3DF0B

Calcium-dependent complex between m-calpain and calpastatin
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
174
structure length
174
Chain Sequence
SEEERQFRKLFVQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKKWQGIYKRFDTDRSGTIGSNELPGAFEAAGFHLNQHIYSMIIRRYSDETGNMDFDNFISCLVRLDAMFRAFRSLDKNGTGQIQVNIQEWLQLTMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calpain-2 catalytic subunit
publication title Concerted multi-pronged attack by calpastatin to occlude the catalytic cleft of heterodimeric calpains.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 63
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2008-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3df0B00
2EC6C 4L9MA 2NCOA 3K21A 1NYAA 1F4QA 3CR2A 3BYAA 2KI6D 1TOPA 1SYMA 1BR1B 3DVMA 1UHHA 3ZNIA 1B8RA 2D8NA 3HCMA 1M63B 2OPOA 3CWGA 2K8MB 1ZUZA 1KK7Z 2H2KA 2KFGA 2L51A 2KAXA 4ICBA 4CIDA 3LLEA 2LE9B 2LMVA 1KSMA 5KU1A 1M39A 2NLNA 4USLA 1F54A 2TN4A 3TS5B 3TZ1A 1FW4A 2F3YA 2JTTA 3F45A 3NSIA 1TNXA 3JTDB 1ODBA 5B8IB 4YRUA 1EJ3A 1R6PA 1QV0A 1AJ5A 2KNEA 1ALWA 1GGZA 5ER4X 1CMFA 2KFHA 1ALVA 3PALA 3OB1B 3MSEB 2ZNDA 4OVNF 1ZFSA 1SL8A 2JRFA 1NCXA 2LNKA 5I2OA 1CFDA 1SNLA 4GUKA 3PATA 4MSPA 1B4CA 2BE6A 1B1GA 2CNPA 2KI4B 3CTNA 4I5NB 1F4OA 1J7RA 3O4YA 2OS8B 2I2RE 1BT6A 2Y1MA 1EXRA 4MN0A 1PVBA 1XO5A 3GK4X 2FJUB 1M46A 1JF0A 3IQQA 3FS7A 3EK4A 1B8LA 1FF1A 2ZN8A 3BUNB 3I5GC 4CLNA 1IJ6A 2WC8A 3BQ3A 2CXJA 5CSFA 4JQ0D 1KK8B 1N2DA 2M7LA 2F33A 2IS9A 3CS1A 4YI8A 4UPGA 4MZKA 3EVUA 3WHUB 3FWBA 1YVLA 1YUTA 3SIBA 1KK7Y 1XK4C 2WCBA 2BECA 4N1GA 2BE4A 2JT8A 5JOLA 4Q04A 1WLZA 5PALA 5TNCA 4C0LA 1CNPA 1R2UA 1BG1A 1DGVA 1OSAA 3PSRA 2M29A 4NQGA 4WQ3A 2BKIB 4NDDA 5JJGA 4MLWA 2COLB 4MBEA 3NXAA 3I5FC 4XYNA 3O6BA 1C7WA 1V1GA 4DUQA 1FPWA 1BU3A 1S26D 3SJSA 4AQJA 4QJ5B 3EVRA 1CMGA 1DJGA 1YR5A 1DF0A 1Y1XA 3TDIA 1JF2A 5HYDA 1TTXA 4ORBB 1S6JA 4YI9A 3I5IB 4TNCA 3C1VA 2ISDA 4DS7A 1QASA 2M3WA 2BCBA 1YX7A 4GNKB 2L50A 1TN4A 2BL0B 1QS7A 2K61A 1N0YA 4CFQA 1CFFA 2I18A 1CDMA 4WRIA 1XA5A 5I8NA 2O5GA 1SKTA 1U5IB 1YRTB 1K93D 3WXAA 2JT3A 2CT9A 1OMRA 3KEVA 1RWYA 3KPXA 1XVJA 2I7AA 3EKJA 1Y1AA 2KFFA 4YGEB 2JXLA 4HRGA 1A29A 2M49B 1SRAA 4YGBB 3SG6A 3VRQA 4GFTA 2L4HA 1RK9A 1YUSA 3VRPA 4PHJA 2L0PA 1DJIA 5ER5A 5HLVA 1CFCA 1KQVA 1SBJA 1EG3A 1AVSA 1J1EA 2P6BB 1SR6C 1N65A 4DIRA 3EK8A 2BBMA 4GGFA 3DVKA 2LLTA 1NUBA 1QVIZ 2E30A 3BOWB 1QX2A 1WDCB 2PMYA 4CFRA 1MXLC 3H4SE 3O78A 4PALA 1YX8A 1JWDA 5FYXA 1F70A 3OHMB 1QTXA 3FIAA 3KHEA 4ETOA 1KFXL 1GGWA 1SCMC 3JVTB 1NX2A 1B47A 1UUSA 5G08A 2Y5IA 2E6WA 2B1UA 2K7BA 1UURA 1NWDA 4P5OE 2M9GA 3TUYB 4ZCUA 1KWOB 2KGBC 3A8RA 1HT9A 1AHRA 2MHHA 1F55A 4QJ4B 3SG2A 1IWQA 1A2XA 1SPYA 1DTLA 2MJWB 1UHJA 2FCDA 4E68A 5DKQA 2HPSA 1OE9B 1VRKA 2KGRA 1DJHA 1K9PA 1CKKA 4OR9B 2HF5A 2LMTA 1K90D 1CFPA 2AMIA 1H8BA 1UHNA 5HLOA 2F3ZA 2LANA 1YURA 4PE0A 1MHOA 2F2OA 1YVHA 3DD4A 2I94A 2CCMA 2AAOA 2BCAA 1SY9A 2WOSA 1ZOTB 1XFWO 2L98A 1TCFA 3GK2A 4PHMA 1J55A 1EL4A 1Y0VH 4GGNA 1YRUB 1J1DA 1QIVA 4IL1A 1A4PA 1QLSA 1KQMB 1RFJA 2JZIA 2F8PA 1KWOC 2LVJA 2KYCA 5KSZA 1A03A 4NDBA 1G4YR 3BUOB 3AAJA 3DVEA 3O2PA 1KFUS 5CPVA 1KFUL 2LHLA 3SG5A 3AKAA 1S6CA 4MRXA 1BMOA 4YGAA 4R1EA 1QXPA 1WLMA 1XFVO 2EGDA 1J7PA 2JXCA 2K0JA 3TS5C 4GPLB 4C0KA 4U8DA 3RLZA 4BY5A 3JTDC 1QJTA 2A4JA 3SG7A 1K9UA 1PSRA 1S3PA 4GGFC 2MLEC 2FCEA 2PALA 2M1UA 2JNXA 3VROA 2KBIA 1EG4A 2M7NA 3GOFA 4PE7A 2HETA 4HSZA 4M2PA 2OTGB 1DJYA 1U5IA 1MUXA 2LUXA 1W7IB 4WQ2A 4PHNA 2CTNA 3EKHA 3I5HB 1TNPA 3PFVA 5CSNA 1CM1A 2SCPA 2KOTA 4P2YB 4N1FA 2LP2A 4A4BA 4PE4A 2KI4C 5AERA 1MWNA 1CM4A 2K7CA 2ZRTA 5D7FA 3CR5X 1L2OB 4D1EA 2LVVA 2M1KB 2OS8C 2ZFDA 1TCOB 2K2FA 4I5KA 2PRUA 1TIZA 5DKNA 1NX0A 1B8CA 1NP8A 1TNQA 1YUUA 2LC5A 3BOWA 1KK8C 2KAVA 2JU0A 3DF0B 2K7DA 3SIAA 4OKHA 1WRLA 3SG3A 2K2AA 1NPQA 1JFJA 3PM8A 1K94A 2JTZA 3NSOA 1CLLA 1KCYA 1OZSA 1E8AA 4MZJA 1IJ5A 2QPTA 4FTGA 4QJ3B 2LCPA 1B9AA 1Y6WA 5BPJA 2VRGA 1AUIB 1CTRA 1IQ5A 1XFYO 1XFXO 2KI6C 3EVVA 1BOCA 1S36A 3DVJA 2QACA 3LK1A 2ZNEA 4AQIA 3VRNA 1EH2A 1BF5A 5KTYA 4YGCB 5HKWA 4NDCA 3BXKA 2MBXA 1CB1A 1S5GZ 1CLMA 2JQ6A 2EC6B 3PLFB 1F71A 3HX4A 2JNFA 1BODA 1LA3A 2M97A 3WHTB 2RGIA 2PSRA 4C0JA 3CGAA 3AAKA 3I5IC 4OCIA 1OQPA 1NCZA 3CLNA 2HQWA 1ZMZA 1GJYA 3E3RA 1WY9A 2BL0C 4M2QA 1CDLA 1K9KA 1L7ZA 1KFXS 1SMGA 1QV1A 2LP3A 2MRDA 1TNWA 2Q4UA 3IF7A 2L5XB 4M2OA 2L4IA 2ZKMX 5K89A 5CSIA 1MR8A 4MRYA 5CSJA 1DGUA 2WNDA 4GAOA 1DJWA 4HREE 4AOMA 2LM5A 5IBWA 2NCPA 3OP0A 1RECA 3RM1A 5D69A 3TDZA 5AEQA 4PE1A 3OX5A 2G2BA 1IGVA 1GQMA 3IQOA 4MEWA 1KSOA 2GV5A 2Y4QA 3OB2B 2KDHA 1S6IA 1SL9A 4GBAA 1FBVA 1WRZA 1NX3A 2GGMA 4PHKA 1DJXA 2ZRSA 2R2IA 3ICBA 3BUXB 1WDCC 1IKUA 5HKZA 1M31A 1YTZC 3D0YB 4I5JA 1PVAA 1SK6D 2WORA 1QX5B 2LVIA 3I5GB 1X02A 2AUCA 1M45A 3JVTC 2V53A 2KSPA 2KQ6A 2LLSA 2M0RA 1S5GY 2WCFA 3SG4A 3CZTX 1CLBA 1JSAA 3QRXA 1DVIA 2Q91A 1DT7B 3TUYC 2BBNA 2H61C 1HQVA 1A75B 1IRJA 1QVIY 2EHBA 2Y1NA 1NSHA 1Q80A 2JOJA 4JWQA 4CPVA 1RROA 5AXIA 1J7QA 4YBHB 1LINA 1RTP1 1K96A 1JC2A 4PDZA 3M0WA 1JUOA 2LMUA 3DF0A 1B7TZ 5J3XA 3BUMB 4PCWA 1JBAA 4JPZB 1XFZO 1LXFC 3I5FB 4I5LB 4MZLA 1UHKA 2JULA 2O60A 4YGDB 2CBLA 4ORCB 5GQQC 4BY4A 1BR4B 2JC2A 2LUCA 3TDUA 2KAYA 1C7VA 5F6TA 1AK8A 2K7OA 2MAZA 1PK0D 1NIWA 3KF9A 4N5XA 3LCPC 5DKRA 1KQMC 2L2EA 4A4CA 1LA0A 2KHNA 3VRRA 1DMOA 4XJKA 1BJFA 1IG5A 1SCVA 3NSLA 2NZ0A 1IH0A 4OV2A 2M8UA 1UHIA 3NSKA 1JFKA 2DOQA 1J7OA 3KO0A 2JPTA 1BLQA 1TRFA 2PASA 4ORAB 3ZWHA 2HQ8A 1AJ4A 1MQ1A 1V1FA 1FI5A 1MXEA 1G8IA 1CDNA 2BCXA 2OTGC 3PN7B 2BKHB 1SR6B 1PRWA 1DJZA 2GGZA 3I5HC 1LKJA 1QATA 2H61A 2G9BA 1PULA 2JT0A 2JWWA 2LLUA 1ZACA 1K2HA 3FWCA 1C07A 1K8UA 1L2OC 1PSBA 1B7TY 1WRKA 3EK7A 1SW8A 4DRWA 3D10A 2SASA 1SCMB 2FOTA 4HRHA 2LHIA 5AFPA 1F8HA 3CR4X 4XJKB 1IQ3A 2KYFA 4ZCVA 3AKBA 3WNXB 5I2QA 1MF8B 1UP5A 1AP4A 1XFUO 2LVKA 4FQOA 1NX1A 1QLKA 2LAPA 3OX6A 4F0ZB 1D1OA 3D0YA 1H4BA 3A4UB 2ZN9A 1OOJA 5I2LA 4DCKA 1PALA 3LL8B 2LV7A 1OMVA 2KQYA 3PN7C 1QX7A 1CDPA 1DF0B 3GK1A 1LVCD 1QIWA 5AANA 2NXQA 1NCYA 1A75A 1K95A 1OZOA 3BUWB 3LK0A 1FI6A 1W7JB 3VGOA 1XYDA 2PVBA 1XK4A 5HKYA 1OMDA 2WCEA 1SL7A 1G33A 2MA2A 1RJVA 2MLFC 1S1EA 4MVFA 1UWOA 2KBMA 1Y1UA 2F2PA
chains in the Genus database with same CATH superfamily
2EC6C 4L9MA 2NCOA 3K21A 1NYAA 1F4QA 3CR2A 3BYAA 2KI6D 1TOPA 4KYNA 1SYMA 1BR1B 3DVMA 1UHHA 1Z4HA 3ZNIA 1B8RA 2L5YA 2D8NA 1OOHA 3HCMA 1M63B 2OPOA 3CWGA 2K8MB 1ZUZA 1KK7Z 2H2KA 2KFGA 1DELA 2KAXA 2L51A 4ICBA 4CIDA 3LLEA 2LE9B 2LMVA 1KSMA 5KU1A 5HL1A 1M39A 2NLNA 4USLA 1F54A 2TN4A 3TS5B 1DQEA 3TZ1A 1FW4A 2F3YA 2JTTA 3F45A 3NSIA 1TNXA 3JTDB 1ODBA 5B8IB 4YRUA 1DC1A 1EJ3A 1R6PA 1QV0A 1AJ5A 2KNEA 1ALWA 1GGZA 2P71A 5ER4X 1CMFA 2KFHA 1ALVA 3PALA 3OB1B 3MSEB 2ZNDA 4OVNF 1ZFSA 2WCKA 1SL8A 2JRFA 2KLEA 4IJ7A 1NCXA 1TUJA 2LNKA 5I2OA 1CFDA 3EG5B 1SNLA 4GUKA 3K1EA 2P70A 3PATA 4MSPA 1TUZA 1XFRA 1B4CA 2BE6A 1B1GA 2CNPA 2KI4B 3CTNA 4I5NB 1F4OA 1J7RA 3O4YA 4INWA 2OS8B 2I2RE 1BT6A 2Y1MA 1EXRA 4MN0A 1PVBA 1XO5A 3GK4X 2FJUB 1M46A 1JF0A 3IQQA 3FS7A 3EK4A 1B8LA 1FF1A 2ZN8A 3BUNB 3I5GC 4CLNA 1IJ6A 2WC8A 3B86A 3BQ3A 2BNXA 2CXJA 4JQ0D 1KK8B 1N2DA 5CSFA 2M7LA 2F33A 2IS9A 3CS1A 3IVTA 4YI8A 4UPGA 4MZKA 3EVUA 2GTEA 3WHUB 3FWBA 1YVLA 1IIOA 1OW4A 1YUTA 3L4LA 3SIBA 1KK7Y 1XK4C 2WCBA 2BECA 4N1GA 2BE4A 2JT8A 5JOLA 3FE9A 1WLZA 3D75A 4Q04A 5PALA 5TNCA 4C0LA 1CNPA 1R2UA 1BG1A 1DGVA 1OSAA 3PSRA 2M29A 4NQGA 4WQ3A 2BKIB 2QEBA 4NDDA 1OOGA 4MLWA 5JJGA 4JD9A 1P28A 2COLB 5EL2A 5I94A 4MBEA 3NXAA 3I5FC 4XYNA 1DEKA 3O6BA 1C7WA 1V1GA 3N7HA 4DUQA 1FPWA 1BU3A 1S26D 3SJSA 4AQJA 4QJ5B 3EVRA 1CMGA 1DJGA 1YR5A 1DF0A 1Y1XA 5FI6A 3TDIA 1JF2A 5HYDA 3BFAA 1TTXA 4ORBB 1S6JA 4YI9A 3I5IB 4TNCA 3C1VA 2ISDA 4DS7A 1QASA 2M3WA 1YX7A 2BCBA 4GNKB 2L50A 1TN4A 2BL0B 1QS7A 2K61A 1N0YA 2WCJA 4CFQA 3L4AA 1CFFA 2I18A 1C3ZA 1CDMA 3OGNA 4OZDA 4WRIA 3D74A 1XA5A 5I8NA 1T14A 2O5GA 1SKTA 1U5IB 1YRTB 1K93D 3WXAA 2JT3A 1OMRA 2CT9A 3KEVA 1RWYA 3KPXA 1XVJA 2I7AA 2PYQA 3EKJA 1Y1AA 2KFFA 4YGEB 2JXLA 4HRGA 1A29A 2M49B 1SRAA 4YGBB 3SG6A 3VRQA 4GFTA 2L4HA 3B88A 3B6XA 1RK9A 1YUSA 3VRPA 4PHJA 2L0PA 1DJIA 5ER5A 5HLVA 1CFCA 1KQVA 1SBJA 1EG3A 1AVSA 1J1EA 2P6BB 3SS4A 1SR6C 1N65A 4DIRA 3EK8A 2BBMA 4GGFA 3CZ0A 3DVKA 1W9ZA 2LLTA 3R1VA 3RZSA 3NGVA 1NUBA 1QVIZ 2E30A 3BOWB 1QX2A 1WDCB 2PMYA 4CFRA 3B7AA 1MXLC 3H4SE 3O78A 4PALA 1YX8A 1JWDA 5FYXA 2WC5A 1F70A 3OHMB 1QTXA 2WCMA 3FIAA 3KHEA 1KFXL 4ETOA 1GGWA 1SCMC 1Z2CB 3JVTB 1NX2A 1B47A 1UUSA 5G08A 2Y5IA 2E6WA 2B1UA 2K7BA 1UURA 1NWDA 4P5OE 2M9GA 3TUYB 4ZCUA 1KWOB 2KGBC 3A8RA 1HT9A 1AHRA 2MHHA 1F55A 4QJ4B 3SG2A 1IWQA 1A2XA 1SPYA 1DTLA 2MJWB 1UHJA 2FCDA 4E68A 5DKQA 2HPSA 1OE9B 1VRKA 1OOFA 1DJHA 1K9PA 2KGRA 4OR9B 2HF5A 1CKKA 2LMTA 1K90D 1CFPA 2AMIA 3S0AA 1H8BA 1UHNA 5HLOA 2F3ZA 2LANA 1YURA 4PE0A 1MHOA 2F2OA 2YGUA 1YVHA 3DD4A 2I94A 2CCMA 2AAOA 2BCAA 1SY9A 2WOSA 1ZOTB 2WCHA 1XFWO 2L98A 1TCFA 3GK2A 4PHMA 1J55A 1EL4A 1Y0VH 3CZ1A 4GGNA 1YRUB 1J1DA 1QIVA 4IL1A 1A4PA 4F7FA 1QLSA 1KQMB 1RFJA 2JZIA 2F8PA 1KWOC 2LVJA 2KYCA 5KSZA 1A03A 4NDBA 1G4YR 3BUOB 3AAJA 3DVEA 3O2PA 1KFUS 5CPVA 3S0DA 1KFUL 2LHLA 3SG5A 1OOIX 1S6CA 1TWOA 3AKAA 1BMOA 4MRXA 4YGAA 4R1EA 1QXPA 1WLMA 1XFVO 2EGDA 3FE8A 1J7PA 2JXCA 2K0JA 3TS5C 4GPLB 3D77A 4C0KA 3BFHA 3CDNA 3O4XA 4U8DA 3RLZA 4BY5A 3D78A 1QJTA 3JTDC 2A4JA 3V2LA 3SG7A 1K9UA 1PSRA 1S3PA 4GGFC 2MLEC 2FCEA 2PALA 3DYEA 2M1UA 2JNXA 3VROA 2KBIA 1EG4A 2M7NA 3GOFA 4PE7A 2HETA 4HSZA 4M2PA 2OTGB 1DJYA 1U5IA 1MUXA 5FI7A 2LUXA 1W7IB 3R1PA 4PHNA 4WQ2A 1C3YA 2CTNA 3EKHA 3I5HB 1TNPA 3PFVA 3D73A 5CSNA 3BJHA 1CM1A 2SCPA 2KOTA 2WCLA 4N1FA 2LP2A 4P2YB 4PE4A 2KI4C 4A4BA 1MWNA 1CM4A 2K7CA 2ZRTA 5D7FA 3CR5X 5AERA 1L2OB 4D1EA 2K60A 2LVVA 2M1KB 2OS8C 2ZFDA 1TCOB 2K2FA 4I5KA 2PRUA 2QEHA 1TIZA 5DKNA 1NX0A 3DZTA 3SS3A 1B8CA 2QEVA 1NP8A 1TNQA 1YUUA 2LC5A 3BOWA 1KK8C 2KAVA 2JU0A 3DF0B 2K7DA 3SIAA 4OKHA 1WRLA 3SG3A 3QMEA 2K2AA 1NPQA 1JFJA 3PM8A 1K94A 2JTZA 3NSOA 1CLLA 1KCYA 1OZSA 1E8AA 4MZJA 1IJ5A 2QPTA 4FTGA 4QJ3B 2LCPA 1B9AA 1Y6WA 5BPJA 2VRGA 1AUIB 1CTRA 1IQ5A 1XFYO 1XFXO 2KI6C 1ORGA 3EVVA 1BOCA 1S36A 3DVJA 2QACA 3LK1A 2ZNEA 4AQIA 3VRNA 3FE6A 1EH2A 1BF5A 5KTYA 3Q8IA 4YGCB 2PQLA 5HKWA 4NDCA 3BXKA 2MBXA 3DXLA 3PJIA 1S5GZ 1CLMA 1CB1A 2JQ6A 2EC6B 3PLFB 1F71A 3HX4A 2JNFA 1BODA 1LA3A 2M97A 2WC6A 3WHTB 2RGIA 2PSRA 3S0GA 4C0JA 3CGAA 3AAKA 3I5IC 4OCIA 1OQPA 1NCZA 3CLNA 2HQWA 1ZMZA 1GJYA 3E3RA 1QWVA 1WY9A 2BL0C 4M2QA 1CDLA 1K9KA 1L7ZA 1KFXS 1SMGA 1QV1A 2LP3A 2MRDA 1TNWA 2Q4UA 3IF7A 2L5XB 4M2OA 3PM2A 2L4IA 2ZKMX 5K89A 5CSIA 5DICA 1MR8A 4MRYA 5CSJA 1DGUA 2WNDA 4GAOA 1DJWA 4HREE 3VB1A 4AOMA 2JPOA 2LM5A 5IBWA 2NCPA 3OP0A 1RECA 3RM1A 5D69A 3TDZA 5AEQA 1GM0A 3CZ2A 4PE1A 3OX5A 2G2BA 1IGVA 1GQMA 2ERBA 3IQOA 4MEWA 1KSOA 2GV5A 2Y4QA 3OB2B 2KDHA 1S6IA 1SL9A 4GBAA 3SS5A 1FBVA 1WRZA 1NX3A 3L47A 2GGMA 4PHKA 1DJXA 2ZRSA 2R2IA 3ICBA 3BUXB 1WDCC 3CYZA 1IKUA 5HKZA 1M31A 1YTZC 3D0YB 3NHIA 4I5JA 1PVAA 1SK6D 2WORA 1QX5B 2LVIA 3I5GB 1X02A 2AUCA 2KPHA 1M45A 3JVTC 2V53A 2KSPA 2KQ6A 2LLSA 2M0RA 1S5GY 2WCFA 3SG4A 3CZTX 1CLBA 1JSAA 3QRXA 1DVIA 2Q91A 1DT7B 2H8VA 3TUYC 2BBNA 3UNWA 2H61C 1HQVA 1A75B 3R1OA 1IRJA 1QVIY 2EHBA 2L2CA 2Y1NA 1NSHA 1Q80A 2JOJA 4JWQA 4CPVA 1RROA 5AXIA 1J7QA 4YBHB 4JKTA 1LINA 1RTP1 1K96A 3R72A 1JC2A 4PDZA 3M0WA 1JUOA 2LMUA 3DF0A 1B7TZ 5J3XA 3BUMB 4PCWA 3S0BA 1JBAA 4JPZB 1XFZO 1LXFC 2QDIA 3I5FB 4I5LB 5FI2A 4MZLA 1UHKA 2JULA 2O60A 4INXA 2BAPA 4YGDB 2CBLA 4ORCB 5GQQC 4BY4A 1BR4B 2JC2A 2LUCA 3TDUA 2KAYA 3B87A 4FQTA 1C7VA 5F6TA 1AK8A 2K7OA 2MAZA 1PK0D 1NIWA 3KF9A 4N5XA 3LCPC 5DKRA 1KQMC 2L2EA 4A4CA 4PT1A 1LA0A 2KHNA 3VRRA 1DMOA 4XJKA 1BJFA 1IG5A 1SCVA 3NSLA 2NZ0A 1IH0A 4OV2A 2KLDA 2M8UA 1UHIA 3NSKA 1JFKA 2DOQA 1J7OA 3KO0A 2JPTA 1BLQA 1TRFA 2PASA 4ORAB 3ZWHA 2HQ8A 1AJ4A 1MQ1A 1V1FA 1FI5A 1MXEA 1G8IA 1CDNA 2FJYA 1LS8A 2BCXA 2OTGC 3PN7B 2BKHB 1SR6B 1PRWA 1DJZA 2GGZA 3DY9A 3I5HC 1LKJA 1QATA 2H61A 2G9BA 1PULA 2JT0A 2JWWA 5D3OA 2LLUA 1ZACA 1K2HA 3FWCA 3OBVA 1C07A 1K8UA 1L2OC 1PSBA 1B7TY 1WRKA 3EK7A 1SW8A 2QEOA 4DRWA 3D10A 2SASA 1SCMB 2FOTA 4HRHA 2LHIA 5AFPA 3S0FA 1F8HA 3CR4X 4XJKB 1IQ3A 2KYFA 4ZCVA 3AKBA 3WNXB 3BFBA 5I2QA 1MF8B 1UP5A 1AP4A 1XFUO 2LVKA 4FQOA 1NX1A 1QLKA 2LAPA 3OX6A 4F0ZB 1D1OA 3D0YA 1SSEB 3A4UB 2ZN9A 1H4BA 1OOJA 5I2LA 4DCKA 1PALA 3LL8B 2LV7A 1OMVA 2KQYA 3NHTA 3PN7C 1QX7A 1CDPA 1DF0B 3CABA 3D76A 3GK1A 1LVCD 1QIWA 5AANA 2NXQA 1NCYA 3S0EA 1A75A 1K95A 1OZOA 3BUWB 3LK0A 1FI6A 1W7JB 3UO9A 3VGOA 1XYDA 2PVBA 1XK4A 5HKYA 1OMDA 2WCEA 1SL7A 1G33A 2MA2A 1RJVA 2MLFC 1S1EA 4MVFA 1UWOA 2KBMA 1Y1UA 2F2PA
chains in the Genus database with same CATH topology
2EC6C 4L9MA 2NCOA 3K21A 1NYAA 1F4QA 3CR2A 3BYAA 2KI6D 1TOPA 1SYMA 1BR1B 3DVMA 1UHHA 3ZNIA 1B8RA 2D8NA 3HCMA 1M63B 2OPOA 3CWGA 2K8MB 1ZUZA 1KK7Z 2H2KA 2KFGA 2L51A 2KAXA 4ICBA 4CIDA 3LLEA 2LE9B 2LMVA 1KSMA 5KU1A 1M39A 2NLNA 4USLA 1F54A 2TN4A 3TS5B 3TZ1A 1FW4A 2F3YA 2JTTA 3F45A 3NSIA 1TNXA 3JTDB 1ODBA 5B8IB 4YRUA 1EJ3A 1R6PA 1QV0A 1AJ5A 2KNEA 1ALWA 1GGZA 5ER4X 1CMFA 2KFHA 1ALVA 3PALA 3OB1B 3MSEB 2ZNDA 4OVNF 1ZFSA 1SL8A 2JRFA 1NCXA 2LNKA 5I2OA 1CFDA 1SNLA 4GUKA 3PATA 4MSPA 1B4CA 2BE6A 1B1GA 2CNPA 2KI4B 3CTNA 4I5NB 1F4OA 1J7RA 3O4YA 2OS8B 2I2RE 1BT6A 2Y1MA 1EXRA 4MN0A 1PVBA 1XO5A 3GK4X 2FJUB 1M46A 1JF0A 3IQQA 3FS7A 3EK4A 1B8LA 1FF1A 2ZN8A 3BUNB 3I5GC 4CLNA 1IJ6A 2WC8A 3BQ3A 2CXJA 5CSFA 4JQ0D 1KK8B 1N2DA 2M7LA 2F33A 2IS9A 3CS1A 4YI8A 4UPGA 4MZKA 3EVUA 3WHUB 3FWBA 1YVLA 1YUTA 3SIBA 1KK7Y 1XK4C 2WCBA 2BECA 4N1GA 2BE4A 2JT8A 5JOLA 4Q04A 1WLZA 5PALA 5TNCA 4C0LA 1CNPA 1R2UA 1BG1A 1DGVA 1OSAA 3PSRA 2M29A 4NQGA 4WQ3A 2BKIB 4NDDA 5JJGA 4MLWA 2COLB 4MBEA 3NXAA 3I5FC 4XYNA 3O6BA 1C7WA 1V1GA 4DUQA 1FPWA 1BU3A 1S26D 3SJSA 4AQJA 4QJ5B 3EVRA 1CMGA 1DJGA 1YR5A 1DF0A 1Y1XA 3TDIA 1JF2A 5HYDA 1TTXA 4ORBB 1S6JA 4YI9A 3I5IB 4TNCA 3C1VA 2ISDA 4DS7A 1QASA 2M3WA 2BCBA 1YX7A 4GNKB 2L50A 1TN4A 2BL0B 1QS7A 2K61A 1N0YA 4CFQA 1CFFA 2I18A 1CDMA 4WRIA 1XA5A 5I8NA 2O5GA 1SKTA 1U5IB 1YRTB 1K93D 3WXAA 2JT3A 2CT9A 1OMRA 3KEVA 1RWYA 3KPXA 1XVJA 2I7AA 3EKJA 1Y1AA 2KFFA 4YGEB 2JXLA 4HRGA 1A29A 2M49B 1SRAA 4YGBB 3SG6A 3VRQA 4GFTA 2L4HA 1RK9A 1YUSA 3VRPA 4PHJA 2L0PA 1DJIA 5ER5A 5HLVA 1CFCA 1KQVA 1SBJA 1EG3A 1AVSA 1J1EA 2P6BB 1SR6C 1N65A 4DIRA 3EK8A 2BBMA 4GGFA 3DVKA 2LLTA 1NUBA 1QVIZ 2E30A 3BOWB 1QX2A 1WDCB 2PMYA 4CFRA 1MXLC 3H4SE 3O78A 4PALA 1YX8A 1JWDA 5FYXA 1F70A 3OHMB 1QTXA 3FIAA 3KHEA 4ETOA 1KFXL 1GGWA 1SCMC 3JVTB 1NX2A 1B47A 1UUSA 5G08A 2Y5IA 2E6WA 2B1UA 2K7BA 1UURA 1NWDA 4P5OE 2M9GA 3TUYB 4ZCUA 1KWOB 2KGBC 3A8RA 1HT9A 1AHRA 2MHHA 1F55A 4QJ4B 3SG2A 1IWQA 1A2XA 1SPYA 1DTLA 2MJWB 1UHJA 2FCDA 4E68A 5DKQA 2HPSA 1OE9B 1VRKA 2KGRA 1DJHA 1K9PA 1CKKA 4OR9B 2HF5A 2LMTA 1K90D 1CFPA 2AMIA 1H8BA 1UHNA 5HLOA 2F3ZA 2LANA 1YURA 4PE0A 1MHOA 2F2OA 1YVHA 3DD4A 2I94A 2CCMA 2AAOA 2BCAA 1SY9A 2WOSA 1ZOTB 1XFWO 2L98A 1TCFA 3GK2A 4PHMA 1J55A 1EL4A 1Y0VH 4GGNA 1YRUB 1J1DA 1QIVA 4IL1A 1A4PA 1QLSA 1KQMB 1RFJA 2JZIA 2F8PA 1KWOC 2LVJA 2KYCA 5KSZA 1A03A 4NDBA 1G4YR 3BUOB 3AAJA 3DVEA 3O2PA 1KFUS 5CPVA 1KFUL 2LHLA 3SG5A 3AKAA 1S6CA 4MRXA 1BMOA 4YGAA 4R1EA 1QXPA 1WLMA 1XFVO 2EGDA 1J7PA 2JXCA 2K0JA 3TS5C 4GPLB 4C0KA 4U8DA 3RLZA 4BY5A 3JTDC 1QJTA 2A4JA 3SG7A 1K9UA 1PSRA 1S3PA 4GGFC 2MLEC 2FCEA 2PALA 2M1UA 2JNXA 3VROA 2KBIA 1EG4A 2M7NA 3GOFA 4PE7A 2HETA 4HSZA 4M2PA 2OTGB 1DJYA 1U5IA 1MUXA 2LUXA 1W7IB 4WQ2A 4PHNA 2CTNA 3EKHA 3I5HB 1TNPA 3PFVA 5CSNA 1CM1A 2SCPA 2KOTA 4P2YB 4N1FA 2LP2A 4A4BA 4PE4A 2KI4C 5AERA 1MWNA 1CM4A 2K7CA 2ZRTA 5D7FA 3CR5X 1L2OB 4D1EA 2LVVA 2M1KB 2OS8C 2ZFDA 1TCOB 2K2FA 4I5KA 2PRUA 1TIZA 5DKNA 1NX0A 1B8CA 1NP8A 1TNQA 1YUUA 2LC5A 3BOWA 1KK8C 2KAVA 2JU0A 3DF0B 2K7DA 3SIAA 4OKHA 1WRLA 3SG3A 2K2AA 1NPQA 1JFJA 3PM8A 1K94A 2JTZA 3NSOA 1CLLA 1KCYA 1OZSA 1E8AA 4MZJA 1IJ5A 2QPTA 4FTGA 4QJ3B 2LCPA 1B9AA 1Y6WA 5BPJA 2VRGA 1AUIB 1CTRA 1IQ5A 1XFYO 1XFXO 2KI6C 3EVVA 1BOCA 1S36A 3DVJA 2QACA 3LK1A 2ZNEA 4AQIA 3VRNA 1EH2A 1BF5A 5KTYA 4YGCB 5HKWA 4NDCA 3BXKA 2MBXA 1CB1A 1S5GZ 1CLMA 2JQ6A 2EC6B 3PLFB 1F71A 3HX4A 2JNFA 1BODA 1LA3A 2M97A 3WHTB 2RGIA 2PSRA 4C0JA 3CGAA 3AAKA 3I5IC 4OCIA 1OQPA 1NCZA 3CLNA 2HQWA 1ZMZA 1GJYA 3E3RA 1WY9A 2BL0C 4M2QA 1CDLA 1K9KA 1L7ZA 1KFXS 1SMGA 1QV1A 2LP3A 2MRDA 1TNWA 2Q4UA 3IF7A 2L5XB 4M2OA 2L4IA 2ZKMX 5K89A 5CSIA 1MR8A 4MRYA 5CSJA 1DGUA 2WNDA 4GAOA 1DJWA 4HREE 4AOMA 2LM5A 5IBWA 2NCPA 3OP0A 1RECA 3RM1A 5D69A 3TDZA 5AEQA 4PE1A 3OX5A 2G2BA 1IGVA 1GQMA 3IQOA 4MEWA 1KSOA 2GV5A 2Y4QA 3OB2B 2KDHA 1S6IA 1SL9A 4GBAA 1FBVA 1WRZA 1NX3A 2GGMA 4PHKA 1DJXA 2ZRSA 2R2IA 3ICBA 3BUXB 1WDCC 1IKUA 5HKZA 1M31A 1YTZC 3D0YB 4I5JA 1PVAA 1SK6D 2WORA 1QX5B 2LVIA 3I5GB 1X02A 2AUCA 1M45A 3JVTC 2V53A 2KSPA 2KQ6A 2LLSA 2M0RA 1S5GY 2WCFA 3SG4A 3CZTX 1CLBA 1JSAA 3QRXA 1DVIA 2Q91A 1DT7B 3TUYC 2BBNA 2H61C 1HQVA 1A75B 1IRJA 1QVIY 2EHBA 2Y1NA 1NSHA 1Q80A 2JOJA 4JWQA 4CPVA 1RROA 5AXIA 1J7QA 4YBHB 1LINA 1RTP1 1K96A 1JC2A 4PDZA 3M0WA 1JUOA 2LMUA 3DF0A 1B7TZ 5J3XA 3BUMB 4PCWA 1JBAA 4JPZB 1XFZO 1LXFC 3I5FB 4I5LB 4MZLA 1UHKA 2JULA 2O60A 4YGDB 2CBLA 4ORCB 5GQQC 4BY4A 1BR4B 2JC2A 2LUCA 3TDUA 2KAYA 1C7VA 5F6TA 1AK8A 2K7OA 2MAZA 1PK0D 1NIWA 3KF9A 4N5XA 3LCPC 5DKRA 1KQMC 2L2EA 4A4CA 1LA0A 2KHNA 3VRRA 1DMOA 4XJKA 1BJFA 1IG5A 1SCVA 3NSLA 2NZ0A 1IH0A 4OV2A 2M8UA 1UHIA 3NSKA 1JFKA 2DOQA 1J7OA 3KO0A 2JPTA 1BLQA 1TRFA 2PASA 4ORAB 3ZWHA 2HQ8A 1AJ4A 1MQ1A 1V1FA 1FI5A 1MXEA 1G8IA 1CDNA 2BCXA 2OTGC 3PN7B 2BKHB 1SR6B 1PRWA 1DJZA 2GGZA 3I5HC 1LKJA 1QATA 2H61A 2G9BA 1PULA 2JT0A 2JWWA 2LLUA 1ZACA 1K2HA 3FWCA 1C07A 1K8UA 1L2OC 1PSBA 1B7TY 1WRKA 3EK7A 1SW8A 4DRWA 3D10A 2SASA 1SCMB 2FOTA 4HRHA 2LHIA 5AFPA 1F8HA 3CR4X 4XJKB 1IQ3A 2KYFA 4ZCVA 3AKBA 3WNXB 5I2QA 1MF8B 1UP5A 1AP4A 1XFUO 2LVKA 4FQOA 1NX1A 1QLKA 2LAPA 3OX6A 4F0ZB 1D1OA 3D0YA 1H4BA 3A4UB 2ZN9A 1OOJA 5I2LA 4DCKA 1PALA 3LL8B 2LV7A 1OMVA 2KQYA 3PN7C 1QX7A 1CDPA 1DF0B 3GK1A 1LVCD 1QIWA 5AANA 2NXQA 1NCYA 1A75A 1K95A 1OZOA 3BUWB 3LK0A 1FI6A 1W7JB 3VGOA 1XYDA 2PVBA 1XK4A 5HKYA 1OMDA 2WCEA 1SL7A 1G33A 2MA2A 1RJVA 2MLFC 1S1EA 4MVFA 1UWOA 2KBMA 1Y1UA 2F2PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EC6 C;  4L9M A;  2NCO A;  3K21 A;  1NYA A;  1F4Q A;  3CR2 A;  3BYA A;  2KI6 D;  1TOP A;  1SYM A;  1BR1 B;  3DVM A;  1UHH A;  3ZNI A;  1B8R A;  2D8N A;  3HCM A;  1M63 B;  2OPO A;  3CWG A;  2K8M B;  1ZUZ A;  1KK7 Z;  2H2K A;  2KFG A;  2L51 A;  2KAX A;  4ICB A;  4CID A;  3LLE A;  2LE9 B;  2LMV A;  1KSM A;  5KU1 A;  1M39 A;  2NLN A;  4USL A;  1F54 A;  2TN4 A;  3TS5 B;  3TZ1 A;  1FW4 A;  2F3Y A;  2JTT A;  3F45 A;  3NSI A;  1TNX A;  3JTD B;  1ODB A;  5B8I B;  4YRU A;  1EJ3 A;  1R6P A;  1QV0 A;  1AJ5 A;  2KNE A;  1ALW A;  1GGZ A;  5ER4 X;  1CMF A;  2KFH A;  1ALV A;  3PAL A;  3OB1 B;  3MSE B;  2ZND A;  4OVN F;  1ZFS A;  1SL8 A;  2JRF A;  1NCX A;  2LNK A;  5I2O A;  1CFD A;  1SNL A;  4GUK A;  3PAT A;  4MSP A;  1B4C A;  2BE6 A;  1B1G A;  2CNP A;  2KI4 B;  3CTN A;  4I5N B;  1F4O A;  1J7R A;  3O4Y A;  2OS8 B;  2I2R E;  1BT6 A;  2Y1M A;  1EXR A;  4MN0 A;  1PVB A;  1XO5 A;  3GK4 X;  2FJU B;  1M46 A;  1JF0 A;  3IQQ A;  3FS7 A;  3EK4 A;  1B8L A;  1FF1 A;  2ZN8 A;  3BUN B;  3I5G C;  4CLN A;  1IJ6 A;  2WC8 A;  3BQ3 A;  2CXJ A;  5CSF A;  4JQ0 D;  1KK8 B;  1N2D A;  2M7L A;  2F33 A;  2IS9 A;  3CS1 A;  4YI8 A;  4UPG A;  4MZK A;  3EVU A;  3WHU B;  3FWB A;  1YVL A;  1YUT A;  3SIB A;  1KK7 Y;  1XK4 C;  2WCB A;  2BEC A;  4N1G A;  2BE4 A;  2JT8 A;  5JOL A;  4Q04 A;  1WLZ A;  5PAL A;  5TNC A;  4C0L A;  1CNP A;  1R2U A;  1BG1 A;  1DGV A;  1OSA A;  3PSR A;  2M29 A;  4NQG A;  4WQ3 A;  2BKI B;  4NDD A;  5JJG A;  4MLW A;  2COL B;  4MBE A;  3NXA A;  3I5F C;  4XYN A;  3O6B A;  1C7W A;  1V1G A;  4DUQ A;  1FPW A;  1BU3 A;  1S26 D;  3SJS A;  4AQJ A;  4QJ5 B;  3EVR A;  1CMG A;  1DJG A;  1YR5 A;  1DF0 A;  1Y1X A;  3TDI A;  1JF2 A;  5HYD A;  1TTX A;  4ORB B;  1S6J A;  4YI9 A;  3I5I B;  4TNC A;  3C1V A;  2ISD A;  4DS7 A;  1QAS A;  2M3W A;  2BCB A;  1YX7 A;  4GNK B;  2L50 A;  1TN4 A;  2BL0 B;  1QS7 A;  2K61 A;  1N0Y A;  4CFQ A;  1CFF A;  2I18 A;  1CDM A;  4WRI A;  1XA5 A;  5I8N A;  2O5G A;  1SKT A;  1U5I B;  1YRT B;  1K93 D;  3WXA A;  2JT3 A;  2CT9 A;  1OMR A;  3KEV A;  1RWY A;  3KPX A;  1XVJ A;  2I7A A;  3EKJ A;  1Y1A A;  2KFF A;  4YGE B;  2JXL A;  4HRG A;  1A29 A;  2M49 B;  1SRA A;  4YGB B;  3SG6 A;  3VRQ A;  4GFT A;  2L4H A;  1RK9 A;  1YUS A;  3VRP A;  4PHJ A;  2L0P A;  1DJI A;  5ER5 A;  5HLV A;  1CFC A;  1KQV A;  1SBJ A;  1EG3 A;  1AVS A;  1J1E A;  2P6B B;  1SR6 C;  1N65 A;  4DIR A;  3EK8 A;  2BBM A;  4GGF A;  3DVK A;  2LLT A;  1NUB A;  1QVI Z;  2E30 A;  3BOW B;  1QX2 A;  1WDC B;  2PMY A;  4CFR A;  1MXL C;  3H4S E;  3O78 A;  4PAL A;  1YX8 A;  1JWD A;  5FYX A;  1F70 A;  3OHM B;  1QTX A;  3FIA A;  3KHE A;  4ETO A;  1KFX L;  1GGW A;  1SCM C;  3JVT B;  1NX2 A;  1B47 A;  1UUS A;  5G08 A;  2Y5I A;  2E6W A;  2B1U A;  2K7B A;  1UUR A;  1NWD A;  4P5O E;  2M9G A;  3TUY B;  4ZCU A;  1KWO B;  2KGB C;  3A8R A;  1HT9 A;  1AHR A;  2MHH A;  1F55 A;  4QJ4 B;  3SG2 A;  1IWQ A;  1A2X A;  1SPY A;  1DTL A;  2MJW B;  1UHJ A;  2FCD A;  4E68 A;  5DKQ A;  2HPS A;  1OE9 B;  1VRK A;  2KGR A;  1DJH A;  1K9P A;  1CKK A;  4OR9 B;  2HF5 A;  2LMT A;  1K90 D;  1CFP A;  2AMI A;  1H8B A;  1UHN A;  5HLO A;  2F3Z A;  2LAN A;  1YUR A;  4PE0 A;  1MHO A;  2F2O A;  1YVH A;  3DD4 A;  2I94 A;  2CCM A;  2AAO A;  2BCA A;  1SY9 A;  2WOS A;  1ZOT B;  1XFW O;  2L98 A;  1TCF A;  3GK2 A;  4PHM A;  1J55 A;  1EL4 A;  1Y0V H;  4GGN A;  1YRU B;  1J1D A;  1QIV A;  4IL1 A;  1A4P A;  1QLS A;  1KQM B;  1RFJ A;  2JZI A;  2F8P A;  1KWO C;  2LVJ A;  2KYC A;  5KSZ A;  1A03 A;  4NDB A;  1G4Y R;  3BUO B;  3AAJ A;  3DVE A;  3O2P A;  1KFU S;  5CPV A;  1KFU L;  2LHL A;  3SG5 A;  3AKA A;  1S6C A;  4MRX A;  1BMO A;  4YGA A;  4R1E A;  1QXP A;  1WLM A;  1XFV O;  2EGD A;  1J7P A;  2JXC A;  2K0J A;  3TS5 C;  4GPL B;  4C0K A;  4U8D A;  3RLZ A;  4BY5 A;  3JTD C;  1QJT A;  2A4J A;  3SG7 A;  1K9U A;  1PSR A;  1S3P A;  4GGF C;  2MLE C;  2FCE A;  2PAL A;  2M1U A;  2JNX A;  3VRO A;  2KBI A;  1EG4 A;  2M7N A;  3GOF A;  4PE7 A;  2HET A;  4HSZ A;  4M2P A;  2OTG B;  1DJY A;  1U5I A;  1MUX A;  2LUX A;  1W7I B;  4WQ2 A;  4PHN A;  2CTN A;  3EKH A;  3I5H B;  1TNP A;  3PFV A;  5CSN A;  1CM1 A;  2SCP A;  2KOT A;  4P2Y B;  4N1F A;  2LP2 A;  4A4B A;  4PE4 A;  2KI4 C;  5AER A;  1MWN A;  1CM4 A;  2K7C A;  2ZRT A;  5D7F A;  3CR5 X;  1L2O B;  4D1E A;  2LVV A;  2M1K B;  2OS8 C;  2ZFD A;  1TCO B;  2K2F A;  4I5K A;  2PRU A;  1TIZ A;  5DKN A;  1NX0 A;  1B8C A;  1NP8 A;  1TNQ A;  1YUU A;  2LC5 A;  3BOW A;  1KK8 C;  2KAV A;  2JU0 A;  3DF0 B;  2K7D A;  3SIA A;  4OKH A;  1WRL A;  3SG3 A;  2K2A A;  1NPQ A;  1JFJ A;  3PM8 A;  1K94 A;  2JTZ A;  3NSO A;  1CLL A;  1KCY A;  1OZS A;  1E8A A;  4MZJ A;  1IJ5 A;  2QPT A;  4FTG A;  4QJ3 B;  2LCP A;  1B9A A;  1Y6W A;  5BPJ A;  2VRG A;  1AUI B;  1CTR A;  1IQ5 A;  1XFY O;  1XFX O;  2KI6 C;  3EVV A;  1BOC A;  1S36 A;  3DVJ A;  2QAC A;  3LK1 A;  2ZNE A;  4AQI A;  3VRN A;  1EH2 A;  1BF5 A;  5KTY A;  4YGC B;  5HKW A;  4NDC A;  3BXK A;  2MBX A;  1CB1 A;  1S5G Z;  1CLM A;  2JQ6 A;  2EC6 B;  3PLF B;  1F71 A;  3HX4 A;  2JNF A;  1BOD A;  1LA3 A;  2M97 A;  3WHT B;  2RGI A;  2PSR A;  4C0J A;  3CGA A;  3AAK A;  3I5I C;  4OCI A;  1OQP A;  1NCZ A;  3CLN A;  2HQW A;  1ZMZ A;  1GJY A;  3E3R A;  1WY9 A;  2BL0 C;  4M2Q A;  1CDL A;  1K9K A;  1L7Z A;  1KFX S;  1SMG A;  1QV1 A;  2LP3 A;  2MRD A;  1TNW A;  2Q4U A;  3IF7 A;  2L5X B;  4M2O A;  2L4I A;  2ZKM X;  5K89 A;  5CSI A;  1MR8 A;  4MRY A;  5CSJ A;  1DGU A;  2WND A;  4GAO A;  1DJW A;  4HRE E;  4AOM A;  2LM5 A;  5IBW A;  2NCP A;  3OP0 A;  1REC A;  3RM1 A;  5D69 A;  3TDZ A;  5AEQ A;  4PE1 A;  3OX5 A;  2G2B A;  1IGV A;  1GQM A;  3IQO A;  4MEW A;  1KSO A;  2GV5 A;  2Y4Q A;  3OB2 B;  2KDH A;  1S6I A;  1SL9 A;  4GBA A;  1FBV A;  1WRZ A;  1NX3 A;  2GGM A;  4PHK A;  1DJX A;  2ZRS A;  2R2I A;  3ICB A;  3BUX B;  1WDC C;  1IKU A;  5HKZ A;  1M31 A;  1YTZ C;  3D0Y B;  4I5J A;  1PVA A;  1SK6 D;  2WOR A;  1QX5 B;  2LVI A;  3I5G B;  1X02 A;  2AUC A;  1M45 A;  3JVT C;  2V53 A;  2KSP A;  2KQ6 A;  2LLS A;  2M0R A;  1S5G Y;  2WCF A;  3SG4 A;  3CZT X;  1CLB A;  1JSA A;  3QRX A;  1DVI A;  2Q91 A;  1DT7 B;  3TUY C;  2BBN A;  2H61 C;  1HQV A;  1A75 B;  1IRJ A;  1QVI Y;  2EHB A;  2Y1N A;  1NSH A;  1Q80 A;  2JOJ A;  4JWQ A;  4CPV A;  1RRO A;  5AXI A;  1J7Q A;  4YBH B;  1LIN A;  1RTP 1;  1K96 A;  1JC2 A;  4PDZ A;  3M0W A;  1JUO A;  2LMU A;  3DF0 A;  1B7T Z;  5J3X A;  3BUM B;  4PCW A;  1JBA A;  4JPZ B;  1XFZ O;  1LXF C;  3I5F B;  4I5L B;  4MZL A;  1UHK A;  2JUL A;  2O60 A;  4YGD B;  2CBL A;  4ORC B;  5GQQ C;  4BY4 A;  1BR4 B;  2JC2 A;  2LUC A;  3TDU A;  2KAY A;  1C7V A;  5F6T A;  1AK8 A;  2K7O A;  2MAZ A;  1PK0 D;  1NIW A;  3KF9 A;  4N5X A;  3LCP C;  5DKR A;  1KQM C;  2L2E A;  4A4C A;  1LA0 A;  2KHN A;  3VRR A;  1DMO A;  4XJK A;  1BJF A;  1IG5 A;  1SCV A;  3NSL A;  2NZ0 A;  1IH0 A;  4OV2 A;  2M8U A;  1UHI A;  3NSK A;  1JFK A;  2DOQ A;  1J7O A;  3KO0 A;  2JPT A;  1BLQ A;  1TRF A;  2PAS A;  4ORA B;  3ZWH A;  2HQ8 A;  1AJ4 A;  1MQ1 A;  1V1F A;  1FI5 A;  1MXE A;  1G8I A;  1CDN A;  2BCX A;  2OTG C;  3PN7 B;  2BKH B;  1SR6 B;  1PRW A;  1DJZ A;  2GGZ A;  3I5H C;  1LKJ A;  1QAT A;  2H61 A;  2G9B A;  1PUL A;  2JT0 A;  2JWW A;  2LLU A;  1ZAC A;  1K2H A;  3FWC A;  1C07 A;  1K8U A;  1L2O C;  1PSB A;  1B7T Y;  1WRK A;  3EK7 A;  1SW8 A;  4DRW A;  3D10 A;  2SAS A;  1SCM B;  2FOT A;  4HRH A;  2LHI A;  5AFP A;  1F8H A;  3CR4 X;  4XJK B;  1IQ3 A;  2KYF A;  4ZCV A;  3AKB A;  3WNX B;  5I2Q A;  1MF8 B;  1UP5 A;  1AP4 A;  1XFU O;  2LVK A;  4FQO A;  1NX1 A;  1QLK A;  2LAP A;  3OX6 A;  4F0Z B;  1D1O A;  3D0Y A;  1H4B A;  3A4U B;  2ZN9 A;  1OOJ A;  5I2L A;  4DCK A;  1PAL A;  3LL8 B;  2LV7 A;  1OMV A;  2KQY A;  3PN7 C;  1QX7 A;  1CDP A;  1DF0 B;  3GK1 A;  1LVC D;  1QIW A;  5AAN A;  2NXQ A;  1NCY A;  1A75 A;  1K95 A;  1OZO A;  3BUW B;  3LK0 A;  1FI6 A;  1W7J B;  3VGO A;  1XYD A;  2PVB A;  1XK4 A;  5HKY A;  1OMD A;  2WCE A;  1SL7 A;  1G33 A;  2MA2 A;  1RJV A;  2MLF C;  1S1E A;  4MVF A;  1UWO A;  2KBM A;  1Y1U A;  2F2P A; 
#chains in the Genus database with same CATH topology
 2EC6 C;  4L9M A;  2NCO A;  3K21 A;  1NYA A;  1F4Q A;  3CR2 A;  3BYA A;  2KI6 D;  1TOP A;  4KYN A;  1SYM A;  1BR1 B;  3DVM A;  1UHH A;  1Z4H A;  3ZNI A;  1B8R A;  2L5Y A;  2D8N A;  1OOH A;  3HCM A;  1M63 B;  2OPO A;  3CWG A;  2K8M B;  1ZUZ A;  1KK7 Z;  2H2K A;  2KFG A;  1DEL A;  2KAX A;  2L51 A;  4ICB A;  4CID A;  3LLE A;  2LE9 B;  2LMV A;  1KSM A;  5KU1 A;  5HL1 A;  1M39 A;  2NLN A;  4USL A;  1F54 A;  2TN4 A;  3TS5 B;  1DQE A;  3TZ1 A;  1FW4 A;  2F3Y A;  2JTT A;  3F45 A;  3NSI A;  1TNX A;  3JTD B;  1ODB A;  5B8I B;  4YRU A;  1DC1 A;  1EJ3 A;  1R6P A;  1QV0 A;  1AJ5 A;  2KNE A;  1ALW A;  1GGZ A;  2P71 A;  5ER4 X;  1CMF A;  2KFH A;  1ALV A;  3PAL A;  3OB1 B;  3MSE B;  2ZND A;  4OVN F;  1ZFS A;  2WCK A;  1SL8 A;  2JRF A;  2KLE A;  4IJ7 A;  1NCX A;  1TUJ A;  2LNK A;  5I2O A;  1CFD A;  3EG5 B;  1SNL A;  4GUK A;  3K1E A;  2P70 A;  3PAT A;  4MSP A;  1TUZ A;  1XFR A;  1B4C A;  2BE6 A;  1B1G A;  2CNP A;  2KI4 B;  3CTN A;  4I5N B;  1F4O A;  1J7R A;  3O4Y A;  4INW A;  2OS8 B;  2I2R E;  1BT6 A;  2Y1M A;  1EXR A;  4MN0 A;  1PVB A;  1XO5 A;  3GK4 X;  2FJU B;  1M46 A;  1JF0 A;  3IQQ A;  3FS7 A;  3EK4 A;  1B8L A;  1FF1 A;  2ZN8 A;  3BUN B;  3I5G C;  4CLN A;  1IJ6 A;  2WC8 A;  3B86 A;  3BQ3 A;  2BNX A;  2CXJ A;  4JQ0 D;  1KK8 B;  1N2D A;  5CSF A;  2M7L A;  2F33 A;  2IS9 A;  3CS1 A;  3IVT A;  4YI8 A;  4UPG A;  4MZK A;  3EVU A;  2GTE A;  3WHU B;  3FWB A;  1YVL A;  1IIO A;  1OW4 A;  1YUT A;  3L4L A;  3SIB A;  1KK7 Y;  1XK4 C;  2WCB A;  2BEC A;  4N1G A;  2BE4 A;  2JT8 A;  5JOL A;  3FE9 A;  1WLZ A;  3D75 A;  4Q04 A;  5PAL A;  5TNC A;  4C0L A;  1CNP A;  1R2U A;  1BG1 A;  1DGV A;  1OSA A;  3PSR A;  2M29 A;  4NQG A;  4WQ3 A;  2BKI B;  2QEB A;  4NDD A;  1OOG A;  4MLW A;  5JJG A;  4JD9 A;  1P28 A;  2COL B;  5EL2 A;  5I94 A;  4MBE A;  3NXA A;  3I5F C;  4XYN A;  1DEK A;  3O6B A;  1C7W A;  1V1G A;  3N7H A;  4DUQ A;  1FPW A;  1BU3 A;  1S26 D;  3SJS A;  4AQJ A;  4QJ5 B;  3EVR A;  1CMG A;  1DJG A;  1YR5 A;  1DF0 A;  1Y1X A;  5FI6 A;  3TDI A;  1JF2 A;  5HYD A;  3BFA A;  1TTX A;  4ORB B;  1S6J A;  4YI9 A;  3I5I B;  4TNC A;  3C1V A;  2ISD A;  4DS7 A;  1QAS A;  2M3W A;  1YX7 A;  2BCB A;  4GNK B;  2L50 A;  1TN4 A;  2BL0 B;  1QS7 A;  2K61 A;  1N0Y A;  2WCJ A;  4CFQ A;  3L4A A;  1CFF A;  2I18 A;  1C3Z A;  1CDM A;  3OGN A;  4OZD A;  4WRI A;  3D74 A;  1XA5 A;  5I8N A;  1T14 A;  2O5G A;  1SKT A;  1U5I B;  1YRT B;  1K93 D;  3WXA A;  2JT3 A;  1OMR A;  2CT9 A;  3KEV A;  1RWY A;  3KPX A;  1XVJ A;  2I7A A;  2PYQ A;  3EKJ A;  1Y1A A;  2KFF A;  4YGE B;  2JXL A;  4HRG A;  1A29 A;  2M49 B;  1SRA A;  4YGB B;  3SG6 A;  3VRQ A;  4GFT A;  2L4H A;  3B88 A;  3B6X A;  1RK9 A;  1YUS A;  3VRP A;  4PHJ A;  2L0P A;  1DJI A;  5ER5 A;  5HLV A;  1CFC A;  1KQV A;  1SBJ A;  1EG3 A;  1AVS A;  1J1E A;  2P6B B;  3SS4 A;  1SR6 C;  1N65 A;  4DIR A;  3EK8 A;  2BBM A;  4GGF A;  3CZ0 A;  3DVK A;  1W9Z A;  2LLT A;  3R1V A;  3RZS A;  3NGV A;  1NUB A;  1QVI Z;  2E30 A;  3BOW B;  1QX2 A;  1WDC B;  2PMY A;  4CFR A;  3B7A A;  1MXL C;  3H4S E;  3O78 A;  4PAL A;  1YX8 A;  1JWD A;  5FYX A;  2WC5 A;  1F70 A;  3OHM B;  1QTX A;  2WCM A;  3FIA A;  3KHE A;  1KFX L;  4ETO A;  1GGW A;  1SCM C;  1Z2C B;  3JVT B;  1NX2 A;  1B47 A;  1UUS A;  5G08 A;  2Y5I A;  2E6W A;  2B1U A;  2K7B A;  1UUR A;  1NWD A;  4P5O E;  2M9G A;  3TUY B;  4ZCU A;  1KWO B;  2KGB C;  3A8R A;  1HT9 A;  1AHR A;  2MHH A;  1F55 A;  4QJ4 B;  3SG2 A;  1IWQ A;  1A2X A;  1SPY A;  1DTL A;  2MJW B;  1UHJ A;  2FCD A;  4E68 A;  5DKQ A;  2HPS A;  1OE9 B;  1VRK A;  1OOF A;  1DJH A;  1K9P A;  2KGR A;  4OR9 B;  2HF5 A;  1CKK A;  2LMT A;  1K90 D;  1CFP A;  2AMI A;  3S0A A;  1H8B A;  1UHN A;  5HLO A;  2F3Z A;  2LAN A;  1YUR A;  4PE0 A;  1MHO A;  2F2O A;  2YGU A;  1YVH A;  3DD4 A;  2I94 A;  2CCM A;  2AAO A;  2BCA A;  1SY9 A;  2WOS A;  1ZOT B;  2WCH A;  1XFW O;  2L98 A;  1TCF A;  3GK2 A;  4PHM A;  1J55 A;  1EL4 A;  1Y0V H;  3CZ1 A;  4GGN A;  1YRU B;  1J1D A;  1QIV A;  4IL1 A;  1A4P A;  4F7F A;  1QLS A;  1KQM B;  1RFJ A;  2JZI A;  2F8P A;  1KWO C;  2LVJ A;  2KYC A;  5KSZ A;  1A03 A;  4NDB A;  1G4Y R;  3BUO B;  3AAJ A;  3DVE A;  3O2P A;  1KFU S;  5CPV A;  3S0D A;  1KFU L;  2LHL A;  3SG5 A;  1OOI X;  1S6C A;  1TWO A;  3AKA A;  1BMO A;  4MRX A;  4YGA A;  4R1E A;  1QXP A;  1WLM A;  1XFV O;  2EGD A;  3FE8 A;  1J7P A;  2JXC A;  2K0J A;  3TS5 C;  4GPL B;  3D77 A;  4C0K A;  3BFH A;  3CDN A;  3O4X A;  4U8D A;  3RLZ A;  4BY5 A;  3D78 A;  1QJT A;  3JTD C;  2A4J A;  3V2L A;  3SG7 A;  1K9U A;  1PSR A;  1S3P A;  4GGF C;  2MLE C;  2FCE A;  2PAL A;  3DYE A;  2M1U A;  2JNX A;  3VRO A;  2KBI A;  1EG4 A;  2M7N A;  3GOF A;  4PE7 A;  2HET A;  4HSZ A;  4M2P A;  2OTG B;  1DJY A;  1U5I A;  1MUX A;  5FI7 A;  2LUX A;  1W7I B;  3R1P A;  4PHN A;  4WQ2 A;  1C3Y A;  2CTN A;  3EKH A;  3I5H B;  1TNP A;  3PFV A;  3D73 A;  5CSN A;  3BJH A;  1CM1 A;  2SCP A;  2KOT A;  2WCL A;  4N1F A;  2LP2 A;  4P2Y B;  4PE4 A;  2KI4 C;  4A4B A;  1MWN A;  1CM4 A;  2K7C A;  2ZRT A;  5D7F A;  3CR5 X;  5AER A;  1L2O B;  4D1E A;  2K60 A;  2LVV A;  2M1K B;  2OS8 C;  2ZFD A;  1TCO B;  2K2F A;  4I5K A;  2PRU A;  2QEH A;  1TIZ A;  5DKN A;  1NX0 A;  3DZT A;  3SS3 A;  1B8C A;  2QEV A;  1NP8 A;  1TNQ A;  1YUU A;  2LC5 A;  3BOW A;  1KK8 C;  2KAV A;  2JU0 A;  3DF0 B;  2K7D A;  3SIA A;  4OKH A;  1WRL A;  3SG3 A;  3QME A;  2K2A A;  1NPQ A;  1JFJ A;  3PM8 A;  1K94 A;  2JTZ A;  3NSO A;  1CLL A;  1KCY A;  1OZS A;  1E8A A;  4MZJ A;  1IJ5 A;  2QPT A;  4FTG A;  4QJ3 B;  2LCP A;  1B9A A;  1Y6W A;  5BPJ A;  2VRG A;  1AUI B;  1CTR A;  1IQ5 A;  1XFY O;  1XFX O;  2KI6 C;  1ORG A;  3EVV A;  1BOC A;  1S36 A;  3DVJ A;  2QAC A;  3LK1 A;  2ZNE A;  4AQI A;  3VRN A;  3FE6 A;  1EH2 A;  1BF5 A;  5KTY A;  3Q8I A;  4YGC B;  2PQL A;  5HKW A;  4NDC A;  3BXK A;  2MBX A;  3DXL A;  3PJI A;  1S5G Z;  1CLM A;  1CB1 A;  2JQ6 A;  2EC6 B;  3PLF B;  1F71 A;  3HX4 A;  2JNF A;  1BOD A;  1LA3 A;  2M97 A;  2WC6 A;  3WHT B;  2RGI A;  2PSR A;  3S0G A;  4C0J A;  3CGA A;  3AAK A;  3I5I C;  4OCI A;  1OQP A;  1NCZ A;  3CLN A;  2HQW A;  1ZMZ A;  1GJY A;  3E3R A;  1QWV A;  1WY9 A;  2BL0 C;  4M2Q A;  1CDL A;  1K9K A;  1L7Z A;  1KFX S;  1SMG A;  1QV1 A;  2LP3 A;  2MRD A;  1TNW A;  2Q4U A;  3IF7 A;  2L5X B;  4M2O A;  3PM2 A;  2L4I A;  2ZKM X;  5K89 A;  5CSI A;  5DIC A;  1MR8 A;  4MRY A;  5CSJ A;  1DGU A;  2WND A;  4GAO A;  1DJW A;  4HRE E;  3VB1 A;  4AOM A;  2JPO A;  2LM5 A;  5IBW A;  2NCP A;  3OP0 A;  1REC A;  3RM1 A;  5D69 A;  3TDZ A;  5AEQ A;  1GM0 A;  3CZ2 A;  4PE1 A;  3OX5 A;  2G2B A;  1IGV A;  1GQM A;  2ERB A;  3IQO A;  4MEW A;  1KSO A;  2GV5 A;  2Y4Q A;  3OB2 B;  2KDH A;  1S6I A;  1SL9 A;  4GBA A;  3SS5 A;  1FBV A;  1WRZ A;  1NX3 A;  3L47 A;  2GGM A;  4PHK A;  1DJX A;  2ZRS A;  2R2I A;  3ICB A;  3BUX B;  1WDC C;  3CYZ A;  1IKU A;  5HKZ A;  1M31 A;  1YTZ C;  3D0Y B;  3NHI A;  4I5J A;  1PVA A;  1SK6 D;  2WOR A;  1QX5 B;  2LVI A;  3I5G B;  1X02 A;  2AUC A;  2KPH A;  1M45 A;  3JVT C;  2V53 A;  2KSP A;  2KQ6 A;  2LLS A;  2M0R A;  1S5G Y;  2WCF A;  3SG4 A;  3CZT X;  1CLB A;  1JSA A;  3QRX A;  1DVI A;  2Q91 A;  1DT7 B;  2H8V A;  3TUY C;  2BBN A;  3UNW A;  2H61 C;  1HQV A;  1A75 B;  3R1O A;  1IRJ A;  1QVI Y;  2EHB A;  2L2C A;  2Y1N A;  1NSH A;  1Q80 A;  2JOJ A;  4JWQ A;  4CPV A;  1RRO A;  5AXI A;  1J7Q A;  4YBH B;  4JKT A;  1LIN A;  1RTP 1;  1K96 A;  3R72 A;  1JC2 A;  4PDZ A;  3M0W A;  1JUO A;  2LMU A;  3DF0 A;  1B7T Z;  5J3X A;  3BUM B;  4PCW A;  3S0B A;  1JBA A;  4JPZ B;  1XFZ O;  1LXF C;  2QDI A;  3I5F B;  4I5L B;  5FI2 A;  4MZL A;  1UHK A;  2JUL A;  2O60 A;  4INX A;  2BAP A;  4YGD B;  2CBL A;  4ORC B;  5GQQ C;  4BY4 A;  1BR4 B;  2JC2 A;  2LUC A;  3TDU A;  2KAY A;  3B87 A;  4FQT A;  1C7V A;  5F6T A;  1AK8 A;  2K7O A;  2MAZ A;  1PK0 D;  1NIW A;  3KF9 A;  4N5X A;  3LCP C;  5DKR A;  1KQM C;  2L2E A;  4A4C A;  4PT1 A;  1LA0 A;  2KHN A;  3VRR A;  1DMO A;  4XJK A;  1BJF A;  1IG5 A;  1SCV A;  3NSL A;  2NZ0 A;  1IH0 A;  4OV2 A;  2KLD A;  2M8U A;  1UHI A;  3NSK A;  1JFK A;  2DOQ A;  1J7O A;  3KO0 A;  2JPT A;  1BLQ A;  1TRF A;  2PAS A;  4ORA B;  3ZWH A;  2HQ8 A;  1AJ4 A;  1MQ1 A;  1V1F A;  1FI5 A;  1MXE A;  1G8I A;  1CDN A;  2FJY A;  1LS8 A;  2BCX A;  2OTG C;  3PN7 B;  2BKH B;  1SR6 B;  1PRW A;  1DJZ A;  2GGZ A;  3DY9 A;  3I5H C;  1LKJ A;  1QAT A;  2H61 A;  2G9B A;  1PUL A;  2JT0 A;  2JWW A;  5D3O A;  2LLU A;  1ZAC A;  1K2H A;  3FWC A;  3OBV A;  1C07 A;  1K8U A;  1L2O C;  1PSB A;  1B7T Y;  1WRK A;  3EK7 A;  1SW8 A;  2QEO A;  4DRW A;  3D10 A;  2SAS A;  1SCM B;  2FOT A;  4HRH A;  2LHI A;  5AFP A;  3S0F A;  1F8H A;  3CR4 X;  4XJK B;  1IQ3 A;  2KYF A;  4ZCV A;  3AKB A;  3WNX B;  3BFB A;  5I2Q A;  1MF8 B;  1UP5 A;  1AP4 A;  1XFU O;  2LVK A;  4FQO A;  1NX1 A;  1QLK A;  2LAP A;  3OX6 A;  4F0Z B;  1D1O A;  3D0Y A;  1SSE B;  3A4U B;  2ZN9 A;  1H4B A;  1OOJ A;  5I2L A;  4DCK A;  1PAL A;  3LL8 B;  2LV7 A;  1OMV A;  2KQY A;  3NHT A;  3PN7 C;  1QX7 A;  1CDP A;  1DF0 B;  3CAB A;  3D76 A;  3GK1 A;  1LVC D;  1QIW A;  5AAN A;  2NXQ A;  1NCY A;  3S0E A;  1A75 A;  1K95 A;  1OZO A;  3BUW B;  3LK0 A;  1FI6 A;  1W7J B;  3UO9 A;  3VGO A;  1XYD A;  2PVB A;  1XK4 A;  5HKY A;  1OMD A;  2WCE A;  1SL7 A;  1G33 A;  2MA2 A;  1RJV A;  2MLF C;  1S1E A;  4MVF A;  1UWO A;  2KBM A;  1Y1U A;  2F2P A; 
#chains in the Genus database with same CATH homology
 2EC6 C;  4L9M A;  2NCO A;  3K21 A;  1NYA A;  1F4Q A;  3CR2 A;  3BYA A;  2KI6 D;  1TOP A;  1SYM A;  1BR1 B;  3DVM A;  1UHH A;  3ZNI A;  1B8R A;  2D8N A;  3HCM A;  1M63 B;  2OPO A;  3CWG A;  2K8M B;  1ZUZ A;  1KK7 Z;  2H2K A;  2KFG A;  2L51 A;  2KAX A;  4ICB A;  4CID A;  3LLE A;  2LE9 B;  2LMV A;  1KSM A;  5KU1 A;  1M39 A;  2NLN A;  4USL A;  1F54 A;  2TN4 A;  3TS5 B;  3TZ1 A;  1FW4 A;  2F3Y A;  2JTT A;  3F45 A;  3NSI A;  1TNX A;  3JTD B;  1ODB A;  5B8I B;  4YRU A;  1EJ3 A;  1R6P A;  1QV0 A;  1AJ5 A;  2KNE A;  1ALW A;  1GGZ A;  5ER4 X;  1CMF A;  2KFH A;  1ALV A;  3PAL A;  3OB1 B;  3MSE B;  2ZND A;  4OVN F;  1ZFS A;  1SL8 A;  2JRF A;  1NCX A;  2LNK A;  5I2O A;  1CFD A;  1SNL A;  4GUK A;  3PAT A;  4MSP A;  1B4C A;  2BE6 A;  1B1G A;  2CNP A;  2KI4 B;  3CTN A;  4I5N B;  1F4O A;  1J7R A;  3O4Y A;  2OS8 B;  2I2R E;  1BT6 A;  2Y1M A;  1EXR A;  4MN0 A;  1PVB A;  1XO5 A;  3GK4 X;  2FJU B;  1M46 A;  1JF0 A;  3IQQ A;  3FS7 A;  3EK4 A;  1B8L A;  1FF1 A;  2ZN8 A;  3BUN B;  3I5G C;  4CLN A;  1IJ6 A;  2WC8 A;  3BQ3 A;  2CXJ A;  5CSF A;  4JQ0 D;  1KK8 B;  1N2D A;  2M7L A;  2F33 A;  2IS9 A;  3CS1 A;  4YI8 A;  4UPG A;  4MZK A;  3EVU A;  3WHU B;  3FWB A;  1YVL A;  1YUT A;  3SIB A;  1KK7 Y;  1XK4 C;  2WCB A;  2BEC A;  4N1G A;  2BE4 A;  2JT8 A;  5JOL A;  4Q04 A;  1WLZ A;  5PAL A;  5TNC A;  4C0L A;  1CNP A;  1R2U A;  1BG1 A;  1DGV A;  1OSA A;  3PSR A;  2M29 A;  4NQG A;  4WQ3 A;  2BKI B;  4NDD A;  5JJG A;  4MLW A;  2COL B;  4MBE A;  3NXA A;  3I5F C;  4XYN A;  3O6B A;  1C7W A;  1V1G A;  4DUQ A;  1FPW A;  1BU3 A;  1S26 D;  3SJS A;  4AQJ A;  4QJ5 B;  3EVR A;  1CMG A;  1DJG A;  1YR5 A;  1DF0 A;  1Y1X A;  3TDI A;  1JF2 A;  5HYD A;  1TTX A;  4ORB B;  1S6J A;  4YI9 A;  3I5I B;  4TNC A;  3C1V A;  2ISD A;  4DS7 A;  1QAS A;  2M3W A;  2BCB A;  1YX7 A;  4GNK B;  2L50 A;  1TN4 A;  2BL0 B;  1QS7 A;  2K61 A;  1N0Y A;  4CFQ A;  1CFF A;  2I18 A;  1CDM A;  4WRI A;  1XA5 A;  5I8N A;  2O5G A;  1SKT A;  1U5I B;  1YRT B;  1K93 D;  3WXA A;  2JT3 A;  2CT9 A;  1OMR A;  3KEV A;  1RWY A;  3KPX A;  1XVJ A;  2I7A A;  3EKJ A;  1Y1A A;  2KFF A;  4YGE B;  2JXL A;  4HRG A;  1A29 A;  2M49 B;  1SRA A;  4YGB B;  3SG6 A;  3VRQ A;  4GFT A;  2L4H A;  1RK9 A;  1YUS A;  3VRP A;  4PHJ A;  2L0P A;  1DJI A;  5ER5 A;  5HLV A;  1CFC A;  1KQV A;  1SBJ A;  1EG3 A;  1AVS A;  1J1E A;  2P6B B;  1SR6 C;  1N65 A;  4DIR A;  3EK8 A;  2BBM A;  4GGF A;  3DVK A;  2LLT A;  1NUB A;  1QVI Z;  2E30 A;  3BOW B;  1QX2 A;  1WDC B;  2PMY A;  4CFR A;  1MXL C;  3H4S E;  3O78 A;  4PAL A;  1YX8 A;  1JWD A;  5FYX A;  1F70 A;  3OHM B;  1QTX A;  3FIA A;  3KHE A;  4ETO A;  1KFX L;  1GGW A;  1SCM C;  3JVT B;  1NX2 A;  1B47 A;  1UUS A;  5G08 A;  2Y5I A;  2E6W A;  2B1U A;  2K7B A;  1UUR A;  1NWD A;  4P5O E;  2M9G A;  3TUY B;  4ZCU A;  1KWO B;  2KGB C;  3A8R A;  1HT9 A;  1AHR A;  2MHH A;  1F55 A;  4QJ4 B;  3SG2 A;  1IWQ A;  1A2X A;  1SPY A;  1DTL A;  2MJW B;  1UHJ A;  2FCD A;  4E68 A;  5DKQ A;  2HPS A;  1OE9 B;  1VRK A;  2KGR A;  1DJH A;  1K9P A;  1CKK A;  4OR9 B;  2HF5 A;  2LMT A;  1K90 D;  1CFP A;  2AMI A;  1H8B A;  1UHN A;  5HLO A;  2F3Z A;  2LAN A;  1YUR A;  4PE0 A;  1MHO A;  2F2O A;  1YVH A;  3DD4 A;  2I94 A;  2CCM A;  2AAO A;  2BCA A;  1SY9 A;  2WOS A;  1ZOT B;  1XFW O;  2L98 A;  1TCF A;  3GK2 A;  4PHM A;  1J55 A;  1EL4 A;  1Y0V H;  4GGN A;  1YRU B;  1J1D A;  1QIV A;  4IL1 A;  1A4P A;  1QLS A;  1KQM B;  1RFJ A;  2JZI A;  2F8P A;  1KWO C;  2LVJ A;  2KYC A;  5KSZ A;  1A03 A;  4NDB A;  1G4Y R;  3BUO B;  3AAJ A;  3DVE A;  3O2P A;  1KFU S;  5CPV A;  1KFU L;  2LHL A;  3SG5 A;  3AKA A;  1S6C A;  4MRX A;  1BMO A;  4YGA A;  4R1E A;  1QXP A;  1WLM A;  1XFV O;  2EGD A;  1J7P A;  2JXC A;  2K0J A;  3TS5 C;  4GPL B;  4C0K A;  4U8D A;  3RLZ A;  4BY5 A;  3JTD C;  1QJT A;  2A4J A;  3SG7 A;  1K9U A;  1PSR A;  1S3P A;  4GGF C;  2MLE C;  2FCE A;  2PAL A;  2M1U A;  2JNX A;  3VRO A;  2KBI A;  1EG4 A;  2M7N A;  3GOF A;  4PE7 A;  2HET A;  4HSZ A;  4M2P A;  2OTG B;  1DJY A;  1U5I A;  1MUX A;  2LUX A;  1W7I B;  4WQ2 A;  4PHN A;  2CTN A;  3EKH A;  3I5H B;  1TNP A;  3PFV A;  5CSN A;  1CM1 A;  2SCP A;  2KOT A;  4P2Y B;  4N1F A;  2LP2 A;  4A4B A;  4PE4 A;  2KI4 C;  5AER A;  1MWN A;  1CM4 A;  2K7C A;  2ZRT A;  5D7F A;  3CR5 X;  1L2O B;  4D1E A;  2LVV A;  2M1K B;  2OS8 C;  2ZFD A;  1TCO B;  2K2F A;  4I5K A;  2PRU A;  1TIZ A;  5DKN A;  1NX0 A;  1B8C A;  1NP8 A;  1TNQ A;  1YUU A;  2LC5 A;  3BOW A;  1KK8 C;  2KAV A;  2JU0 A;  3DF0 B;  2K7D A;  3SIA A;  4OKH A;  1WRL A;  3SG3 A;  2K2A A;  1NPQ A;  1JFJ A;  3PM8 A;  1K94 A;  2JTZ A;  3NSO A;  1CLL A;  1KCY A;  1OZS A;  1E8A A;  4MZJ A;  1IJ5 A;  2QPT A;  4FTG A;  4QJ3 B;  2LCP A;  1B9A A;  1Y6W A;  5BPJ A;  2VRG A;  1AUI B;  1CTR A;  1IQ5 A;  1XFY O;  1XFX O;  2KI6 C;  3EVV A;  1BOC A;  1S36 A;  3DVJ A;  2QAC A;  3LK1 A;  2ZNE A;  4AQI A;  3VRN A;  1EH2 A;  1BF5 A;  5KTY A;  4YGC B;  5HKW A;  4NDC A;  3BXK A;  2MBX A;  1CB1 A;  1S5G Z;  1CLM A;  2JQ6 A;  2EC6 B;  3PLF B;  1F71 A;  3HX4 A;  2JNF A;  1BOD A;  1LA3 A;  2M97 A;  3WHT B;  2RGI A;  2PSR A;  4C0J A;  3CGA A;  3AAK A;  3I5I C;  4OCI A;  1OQP A;  1NCZ A;  3CLN A;  2HQW A;  1ZMZ A;  1GJY A;  3E3R A;  1WY9 A;  2BL0 C;  4M2Q A;  1CDL A;  1K9K A;  1L7Z A;  1KFX S;  1SMG A;  1QV1 A;  2LP3 A;  2MRD A;  1TNW A;  2Q4U A;  3IF7 A;  2L5X B;  4M2O A;  2L4I A;  2ZKM X;  5K89 A;  5CSI A;  1MR8 A;  4MRY A;  5CSJ A;  1DGU A;  2WND A;  4GAO A;  1DJW A;  4HRE E;  4AOM A;  2LM5 A;  5IBW A;  2NCP A;  3OP0 A;  1REC A;  3RM1 A;  5D69 A;  3TDZ A;  5AEQ A;  4PE1 A;  3OX5 A;  2G2B A;  1IGV A;  1GQM A;  3IQO A;  4MEW A;  1KSO A;  2GV5 A;  2Y4Q A;  3OB2 B;  2KDH A;  1S6I A;  1SL9 A;  4GBA A;  1FBV A;  1WRZ A;  1NX3 A;  2GGM A;  4PHK A;  1DJX A;  2ZRS A;  2R2I A;  3ICB A;  3BUX B;  1WDC C;  1IKU A;  5HKZ A;  1M31 A;  1YTZ C;  3D0Y B;  4I5J A;  1PVA A;  1SK6 D;  2WOR A;  1QX5 B;  2LVI A;  3I5G B;  1X02 A;  2AUC A;  1M45 A;  3JVT C;  2V53 A;  2KSP A;  2KQ6 A;  2LLS A;  2M0R A;  1S5G Y;  2WCF A;  3SG4 A;  3CZT X;  1CLB A;  1JSA A;  3QRX A;  1DVI A;  2Q91 A;  1DT7 B;  3TUY C;  2BBN A;  2H61 C;  1HQV A;  1A75 B;  1IRJ A;  1QVI Y;  2EHB A;  2Y1N A;  1NSH A;  1Q80 A;  2JOJ A;  4JWQ A;  4CPV A;  1RRO A;  5AXI A;  1J7Q A;  4YBH B;  1LIN A;  1RTP 1;  1K96 A;  1JC2 A;  4PDZ A;  3M0W A;  1JUO A;  2LMU A;  3DF0 A;  1B7T Z;  5J3X A;  3BUM B;  4PCW A;  1JBA A;  4JPZ B;  1XFZ O;  1LXF C;  3I5F B;  4I5L B;  4MZL A;  1UHK A;  2JUL A;  2O60 A;  4YGD B;  2CBL A;  4ORC B;  5GQQ C;  4BY4 A;  1BR4 B;  2JC2 A;  2LUC A;  3TDU A;  2KAY A;  1C7V A;  5F6T A;  1AK8 A;  2K7O A;  2MAZ A;  1PK0 D;  1NIW A;  3KF9 A;  4N5X A;  3LCP C;  5DKR A;  1KQM C;  2L2E A;  4A4C A;  1LA0 A;  2KHN A;  3VRR A;  1DMO A;  4XJK A;  1BJF A;  1IG5 A;  1SCV A;  3NSL A;  2NZ0 A;  1IH0 A;  4OV2 A;  2M8U A;  1UHI A;  3NSK A;  1JFK A;  2DOQ A;  1J7O A;  3KO0 A;  2JPT A;  1BLQ A;  1TRF A;  2PAS A;  4ORA B;  3ZWH A;  2HQ8 A;  1AJ4 A;  1MQ1 A;  1V1F A;  1FI5 A;  1MXE A;  1G8I A;  1CDN A;  2BCX A;  2OTG C;  3PN7 B;  2BKH B;  1SR6 B;  1PRW A;  1DJZ A;  2GGZ A;  3I5H C;  1LKJ A;  1QAT A;  2H61 A;  2G9B A;  1PUL A;  2JT0 A;  2JWW A;  2LLU A;  1ZAC A;  1K2H A;  3FWC A;  1C07 A;  1K8U A;  1L2O C;  1PSB A;  1B7T Y;  1WRK A;  3EK7 A;  1SW8 A;  4DRW A;  3D10 A;  2SAS A;  1SCM B;  2FOT A;  4HRH A;  2LHI A;  5AFP A;  1F8H A;  3CR4 X;  4XJK B;  1IQ3 A;  2KYF A;  4ZCV A;  3AKB A;  3WNX B;  5I2Q A;  1MF8 B;  1UP5 A;  1AP4 A;  1XFU O;  2LVK A;  4FQO A;  1NX1 A;  1QLK A;  2LAP A;  3OX6 A;  4F0Z B;  1D1O A;  3D0Y A;  1H4B A;  3A4U B;  2ZN9 A;  1OOJ A;  5I2L A;  4DCK A;  1PAL A;  3LL8 B;  2LV7 A;  1OMV A;  2KQY A;  3PN7 C;  1QX7 A;  1CDP A;  1DF0 B;  3GK1 A;  1LVC D;  1QIW A;  5AAN A;  2NXQ A;  1NCY A;  1A75 A;  1K95 A;  1OZO A;  3BUW B;  3LK0 A;  1FI6 A;  1W7J B;  3VGO A;  1XYD A;  2PVB A;  1XK4 A;  5HKY A;  1OMD A;  2WCE A;  1SL7 A;  1G33 A;  2MA2 A;  1RJV A;  2MLF C;  1S1E A;  4MVF A;  1UWO A;  2KBM A;  1Y1U A;  2F2P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...