4IJ7A

Crystal structure of odorant binding protein 48 from anopheles gambiae (agamobp48) with peg
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
172
structure length
172
Chain Sequence
GDNPCAAGPPVDTNPAECCPKPMLVDGTIMMDCYKKYGEQTKKQLQMDGIPRGCCIAECAMNATNMYADGMLKRDDLSKMFMDAVKDKPEWMSLVRDATNACFELAEKKMDEIEAGAKLEPSFEGEKICHPISGTILRCMGMMMFAQCPASVFNVNENCNKLREYGSICPMI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal and Solution Studies of the "Plus-C" Odorant-binding Protein 48 from Anopheles gambiae: CONTROL OF BINDING SPECIFICITY THROUGH THREE-DIMENSIONAL DOMAIN SWAPPING.
pubmed doi rcsb
source organism Anopheles gambiae
molecule tags Transport protein
molecule keywords Odorant binding protein-8
total genus 52
structure length 172
sequence length 172
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.270 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Recoverin; domain 1 4ij7A00
4KYNA 4IJ7A 3PM2A
chains in the Genus database with same CATH superfamily
3RLZA 2JZIA 1KK8C 1YR5A 2QACA 2YGUA 1SCMC 4HREE 1NX2A 2HQWA 4YGEB 1SCVA 1WDCB 4FTGA 1GGWA 1KK8B 1UHJA 5FI2A 3WHUB 1Z4HA 2L5YA 2H61A 2K7DA 4MEWA 4WRIA 4ZCUA 1KFXL 1J7RA 1YRTB 3R1OA 1ALWA 2PVBA 2DOQA 2M3WA 1RK9A 2PRUA 4JQ0D 3BUMB 1IJ6A 4USLA 2PASA 1EH2A 3R72A 1UWOA 2WC6A 3KPXA 2P70A 2GGZA 4ICBA 4MLWA 1BR1B 2JU0A 1UUSA 2G2BA 1A2XA 5AXIA 1BODA 2KSPA 2MBXA 3CR4X 1IGVA 1K95A 5HKWA 1ALVA 2L2EA 1W9ZA 1JFKA 1Y1UA 4BY5A 4YI9A 1AJ4A 1OW4A 4YGBB 3TDUA 2QEBA 5CSJA 1NUBA 3K21A 2FCDA 2SCPA 3OHMB 5D7FA 1ZFSA 1IJ5A 2O5GA 3NHIA 3I5IC 1CB1A 1B7TY 1KWOC 1XFZO 1NCZA 1B1GA 2IS9A 1ZOTB 5HLOA 4WQ2A 4CPVA 1K9KA 2QEOA 4HRHA 5KTYA 1KFUS 4QJ5B 4JD9A 4DRWA 1BG1A 2LHLA 1IQ3A 2KNEA 2ZRSA 2K7BA 1DJWA 1TNQA 2K61A 3I5HC 1YX8A 2MRDA 5HYDA 5FYXA 3SG5A 4M2QA 2FCEA 1TNWA 4NDBA 4HSZA 2M0RA 3A8RA 1R6PA 3BUNB 4DCKA 3NGVA 2F2PA 3SS3A 4DUQA 3TUYC 3DZTA 2ZKMX 2KBIA 1X02A 2WCHA 1SK6D 3M0WA 3EVRA 3GK4X 1SL8A 3VGOA 1K96A 3BOWB 1NX1A 1CM4A 2CTNA 3R1PA 4JWQA 5DICA 5I94A 1YVHA 4OZDA 1YVLA 4PCWA 4N5XA 1S6CA 1KK7Z 2L2CA 1JFJA 2M7LA 1QIWA 4PE7A 1DQEA 2WORA 1XFUO 3B88A 2BCBA 2LE9B 3TS5C 3KF9A 1BU3A 1SPYA 2L51A 1HQVA 2M49B 2KAVA 5TNCA 3I5GC 5G08A 4A4BA 2OTGB 1N65A 2KFFA 1TOPA 2BAPA 2L4HA 2M1KB 2HF5A 2WNDA 2OS8C 1RFJA 4DIRA 1A75A 2FJUB 5AERA 3SG4A 3QMEA 1K8UA 3CR5X 3BJHA 1B8LA 1FI5A 2LC5A 2EGDA 2LCPA 2AUCA 2KLEA 1TIZA 2F2OA 1DJXA 2E6WA 1MR8A 2F33A 2ISDA 1S36A 1K2HA 4I5NB 1K94A 4M2OA 1QTXA 2KQYA 1P28A 3SG6A 1TNPA 1PK0D 4DS7A 4OV2A 1NX0A 2KAXA 2LNKA 3FIAA 1WLMA 1CDLA 4F0ZB 4FQOA 3DVKA 3BFBA 1SYMA 3GK2A 2Y5IA 4XJKA 5I2LA 1QX2A 1FI6A 1QV0A 2LVKA 4ORAB 3VB1A 2GV5A 2LVVA 3B86A 1K90D 1M45A 1ZACA 4F7FA 1CMGA 1C7WA 2BCXA 2KLDA 2K2AA 3RM1A 1A4PA 1T14A 5AEQA 1KFXS 3S0EA 1W7IB 1Y0VH 1G33A 2KOTA 4PT1A 1J7QA 2F8PA 4FQTA 3O2PA 5CPVA 2JULA 2KPHA 3I5GB 4YGCB 4QJ4B 3DVMA 1FF1A 5HKZA 1JF2A 1QX5B 4AQIA 1H8BA 2MA2A 1EG4A 1DJGA 2LHIA 2BNXA 4OR9B 3LL8B 5F6TA 3FE8A 3DVJA 1IH0A 5B8IB 1KFUL 1QX7A 3EKJA 1MXEA 3OP0A 1S26D 3D0YA 4MVFA 1QLKA 2KYCA 1BR4B 1WRZA 1CNPA 2KFGA 1UHKA 5GQQC 2LP3A 4QJ3B 4AOMA 2KI4B 4XJKB 1PULA 3I5FB 5AFPA 1A03A 1PRWA 1LINA 1PSBA 1UHNA 1SNLA 1XFRA 3TZ1A 1KQVA 3EG5B 1CLMA 2F3YA 3EK7A 1AJ5A 2JQ6A 1XFVO 1QVIY 1C7VA 3CS1A 4P2YB 1OZOA 2JT3A 4YI8A 3SIBA 4CLNA 1QATA 2WCLA 2LVIA 3I5FC 2BL0B 2CBLA 3O4XA 4C0JA 1NSHA 3BOWA 4C0KA 3D10A 1UURA 4MRXA 3PSRA 1YURA 2CNPA 1CM1A 3CZ0A 4L9MA 2WC8A 3OB1B 3ICBA 4AQJA 2OTGC 1XO5A 3SJSA 1JC2A 2Y4QA 1K9UA 3O6BA 5ER5A 1JBAA 2KHNA 2BKHB 1Q80A 5FI6A 2KFHA 4GAOA 4YGDB 1SL7A 1QIVA 1S5GY 1OSAA 4ORCB 2PALA 1Y1XA 1R2UA 3BQ3A 3CDNA 4I5JA 5CSIA 5D3OA 2M97A 2K7OA 5ER4X 2GGMA 3NSIA 3VROA 2JT8A 1ORGA 2NXQA 1KSOA 1QXPA 3LCPC 1OE9B 3FS7A 2K8MB 2LLTA 5J3XA 1PALA 1C3YA 2JNFA 3KEVA 1DC1A 1N2DA 2I2RE 2TN4A 1RTP1 2JWWA 3O78A 4OKHA 2LUXA 4GGNA 3OGNA 5CSNA 2PMYA 1TWOA 1YTZC 1RROA 1J1DA 1OMVA 4PHKA 2KYFA 1QS7A 1EJ3A 1LS8A 4GBAA 1YUUA 2WCKA 2AAOA 2EC6B 1KK7Y 2P6BB 2JXCA 3I5HB 3S0FA 3FE9A 3DY9A 2H61C 3S0AA 1J1EA 2JTTA 4E68A 1SSEB 3VRNA 2WCJA 1G4YR 3FWBA 2AMIA 2BE6A 4KYNA 2JNXA 1MHOA 3BYAA 3TUYB 3DF0A 4YRUA 2MJWB 2E30A 3DF0B 3E3RA 4MZJA 1RWYA 4YGAA 2NCOA 3DXLA 2WOSA 4OCIA 1B8RA 2Q91A 5JOLA 1UP5A 4NDDA 3BFAA 4CIDA 1DT7B 3WHTB 3EVVA 2KGBC 2HPSA 1TTXA 2KAYA 3LK1A 3NHTA 3OX6A 1TUJA 1OZSA 2HQ8A 4PE0A 2ZN9A 3NSOA 1S5GZ 1XVJA 1H4BA 1TCFA 3VRPA 1NX3A 1CMFA 1Z2CB 3CZ1A 2CXJA 1QASA 3PATA 1EXRA 5DKNA 3DD4A 3A4UB 2I7AA 1M39A 1IQ5A 1UHHA 1SMGA 1V1FA 1DGUA 2LLUA 1Y1AA 2QEVA 4GGFA 1SW8A 1K9PA 1GQMA 2M8UA 1GGZA 4MN0A 1QV1A 2WCMA 1KSMA 1ZMZA 3UO9A 4PALA 3D75A 2EC6C 3AKAA 4JKTA 1BMOA 4MRYA 1J7OA 1XYDA 2LMVA 5FI7A 3NXAA 3HCMA 1NCYA 5EL2A 3CABA 1W7JB 3DVEA 3JVTB 1TRFA 3DYEA 4PE1A 2JXLA 2L50A 3PM2A 1C3ZA 1QVIZ 2KQ6A 2M1UA 1E8AA 3PLFB 4GFTA 1ODBA 3S0BA 1M46A 2MLFC 2ZN8A 3GK1A 1CDPA 3KHEA 1BLQA 2QEHA 4GUKA 2L5XB 3SIAA 1MWNA 2BCAA 1IG5A 1F8HA 1U5IA 2Y1MA 1XK4A 3CR2A 2NCPA 4TNCA 1CLLA 3AKBA 2LAPA 3D74A 1F54A 1OOGA 4M2PA 4C0LA 1CFFA 3I5IB 2LLSA 3AAJA 1G8IA 3CWGA 2ZFDA 2CT9A 2L98A 1B4CA 3B7AA 1KQMC 3FWCA 3LK0A 3PN7B 1FW4A 2LVJA 1J55A 1OOIX 3V2LA 3D77A 1EG3A 1VRKA 1DJHA 1DVIA 2WC5A 3UNWA 2BKIB 1MF8B 2WCFA 4INWA 2K0JA 3D73A 1OOJA 2BBNA 2JC2A 2KDHA 3SG2A 3JTDB 1SRAA 2M29A 1SL9A 2OS8B 5AANA 3IQQA 3TDIA 2NLNA 4CFRA 4GPLB 1NYAA 2KI4C 1LXFC 3N7HA 4NDCA 1DF0A 5I8NA 1S1EA 1NWDA 1DEKA 2KI6D 1OOFA 1DGVA 2KGRA 3D76A 4R1EA 1CDNA 4ETOA 1FBVA 2F3ZA 1AP4A 2COLB 1PVBA 3B6XA 1QJTA 1OOHA 1ZUZA 5JJGA 1Y6WA 1B47A 1IWQA 2RGIA 2K7CA 3IF7A 1U5IB 2PYQA 1WDCC 4GNKB 1AK8A 1S6IA 2I18A 4NQGA 1SKTA 4INXA 4N1FA 2WCEA 2FJYA 3CYZA 1L7ZA 3OB2B 1MXLC 3L4LA 4I5KA 5HL1A 2JPTA 1BJFA 3JVTC 1GJYA 1DJZA 1WLZA 1F55A 2PQLA 1WRLA 2ZNEA 4MZLA 2VRGA 3IVTA 2PSRA 3PALA 1NPQA 3SS5A 3O4YA 2QDIA 4CFQA 3EVUA 3BFHA 3B87A 2HETA 1JWDA 1SR6B 2MHHA 1F4QA 1S6JA 1PVAA 1RECA 2BE4A 1WRKA 1RJVA 5IBWA 2L4IA 1XFXO 3HX4A 4PHNA 2LUCA 1M63B 2R2IA 1LA3A 3BUXB 2B1UA 3TS5B 1EL4A 1OQPA 4PDZA 4IJ7A 3FE6A 1DJYA 2LMTA 1F4OA 1NCXA 1AVSA 1UHIA 2LANA 5HLVA 5DKQA 5I2OA 1DMOA 3OX5A 2LV7A 1S3PA 3OBVA 4ZCVA 1LVCD 1JSAA 2JT0A 1DELA 3JTDC 1CTRA 3BXKA 3PM8A 3GOFA 1A75B 1XFWO 5DKRA 3ZWHA 2Y1NA 3L47A 1FPWA 5KSZA 5I2QA 3PFVA 1DF0B 3K1EA 4BY4A 1MQ1A 2H8VA 2JPOA 1L2OC 2I94A 1CFDA 1OMDA 2CCMA 3NSLA 2A4JA 1SR6C 2ZRTA 4ORBB 3S0GA 4Q04A 1YX7A 2O60A 3CZ2A 1LKJA 1N0YA 3H4SE 2MAZA 1BOCA 1IRJA 2KI6C 2V53A 3CTNA 4U8DA 1SCMB 1KCYA 1B7TZ 1D1OA 2BL0C 3WXAA 1XA5A 2JOJA 1F70A 3RZSA 1KWOB 1XK4C 1L2OB 1M31A 1TCOB 2WCBA 4P5OE 5HKYA 2LP2A 1DJIA 3BUOB 2ZNDA 1AUIB 2P71A 2LM5A 1XFYO 4HRGA 1AHRA 2H2KA 1TNXA 3EK4A 1A29A 3NSKA 4PE4A 1CDMA 1TUZA 2EHBA 3CGAA 2Q4UA 3R1VA 2QPTA 4WQ3A 1YUSA 1B8CA 1QWVA 1V1GA 4D1EA 1YRUB 3CZTX 1B9AA 1TN4A 2SASA 3Q8IA 4PHJA 5CSFA 3AAKA 3D78A 4JPZB 4MBEA 1PSRA 4OVNF 1K93D 3SS4A 4N1GA 3LLEA 2K2FA 2NZ0A 1CFCA 4A4CA 1BT6A 4UPGA 5PALA 1YUTA 2ERBA 2M9GA 4GGFC 5BPJA 3S0DA 5K89A 2LMUA 3PN7C 2K60A 1WY9A 1SY9A 3F45A 3SG3A 1IIOA 3KO0A 2BBMA 1DTLA 4YBHB 3CLNA 1OMRA 3D0YB 2BECA 3L4AA 1NIWA 4I5LB 1C07A 1IKUA 2G9BA 4MZKA 3C1VA 3QRXA 2JTZA 1J7PA 2FOTA 3VRRA 1CLBA 2OPOA 1HT9A 3EK8A 1QLSA 2GTEA 2JRFA 3BUWB 1F71A 1CKKA 1JUOA 1MUXA 1NP8A 4PHMA 2MLEC 4XYNA 1KQMB 1SBJA 3SG7A 5KU1A 5D69A 3PJIA 1LA0A 2L0PA 3TDZA 4IL1A 1BF5A 3WNXB 2D8NA 2M7NA 3IQOA 3EKHA 3VRQA 3MSEB 1GM0A 3ZNIA 4MSPA 2KBMA 1JF0A 1CFPA
chains in the Genus database with same CATH topology
1DELA 4JKTA 1W9ZA 3IVTA 2BAPA 2YGUA 5FI7A 3SS5A 3SS3A 3UO9A 4GBAA 5FI2A 2KLDA 4I5LB 1Z4HA 2L5YA 5FI6A 4MEWA 3UNWA 3PM2A 4GAOA 1Z2CB 5I94A 4KYNA 2KLEA 5D3OA 4I5JA 4IJ7A 3SS4A 3EG5B 4I5NB 4I5KA 5HL1A 3KEVA 3O4XA 3OBVA 1DC1A 2BNXA 1DEKA 2K60A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KYN A;  4IJ7 A;  3PM2 A; 
#chains in the Genus database with same CATH topology
 3RLZ A;  2JZI A;  1KK8 C;  1YR5 A;  2QAC A;  2YGU A;  1SCM C;  4HRE E;  1NX2 A;  2HQW A;  4YGE B;  1SCV A;  1WDC B;  4FTG A;  1GGW A;  1KK8 B;  1UHJ A;  5FI2 A;  3WHU B;  1Z4H A;  2L5Y A;  2H61 A;  2K7D A;  4MEW A;  4WRI A;  4ZCU A;  1KFX L;  1J7R A;  1YRT B;  3R1O A;  1ALW A;  2PVB A;  2DOQ A;  2M3W A;  1RK9 A;  2PRU A;  4JQ0 D;  3BUM B;  1IJ6 A;  4USL A;  2PAS A;  1EH2 A;  3R72 A;  1UWO A;  2WC6 A;  3KPX A;  2P70 A;  2GGZ A;  4ICB A;  4MLW A;  1BR1 B;  2JU0 A;  1UUS A;  2G2B A;  1A2X A;  5AXI A;  1BOD A;  2KSP A;  2MBX A;  3CR4 X;  1IGV A;  1K95 A;  5HKW A;  1ALV A;  2L2E A;  1W9Z A;  1JFK A;  1Y1U A;  4BY5 A;  4YI9 A;  1AJ4 A;  1OW4 A;  4YGB B;  3TDU A;  2QEB A;  5CSJ A;  1NUB A;  3K21 A;  2FCD A;  2SCP A;  3OHM B;  5D7F A;  1ZFS A;  1IJ5 A;  2O5G A;  3NHI A;  3I5I C;  1CB1 A;  1B7T Y;  1KWO C;  1XFZ O;  1NCZ A;  1B1G A;  2IS9 A;  1ZOT B;  5HLO A;  4WQ2 A;  4CPV A;  1K9K A;  2QEO A;  4HRH A;  5KTY A;  1KFU S;  4QJ5 B;  4JD9 A;  4DRW A;  1BG1 A;  2LHL A;  1IQ3 A;  2KNE A;  2ZRS A;  2K7B A;  1DJW A;  1TNQ A;  2K61 A;  3I5H C;  1YX8 A;  2MRD A;  5HYD A;  5FYX A;  3SG5 A;  4M2Q A;  2FCE A;  1TNW A;  4NDB A;  4HSZ A;  2M0R A;  3A8R A;  1R6P A;  3BUN B;  4DCK A;  3NGV A;  2F2P A;  3SS3 A;  4DUQ A;  3TUY C;  3DZT A;  2ZKM X;  2KBI A;  1X02 A;  2WCH A;  1SK6 D;  3M0W A;  3EVR A;  3GK4 X;  1SL8 A;  3VGO A;  1K96 A;  3BOW B;  1NX1 A;  1CM4 A;  2CTN A;  3R1P A;  4JWQ A;  5DIC A;  5I94 A;  1YVH A;  4OZD A;  1YVL A;  4PCW A;  4N5X A;  1S6C A;  1KK7 Z;  2L2C A;  1JFJ A;  2M7L A;  1QIW A;  4PE7 A;  1DQE A;  2WOR A;  1XFU O;  3B88 A;  2BCB A;  2LE9 B;  3TS5 C;  3KF9 A;  1BU3 A;  1SPY A;  2L51 A;  1HQV A;  2M49 B;  2KAV A;  5TNC A;  3I5G C;  5G08 A;  4A4B A;  2OTG B;  1N65 A;  2KFF A;  1TOP A;  2BAP A;  2L4H A;  2M1K B;  2HF5 A;  2WND A;  2OS8 C;  1RFJ A;  4DIR A;  1A75 A;  2FJU B;  5AER A;  3SG4 A;  3QME A;  1K8U A;  3CR5 X;  3BJH A;  1B8L A;  1FI5 A;  2LC5 A;  2EGD A;  2LCP A;  2AUC A;  2KLE A;  1TIZ A;  2F2O A;  1DJX A;  2E6W A;  1MR8 A;  2F33 A;  2ISD A;  1S36 A;  1K2H A;  4I5N B;  1K94 A;  4M2O A;  1QTX A;  2KQY A;  1P28 A;  3SG6 A;  1TNP A;  1PK0 D;  4DS7 A;  4OV2 A;  1NX0 A;  2KAX A;  2LNK A;  3FIA A;  1WLM A;  1CDL A;  4F0Z B;  4FQO A;  3DVK A;  3BFB A;  1SYM A;  3GK2 A;  2Y5I A;  4XJK A;  5I2L A;  1QX2 A;  1FI6 A;  1QV0 A;  2LVK A;  4ORA B;  3VB1 A;  2GV5 A;  2LVV A;  3B86 A;  1K90 D;  1M45 A;  1ZAC A;  4F7F A;  1CMG A;  1C7W A;  2BCX A;  2KLD A;  2K2A A;  3RM1 A;  1A4P A;  1T14 A;  5AEQ A;  1KFX S;  3S0E A;  1W7I B;  1Y0V H;  1G33 A;  2KOT A;  4PT1 A;  1J7Q A;  2F8P A;  4FQT A;  3O2P A;  5CPV A;  2JUL A;  2KPH A;  3I5G B;  4YGC B;  4QJ4 B;  3DVM A;  1FF1 A;  5HKZ A;  1JF2 A;  1QX5 B;  4AQI A;  1H8B A;  2MA2 A;  1EG4 A;  1DJG A;  2LHI A;  2BNX A;  4OR9 B;  3LL8 B;  5F6T A;  3FE8 A;  3DVJ A;  1IH0 A;  5B8I B;  1KFU L;  1QX7 A;  3EKJ A;  1MXE A;  3OP0 A;  1S26 D;  3D0Y A;  4MVF A;  1QLK A;  2KYC A;  1BR4 B;  1WRZ A;  1CNP A;  2KFG A;  1UHK A;  5GQQ C;  2LP3 A;  4QJ3 B;  4AOM A;  2KI4 B;  4XJK B;  1PUL A;  3I5F B;  5AFP A;  1A03 A;  1PRW A;  1LIN A;  1PSB A;  1UHN A;  1SNL A;  1XFR A;  3TZ1 A;  1KQV A;  3EG5 B;  1CLM A;  2F3Y A;  3EK7 A;  1AJ5 A;  2JQ6 A;  1XFV O;  1QVI Y;  1C7V A;  3CS1 A;  4P2Y B;  1OZO A;  2JT3 A;  4YI8 A;  3SIB A;  4CLN A;  1QAT A;  2WCL A;  2LVI A;  3I5F C;  2BL0 B;  2CBL A;  3O4X A;  4C0J A;  1NSH A;  3BOW A;  4C0K A;  3D10 A;  1UUR A;  4MRX A;  3PSR A;  1YUR A;  2CNP A;  1CM1 A;  3CZ0 A;  4L9M A;  2WC8 A;  3OB1 B;  3ICB A;  4AQJ A;  2OTG C;  1XO5 A;  3SJS A;  1JC2 A;  2Y4Q A;  1K9U A;  3O6B A;  5ER5 A;  1JBA A;  2KHN A;  2BKH B;  1Q80 A;  5FI6 A;  2KFH A;  4GAO A;  4YGD B;  1SL7 A;  1QIV A;  1S5G Y;  1OSA A;  4ORC B;  2PAL A;  1Y1X A;  1R2U A;  3BQ3 A;  3CDN A;  4I5J A;  5CSI A;  5D3O A;  2M97 A;  2K7O A;  5ER4 X;  2GGM A;  3NSI A;  3VRO A;  2JT8 A;  1ORG A;  2NXQ A;  1KSO A;  1QXP A;  3LCP C;  1OE9 B;  3FS7 A;  2K8M B;  2LLT A;  5J3X A;  1PAL A;  1C3Y A;  2JNF A;  3KEV A;  1DC1 A;  1N2D A;  2I2R E;  2TN4 A;  1RTP 1;  2JWW A;  3O78 A;  4OKH A;  2LUX A;  4GGN A;  3OGN A;  5CSN A;  2PMY A;  1TWO A;  1YTZ C;  1RRO A;  1J1D A;  1OMV A;  4PHK A;  2KYF A;  1QS7 A;  1EJ3 A;  1LS8 A;  4GBA A;  1YUU A;  2WCK A;  2AAO A;  2EC6 B;  1KK7 Y;  2P6B B;  2JXC A;  3I5H B;  3S0F A;  3FE9 A;  3DY9 A;  2H61 C;  3S0A A;  1J1E A;  2JTT A;  4E68 A;  1SSE B;  3VRN A;  2WCJ A;  1G4Y R;  3FWB A;  2AMI A;  2BE6 A;  4KYN A;  2JNX A;  1MHO A;  3BYA A;  3TUY B;  3DF0 A;  4YRU A;  2MJW B;  2E30 A;  3DF0 B;  3E3R A;  4MZJ A;  1RWY A;  4YGA A;  2NCO A;  3DXL A;  2WOS A;  4OCI A;  1B8R A;  2Q91 A;  5JOL A;  1UP5 A;  4NDD A;  3BFA A;  4CID A;  1DT7 B;  3WHT B;  3EVV A;  2KGB C;  2HPS A;  1TTX A;  2KAY A;  3LK1 A;  3NHT A;  3OX6 A;  1TUJ A;  1OZS A;  2HQ8 A;  4PE0 A;  2ZN9 A;  3NSO A;  1S5G Z;  1XVJ A;  1H4B A;  1TCF A;  3VRP A;  1NX3 A;  1CMF A;  1Z2C B;  3CZ1 A;  2CXJ A;  1QAS A;  3PAT A;  1EXR A;  5DKN A;  3DD4 A;  3A4U B;  2I7A A;  1M39 A;  1IQ5 A;  1UHH A;  1SMG A;  1V1F A;  1DGU A;  2LLU A;  1Y1A A;  2QEV A;  4GGF A;  1SW8 A;  1K9P A;  1GQM A;  2M8U A;  1GGZ A;  4MN0 A;  1QV1 A;  2WCM A;  1KSM A;  1ZMZ A;  3UO9 A;  4PAL A;  3D75 A;  2EC6 C;  3AKA A;  4JKT A;  1BMO A;  4MRY A;  1J7O A;  1XYD A;  2LMV A;  5FI7 A;  3NXA A;  3HCM A;  1NCY A;  5EL2 A;  3CAB A;  1W7J B;  3DVE A;  3JVT B;  1TRF A;  3DYE A;  4PE1 A;  2JXL A;  2L50 A;  3PM2 A;  1C3Z A;  1QVI Z;  2KQ6 A;  2M1U A;  1E8A A;  3PLF B;  4GFT A;  1ODB A;  3S0B A;  1M46 A;  2MLF C;  2ZN8 A;  3GK1 A;  1CDP A;  3KHE A;  1BLQ A;  2QEH A;  4GUK A;  2L5X B;  3SIA A;  1MWN A;  2BCA A;  1IG5 A;  1F8H A;  1U5I A;  2Y1M A;  1XK4 A;  3CR2 A;  2NCP A;  4TNC A;  1CLL A;  3AKB A;  2LAP A;  3D74 A;  1F54 A;  1OOG A;  4M2P A;  4C0L A;  1CFF A;  3I5I B;  2LLS A;  3AAJ A;  1G8I A;  3CWG A;  2ZFD A;  2CT9 A;  2L98 A;  1B4C A;  3B7A A;  1KQM C;  3FWC A;  3LK0 A;  3PN7 B;  1FW4 A;  2LVJ A;  1J55 A;  1OOI X;  3V2L A;  3D77 A;  1EG3 A;  1VRK A;  1DJH A;  1DVI A;  2WC5 A;  3UNW A;  2BKI B;  1MF8 B;  2WCF A;  4INW A;  2K0J A;  3D73 A;  1OOJ A;  2BBN A;  2JC2 A;  2KDH A;  3SG2 A;  3JTD B;  1SRA A;  2M29 A;  1SL9 A;  2OS8 B;  5AAN A;  3IQQ A;  3TDI A;  2NLN A;  4CFR A;  4GPL B;  1NYA A;  2KI4 C;  1LXF C;  3N7H A;  4NDC A;  1DF0 A;  5I8N A;  1S1E A;  1NWD A;  1DEK A;  2KI6 D;  1OOF A;  1DGV A;  2KGR A;  3D76 A;  4R1E A;  1CDN A;  4ETO A;  1FBV A;  2F3Z A;  1AP4 A;  2COL B;  1PVB A;  3B6X A;  1QJT A;  1OOH A;  1ZUZ A;  5JJG A;  1Y6W A;  1B47 A;  1IWQ A;  2RGI A;  2K7C A;  3IF7 A;  1U5I B;  2PYQ A;  1WDC C;  4GNK B;  1AK8 A;  1S6I A;  2I18 A;  4NQG A;  1SKT A;  4INX A;  4N1F A;  2WCE A;  2FJY A;  3CYZ A;  1L7Z A;  3OB2 B;  1MXL C;  3L4L A;  4I5K A;  5HL1 A;  2JPT A;  1BJF A;  3JVT C;  1GJY A;  1DJZ A;  1WLZ A;  1F55 A;  2PQL A;  1WRL A;  2ZNE A;  4MZL A;  2VRG A;  3IVT A;  2PSR A;  3PAL A;  1NPQ A;  3SS5 A;  3O4Y A;  2QDI A;  4CFQ A;  3EVU A;  3BFH A;  3B87 A;  2HET A;  1JWD A;  1SR6 B;  2MHH A;  1F4Q A;  1S6J A;  1PVA A;  1REC A;  2BE4 A;  1WRK A;  1RJV A;  5IBW A;  2L4I A;  1XFX O;  3HX4 A;  4PHN A;  2LUC A;  1M63 B;  2R2I A;  1LA3 A;  3BUX B;  2B1U A;  3TS5 B;  1EL4 A;  1OQP A;  4PDZ A;  4IJ7 A;  3FE6 A;  1DJY A;  2LMT A;  1F4O A;  1NCX A;  1AVS A;  1UHI A;  2LAN A;  5HLV A;  5DKQ A;  5I2O A;  1DMO A;  3OX5 A;  2LV7 A;  1S3P A;  3OBV A;  4ZCV A;  1LVC D;  1JSA A;  2JT0 A;  1DEL A;  3JTD C;  1CTR A;  3BXK A;  3PM8 A;  3GOF A;  1A75 B;  1XFW O;  5DKR A;  3ZWH A;  2Y1N A;  3L47 A;  1FPW A;  5KSZ A;  5I2Q A;  3PFV A;  1DF0 B;  3K1E A;  4BY4 A;  1MQ1 A;  2H8V A;  2JPO A;  1L2O C;  2I94 A;  1CFD A;  1OMD A;  2CCM A;  3NSL A;  2A4J A;  1SR6 C;  2ZRT A;  4ORB B;  3S0G A;  4Q04 A;  1YX7 A;  2O60 A;  3CZ2 A;  1LKJ A;  1N0Y A;  3H4S E;  2MAZ A;  1BOC A;  1IRJ A;  2KI6 C;  2V53 A;  3CTN A;  4U8D A;  1SCM B;  1KCY A;  1B7T Z;  1D1O A;  2BL0 C;  3WXA A;  1XA5 A;  2JOJ A;  1F70 A;  3RZS A;  1KWO B;  1XK4 C;  1L2O B;  1M31 A;  1TCO B;  2WCB A;  4P5O E;  5HKY A;  2LP2 A;  1DJI A;  3BUO B;  2ZND A;  1AUI B;  2P71 A;  2LM5 A;  1XFY O;  4HRG A;  1AHR A;  2H2K A;  1TNX A;  3EK4 A;  1A29 A;  3NSK A;  4PE4 A;  1CDM A;  1TUZ A;  2EHB A;  3CGA A;  2Q4U A;  3R1V A;  2QPT A;  4WQ3 A;  1YUS A;  1B8C A;  1QWV A;  1V1G A;  4D1E A;  1YRU B;  3CZT X;  1B9A A;  1TN4 A;  2SAS A;  3Q8I A;  4PHJ A;  5CSF A;  3AAK A;  3D78 A;  4JPZ B;  4MBE A;  1PSR A;  4OVN F;  1K93 D;  3SS4 A;  4N1G A;  3LLE A;  2K2F A;  2NZ0 A;  1CFC A;  4A4C A;  1BT6 A;  4UPG A;  5PAL A;  1YUT A;  2ERB A;  2M9G A;  4GGF C;  5BPJ A;  3S0D A;  5K89 A;  2LMU A;  3PN7 C;  2K60 A;  1WY9 A;  1SY9 A;  3F45 A;  3SG3 A;  1IIO A;  3KO0 A;  2BBM A;  1DTL A;  4YBH B;  3CLN A;  1OMR A;  3D0Y B;  2BEC A;  3L4A A;  1NIW A;  4I5L B;  1C07 A;  1IKU A;  2G9B A;  4MZK A;  3C1V A;  3QRX A;  2JTZ A;  1J7P A;  2FOT A;  3VRR A;  1CLB A;  2OPO A;  1HT9 A;  3EK8 A;  1QLS A;  2GTE A;  2JRF A;  3BUW B;  1F71 A;  1CKK A;  1JUO A;  1MUX A;  1NP8 A;  4PHM A;  2MLE C;  4XYN A;  1KQM B;  1SBJ A;  3SG7 A;  5KU1 A;  5D69 A;  3PJI A;  1LA0 A;  2L0P A;  3TDZ A;  4IL1 A;  1BF5 A;  3WNX B;  2D8N A;  2M7N A;  3IQO A;  3EKH A;  3VRQ A;  3MSE B;  1GM0 A;  3ZNI A;  4MSP A;  2KBM A;  1JF0 A;  1CFP A; 
#chains in the Genus database with same CATH homology
 1DEL A;  4JKT A;  1W9Z A;  3IVT A;  2BAP A;  2YGU A;  5FI7 A;  3SS5 A;  3SS3 A;  3UO9 A;  4GBA A;  5FI2 A;  2KLD A;  4I5L B;  1Z4H A;  2L5Y A;  5FI6 A;  4MEW A;  3UNW A;  3PM2 A;  4GAO A;  1Z2C B;  5I94 A;  4KYN A;  2KLE A;  5D3O A;  4I5J A;  4IJ7 A;  3SS4 A;  3EG5 B;  4I5N B;  4I5K A;  5HL1 A;  3KEV A;  3O4X A;  3OBV A;  1DC1 A;  2BNX A;  1DEK A;  2K60 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...