU S;  4AQI A;  3PAT A;  3TDI A;  1QX2 A;  1KK7 Z;  1S6I A;  2KNE A;  2JPO A;  2NZ0 A;  1TRF A;  2JOJ A;  1ZFS A;  4MRY A;  2CTN A;  2A4J A;  1QV1 A;  1F4O A;  1BOC A;  1C7W A;  1BMO A;  3O4X A;  3NXA A;  2LLU A;  2WC5 A;  3AAK A;  2ZRS A;  4PCW A;  1YUT A;  2WCJ A;  1JUO A;  3SIB A;  1CFC A;  3FE8 A;  4YGC B;  1Y1U A;  2E6W A;  5FYX A;  1IJ5 A;  2M8U A;  4FQO A;  4DRW A;  3BYA A;  2M1U A;  3BUM B;  4MZK A;  2K61 A;  2M7N A;  1Y0V H;  3SG4 A;  4OR9 B;  2I7A A;  1TUJ A;  1YVL A;  1YUU A;  1SL8 A;  4C0J A;  4CID A;  1CKK A;  2Q91 A;  4I5K A;  2K0J A;  3O4Y A;  2PYQ A;  3VGO A;  3B6X A;  2MA2 A;  2OS8 B;  1R6P A;  1GGZ A;  3BFB A;  2KDH A;  1UHH A;  1KK7 Y;  2L51 A;  1CFP A;  1UUR A;  3PSR A;  5JOL A;  2MLF C;  5AFP A;  1E8A A;  1K94 A;  1XK4 A;  3S0A A;  3CR5 X;  3I5I B;  1L2O C;  1WRL A;  3WXA A;  2WC8 A;  2BL0 C;  2HQW A;  4FTG A;  1DTL A;  3LK1 A;  3TUY B;  1QLK A;  1XA5 A;  2F8P A;  1K93 D;  3DY9 A;  1L7Z A;  1B9A A;  5CSN A;  1KSO A;  5FI6 A;  2E30 A;  1TWO A;  3S0E A;  1SW8 A;  1C3Y A;  2AUC A;  1REC A;  3DD4 A;  5KTY A;  2P71 A;  4AOM A;  5AAN A;  4N1G A;  1TNQ A;  2K8M B;  2LVJ A;  1PVB A;  1RFJ A;  2LUX A;  1OE9 B;  4I5J A;  5F6T A;  5I2O A;  1UHJ A;  1CNP A;  2BKH B;  1YRU B;  1JBA A;  3O78 A;  3M0W A;  3VRN A;  1FW4 A;  2FJY A;  2P6B B;  3OGN A;  4N5X A;  1MXE A;  2H2K A;  1JSA A;  2PQL A;  1QAT A;  1H8B A;  1KCY A;  3DVM A;  1M45 A;  1QV0 A;  2ZNE A;  4XJK A;  1HT9 A;  1SYM A;  3TDZ A;  1WLM A;  2KLD A;  1KK8 B;  2COL B;  2H61 C;  3B7A A;  1ZAC A;  4U8D A;  1RTP 1;  1QVI Z;  2NLN A;  3R1O A;  4HSZ A;  2OPO A;  3FIA A;  1BOD A;  1NCY A;  1EG3 A;  1BR1 B;  2JRF A;  3LL8 B;  1CFD A;  5D69 A;  5ER5 A;  2L2C A;  3CDN A;  2QAC A;  1UUS A;  2V53 A;  2KPH A;  1DC1 A;  1BJF A;  2Y1N A;  3S0F A;  1LIN A;  2ERB A;  5DKN A;  4BY4 A; 
#chains in the Genus database with same CATH homology
 1DEL A;  4GAO A;  4I5L B;  3UNW A;  2BNX A;  4I5J A;  2K60 A;  2KLE A;  5HL1 A;  3IVT A;  4I5K A;  4JKT A;  5D3O A;  5FI2 A;  3SS4 A;  3SS5 A;  5FI7 A;  3KEV A;  4GBA A;  4KYN A;  5I94 A;  4MEW A;  3OBV A;  4I5N B;  2KLD A;  3O4X A;  4IJ7 A;  1W9Z A;  1Z2C B;  1DEK A;  3UO9 A;  3SS3 A;  5FI6 A;  2L5Y A;  3PM2 A;  3EG5 B;  1Z4H A;  1DC1 A;  2YGU A;  2BAP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...