4IJ7A

Crystal structure of odorant binding protein 48 from anopheles gambiae (agamobp48) with peg
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
172
structure length
172
Chain Sequence
b'GDNPCAAGPPVDTNPAECCPKPMLVDGTIMMDCYKKYGEQTKKQLQMDGIPRGCCIAECAMNATNMYADGMLKRDDLSKMFMDAVKDKPEWMSLVRDATNACFELAEKKMDEIEAGAKLEPSFEGEKICHPISGTILRCMGMMMFAQCPASVFNVNENCNKLREYGSICPMI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Odorant binding protein-8
publication title Crystal and Solution Studies of the "Plus-C" Odorant-binding Protein 48 from Anopheles gambiae: CONTROL OF BINDING SPECIFICITY THROUGH THREE-DIMENSIONAL DOMAIN SWAPPING.
pubmed doi rcsb
source organism Anopheles gambiae
molecule tags Transport protein
total genus 52
structure length 172
sequence length 172
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.270 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Recoverin; domain 1 4ij7A00
4IJ7A 4KYNA 3PM2A
chains in the Genus database with same CATH superfamily
1DF0A 2KI6D 4NDCA 4DCKA 3PFVA 1C07A 2E6WA 2BCAA 4MSPA 3AAKA 1K9KA 1XFVO 2CCMA 2HETA 1CLLA 5J3XA 2Y1NA 1GGWA 1TCFA 2G9BA 4PCWA 1K8UA 1GGZA 1CDMA 5AEQA 4INXA 2JOJA 1SK6D 5CSIA 3DVMA 1F70A 1EH2A 4HRGA 1CM1A 4PE0A 5AFPA 1CFFA 3CLNA 2JT8A 1DTLA 4P2YB 4ZCUA 5HYDA 2KYCA 2LHIA 2M9GA 3SJSA 2KAXA 3DZTA 3FS7A 3D0YA 3CZ1A 3BJHA 3JTDB 1AP4A 2CT9A 1DJYA 3OX6A 3S0DA 2PQLA 1CLBA 2V53A 1LINA 1NCYA 1AJ4A 3I5GB 3WHTB 1F8HA 2LV7A 1K9PA 1M46A 2E30A 5CSFA 3ZWHA 1YRUB 1PVAA 3FE9A 4C0LA 1M39A 1WDCB 1ALWA 1SSEB 3O4XA 1OOIX 1IG5A 1S5GY 3SS3A 3KO0A 1A2XA 1GM0A 1F54A 4N5XA 1CFDA 1Y1XA 1XFUO 4INWA 1BR1B 1A29A 1G33A 4PHNA 1DJGA 3TUYC 4E68A 1LS8A 1DGVA 2PALA 5CSJA 3L4AA 1N0YA 3CZTX 1GJYA 4ZCVA 3LLEA 3BYAA 1NPQA 3EVUA 1BR4B 2WCHA 1CKKA 3IQOA 1Q80A 2JXLA 3DYEA 4M2PA 4M2OA 2M7LA 1YURA 2JPTA 2O5GA 2WNDA 2ZN9A 4KYNA 1YVHA 3CR5X 2OTGC 3CDNA 3PATA 1NIWA 4YI9A 1J1DA 2ISDA 4DUQA 1UHKA 2CBLA 2JNXA 1S1EA 2K7CA 4FQTA 4N1GA 3BUMB 4MLWA 3S0FA 2NCOA 1J55A 3DF0A 2JQ6A 2BCXA 4QJ3B 2WCKA 1BJFA 1Y1UA 4GGFA 5I2LA 1UHIA 2F3ZA 3S0BA 2JU0A 3FE6A 2QEOA 2KSPA 2NZ0A 2BE6A 3EVVA 5DKRA 1B8RA 2M7NA 3I5HB 1DMOA 1CLMA 2GGMA 1BT6A 2M8UA 3FWCA 2K8MB 1OW4A 3OX5A 1MWNA 2PASA 1U5IB 3OB2B 1QV1A 3SS5A 1MQ1A 4GAOA 1XYDA 2LANA 1YUUA 1OSAA 3CYZA 1XO5A 2KDHA 2L4IA 3A8RA 2L5XB 4GPLB 5I2QA 1BMOA 5I2OA 1C3ZA 2EHBA 1BU3A 4PT1A 2H61A 1OZSA 1QVIY 3R1PA 1K96A 1SYMA 1DELA 3VRNA 2JZIA 1NYAA 2JT0A 1QTXA 4JPZB 1CDLA 1DF0B 3O6BA 1KK8B 3PJIA 4ORAB 4OKHA 5HL1A 1IJ5A 3UO9A 3BXKA 3CTNA 4PHKA 3SG6A 1D1OA 1B7TY 2MJWB 3SIBA 3LCPC 2JXCA 1TRFA 5PALA 1ALVA 3OP0A 2JC2A 4MVFA 1CFPA 4QJ5B 2OS8C 1DVIA 1S26D 3D77A 3PALA 3SG5A 1NSHA 3N7HA 4U8DA 4YGBB 2SCPA 2NXQA 1CFCA 2L2CA 4IJ7A 2KBIA 2CNPA 3D0YB 3BFBA 1J7OA 1L7ZA 3GK2A 1CMGA 2BBNA 3QMEA 4MEWA 1SCMC 4USLA 5JJGA 5AXIA 2K0JA 2KAYA 2LCPA 4QJ4B 1AK8A 1IKUA 3PN7C 3PSRA 2HQWA 2Y1MA 1G8IA 2B1UA 1ZFSA 1SMGA 1T14A 4PE7A 1TUZA 1OMVA 1W9ZA 1H8BA 1MR8A 4YRUA 1RFJA 2G2BA 1K9UA 1TN4A 5BPJA 1KQMB 3O2PA 1PSRA 3DY9A 1PALA 2Q91A 3KHEA 3LK0A 4GFTA 1KFUS 5F6TA 1NP8A 1A4PA 1V1FA 1UUSA 1DC1A 1AJ5A 3EKHA 5KTYA 2I7AA 2JWWA 1E8AA 1QASA 1YR5A 3NSIA 3MSEB 3SG7A 4WRIA 1OOFA 3QRXA 1QV0A 4CIDA 1UWOA 2QEBA 3B88A 2KGRA 3O4YA 4GGNA 1CMFA 5FI7A 3VGOA 2CXJA 2L4HA 3EK4A 5HKZA 2JPOA 3F45A 2F33A 1WY9A 1NWDA 2LHLA 3AKAA 4JQ0D 4ORCB 5HLOA 5IBWA 4N1FA 4DRWA 1W7IB 5FI6A 2LLUA 2BL0B 1IIOA 1F4OA 2FJUB 3IQQA 2KI4B 3GK1A 4GGFC 4CFRA 3RZSA 3EKJA 2QACA 1TIZA 3B86A 2GTEA 1CDPA 3FIAA 3RLZA 4MN0A 1SRAA 2KLDA 3DF0B 2HF5A 5I94A 3JVTC 4I5NB 3RM1A 2QEHA 1NX0A 1RK9A 5AERA 2P70A 4IL1A 4C0JA 2Q4UA 3GK4X 1RECA 2KOTA 4I5KA 3CGAA 1OOHA 3KPXA 2LUXA 4C0KA 1KFXL 4DS7A 3BUOB 1BF5A 1SR6C 1WLZA 4JD9A 2LE9B 3B6XA 3IVTA 2M1UA 2H61C 2LVKA 1B9AA 3CZ0A 4CFQA 3I5IC 1UP5A 3WHUB 1R2UA 3D73A 1HT9A 1BOCA 2O60A 2WC8A 1J7PA 5KU1A 1DEKA 1OMRA 2KI6C 2QEVA 5DKQA 2F3YA 3EG5B 2CTNA 4PDZA 3V2LA 5ER4X 5DICA 4ETOA 2AMIA 1BLQA 2OTGB 1M31A 1PVBA 1KFXS 4A4BA 2LMUA 3C1VA 4OZDA 3TS5C 1J1EA 1SKTA 2OPOA 1DJWA 2L0PA 2ZNEA 2IS9A 1MXEA 1A03A 2JRFA 1KK7Z 1MUXA 1SL7A 1ODBA 2LVVA 3I5FB 4ICBA 2R2IA 3S0GA 3SIAA 1SY9A 2BNXA 4TNCA 1QATA 1P28A 2K61A 4PE4A 1YX7A 1LVCD 3AAJA 1OMDA 3OBVA 2D8NA 1OOJA 1EG4A 2L5YA 2F8PA 2LC5A 1L2OC 1DJIA 2L2EA 2LVIA 1Y0VH 1QIWA 4YGEB 1JF0A 3NSKA 2BAPA 5HKWA 4JWQA 1B8CA 1GQMA 1UURA 1K90D 2ERBA 3NSOA 3BUXB 2M1KB 2LAPA 1LA3A 2KBMA 3R1VA 1XK4C 5D7FA 3PM2A 1MHOA 2KYFA 4MZLA 4NDBA 1EG3A 2BBMA 1KQVA 3HCMA 4PHJA 1DQEA 1YVLA 2WCLA 2YGUA 3DVKA 4GBAA 3OHMB 2H2KA 3A4UB 1JBAA 2KLEA 3D78A 1JF2A 1QLKA 1SL9A 1A75A 2LP2A 2P6BB 1K2HA 1OZOA 1KWOC 2L50A 1S36A 1UHNA 5GQQC 2RGIA 1JWDA 2BE4A 5HLVA 3B87A 1EJ3A 4WQ3A 1AHRA 3D74A 5G08A 1IRJA 3E3RA 4MZJA 1FF1A 1DT7B 3BUNB 2FCEA 4OV2A 1CDNA 1FW4A 3TDUA 1DJHA 1RJVA 3NHTA 1KSMA 1ORGA 2OS8B 1NX1A 1CB1A 1ZUZA 3EK8A 3WXAA 1KFUL 1MXLC 1XFRA 2LMVA 2WOSA 4WQ2A 3SG3A 1H4BA 3TDIA 4HRHA 3LK1A 2I2RE 1IQ5A 5EL2A 4YGAA 1FI5A 1EL4A 3R72A 2KNEA 5TNCA 2KHNA 2K60A 4OVNF 1SCMB 3B7AA 1XK4A 2WC6A 2EC6B 1IJ6A 3PN7B 1SNLA 3BFHA 4YI8A 3SG4A 3BUWB 1YTZC 4AQJA 2KGBC 2PYQA 2ZFDA 1U5IA 3L47A 1AUIB 3KEVA 1C7WA 5ER5A 2PRUA 3D75A 3WNXB 5FYXA 3S0EA 1QLSA 2MA2A 3EK7A 4XJKA 2AAOA 2M97A 3OGNA 1QX2A 2WCFA 1SL8A 4R1EA 3TZ1A 4CPVA 3ICBA 2MHHA 1ZOTB 1DGUA 2EGDA 2F2PA 1FPWA 2JULA 3CR2A 4XYNA 3DXLA 1VRKA 1N65A 3GOFA 1S6IA 1S6JA 1QXPA 2WCMA 1TUJA 4I5LB 4NDDA 2A4JA 1F4QA 5K89A 1QS7A 4BY5A 2L98A 2Y4QA 4UPGA 1JSAA 3SG2A 4HSZA 3NHIA 2KQ6A 4FTGA 2WC5A 1CTRA 3JTDC 4MRYA 1QWVA 2F2OA 4YGDB 1YX8A 2LP3A 3AKBA 2M49B 1V1GA 3BOWA 3D76A 3I5GC 1NCXA 3Q8IA 3NXAA 3UNWA 2BKIB 3JVTB 1ZMZA 1S6CA 2BL0C 2L51A 1WDCC 1WRKA 2LLSA 4YGCB 2KI4C 2KFHA 1B8LA 1TNPA 2GV5A 1JFKA 1EXRA 1Z4HA 3M0WA 3TUYB 1C3YA 4NQGA 1M63B 3LL8B 3VRQA 1PULA 1XVJA 2MBXA 2LM5A 3DVEA 1SR6B 1PRWA 1OQPA 2KPHA 4FQOA 3VRRA 4I5JA 1KK7Y 1XFYO 2PVBA 1TOPA 3I5IB 1FI6A 1J7QA 5HKYA 1B47A 4OR9B 2KFFA 2ZRTA 3CS1A 4HREE 1IWQA 1RTP1 4CLNA 1S5GZ 2JT3A 3CR4X 1YUTA 2ZNDA 4Q04A 1A75B 1BG1A 1N2DA 2M3WA 3SS4A 1KCYA 2I18A 2QDIA 4MZKA 5DKNA 1XFXO 1F71A 3CABA 2K2FA 1SCVA 1WRLA 2GGZA 4L9MA 2BECA 3TS5B 1Y6WA 2LMTA 2TN4A 2Y5IA 5B8IB 1LXFC 3OB1B 1OOGA 2FJYA 3K21A 1OE9B 1BODA 1TNWA 2H8VA 4BY4A 1JUOA 4A4CA 1QJTA 1KSOA 5CSNA 2NCPA 1QIVA 2K2AA 2COLB 2BKHB 5AANA 3NGVA 1DJZA 1DJXA 1L2OB 3I5FC 3IF7A 2LUCA 2BCBA 1HQVA 3TDZA 4PALA 2NLNA 4MRXA 3ZNIA 2WCJA 3O78A 4GNKB 1TWOA 3I5HC 2ZRSA 1PSBA 3DVJA 3K1EA 3VROA 5KSZA 1RROA 1IH0A 3VB1A 3VRPA 3FWBA 4YBHB 1JFJA 1XFZO 2HPSA 5FI2A 1C7VA 3HX4A 1SPYA 3PLFB 4M2QA 1AVSA 1F55A 3CZ2A 4F7FA 2K7OA 2AUCA 3DD4A 1NX2A 3EVRA 2JTZA 2M0RA 2ZN8A 3CWGA 1B1GA 2PMYA 3NSLA 2LNKA 1WLMA 2SASA 1KWOB 1MF8B 2KAVA 4XJKB 1G4YR 2LVJA 4JKTA 4GUKA 5I8NA 1TNQA 2I94A 2HQ8A 1QX7A 1KK8C 1CM4A 2FCDA 2MLEC 4MBEA 4PE1A 1B4CA 1LKJA 1R6PA 1W7JB 3L4LA 1NCZA 1WRZA 1ZACA 2P71A 1XFWO 1NUBA 2KQYA 1IQ3A 1LA0A 1K94A 1FBVA 4OCIA 5CPVA 1UHHA 3FE8A 2MAZA 1QVIZ 2WORA 2VRGA 2WCBA 2ZKMX 1TCOB 5JOLA 3R1OA 1CNPA 1Y1AA 3S0AA 1QX5B 2KFGA 2LLTA 1JC2A 1X02A 1K93D 2WCEA 3D10A 3PM8A 1YRTB 4AOMA 2FOTA 1Z2CB 2MLFC 4P5OE 1J7RA 1M45A 1TTXA 4PHMA 5D69A 2K7BA 4F0ZB 1B7TZ 1TNXA 4DIRA 1UHJA 1RWYA 1PK0D 1NX3A 1SW8A 2MRDA 2PSRA 3BOWB 5D3OA 2M29A 2EC6C 3BQ3A 2JNFA 1S3PA 2QPTA 1IGVA 4ORBB 2K7DA 4AQIA 3H4SE 3BFAA 1KQMC 4D1EA 3KF9A 1XA5A 2DOQA 1YUSA 1K95A 2JTTA 1SBJA
chains in the Genus database with same CATH topology
2BNXA 1Z4HA 2KLEA 4I5LB 3OBVA 3IVTA 2L5YA 5FI6A 3SS5A 4GAOA 4KYNA 1Z2CB 3O4XA 3KEVA 2BAPA 3SS3A 3UO9A 4I5JA 1DC1A 4JKTA 4IJ7A 2KLDA 1DEKA 5I94A 4I5NB 3PM2A 3EG5B 5D3OA 1DELA 4MEWA 5FI7A 3UNWA 4I5KA 3SS4A 1W9ZA 2YGUA 5HL1A 4GBAA 2K60A 5FI2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IJ7 A;  4KYN A;  3PM2 A; 
#chains in the Genus database with same CATH topology
 1DF0 A;  2KI6 D;  4NDC A;  4DCK A;  3PFV A;  1C07 A;  2E6W A;  2BCA A;  4MSP A;  3AAK A;  1K9K A;  1XFV O;  2CCM A;  2HET A;  1CLL A;  5J3X A;  2Y1N A;  1GGW A;  1TCF A;  2G9B A;  4PCW A;  1K8U A;  1GGZ A;  1CDM A;  5AEQ A;  4INX A;  2JOJ A;  1SK6 D;  5CSI A;  3DVM A;  1F70 A;  1EH2 A;  4HRG A;  1CM1 A;  4PE0 A;  5AFP A;  1CFF A;  3CLN A;  2JT8 A;  1DTL A;  4P2Y B;  4ZCU A;  5HYD A;  2KYC A;  2LHI A;  2M9G A;  3SJS A;  2KAX A;  3DZT A;  3FS7 A;  3D0Y A;  3CZ1 A;  3BJH A;  3JTD B;  1AP4 A;  2CT9 A;  1DJY A;  3OX6 A;  3S0D A;  2PQL A;  1CLB A;  2V53 A;  1LIN A;  1NCY A;  1AJ4 A;  3I5G B;  3WHT B;  1F8H A;  2LV7 A;  1K9P A;  1M46 A;  2E30 A;  5CSF A;  3ZWH A;  1YRU B;  1PVA A;  3FE9 A;  4C0L A;  1M39 A;  1WDC B;  1ALW A;  1SSE B;  3O4X A;  1OOI X;  1IG5 A;  1S5G Y;  3SS3 A;  3KO0 A;  1A2X A;  1GM0 A;  1F54 A;  4N5X A;  1CFD A;  1Y1X A;  1XFU O;  4INW A;  1BR1 B;  1A29 A;  1G33 A;  4PHN A;  1DJG A;  3TUY C;  4E68 A;  1LS8 A;  1DGV A;  2PAL A;  5CSJ A;  3L4A A;  1N0Y A;  3CZT X;  1GJY A;  4ZCV A;  3LLE A;  3BYA A;  1NPQ A;  3EVU A;  1BR4 B;  2WCH A;  1CKK A;  3IQO A;  1Q80 A;  2JXL A;  3DYE A;  4M2P A;  4M2O A;  2M7L A;  1YUR A;  2JPT A;  2O5G A;  2WND A;  2ZN9 A;  4KYN A;  1YVH A;  3CR5 X;  2OTG C;  3CDN A;  3PAT A;  1NIW A;  4YI9 A;  1J1D A;  2ISD A;  4DUQ A;  1UHK A;  2CBL A;  2JNX A;  1S1E A;  2K7C A;  4FQT A;  4N1G A;  3BUM B;  4MLW A;  3S0F A;  2NCO A;  1J55 A;  3DF0 A;  2JQ6 A;  2BCX A;  4QJ3 B;  2WCK A;  1BJF A;  1Y1U A;  4GGF A;  5I2L A;  1UHI A;  2F3Z A;  3S0B A;  2JU0 A;  3FE6 A;  2QEO A;  2KSP A;  2NZ0 A;  2BE6 A;  3EVV A;  5DKR A;  1B8R A;  2M7N A;  3I5H B;  1DMO A;  1CLM A;  2GGM A;  1BT6 A;  2M8U A;  3FWC A;  2K8M B;  1OW4 A;  3OX5 A;  1MWN A;  2PAS A;  1U5I B;  3OB2 B;  1QV1 A;  3SS5 A;  1MQ1 A;  4GAO A;  1XYD A;  2LAN A;  1YUU A;  1OSA A;  3CYZ A;  1XO5 A;  2KDH A;  2L4I A;  3A8R A;  2L5X B;  4GPL B;  5I2Q A;  1BMO A;  5I2O A;  1C3Z A;  2EHB A;  1BU3 A;  4PT1 A;  2H61 A;  1OZS A;  1QVI Y;  3R1P A;  1K96 A;  1SYM A;  1DEL A;  3VRN A;  2JZI A;  1NYA A;  2JT0 A;  1QTX A;  4JPZ B;  1CDL A;  1DF0 B;  3O6B A;  1KK8 B;  3PJI A;  4ORA B;  4OKH A;  5HL1 A;  1IJ5 A;  3UO9 A;  3BXK A;  3CTN A;  4PHK A;  3SG6 A;  1D1O A;  1B7T Y;  2MJW B;  3SIB A;  3LCP C;  2JXC A;  1TRF A;  5PAL A;  1ALV A;  3OP0 A;  2JC2 A;  4MVF A;  1CFP A;  4QJ5 B;  2OS8 C;  1DVI A;  1S26 D;  3D77 A;  3PAL A;  3SG5 A;  1NSH A;  3N7H A;  4U8D A;  4YGB B;  2SCP A;  2NXQ A;  1CFC A;  2L2C A;  4IJ7 A;  2KBI A;  2CNP A;  3D0Y B;  3BFB A;  1J7O A;  1L7Z A;  3GK2 A;  1CMG A;  2BBN A;  3QME A;  4MEW A;  1SCM C;  4USL A;  5JJG A;  5AXI A;  2K0J A;  2KAY A;  2LCP A;  4QJ4 B;  1AK8 A;  1IKU A;  3PN7 C;  3PSR A;  2HQW A;  2Y1M A;  1G8I A;  2B1U A;  1ZFS A;  1SMG A;  1T14 A;  4PE7 A;  1TUZ A;  1OMV A;  1W9Z A;  1H8B A;  1MR8 A;  4YRU A;  1RFJ A;  2G2B A;  1K9U A;  1TN4 A;  5BPJ A;  1KQM B;  3O2P A;  1PSR A;  3DY9 A;  1PAL A;  2Q91 A;  3KHE A;  3LK0 A;  4GFT A;  1KFU S;  5F6T A;  1NP8 A;  1A4P A;  1V1F A;  1UUS A;  1DC1 A;  1AJ5 A;  3EKH A;  5KTY A;  2I7A A;  2JWW A;  1E8A A;  1QAS A;  1YR5 A;  3NSI A;  3MSE B;  3SG7 A;  4WRI A;  1OOF A;  3QRX A;  1QV0 A;  4CID A;  1UWO A;  2QEB A;  3B88 A;  2KGR A;  3O4Y A;  4GGN A;  1CMF A;  5FI7 A;  3VGO A;  2CXJ A;  2L4H A;  3EK4 A;  5HKZ A;  2JPO A;  3F45 A;  2F33 A;  1WY9 A;  1NWD A;  2LHL A;  3AKA A;  4JQ0 D;  4ORC B;  5HLO A;  5IBW A;  4N1F A;  4DRW A;  1W7I B;  5FI6 A;  2LLU A;  2BL0 B;  1IIO A;  1F4O A;  2FJU B;  3IQQ A;  2KI4 B;  3GK1 A;  4GGF C;  4CFR A;  3RZS A;  3EKJ A;  2QAC A;  1TIZ A;  3B86 A;  2GTE A;  1CDP A;  3FIA A;  3RLZ A;  4MN0 A;  1SRA A;  2KLD A;  3DF0 B;  2HF5 A;  5I94 A;  3JVT C;  4I5N B;  3RM1 A;  2QEH A;  1NX0 A;  1RK9 A;  5AER A;  2P70 A;  4IL1 A;  4C0J A;  2Q4U A;  3GK4 X;  1REC A;  2KOT A;  4I5K A;  3CGA A;  1OOH A;  3KPX A;  2LUX A;  4C0K A;  1KFX L;  4DS7 A;  3BUO B;  1BF5 A;  1SR6 C;  1WLZ A;  4JD9 A;  2LE9 B;  3B6X A;  3IVT A;  2M1U A;  2H61 C;  2LVK A;  1B9A A;  3CZ0 A;  4CFQ A;  3I5I C;  1UP5 A;  3WHU B;  1R2U A;  3D73 A;  1HT9 A;  1BOC A;  2O60 A;  2WC8 A;  1J7P A;  5KU1 A;  1DEK A;  1OMR A;  2KI6 C;  2QEV A;  5DKQ A;  2F3Y A;  3EG5 B;  2CTN A;  4PDZ A;  3V2L A;  5ER4 X;  5DIC A;  4ETO A;  2AMI A;  1BLQ A;  2OTG B;  1M31 A;  1PVB A;  1KFX S;  4A4B A;  2LMU A;  3C1V A;  4OZD A;  3TS5 C;  1J1E A;  1SKT A;  2OPO A;  1DJW A;  2L0P A;  2ZNE A;  2IS9 A;  1MXE A;  1A03 A;  2JRF A;  1KK7 Z;  1MUX A;  1SL7 A;  1ODB A;  2LVV A;  3I5F B;  4ICB A;  2R2I A;  3S0G A;  3SIA A;  1SY9 A;  2BNX A;  4TNC A;  1QAT A;  1P28 A;  2K61 A;  4PE4 A;  1YX7 A;  1LVC D;  3AAJ A;  1OMD A;  3OBV A;  2D8N A;  1OOJ A;  1EG4 A;  2L5Y A;  2F8P A;  2LC5 A;  1L2O C;  1DJI A;  2L2E A;  2LVI A;  1Y0V H;  1QIW A;  4YGE B;  1JF0 A;  3NSK A;  2BAP A;  5HKW A;  4JWQ A;  1B8C A;  1GQM A;  1UUR A;  1K90 D;  2ERB A;  3NSO A;  3BUX B;  2M1K B;  2LAP A;  1LA3 A;  2KBM A;  3R1V A;  1XK4 C;  5D7F A;  3PM2 A;  1MHO A;  2KYF A;  4MZL A;  4NDB A;  1EG3 A;  2BBM A;  1KQV A;  3HCM A;  4PHJ A;  1DQE A;  1YVL A;  2WCL A;  2YGU A;  3DVK A;  4GBA A;  3OHM B;  2H2K A;  3A4U B;  1JBA A;  2KLE A;  3D78 A;  1JF2 A;  1QLK A;  1SL9 A;  1A75 A;  2LP2 A;  2P6B B;  1K2H A;  1OZO A;  1KWO C;  2L50 A;  1S36 A;  1UHN A;  5GQQ C;  2RGI A;  1JWD A;  2BE4 A;  5HLV A;  3B87 A;  1EJ3 A;  4WQ3 A;  1AHR A;  3D74 A;  5G08 A;  1IRJ A;  3E3R A;  4MZJ A;  1FF1 A;  1DT7 B;  3BUN B;  2FCE A;  4OV2 A;  1CDN A;  1FW4 A;  3TDU A;  1DJH A;  1RJV A;  3NHT A;  1KSM A;  1ORG A;  2OS8 B;  1NX1 A;  1CB1 A;  1ZUZ A;  3EK8 A;  3WXA A;  1KFU L;  1MXL C;  1XFR A;  2LMV A;  2WOS A;  4WQ2 A;  3SG3 A;  1H4B A;  3TDI A;  4HRH A;  3LK1 A;  2I2R E;  1IQ5 A;  5EL2 A;  4YGA A;  1FI5 A;  1EL4 A;  3R72 A;  2KNE A;  5TNC A;  2KHN A;  2K60 A;  4OVN F;  1SCM B;  3B7A A;  1XK4 A;  2WC6 A;  2EC6 B;  1IJ6 A;  3PN7 B;  1SNL A;  3BFH A;  4YI8 A;  3SG4 A;  3BUW B;  1YTZ C;  4AQJ A;  2KGB C;  2PYQ A;  2ZFD A;  1U5I A;  3L47 A;  1AUI B;  3KEV A;  1C7W A;  5ER5 A;  2PRU A;  3D75 A;  3WNX B;  5FYX A;  3S0E A;  1QLS A;  2MA2 A;  3EK7 A;  4XJK A;  2AAO A;  2M97 A;  3OGN A;  1QX2 A;  2WCF A;  1SL8 A;  4R1E A;  3TZ1 A;  4CPV A;  3ICB A;  2MHH A;  1ZOT B;  1DGU A;  2EGD A;  2F2P A;  1FPW A;  2JUL A;  3CR2 A;  4XYN A;  3DXL A;  1VRK A;  1N65 A;  3GOF A;  1S6I A;  1S6J A;  1QXP A;  2WCM A;  1TUJ A;  4I5L B;  4NDD A;  2A4J A;  1F4Q A;  5K89 A;  1QS7 A;  4BY5 A;  2L98 A;  2Y4Q A;  4UPG A;  1JSA A;  3SG2 A;  4HSZ A;  3NHI A;  2KQ6 A;  4FTG A;  2WC5 A;  1CTR A;  3JTD C;  4MRY A;  1QWV A;  2F2O A;  4YGD B;  1YX8 A;  2LP3 A;  3AKB A;  2M49 B;  1V1G A;  3BOW A;  3D76 A;  3I5G C;  1NCX A;  3Q8I A;  3NXA A;  3UNW A;  2BKI B;  3JVT B;  1ZMZ A;  1S6C A;  2BL0 C;  2L51 A;  1WDC C;  1WRK A;  2LLS A;  4YGC B;  2KI4 C;  2KFH A;  1B8L A;  1TNP A;  2GV5 A;  1JFK A;  1EXR A;  1Z4H A;  3M0W A;  3TUY B;  1C3Y A;  4NQG A;  1M63 B;  3LL8 B;  3VRQ A;  1PUL A;  1XVJ A;  2MBX A;  2LM5 A;  3DVE A;  1SR6 B;  1PRW A;  1OQP A;  2KPH A;  4FQO A;  3VRR A;  4I5J A;  1KK7 Y;  1XFY O;  2PVB A;  1TOP A;  3I5I B;  1FI6 A;  1J7Q A;  5HKY A;  1B47 A;  4OR9 B;  2KFF A;  2ZRT A;  3CS1 A;  4HRE E;  1IWQ A;  1RTP 1;  4CLN A;  1S5G Z;  2JT3 A;  3CR4 X;  1YUT A;  2ZND A;  4Q04 A;  1A75 B;  1BG1 A;  1N2D A;  2M3W A;  3SS4 A;  1KCY A;  2I18 A;  2QDI A;  4MZK A;  5DKN A;  1XFX O;  1F71 A;  3CAB A;  2K2F A;  1SCV A;  1WRL A;  2GGZ A;  4L9M A;  2BEC A;  3TS5 B;  1Y6W A;  2LMT A;  2TN4 A;  2Y5I A;  5B8I B;  1LXF C;  3OB1 B;  1OOG A;  2FJY A;  3K21 A;  1OE9 B;  1BOD A;  1TNW A;  2H8V A;  4BY4 A;  1JUO A;  4A4C A;  1QJT A;  1KSO A;  5CSN A;  2NCP A;  1QIV A;  2K2A A;  2COL B;  2BKH B;  5AAN A;  3NGV A;  1DJZ A;  1DJX A;  1L2O B;  3I5F C;  3IF7 A;  2LUC A;  2BCB A;  1HQV A;  3TDZ A;  4PAL A;  2NLN A;  4MRX A;  3ZNI A;  2WCJ A;  3O78 A;  4GNK B;  1TWO A;  3I5H C;  2ZRS A;  1PSB A;  3DVJ A;  3K1E A;  3VRO A;  5KSZ A;  1RRO A;  1IH0 A;  3VB1 A;  3VRP A;  3FWB A;  4YBH B;  1JFJ A;  1XFZ O;  2HPS A;  5FI2 A;  1C7V A;  3HX4 A;  1SPY A;  3PLF B;  4M2Q A;  1AVS A;  1F55 A;  3CZ2 A;  4F7F A;  2K7O A;  2AUC A;  3DD4 A;  1NX2 A;  3EVR A;  2JTZ A;  2M0R A;  2ZN8 A;  3CWG A;  1B1G A;  2PMY A;  3NSL A;  2LNK A;  1WLM A;  2SAS A;  1KWO B;  1MF8 B;  2KAV A;  4XJK B;  1G4Y R;  2LVJ A;  4JKT A;  4GUK A;  5I8N A;  1TNQ A;  2I94 A;  2HQ8 A;  1QX7 A;  1KK8 C;  1CM4 A;  2FCD A;  2MLE C;  4MBE A;  4PE1 A;  1B4C A;  1LKJ A;  1R6P A;  1W7J B;  3L4L A;  1NCZ A;  1WRZ A;  1ZAC A;  2P71 A;  1XFW O;  1NUB A;  2KQY A;  1IQ3 A;  1LA0 A;  1K94 A;  1FBV A;  4OCI A;  5CPV A;  1UHH A;  3FE8 A;  2MAZ A;  1QVI Z;  2WOR A;  2VRG A;  2WCB A;  2ZKM X;  1TCO B;  5JOL A;  3R1O A;  1CNP A;  1Y1A A;  3S0A A;  1QX5 B;  2KFG A;  2LLT A;  1JC2 A;  1X02 A;  1K93 D;  2WCE A;  3D10 A;  3PM8 A;  1YRT B;  4AOM A;  2FOT A;  1Z2C B;  2MLF C;  4P5O E;  1J7R A;  1M45 A;  1TTX A;  4PHM A;  5D69 A;  2K7B A;  4F0Z B;  1B7T Z;  1TNX A;  4DIR A;  1UHJ A;  1RWY A;  1PK0 D;  1NX3 A;  1SW8 A;  2MRD A;  2PSR A;  3BOW B;  5D3O A;  2M29 A;  2EC6 C;  3BQ3 A;  2JNF A;  1S3P A;  2QPT A;  1IGV A;  4ORB B;  2K7D A;  4AQI A;  3H4S E;  3BFA A;  1KQM C;  4D1E A;  3KF9 A;  1XA5 A;  2DOQ A;  1YUS A;  1K95 A;  2JTT A;  1SBJ A; 
#chains in the Genus database with same CATH homology
 2BNX A;  1Z4H A;  2KLE A;  4I5L B;  3OBV A;  3IVT A;  2L5Y A;  5FI6 A;  3SS5 A;  4GAO A;  4KYN A;  1Z2C B;  3O4X A;  3KEV A;  2BAP A;  3SS3 A;  3UO9 A;  4I5J A;  1DC1 A;  4JKT A;  4IJ7 A;  2KLD A;  1DEK A;  5I94 A;  4I5N B;  3PM2 A;  3EG5 B;  5D3O A;  1DEL A;  4MEW A;  5FI7 A;  3UNW A;  4I5K A;  3SS4 A;  1W9Z A;  2YGU A;  5HL1 A;  4GBA A;  2K60 A;  5FI2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...