3DF0B

Calcium-dependent complex between m-calpain and calpastatin
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
174
structure length
174
Chain Sequence
SEEERQFRKLFVQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKKWQGIYKRFDTDRSGTIGSNELPGAFEAAGFHLNQHIYSMIIRRYSDETGNMDFDNFISCLVRLDAMFRAFRSLDKNGTGQIQVNIQEWLQLTMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Calpain-2 catalytic subunit
publication title Concerted multi-pronged attack by calpastatin to occlude the catalytic cleft of heterodimeric calpains.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 63
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2008-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3df0B00
5DKRA 3BXKA 2KNEA 1X02A 1B1GA 3DVEA 4CIDA 1UURA 1CTRA 2KI4C 4TNCA 1ALVA 1QX5B 3TDUA 2RGIA 3ICBA 4YI8A 1EG4A 2TN4A 2QPTA 2KQ6A 5KU1A 1WRZA 2JRFA 2LLUA 2ZN8A 1QLKA 4P2YB 3LK1A 2PRUA 1CMGA 1TRFA 4N1FA 5IBWA 1KCYA 2K7OA 1IQ5A 1N0YA 3PN7B 3WHUB 1BG1A 2JXCA 3OB2B 1RROA 2LM5A 1RTP1 2ZNEA 3VROA 2OTGB 3DF0B 1SR6B 2BCBA 1BR4B 2LMUA 1CLMA 4MEWA 1KK7Z 1UUSA 2LVKA 4QJ4B 1K90D 1L2OC 2LVVA 3MSEB 3PATA 1A03A 1TTXA 2HQWA 4QJ3B 4C0KA 1WLZA 4MRYA 3TDZA 3EKJA 4PCWA 5D69A 5FYXA 1JF0A 2NZ0A 1XFZO 2MJWB 4DIRA 3TZ1A 4OV2A 2HQ8A 1TN4A 2JXLA 2JTTA 4YGEB 3LK0A 5BPJA 1FI6A 3TUYC 1EXRA 4WQ2A 2Y5IA 3F45A 4CLNA 4DS7A 1CMFA 1DGVA 1IGVA 1A2XA 2L4HA 2JT8A 1D1OA 1QX2A 2BCXA 2BL0B 5DKNA 2F8PA 1RK9A 1W7JB 1KQMB 4PE0A 2JZIA 2LHLA 2HETA 2PVBA 2OPOA 3BUNB 4ORAB 1PRWA 1NSHA 2KI4B 2GGMA 3PSRA 1AUIB 2L0PA 5I2OA 1KSMA 1IJ6A 1HT9A 1QVIZ 2M97A 1TNQA 4MSPA 2M1KB 1TIZA 2K2FA 2KOTA 1S5GZ 4D1EA 5I8NA 1NUBA 2FOTA 3SJSA 2PASA 1K95A 1SCVA 2ZRTA 2LANA 5CSJA 1NCYA 4E68A 1S6CA 1K9UA 3CR4X 1NP8A 1KQVA 1DGUA 1KWOC 2I18A 2KBIA 2KAYA 1K94A 1V1GA 5CSNA 1XFWO 1AP4A 2Y4QA 5TNCA 1YUTA 3EVVA 1L2OB 1TNXA 4P5OE 3BYAA 1MHOA 1S6JA 3VRQA 1PSBA 3AKBA 2LNKA 3DD4A 3DF0A 3K21A 3FWCA 2Y1NA 2KYFA 4ICBA 2JOJA 1ZUZA 1N65A 2LHIA 2I7AA 1J1DA 1XFUO 1M31A 5KSZA 1A29A 4AOMA 2K7BA 2WCBA 2E6WA 2KSPA 4U8DA 1SKTA 1QLSA 5CSFA 2BE6A 4WQ3A 3QRXA 1M46A 2FCDA 1PK0D 4ZCVA 2M7LA 3PN7C 1SPYA 3CR5X 2R2IA 3DVJA 1YX7A 2K8MB 1ALWA 1ZFSA 4GGNA 2KGRA 1NX2A 2HPSA 1DJGA 2JULA 3BOWA 2WNDA 2A4JA 4M2PA 1YUSA 1H4BA 2KGBC 1B47A 2CBLA 3O2PA 1G4YR 3D10A 3EVUA 1YUUA 2BBNA 1BOCA 2ZN9A 4MLWA 4MBEA 1SMGA 3D0YA 3GOFA 5AFPA 1KWOB 4GAOA 5I2QA 2WCEA 2I2RE 1YURA 4DCKA 3ZNIA 4CFQA 2BKIB 1F70A 1K8UA 1IWQA 4PHMA 2E30A 2BL0C 1DTLA 2LUXA 1BT6A 1DF0B 1YRUB 1MQ1A 1KQMC 1YX8A 1SBJA 3BUOB 3A4UB 1GGZA 1CM4A 2B1UA 1U5IB 1JWDA 4AQJA 3FWBA 4AQIA 1OMDA 2JPTA 1LVCD 4QJ5B 3VRRA 1BF5A 3O6BA 3WHTB 1M39A 1S36A 2PMYA 5JJGA 1FI5A 1K9PA 1ZMZA 2KAVA 1OSAA 4M2OA 1RFJA 1WRLA 2LE9B 3NXAA 1SY9A 4MVFA 1TNWA 3IQOA 2GGZA 3OHMB 4UPGA 5ER5A 5ER4X 2MLFC 2K61A 2CTNA 3A8RA 2L50A 2LP3A 3EVRA 1BR1B 1MXLC 2L51A 3SG4A 1NCXA 1MXEA 1JBAA 2L5XB 2LC5A 2CCMA 3PFVA 2M3WA 3OB1B 4HSZA 1J7RA 2Q91A 1UHJA 1XA5A 1VRKA 3CS1A 4YBHB 1OMVA 3SG5A 1CLLA 1CFFA 1AK8A 2M0RA 1XFXO 1MF8B 2G9BA 1PALA 2LMTA 4PHKA 1LINA 2ZRSA 3DVMA 4NQGA 1DJIA 4MN0A 2L4IA 1TNPA 2MRDA 1E8AA 1KFXS 1IJ5A 1DJWA 1AJ5A 1RECA 2LCPA 2EGDA 2WOSA 3IQQA 3NSLA 1UP5A 1MWNA 2EC6B 1S1EA 4CPVA 1Q80A 1DF0A 1L7ZA 2H61C 2LUCA 1SCMB 3KEVA 3SG7A 3VRNA 2GV5A 4JPZB 4I5KA 4MZKA 1QXPA 1U5IA 1NX3A 3SIBA 1SL8A 4PALA 4HRHA 1N2DA 1KSOA 1PVAA 4XJKB 1QATA 2H2KA 2M49B 2LP2A 3FS7A 5I2LA 2KHNA 1KFUL 1AHRA 2KFGA 5G08A 3EK8A 2CXJA 4NDCA 3EK7A 1TCOB 4A4CA 2LVIA 4PHJA 3EK4A 1GGWA 2BKHB 1MR8A 3HCMA 4YGDB 4YRUA 3O4YA 1NPQA 2F2OA 1YVHA 1OZSA 4YI9A 2NXQA 3CWGA 1A75B 1WDCC 2K2AA 2L98A 3AAJA 1G33A 2M29A 3CTNA 2NCOA 2Y1MA 2BECA 3I5IC 4HRGA 5HKZA 1QS7A 1F8HA 3CZTX 5PALA 1RJVA 1IG5A 1A4PA 1UHNA 2JTZA 3SG6A 5HKYA 4DRWA 3JVTB 4PE4A 1XFYO 1K93D 4ORBB 4DUQA 3TDIA 1R6PA 4WRIA 2O60A 1CDNA 1TCFA 2SASA 1OOJA 2CT9A 1H8BA 3KPXA 1DJHA 2FJUB 3OP0A 3VGOA 2WC8A 1BLQA 4Q04A 1CM1A 3RLZA 3SG2A 2ISDA 3GK2A 1IKUA 1OQPA 1QV1A 1S26D 5GQQC 1Y1UA 2G2BA 4BY4A 1PULA 2NLNA 2CNPA 2KBMA 3PALA 5HLVA 1NYAA 4GUKA 3KHEA 1DMOA 1NWDA 3OX5A 1Y6WA 2LVJA 1QASA 1QX7A 5D7FA 1DJYA 1XYDA 3SG3A 4XJKA 1CNPA 4ETOA 2PALA 2K7CA 5KTYA 3IF7A 3ZWHA 5DKQA 3KF9A 1B7TY 1WDCB 3OX6A 2O5GA 1K96A 2EC6C 5HYDA 1SRAA 1XK4C 5JOLA 1EG3A 4I5NB 2F2PA 2AMIA 5K89A 1KFUS 1SCMC 2F33A 1B7TZ 1EJ3A 3I5IB 2QACA 3TS5B 1CDLA 4PE1A 1CFDA 1IRJA 2IS9A 1OMRA 1QV0A 1A75A 2WORA 2M1UA 1M45A 2D8NA 3GK4X 1ZOTB 4JQ0D 1YTZC 1YR5A 3PLFB 4GGFC 4M2QA 4NDBA 1XO5A 3BUMB 3M0WA 1G8IA 2BE4A 1F55A 5CSIA 4I5JA 1R2UA 1XVJA 4N1GA 2JC2A 1EL4A 5AEQA 2JT0A 4I5LB 4OVNF 5CPVA 1GJYA 1BODA 1TOPA 1AVSA 1F4QA 4OR9B 4MRXA 1DJZA 4PDZA 2VRGA 1KK7Y 1WY9A 2H61A 1IH0A 2K0JA 1LKJA 1FW4A 4R1EA 1BJFA 1LXFC 4YGBB 4BY5A 3AKAA 1J1EA 3E3RA 1NX0A 2BCAA 1PSRA 2JWWA 4USLA 1CKKA 2MAZA 4XYNA 5AERA 2JQ6A 5F6TA 1J55A 3I5GC 1SW8A 3WXAA 1M63B 1SL9A 3LCPC 4YGCB 2HF5A 2OS8C 1DJXA 2KFFA 2EHBA 2KAXA 4NDDA 4YGAA 2LLSA 1JFKA 1SNLA 1ODBA 2M9GA 2ZNDA 3JVTC 4C0LA 1DT7B 1Y0VH 4MZLA 1KK8B 4MZJA 5AXIA 1SK6D 1XFVO 1NCZA 5J3XA 5B8IB 3BOWB 3VRPA 1MUXA 1QIVA 1SL7A 2MLEC 3BUWB 1CDPA 3SIAA 3JTDC 5HKWA 3PM8A 3H4SE 3LLEA 3O78A 2L2EA 1FPWA 1FBVA 2KI6C 3FIAA 3I5FB 1QVIY 1ZACA 1W7IB 1JSAA 1WLMA 2KDHA 2KQYA 4ORCB 1S5GY 3CGAA 1S3PA 2PSRA 3LL8B 2ZKMX 1JFJA 3D0YB 1OZOA 1B9AA 4L9MA 1LA3A 1CFCA 3NSKA 1B8CA 1SYMA 1UHIA 3EKHA 1DVIA 2F3YA 1UHKA 1J7OA 3I5HC 5AANA 2JT3A 1QTXA 1F71A 3C1VA 1JC2A 3AAKA 2FCEA 4ZCUA 5HLOA 1GQMA 1LA0A 4HREE 1NX1A 4IL1A 1JF2A 4GFTA 2KI6D 4FQOA 2V53A 4GBAA 2NCPA 3TS5C 3DVKA 1C07A 2K7DA 1F4OA 3CLNA 2JNXA 3I5GB 1B8LA 4PE7A 1PVBA 1K9KA 2OS8B 1YVLA 1CB1A 1JUOA 1UWOA 3BQ3A 2M7NA 1BMOA 4N5XA 3HX4A 3TUYB 1CDMA 2COLB 2LV7A 2JU0A 1J7QA 2MHHA 1UHHA 1B8RA 3JTDB 1YRTB 3RM1A 1J7PA 2M8UA 2WCFA 1RWYA 1IQ3A 2ZFDA 2AUCA 4GNKB 4PHNA 1HQVA 1XK4A 1CLBA 4OCIA 4A4BA 3NSIA 2Q4UA 2KYCA 2OTGC 1Y1XA 1SR6C 1FF1A 2JNFA 1CFPA 1K2HA 1AJ4A 1WRKA 1BU3A 1EH2A 3KO0A 2LAPA 2LLTA 3I5HB 4GGFA 2F3ZA 3WNXB 2KFHA 1NIWA 1QIWA 1V1FA 1B4CA 1KFXL 4JWQA 2I94A 1KK8C 2MA2A 3CR2A 4OKHA 1OE9B 4F0ZB 1F54A 1Y1AA 4C0JA 1C7VA 2LMVA 2SCPA 2P6BB 4GPLB 2MBXA 4CFRA 3GK1A 1S6IA 2DOQA 3NSOA 2AAOA 2BBMA 3BUXB 3I5FC 1C7WA 1QJTA 4FTGA
chains in the Genus database with same CATH superfamily
5DKRA 3BXKA 3EG5B 2KNEA 1X02A 1B1GA 3DVEA 4CIDA 1UURA 1CTRA 2KI4C 4TNCA 3S0GA 5HL1A 1ALVA 1QX5B 3TDUA 2QDIA 2RGIA 3ICBA 4YI8A 3K1EA 1EG4A 2TN4A 2QPTA 2KQ6A 5KU1A 1WRZA 3B7AA 3S0AA 2JRFA 2LLUA 2ZN8A 1QLKA 4P2YB 3LK1A 2PRUA 1CMGA 1TRFA 2GTEA 4N1FA 5IBWA 2K7OA 1IQ5A 1N0YA 2BNXA 3PN7B 3WHUB 1BG1A 2JXCA 3OB2B 1RROA 2LM5A 1RTP1 2ZNEA 3VROA 2OTGB 3DF0B 1OOFA 1SR6B 2BCBA 1BR4B 2LMUA 1CLMA 4MEWA 1KK7Z 1UUSA 4JKTA 2LVKA 4QJ4B 1K90D 4INWA 1L2OC 2LVVA 3MSEB 3PATA 1A03A 1TTXA 2HQWA 4QJ3B 4C0KA 1WLZA 4MRYA 2FJYA 3EKJA 4PCWA 3TDZA 5D69A 5FYXA 1JF0A 2NZ0A 5FI7A 1XFZO 2MJWB 4DIRA 3TZ1A 4OV2A 1TWOA 2HQ8A 1TN4A 2JXLA 2JTTA 3L4AA 2WCMA 3LK0A 4YGEB 5BPJA 3TUYC 1EXRA 1FI6A 4WQ2A 2Y5IA 3F45A 4CLNA 4DS7A 1CMFA 1DGVA 1IGVA 1A2XA 2L4HA 2JT8A 3L47A 1D1OA 1QX2A 2BCXA 2BL0B 5DKNA 2F8PA 1RK9A 3NHIA 1W7JB 1KQMB 3D78A 4PE0A 3Q8IA 2JZIA 2LHLA 2HETA 2PVBA 2OPOA 2QEVA 1KCYA 3BUNB 4ORAB 1PRWA 3S0EA 1NSHA 1XFRA 2KI4B 2GGMA 3PSRA 1AUIB 2L0PA 5I2OA 1KSMA 1IJ6A 1HT9A 1QVIZ 2M97A 1TNQA 4MSPA 2M1KB 1TIZA 2K2FA 2KOTA 1S5GZ 4D1EA 5I8NA 1NUBA 2FOTA 3SJSA 1Z2CB 2PASA 2QEBA 1K95A 1SCVA 2ZRTA 2LANA 2H8VA 5CSJA 1NCYA 2YGUA 4E68A 1S6CA 1K9UA 3CR4X 1NP8A 1KQVA 3R1PA 1DGUA 1KWOC 3DYEA 2I18A 2KBIA 2KAYA 1K94A 1V1GA 3VB1A 5CSNA 3BFHA 1XFWO 1AP4A 3S0BA 2Y4QA 5TNCA 1YUTA 3EVVA 1OOHA 1L2OB 1TNXA 4P5OE 3BYAA 1MHOA 1S6JA 3VRQA 1PSBA 3AKBA 2LNKA 3DD4A 3DF0A 3K21A 3FWCA 2Y1NA 2KYFA 4ICBA 2JOJA 1ZUZA 1N65A 2LHIA 2I7AA 1J1DA 1XFUO 2WCJA 1M31A 5KSZA 1A29A 4AOMA 2K7BA 2WCBA 2E6WA 2KSPA 3L4LA 1SKTA 1QLSA 4U8DA 5CSFA 2BE6A 4WQ3A 3QRXA 1M46A 2FCDA 1PK0D 3CABA 2L5YA 4ZCVA 3PN7C 2M7LA 1SPYA 3CR5X 2JPOA 3D74A 2R2IA 3DVJA 1YX7A 2K8MB 1ALWA 1ZFSA 4GGNA 2KGRA 1NX2A 2HPSA 1DJGA 2JULA 3BOWA 2WNDA 2A4JA 4M2PA 1YUSA 1H4BA 2KGBC 1B47A 2CBLA 3O2PA 1G4YR 3D10A 3EVUA 1YUUA 2BBNA 1BOCA 2BAPA 2ZN9A 4MLWA 3FE9A 4MBEA 1SMGA 1SSEB 1QWVA 3D0YA 3GOFA 5AFPA 1KWOB 4GAOA 5I2QA 2WCEA 2I2RE 1YURA 4DCKA 3ZNIA 4CFQA 2BKIB 1F70A 1K8UA 1IWQA 4PHMA 5DICA 2E30A 2BL0C 1DTLA 2LUXA 1BT6A 1DF0B 1YRUB 1MQ1A 1KQMC 1YX8A 1SBJA 3BUOB 3A4UB 1GGZA 3D77A 1CM4A 2B1UA 1U5IB 1JWDA 4AQJA 3FWBA 4AQIA 1OMDA 2JPTA 1LVCD 4QJ5B 3VRRA 1BF5A 3O6BA 3OBVA 3WHTB 1M39A 1S36A 2ERBA 2PMYA 5JJGA 1K9PA 1FI5A 1ZMZA 2KAVA 1OSAA 4M2OA 1RFJA 1WRLA 2LE9B 3NXAA 1SY9A 4MVFA 1TNWA 3IQOA 2GGZA 3OHMB 4UPGA 2WC5A 5ER5A 5ER4X 2MLFC 2K61A 5FI6A 2CTNA 3FE6A 3A8RA 2L50A 2LP3A 3EVRA 1BR1B 1MXLC 2L51A 2WCKA 3SG4A 1NCXA 1MXEA 1JBAA 2L5XB 2LC5A 2CCMA 3PFVA 2M3WA 3OB1B 4HSZA 1J7RA 2Q91A 1UHJA 2P71A 1XA5A 1VRKA 3CS1A 4YBHB 1OMVA 3SG5A 1CLLA 1CFFA 1AK8A 1DC1A 2M0RA 1XFXO 1MF8B 2G9BA 1PALA 2LMTA 1C3ZA 1LINA 2ZRSA 3CDNA 3DVMA 4PHKA 4NQGA 1DJIA 4MN0A 2L4IA 1TNPA 2MRDA 1E8AA 3CZ0A 1TUZA 1KFXS 1IJ5A 1DJWA 1AJ5A 1RECA 1Z4HA 2LCPA 3QMEA 2EGDA 2WOSA 3IQQA 3NSLA 1UP5A 1MWNA 2EC6B 1S1EA 4CPVA 3D76A 1Q80A 1DF0A 1LS8A 1L7ZA 2H61C 2LUCA 1SCMB 3KEVA 3SG7A 3VRNA 2GV5A 4JPZB 4I5KA 4MZKA 1QXPA 1TUJA 1U5IA 1NX3A 3D75A 1SL8A 4PALA 3SIBA 4HRHA 1N2DA 3PM2A 1KSOA 3D73A 1PVAA 4XJKB 2QEHA 1QATA 2H2KA 2M49B 2LP2A 3FS7A 5I2LA 2KHNA 1KFUL 1AHRA 2KFGA 5G08A 3EK8A 2CXJA 4NDCA 3EK7A 2L2CA 1TCOB 4A4CA 2LVIA 4PHJA 3NGVA 3EK4A 1GGWA 2BKHB 1MR8A 3HCMA 4YGDB 4YRUA 3O4YA 1NPQA 2F2OA 1YVHA 2WC6A 1OZSA 4YI9A 2NXQA 3CWGA 1A75B 1WDCC 2K2AA 4INXA 2L98A 3AAJA 1DQEA 1G33A 2M29A 3CTNA 2NCOA 1C3YA 2Y1MA 2BECA 3I5IC 4HRGA 5HKZA 1QS7A 3R1OA 3CZTX 5PALA 1F8HA 1RJVA 1IG5A 1A4PA 1UHNA 2JTZA 3SG6A 5HKYA 2WCHA 4DRWA 3JVTB 3R1VA 3S0DA 4PE4A 1GM0A 1XFYO 1K93D 4ORBB 4DUQA 3BFAA 3TDIA 1R6PA 3UO9A 4WRIA 2O60A 1CDNA 1TCFA 2SASA 1OOJA 2CT9A 1H8BA 1DEKA 3V2LA 3KPXA 1DJHA 2FJUB 1OW4A 3OP0A 3VGOA 2WC8A 1BLQA 4Q04A 1CM1A 3RLZA 3SG2A 2ISDA 3GK2A 1IKUA 1OQPA 2KLEA 1QV1A 1S26D 5GQQC 1Y1UA 2G2BA 4BY4A 1PULA 2NLNA 2CNPA 2KBMA 3PALA 5HLVA 1NYAA 4GUKA 3KHEA 1DMOA 1NWDA 3OX5A 1Y6WA 2LVJA 1QASA 1QX7A 5I94A 4PT1A 5D7FA 1DJYA 1XYDA 4FQTA 3SG3A 4XJKA 1P28A 1CNPA 4ETOA 2PALA 3N7HA 2K7CA 5KTYA 3IF7A 3FE8A 3ZWHA 5DKQA 3KF9A 1B7TY 1WDCB 3OX6A 2O5GA 3RZSA 1K96A 2EC6C 5HYDA 3PJIA 1SRAA 1XK4C 5JOLA 1EG3A 4I5NB 2F2PA 2AMIA 3NHTA 5K89A 1KFUS 1SCMC 2F33A 1B7TZ 1EJ3A 3I5IB 2QACA 3TS5B 1CDLA 4PE1A 1CFDA 1IRJA 2IS9A 1OMRA 1QV0A 4KYNA 1A75A 2WORA 2M1UA 1M45A 2D8NA 3GK4X 1ZOTB 4JQ0D 1YTZC 3CZ1A 1YR5A 3PLFB 1DT7B 4GGFC 4M2QA 4NDBA 1XO5A 3BUMB 3M0WA 1G8IA 2BE4A 1F55A 5CSIA 4I5JA 1R2UA 1XVJA 4N1GA 2JC2A 1EL4A 5AEQA 2JT0A 4I5LB 4OVNF 5CPVA 4F7FA 1GJYA 1BODA 1TOPA 3R72A 1AVSA 1F4QA 4OR9B 4MRXA 1DJZA 4PDZA 2VRGA 1KK7Y 1WY9A 2H61A 1IH0A 2K0JA 1LKJA 1FW4A 3OGNA 4R1EA 1BJFA 1LXFC 4YGBB 4BY5A 2PQLA 3AKAA 1J1EA 3E3RA 1NX0A 2BCAA 1PSRA 2JWWA 4USLA 1CKKA 2MAZA 4XYNA 5AERA 2JQ6A 1DELA 5F6TA 1J55A 3I5GC 1SW8A 2QEOA 3WXAA 1M63B 1SL9A 3CZ2A 3LCPC 4YGCB 2HF5A 2OS8C 1DJXA 3DXLA 3SS5A 2KFFA 2EHBA 2KAXA 3B88A 2P70A 2LLSA 1JFKA 1SNLA 1ODBA 2M9GA 2ZNDA 3JVTC 4NDDA 4YGAA 5D3OA 4C0LA 1Y0VH 4MZLA 1KK8B 4MZJA 3DZTA 5AXIA 1SK6D 1XFVO 1NCZA 2KLDA 5J3XA 5B8IB 3BOWB 3VRPA 1MUXA 1QIVA 1SL7A 2MLEC 3BUWB 1CDPA 3SIAA 3JTDC 5HKWA 3PM8A 3B6XA 3H4SE 3LLEA 3O78A 2L2EA 1FPWA 1FBVA 2KI6C 3FIAA 3I5FB 1QVIY 1ZACA 1W7IB 1JSAA 1WLMA 2KDHA 2KQYA 4ORCB 1S5GY 3CGAA 1OOGA 3DY9A 1S3PA 2PSRA 3LL8B 2ZKMX 1JFJA 3D0YB 1OZOA 1B9AA 4L9MA 3IVTA 1LA3A 1CFCA 1OOIX 3NSKA 3O4XA 4OZDA 1B8CA 3BJHA 1SYMA 1UHIA 1ORGA 3EKHA 1DVIA 2F3YA 1UHKA 1J7OA 3I5HC 5AANA 2JT3A 1QTXA 1F71A 3C1VA 1JC2A 3AAKA 2FCEA 4ZCUA 1IIOA 5HLOA 1GQMA 1LA0A 4HREE 1NX1A 4IL1A 1JF2A 4GFTA 2KI6D 4FQOA 2V53A 4GBAA 2NCPA 3TS5C 3DVKA 1C07A 4IJ7A 2K7DA 1F4OA 3CLNA 2JNXA 3I5GB 1B8LA 3SS4A 4PE7A 1PVBA 1K9KA 2OS8B 1YVLA 1CB1A 1JUOA 1UWOA 3BQ3A 2M7NA 1BMOA 4N5XA 3HX4A 3TUYB 1CDMA 2K60A 2COLB 3UNWA 2LV7A 2JU0A 1J7QA 2MHHA 1UHHA 1B8RA 3JTDB 1YRTB 3CYZA 3RM1A 1J7PA 2M8UA 2WCFA 1RWYA 1IQ3A 3B86A 2ZFDA 2AUCA 2WCLA 4GNKB 4PHNA 1HQVA 1XK4A 5FI2A 4JD9A 1CLBA 4OCIA 4A4BA 3NSIA 2Q4UA 2KYCA 2OTGC 1Y1XA 1SR6C 3B87A 1FF1A 2JNFA 1CFPA 1K2HA 1AJ4A 1W9ZA 1WRKA 1BU3A 3BFBA 1EH2A 3KO0A 2LAPA 2LLTA 3I5HB 4GGFA 2F3ZA 3WNXB 2KFHA 1NIWA 1QIWA 1V1FA 1B4CA 1KFXL 4JWQA 2I94A 1KK8C 2MA2A 5EL2A 3CR2A 4OKHA 1OE9B 4F0ZB 1F54A 1Y1AA 4C0JA 1C7VA 2LMVA 1T14A 2SCPA 3S0FA 2P6BB 4GPLB 2MBXA 4CFRA 2KPHA 3GK1A 1S6IA 2DOQA 3NSOA 2AAOA 3SS3A 2BBMA 3BUXB 3I5FC 2PYQA 1C7WA 1QJTA 4FTGA
chains in the Genus database with same CATH topology
5DKRA 3BXKA 2KNEA 1X02A 1B1GA 3DVEA 4CIDA 1UURA 1CTRA 2KI4C 4TNCA 1ALVA 1QX5B 3TDUA 2RGIA 3ICBA 4YI8A 1EG4A 2TN4A 2QPTA 2KQ6A 5KU1A 1WRZA 2JRFA 2LLUA 2ZN8A 1QLKA 4P2YB 3LK1A 2PRUA 1CMGA 1TRFA 4N1FA 5IBWA 1KCYA 2K7OA 1IQ5A 1N0YA 3PN7B 3WHUB 1BG1A 2JXCA 3OB2B 1RROA 2LM5A 1RTP1 2ZNEA 3VROA 2OTGB 3DF0B 1SR6B 2BCBA 1BR4B 2LMUA 1CLMA 4MEWA 1KK7Z 1UUSA 2LVKA 4QJ4B 1K90D 1L2OC 2LVVA 3MSEB 3PATA 1A03A 1TTXA 2HQWA 4QJ3B 4C0KA 1WLZA 4MRYA 3TDZA 3EKJA 4PCWA 5D69A 5FYXA 1JF0A 2NZ0A 1XFZO 2MJWB 4DIRA 3TZ1A 4OV2A 2HQ8A 1TN4A 2JXLA 2JTTA 4YGEB 3LK0A 5BPJA 1FI6A 3TUYC 1EXRA 4WQ2A 2Y5IA 3F45A 4CLNA 4DS7A 1CMFA 1DGVA 1IGVA 1A2XA 2L4HA 2JT8A 1D1OA 1QX2A 2BCXA 2BL0B 5DKNA 2F8PA 1RK9A 1W7JB 1KQMB 4PE0A 2JZIA 2LHLA 2HETA 2PVBA 2OPOA 3BUNB 4ORAB 1PRWA 1NSHA 2KI4B 2GGMA 3PSRA 1AUIB 2L0PA 5I2OA 1KSMA 1IJ6A 1HT9A 1QVIZ 2M97A 1TNQA 4MSPA 2M1KB 1TIZA 2K2FA 2KOTA 1S5GZ 4D1EA 5I8NA 1NUBA 2FOTA 3SJSA 2PASA 1K95A 1SCVA 2ZRTA 2LANA 5CSJA 1NCYA 4E68A 1S6CA 1K9UA 3CR4X 1NP8A 1KQVA 1DGUA 1KWOC 2I18A 2KBIA 2KAYA 1K94A 1V1GA 5CSNA 1XFWO 1AP4A 2Y4QA 5TNCA 1YUTA 3EVVA 1L2OB 1TNXA 4P5OE 3BYAA 1MHOA 1S6JA 3VRQA 1PSBA 3AKBA 2LNKA 3DD4A 3DF0A 3K21A 3FWCA 2Y1NA 2KYFA 4ICBA 2JOJA 1ZUZA 1N65A 2LHIA 2I7AA 1J1DA 1XFUO 1M31A 5KSZA 1A29A 4AOMA 2K7BA 2WCBA 2E6WA 2KSPA 4U8DA 1SKTA 1QLSA 5CSFA 2BE6A 4WQ3A 3QRXA 1M46A 2FCDA 1PK0D 4ZCVA 2M7LA 3PN7C 1SPYA 3CR5X 2R2IA 3DVJA 1YX7A 2K8MB 1ALWA 1ZFSA 4GGNA 2KGRA 1NX2A 2HPSA 1DJGA 2JULA 3BOWA 2WNDA 2A4JA 4M2PA 1YUSA 1H4BA 2KGBC 1B47A 2CBLA 3O2PA 1G4YR 3D10A 3EVUA 1YUUA 2BBNA 1BOCA 2ZN9A 4MLWA 4MBEA 1SMGA 3D0YA 3GOFA 5AFPA 1KWOB 4GAOA 5I2QA 2WCEA 2I2RE 1YURA 4DCKA 3ZNIA 4CFQA 2BKIB 1F70A 1K8UA 1IWQA 4PHMA 2E30A 2BL0C 1DTLA 2LUXA 1BT6A 1DF0B 1YRUB 1MQ1A 1KQMC 1YX8A 1SBJA 3BUOB 3A4UB 1GGZA 1CM4A 2B1UA 1U5IB 1JWDA 4AQJA 3FWBA 4AQIA 1OMDA 2JPTA 1LVCD 4QJ5B 3VRRA 1BF5A 3O6BA 3WHTB 1M39A 1S36A 2PMYA 5JJGA 1FI5A 1K9PA 1ZMZA 2KAVA 1OSAA 4M2OA 1RFJA 1WRLA 2LE9B 3NXAA 1SY9A 4MVFA 1TNWA 3IQOA 2GGZA 3OHMB 4UPGA 5ER5A 5ER4X 2MLFC 2K61A 2CTNA 3A8RA 2L50A 2LP3A 3EVRA 1BR1B 1MXLC 2L51A 3SG4A 1NCXA 1MXEA 1JBAA 2L5XB 2LC5A 2CCMA 3PFVA 2M3WA 3OB1B 4HSZA 1J7RA 2Q91A 1UHJA 1XA5A 1VRKA 3CS1A 4YBHB 1OMVA 3SG5A 1CLLA 1CFFA 1AK8A 2M0RA 1XFXO 1MF8B 2G9BA 1PALA 2LMTA 4PHKA 1LINA 2ZRSA 3DVMA 4NQGA 1DJIA 4MN0A 2L4IA 1TNPA 2MRDA 1E8AA 1KFXS 1IJ5A 1DJWA 1AJ5A 1RECA 2LCPA 2EGDA 2WOSA 3IQQA 3NSLA 1UP5A 1MWNA 2EC6B 1S1EA 4CPVA 1Q80A 1DF0A 1L7ZA 2H61C 2LUCA 1SCMB 3KEVA 3SG7A 3VRNA 2GV5A 4JPZB 4I5KA 4MZKA 1QXPA 1U5IA 1NX3A 3SIBA 1SL8A 4PALA 4HRHA 1N2DA 1KSOA 1PVAA 4XJKB 1QATA 2H2KA 2M49B 2LP2A 3FS7A 5I2LA 2KHNA 1KFUL 1AHRA 2KFGA 5G08A 3EK8A 2CXJA 4NDCA 3EK7A 1TCOB 4A4CA 2LVIA 4PHJA 3EK4A 1GGWA 2BKHB 1MR8A 3HCMA 4YGDB 4YRUA 3O4YA 1NPQA 2F2OA 1YVHA 1OZSA 4YI9A 2NXQA 3CWGA 1A75B 1WDCC 2K2AA 2L98A 3AAJA 1G33A 2M29A 3CTNA 2NCOA 2Y1MA 2BECA 3I5IC 4HRGA 5HKZA 1QS7A 1F8HA 3CZTX 5PALA 1RJVA 1IG5A 1A4PA 1UHNA 2JTZA 3SG6A 5HKYA 4DRWA 3JVTB 4PE4A 1XFYO 1K93D 4ORBB 4DUQA 3TDIA 1R6PA 4WRIA 2O60A 1CDNA 1TCFA 2SASA 1OOJA 2CT9A 1H8BA 3KPXA 1DJHA 2FJUB 3OP0A 3VGOA 2WC8A 1BLQA 4Q04A 1CM1A 3RLZA 3SG2A 2ISDA 3GK2A 1IKUA 1OQPA 1QV1A 1S26D 5GQQC 1Y1UA 2G2BA 4BY4A 1PULA 2NLNA 2CNPA 2KBMA 3PALA 5HLVA 1NYAA 4GUKA 3KHEA 1DMOA 1NWDA 3OX5A 1Y6WA 2LVJA 1QASA 1QX7A 5D7FA 1DJYA 1XYDA 3SG3A 4XJKA 1CNPA 4ETOA 2PALA 2K7CA 5KTYA 3IF7A 3ZWHA 5DKQA 3KF9A 1B7TY 1WDCB 3OX6A 2O5GA 1K96A 2EC6C 5HYDA 1SRAA 1XK4C 5JOLA 1EG3A 4I5NB 2F2PA 2AMIA 5K89A 1KFUS 1SCMC 2F33A 1B7TZ 1EJ3A 3I5IB 2QACA 3TS5B 1CDLA 4PE1A 1CFDA 1IRJA 2IS9A 1OMRA 1QV0A 1A75A 2WORA 2M1UA 1M45A 2D8NA 3GK4X 1ZOTB 4JQ0D 1YTZC 1YR5A 3PLFB 4GGFC 4M2QA 4NDBA 1XO5A 3BUMB 3M0WA 1G8IA 2BE4A 1F55A 5CSIA 4I5JA 1R2UA 1XVJA 4N1GA 2JC2A 1EL4A 5AEQA 2JT0A 4I5LB 4OVNF 5CPVA 1GJYA 1BODA 1TOPA 1AVSA 1F4QA 4OR9B 4MRXA 1DJZA 4PDZA 2VRGA 1KK7Y 1WY9A 2H61A 1IH0A 2K0JA 1LKJA 1FW4A 4R1EA 1BJFA 1LXFC 4YGBB 4BY5A 3AKAA 1J1EA 3E3RA 1NX0A 2BCAA 1PSRA 2JWWA 4USLA 1CKKA 2MAZA 4XYNA 5AERA 2JQ6A 5F6TA 1J55A 3I5GC 1SW8A 3WXAA 1M63B 1SL9A 3LCPC 4YGCB 2HF5A 2OS8C 1DJXA 2KFFA 2EHBA 2KAXA 4NDDA 4YGAA 2LLSA 1JFKA 1SNLA 1ODBA 2M9GA 2ZNDA 3JVTC 4C0LA 1DT7B 1Y0VH 4MZLA 1KK8B 4MZJA 5AXIA 1SK6D 1XFVO 1NCZA 5J3XA 5B8IB 3BOWB 3VRPA 1MUXA 1QIVA 1SL7A 2MLEC 3BUWB 1CDPA 3SIAA 3JTDC 5HKWA 3PM8A 3H4SE 3LLEA 3O78A 2L2EA 1FPWA 1FBVA 2KI6C 3FIAA 3I5FB 1QVIY 1ZACA 1W7IB 1JSAA 1WLMA 2KDHA 2KQYA 4ORCB 1S5GY 3CGAA 1S3PA 2PSRA 3LL8B 2ZKMX 1JFJA 3D0YB 1OZOA 1B9AA 4L9MA 1LA3A 1CFCA 3NSKA 1B8CA 1SYMA 1UHIA 3EKHA 1DVIA 2F3YA 1UHKA 1J7OA 3I5HC 5AANA 2JT3A 1QTXA 1F71A 3C1VA 1JC2A 3AAKA 2FCEA 4ZCUA 5HLOA 1GQMA 1LA0A 4HREE 1NX1A 4IL1A 1JF2A 4GFTA 2KI6D 4FQOA 2V53A 4GBAA 2NCPA 3TS5C 3DVKA 1C07A 2K7DA 1F4OA 3CLNA 2JNXA 3I5GB 1B8LA 4PE7A 1PVBA 1K9KA 2OS8B 1YVLA 1CB1A 1JUOA 1UWOA 3BQ3A 2M7NA 1BMOA 4N5XA 3HX4A 3TUYB 1CDMA 2COLB 2LV7A 2JU0A 1J7QA 2MHHA 1UHHA 1B8RA 3JTDB 1YRTB 3RM1A 1J7PA 2M8UA 2WCFA 1RWYA 1IQ3A 2ZFDA 2AUCA 4GNKB 4PHNA 1HQVA 1XK4A 1CLBA 4OCIA 4A4BA 3NSIA 2Q4UA 2KYCA 2OTGC 1Y1XA 1SR6C 1FF1A 2JNFA 1CFPA 1K2HA 1AJ4A 1WRKA 1BU3A 1EH2A 3KO0A 2LAPA 2LLTA 3I5HB 4GGFA 2F3ZA 3WNXB 2KFHA 1NIWA 1QIWA 1V1FA 1B4CA 1KFXL 4JWQA 2I94A 1KK8C 2MA2A 3CR2A 4OKHA 1OE9B 4F0ZB 1F54A 1Y1AA 4C0JA 1C7VA 2LMVA 2SCPA 2P6BB 4GPLB 2MBXA 4CFRA 3GK1A 1S6IA 2DOQA 3NSOA 2AAOA 2BBMA 3BUXB 3I5FC 1C7WA 1QJTA 4FTGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DKR A;  3BXK A;  2KNE A;  1X02 A;  1B1G A;  3DVE A;  4CID A;  1UUR A;  1CTR A;  2KI4 C;  4TNC A;  1ALV A;  1QX5 B;  3TDU A;  2RGI A;  3ICB A;  4YI8 A;  1EG4 A;  2TN4 A;  2QPT A;  2KQ6 A;  5KU1 A;  1WRZ A;  2JRF A;  2LLU A;  2ZN8 A;  1QLK A;  4P2Y B;  3LK1 A;  2PRU A;  1CMG A;  1TRF A;  4N1F A;  5IBW A;  1KCY A;  2K7O A;  1IQ5 A;  1N0Y A;  3PN7 B;  3WHU B;  1BG1 A;  2JXC A;  3OB2 B;  1RRO A;  2LM5 A;  1RTP 1;  2ZNE A;  3VRO A;  2OTG B;  3DF0 B;  1SR6 B;  2BCB A;  1BR4 B;  2LMU A;  1CLM A;  4MEW A;  1KK7 Z;  1UUS A;  2LVK A;  4QJ4 B;  1K90 D;  1L2O C;  2LVV A;  3MSE B;  3PAT A;  1A03 A;  1TTX A;  2HQW A;  4QJ3 B;  4C0K A;  1WLZ A;  4MRY A;  3TDZ A;  3EKJ A;  4PCW A;  5D69 A;  5FYX A;  1JF0 A;  2NZ0 A;  1XFZ O;  2MJW B;  4DIR A;  3TZ1 A;  4OV2 A;  2HQ8 A;  1TN4 A;  2JXL A;  2JTT A;  4YGE B;  3LK0 A;  5BPJ A;  1FI6 A;  3TUY C;  1EXR A;  4WQ2 A;  2Y5I A;  3F45 A;  4CLN A;  4DS7 A;  1CMF A;  1DGV A;  1IGV A;  1A2X A;  2L4H A;  2JT8 A;  1D1O A;  1QX2 A;  2BCX A;  2BL0 B;  5DKN A;  2F8P A;  1RK9 A;  1W7J B;  1KQM B;  4PE0 A;  2JZI A;  2LHL A;  2HET A;  2PVB A;  2OPO A;  3BUN B;  4ORA B;  1PRW A;  1NSH A;  2KI4 B;  2GGM A;  3PSR A;  1AUI B;  2L0P A;  5I2O A;  1KSM A;  1IJ6 A;  1HT9 A;  1QVI Z;  2M97 A;  1TNQ A;  4MSP A;  2M1K B;  1TIZ A;  2K2F A;  2KOT A;  1S5G Z;  4D1E A;  5I8N A;  1NUB A;  2FOT A;  3SJS A;  2PAS A;  1K95 A;  1SCV A;  2ZRT A;  2LAN A;  5CSJ A;  1NCY A;  4E68 A;  1S6C A;  1K9U A;  3CR4 X;  1NP8 A;  1KQV A;  1DGU A;  1KWO C;  2I18 A;  2KBI A;  2KAY A;  1K94 A;  1V1G A;  5CSN A;  1XFW O;  1AP4 A;  2Y4Q A;  5TNC A;  1YUT A;  3EVV A;  1L2O B;  1TNX A;  4P5O E;  3BYA A;  1MHO A;  1S6J A;  3VRQ A;  1PSB A;  3AKB A;  2LNK A;  3DD4 A;  3DF0 A;  3K21 A;  3FWC A;  2Y1N A;  2KYF A;  4ICB A;  2JOJ A;  1ZUZ A;  1N65 A;  2LHI A;  2I7A A;  1J1D A;  1XFU O;  1M31 A;  5KSZ A;  1A29 A;  4AOM A;  2K7B A;  2WCB A;  2E6W A;  2KSP A;  4U8D A;  1SKT A;  1QLS A;  5CSF A;  2BE6 A;  4WQ3 A;  3QRX A;  1M46 A;  2FCD A;  1PK0 D;  4ZCV A;  2M7L A;  3PN7 C;  1SPY A;  3CR5 X;  2R2I A;  3DVJ A;  1YX7 A;  2K8M B;  1ALW A;  1ZFS A;  4GGN A;  2KGR A;  1NX2 A;  2HPS A;  1DJG A;  2JUL A;  3BOW A;  2WND A;  2A4J A;  4M2P A;  1YUS A;  1H4B A;  2KGB C;  1B47 A;  2CBL A;  3O2P A;  1G4Y R;  3D10 A;  3EVU A;  1YUU A;  2BBN A;  1BOC A;  2ZN9 A;  4MLW A;  4MBE A;  1SMG A;  3D0Y A;  3GOF A;  5AFP A;  1KWO B;  4GAO A;  5I2Q A;  2WCE A;  2I2R E;  1YUR A;  4DCK A;  3ZNI A;  4CFQ A;  2BKI B;  1F70 A;  1K8U A;  1IWQ A;  4PHM A;  2E30 A;  2BL0 C;  1DTL A;  2LUX A;  1BT6 A;  1DF0 B;  1YRU B;  1MQ1 A;  1KQM C;  1YX8 A;  1SBJ A;  3BUO B;  3A4U B;  1GGZ A;  1CM4 A;  2B1U A;  1U5I B;  1JWD A;  4AQJ A;  3FWB A;  4AQI A;  1OMD A;  2JPT A;  1LVC D;  4QJ5 B;  3VRR A;  1BF5 A;  3O6B A;  3WHT B;  1M39 A;  1S36 A;  2PMY A;  5JJG A;  1FI5 A;  1K9P A;  1ZMZ A;  2KAV A;  1OSA A;  4M2O A;  1RFJ A;  1WRL A;  2LE9 B;  3NXA A;  1SY9 A;  4MVF A;  1TNW A;  3IQO A;  2GGZ A;  3OHM B;  4UPG A;  5ER5 A;  5ER4 X;  2MLF C;  2K61 A;  2CTN A;  3A8R A;  2L50 A;  2LP3 A;  3EVR A;  1BR1 B;  1MXL C;  2L51 A;  3SG4 A;  1NCX A;  1MXE A;  1JBA A;  2L5X B;  2LC5 A;  2CCM A;  3PFV A;  2M3W A;  3OB1 B;  4HSZ A;  1J7R A;  2Q91 A;  1UHJ A;  1XA5 A;  1VRK A;  3CS1 A;  4YBH B;  1OMV A;  3SG5 A;  1CLL A;  1CFF A;  1AK8 A;  2M0R A;  1XFX O;  1MF8 B;  2G9B A;  1PAL A;  2LMT A;  4PHK A;  1LIN A;  2ZRS A;  3DVM A;  4NQG A;  1DJI A;  4MN0 A;  2L4I A;  1TNP A;  2MRD A;  1E8A A;  1KFX S;  1IJ5 A;  1DJW A;  1AJ5 A;  1REC A;  2LCP A;  2EGD A;  2WOS A;  3IQQ A;  3NSL A;  1UP5 A;  1MWN A;  2EC6 B;  1S1E A;  4CPV A;  1Q80 A;  1DF0 A;  1L7Z A;  2H61 C;  2LUC A;  1SCM B;  3KEV A;  3SG7 A;  3VRN A;  2GV5 A;  4JPZ B;  4I5K A;  4MZK A;  1QXP A;  1U5I A;  1NX3 A;  3SIB A;  1SL8 A;  4PAL A;  4HRH A;  1N2D A;  1KSO A;  1PVA A;  4XJK B;  1QAT A;  2H2K A;  2M49 B;  2LP2 A;  3FS7 A;  5I2L A;  2KHN A;  1KFU L;  1AHR A;  2KFG A;  5G08 A;  3EK8 A;  2CXJ A;  4NDC A;  3EK7 A;  1TCO B;  4A4C A;  2LVI A;  4PHJ A;  3EK4 A;  1GGW A;  2BKH B;  1MR8 A;  3HCM A;  4YGD B;  4YRU A;  3O4Y A;  1NPQ A;  2F2O A;  1YVH A;  1OZS A;  4YI9 A;  2NXQ A;  3CWG A;  1A75 B;  1WDC C;  2K2A A;  2L98 A;  3AAJ A;  1G33 A;  2M29 A;  3CTN A;  2NCO A;  2Y1M A;  2BEC A;  3I5I C;  4HRG A;  5HKZ A;  1QS7 A;  1F8H A;  3CZT X;  5PAL A;  1RJV A;  1IG5 A;  1A4P A;  1UHN A;  2JTZ A;  3SG6 A;  5HKY A;  4DRW A;  3JVT B;  4PE4 A;  1XFY O;  1K93 D;  4ORB B;  4DUQ A;  3TDI A;  1R6P A;  4WRI A;  2O60 A;  1CDN A;  1TCF A;  2SAS A;  1OOJ A;  2CT9 A;  1H8B A;  3KPX A;  1DJH A;  2FJU B;  3OP0 A;  3VGO A;  2WC8 A;  1BLQ A;  4Q04 A;  1CM1 A;  3RLZ A;  3SG2 A;  2ISD A;  3GK2 A;  1IKU A;  1OQP A;  1QV1 A;  1S26 D;  5GQQ C;  1Y1U A;  2G2B A;  4BY4 A;  1PUL A;  2NLN A;  2CNP A;  2KBM A;  3PAL A;  5HLV A;  1NYA A;  4GUK A;  3KHE A;  1DMO A;  1NWD A;  3OX5 A;  1Y6W A;  2LVJ A;  1QAS A;  1QX7 A;  5D7F A;  1DJY A;  1XYD A;  3SG3 A;  4XJK A;  1CNP A;  4ETO A;  2PAL A;  2K7C A;  5KTY A;  3IF7 A;  3ZWH A;  5DKQ A;  3KF9 A;  1B7T Y;  1WDC B;  3OX6 A;  2O5G A;  1K96 A;  2EC6 C;  5HYD A;  1SRA A;  1XK4 C;  5JOL A;  1EG3 A;  4I5N B;  2F2P A;  2AMI A;  5K89 A;  1KFU S;  1SCM C;  2F33 A;  1B7T Z;  1EJ3 A;  3I5I B;  2QAC A;  3TS5 B;  1CDL A;  4PE1 A;  1CFD A;  1IRJ A;  2IS9 A;  1OMR A;  1QV0 A;  1A75 A;  2WOR A;  2M1U A;  1M45 A;  2D8N A;  3GK4 X;  1ZOT B;  4JQ0 D;  1YTZ C;  1YR5 A;  3PLF B;  4GGF C;  4M2Q A;  4NDB A;  1XO5 A;  3BUM B;  3M0W A;  1G8I A;  2BE4 A;  1F55 A;  5CSI A;  4I5J A;  1R2U A;  1XVJ A;  4N1G A;  2JC2 A;  1EL4 A;  5AEQ A;  2JT0 A;  4I5L B;  4OVN F;  5CPV A;  1GJY A;  1BOD A;  1TOP A;  1AVS A;  1F4Q A;  4OR9 B;  4MRX A;  1DJZ A;  4PDZ A;  2VRG A;  1KK7 Y;  1WY9 A;  2H61 A;  1IH0 A;  2K0J A;  1LKJ A;  1FW4 A;  4R1E A;  1BJF A;  1LXF C;  4YGB B;  4BY5 A;  3AKA A;  1J1E A;  3E3R A;  1NX0 A;  2BCA A;  1PSR A;  2JWW A;  4USL A;  1CKK A;  2MAZ A;  4XYN A;  5AER A;  2JQ6 A;  5F6T A;  1J55 A;  3I5G C;  1SW8 A;  3WXA A;  1M63 B;  1SL9 A;  3LCP C;  4YGC B;  2HF5 A;  2OS8 C;  1DJX A;  2KFF A;  2EHB A;  2KAX A;  4NDD A;  4YGA A;  2LLS A;  1JFK A;  1SNL A;  1ODB A;  2M9G A;  2ZND A;  3JVT C;  4C0L A;  1DT7 B;  1Y0V H;  4MZL A;  1KK8 B;  4MZJ A;  5AXI A;  1SK6 D;  1XFV O;  1NCZ A;  5J3X A;  5B8I B;  3BOW B;  3VRP A;  1MUX A;  1QIV A;  1SL7 A;  2MLE C;  3BUW B;  1CDP A;  3SIA A;  3JTD C;  5HKW A;  3PM8 A;  3H4S E;  3LLE A;  3O78 A;  2L2E A;  1FPW A;  1FBV A;  2KI6 C;  3FIA A;  3I5F B;  1QVI Y;  1ZAC A;  1W7I B;  1JSA A;  1WLM A;  2KDH A;  2KQY A;  4ORC B;  1S5G Y;  3CGA A;  1S3P A;  2PSR A;  3LL8 B;  2ZKM X;  1JFJ A;  3D0Y B;  1OZO A;  1B9A A;  4L9M A;  1LA3 A;  1CFC A;  3NSK A;  1B8C A;  1SYM A;  1UHI A;  3EKH A;  1DVI A;  2F3Y A;  1UHK A;  1J7O A;  3I5H C;  5AAN A;  2JT3 A;  1QTX A;  1F71 A;  3C1V A;  1JC2 A;  3AAK A;  2FCE A;  4ZCU A;  5HLO A;  1GQM A;  1LA0 A;  4HRE E;  1NX1 A;  4IL1 A;  1JF2 A;  4GFT A;  2KI6 D;  4FQO A;  2V53 A;  4GBA A;  2NCP A;  3TS5 C;  3DVK A;  1C07 A;  2K7D A;  1F4O A;  3CLN A;  2JNX A;  3I5G B;  1B8L A;  4PE7 A;  1PVB A;  1K9K A;  2OS8 B;  1YVL A;  1CB1 A;  1JUO A;  1UWO A;  3BQ3 A;  2M7N A;  1BMO A;  4N5X A;  3HX4 A;  3TUY B;  1CDM A;  2COL B;  2LV7 A;  2JU0 A;  1J7Q A;  2MHH A;  1UHH A;  1B8R A;  3JTD B;  1YRT B;  3RM1 A;  1J7P A;  2M8U A;  2WCF A;  1RWY A;  1IQ3 A;  2ZFD A;  2AUC A;  4GNK B;  4PHN A;  1HQV A;  1XK4 A;  1CLB A;  4OCI A;  4A4B A;  3NSI A;  2Q4U A;  2KYC A;  2OTG C;  1Y1X A;  1SR6 C;  1FF1 A;  2JNF A;  1CFP A;  1K2H A;  1AJ4 A;  1WRK A;  1BU3 A;  1EH2 A;  3KO0 A;  2LAP A;  2LLT A;  3I5H B;  4GGF A;  2F3Z A;  3WNX B;  2KFH A;  1NIW A;  1QIW A;  1V1F A;  1B4C A;  1KFX L;  4JWQ A;  2I94 A;  1KK8 C;  2MA2 A;  3CR2 A;  4OKH A;  1OE9 B;  4F0Z B;  1F54 A;  1Y1A A;  4C0J A;  1C7V A;  2LMV A;  2SCP A;  2P6B B;  4GPL B;  2MBX A;  4CFR A;  3GK1 A;  1S6I A;  2DOQ A;  3NSO A;  2AAO A;  2BBM A;  3BUX B;  3I5F C;  1C7W A;  1QJT A;  4FTG A; 
#chains in the Genus database with same CATH topology
 5DKR A;  3BXK A;  3EG5 B;  2KNE A;  1X02 A;  1B1G A;  3DVE A;  4CID A;  1UUR A;  1CTR A;  2KI4 C;  4TNC A;  3S0G A;  5HL1 A;  1ALV A;  1QX5 B;  3TDU A;  2QDI A;  2RGI A;  3ICB A;  4YI8 A;  3K1E A;  1EG4 A;  2TN4 A;  2QPT A;  2KQ6 A;  5KU1 A;  1WRZ A;  3B7A A;  3S0A A;  2JRF A;  2LLU A;  2ZN8 A;  1QLK A;  4P2Y B;  3LK1 A;  2PRU A;  1CMG A;  1TRF A;  2GTE A;  4N1F A;  5IBW A;  2K7O A;  1IQ5 A;  1N0Y A;  2BNX A;  3PN7 B;  3WHU B;  1BG1 A;  2JXC A;  3OB2 B;  1RRO A;  2LM5 A;  1RTP 1;  2ZNE A;  3VRO A;  2OTG B;  3DF0 B;  1OOF A;  1SR6 B;  2BCB A;  1BR4 B;  2LMU A;  1CLM A;  4MEW A;  1KK7 Z;  1UUS A;  4JKT A;  2LVK A;  4QJ4 B;  1K90 D;  4INW A;  1L2O C;  2LVV A;  3MSE B;  3PAT A;  1A03 A;  1TTX A;  2HQW A;  4QJ3 B;  4C0K A;  1WLZ A;  4MRY A;  2FJY A;  3EKJ A;  4PCW A;  3TDZ A;  5D69 A;  5FYX A;  1JF0 A;  2NZ0 A;  5FI7 A;  1XFZ O;  2MJW B;  4DIR A;  3TZ1 A;  4OV2 A;  1TWO A;  2HQ8 A;  1TN4 A;  2JXL A;  2JTT A;  3L4A A;  2WCM A;  3LK0 A;  4YGE B;  5BPJ A;  3TUY C;  1EXR A;  1FI6 A;  4WQ2 A;  2Y5I A;  3F45 A;  4CLN A;  4DS7 A;  1CMF A;  1DGV A;  1IGV A;  1A2X A;  2L4H A;  2JT8 A;  3L47 A;  1D1O A;  1QX2 A;  2BCX A;  2BL0 B;  5DKN A;  2F8P A;  1RK9 A;  3NHI A;  1W7J B;  1KQM B;  3D78 A;  4PE0 A;  3Q8I A;  2JZI A;  2LHL A;  2HET A;  2PVB A;  2OPO A;  2QEV A;  1KCY A;  3BUN B;  4ORA B;  1PRW A;  3S0E A;  1NSH A;  1XFR A;  2KI4 B;  2GGM A;  3PSR A;  1AUI B;  2L0P A;  5I2O A;  1KSM A;  1IJ6 A;  1HT9 A;  1QVI Z;  2M97 A;  1TNQ A;  4MSP A;  2M1K B;  1TIZ A;  2K2F A;  2KOT A;  1S5G Z;  4D1E A;  5I8N A;  1NUB A;  2FOT A;  3SJS A;  1Z2C B;  2PAS A;  2QEB A;  1K95 A;  1SCV A;  2ZRT A;  2LAN A;  2H8V A;  5CSJ A;  1NCY A;  2YGU A;  4E68 A;  1S6C A;  1K9U A;  3CR4 X;  1NP8 A;  1KQV A;  3R1P A;  1DGU A;  1KWO C;  3DYE A;  2I18 A;  2KBI A;  2KAY A;  1K94 A;  1V1G A;  3VB1 A;  5CSN A;  3BFH A;  1XFW O;  1AP4 A;  3S0B A;  2Y4Q A;  5TNC A;  1YUT A;  3EVV A;  1OOH A;  1L2O B;  1TNX A;  4P5O E;  3BYA A;  1MHO A;  1S6J A;  3VRQ A;  1PSB A;  3AKB A;  2LNK A;  3DD4 A;  3DF0 A;  3K21 A;  3FWC A;  2Y1N A;  2KYF A;  4ICB A;  2JOJ A;  1ZUZ A;  1N65 A;  2LHI A;  2I7A A;  1J1D A;  1XFU O;  2WCJ A;  1M31 A;  5KSZ A;  1A29 A;  4AOM A;  2K7B A;  2WCB A;  2E6W A;  2KSP A;  3L4L A;  1SKT A;  1QLS A;  4U8D A;  5CSF A;  2BE6 A;  4WQ3 A;  3QRX A;  1M46 A;  2FCD A;  1PK0 D;  3CAB A;  2L5Y A;  4ZCV A;  3PN7 C;  2M7L A;  1SPY A;  3CR5 X;  2JPO A;  3D74 A;  2R2I A;  3DVJ A;  1YX7 A;  2K8M B;  1ALW A;  1ZFS A;  4GGN A;  2KGR A;  1NX2 A;  2HPS A;  1DJG A;  2JUL A;  3BOW A;  2WND A;  2A4J A;  4M2P A;  1YUS A;  1H4B A;  2KGB C;  1B47 A;  2CBL A;  3O2P A;  1G4Y R;  3D10 A;  3EVU A;  1YUU A;  2BBN A;  1BOC A;  2BAP A;  2ZN9 A;  4MLW A;  3FE9 A;  4MBE A;  1SMG A;  1SSE B;  1QWV A;  3D0Y A;  3GOF A;  5AFP A;  1KWO B;  4GAO A;  5I2Q A;  2WCE A;  2I2R E;  1YUR A;  4DCK A;  3ZNI A;  4CFQ A;  2BKI B;  1F70 A;  1K8U A;  1IWQ A;  4PHM A;  5DIC A;  2E30 A;  2BL0 C;  1DTL A;  2LUX A;  1BT6 A;  1DF0 B;  1YRU B;  1MQ1 A;  1KQM C;  1YX8 A;  1SBJ A;  3BUO B;  3A4U B;  1GGZ A;  3D77 A;  1CM4 A;  2B1U A;  1U5I B;  1JWD A;  4AQJ A;  3FWB A;  4AQI A;  1OMD A;  2JPT A;  1LVC D;  4QJ5 B;  3VRR A;  1BF5 A;  3O6B A;  3OBV A;  3WHT B;  1M39 A;  1S36 A;  2ERB A;  2PMY A;  5JJG A;  1K9P A;  1FI5 A;  1ZMZ A;  2KAV A;  1OSA A;  4M2O A;  1RFJ A;  1WRL A;  2LE9 B;  3NXA A;  1SY9 A;  4MVF A;  1TNW A;  3IQO A;  2GGZ A;  3OHM B;  4UPG A;  2WC5 A;  5ER5 A;  5ER4 X;  2MLF C;  2K61 A;  5FI6 A;  2CTN A;  3FE6 A;  3A8R A;  2L50 A;  2LP3 A;  3EVR A;  1BR1 B;  1MXL C;  2L51 A;  2WCK A;  3SG4 A;  1NCX A;  1MXE A;  1JBA A;  2L5X B;  2LC5 A;  2CCM A;  3PFV A;  2M3W A;  3OB1 B;  4HSZ A;  1J7R A;  2Q91 A;  1UHJ A;  2P71 A;  1XA5 A;  1VRK A;  3CS1 A;  4YBH B;  1OMV A;  3SG5 A;  1CLL A;  1CFF A;  1AK8 A;  1DC1 A;  2M0R A;  1XFX O;  1MF8 B;  2G9B A;  1PAL A;  2LMT A;  1C3Z A;  1LIN A;  2ZRS A;  3CDN A;  3DVM A;  4PHK A;  4NQG A;  1DJI A;  4MN0 A;  2L4I A;  1TNP A;  2MRD A;  1E8A A;  3CZ0 A;  1TUZ A;  1KFX S;  1IJ5 A;  1DJW A;  1AJ5 A;  1REC A;  1Z4H A;  2LCP A;  3QME A;  2EGD A;  2WOS A;  3IQQ A;  3NSL A;  1UP5 A;  1MWN A;  2EC6 B;  1S1E A;  4CPV A;  3D76 A;  1Q80 A;  1DF0 A;  1LS8 A;  1L7Z A;  2H61 C;  2LUC A;  1SCM B;  3KEV A;  3SG7 A;  3VRN A;  2GV5 A;  4JPZ B;  4I5K A;  4MZK A;  1QXP A;  1TUJ A;  1U5I A;  1NX3 A;  3D75 A;  1SL8 A;  4PAL A;  3SIB A;  4HRH A;  1N2D A;  3PM2 A;  1KSO A;  3D73 A;  1PVA A;  4XJK B;  2QEH A;  1QAT A;  2H2K A;  2M49 B;  2LP2 A;  3FS7 A;  5I2L A;  2KHN A;  1KFU L;  1AHR A;  2KFG A;  5G08 A;  3EK8 A;  2CXJ A;  4NDC A;  3EK7 A;  2L2C A;  1TCO B;  4A4C A;  2LVI A;  4PHJ A;  3NGV A;  3EK4 A;  1GGW A;  2BKH B;  1MR8 A;  3HCM A;  4YGD B;  4YRU A;  3O4Y A;  1NPQ A;  2F2O A;  1YVH A;  2WC6 A;  1OZS A;  4YI9 A;  2NXQ A;  3CWG A;  1A75 B;  1WDC C;  2K2A A;  4INX A;  2L98 A;  3AAJ A;  1DQE A;  1G33 A;  2M29 A;  3CTN A;  2NCO A;  1C3Y A;  2Y1M A;  2BEC A;  3I5I C;  4HRG A;  5HKZ A;  1QS7 A;  3R1O A;  3CZT X;  5PAL A;  1F8H A;  1RJV A;  1IG5 A;  1A4P A;  1UHN A;  2JTZ A;  3SG6 A;  5HKY A;  2WCH A;  4DRW A;  3JVT B;  3R1V A;  3S0D A;  4PE4 A;  1GM0 A;  1XFY O;  1K93 D;  4ORB B;  4DUQ A;  3BFA A;  3TDI A;  1R6P A;  3UO9 A;  4WRI A;  2O60 A;  1CDN A;  1TCF A;  2SAS A;  1OOJ A;  2CT9 A;  1H8B A;  1DEK A;  3V2L A;  3KPX A;  1DJH A;  2FJU B;  1OW4 A;  3OP0 A;  3VGO A;  2WC8 A;  1BLQ A;  4Q04 A;  1CM1 A;  3RLZ A;  3SG2 A;  2ISD A;  3GK2 A;  1IKU A;  1OQP A;  2KLE A;  1QV1 A;  1S26 D;  5GQQ C;  1Y1U A;  2G2B A;  4BY4 A;  1PUL A;  2NLN A;  2CNP A;  2KBM A;  3PAL A;  5HLV A;  1NYA A;  4GUK A;  3KHE A;  1DMO A;  1NWD A;  3OX5 A;  1Y6W A;  2LVJ A;  1QAS A;  1QX7 A;  5I94 A;  4PT1 A;  5D7F A;  1DJY A;  1XYD A;  4FQT A;  3SG3 A;  4XJK A;  1P28 A;  1CNP A;  4ETO A;  2PAL A;  3N7H A;  2K7C A;  5KTY A;  3IF7 A;  3FE8 A;  3ZWH A;  5DKQ A;  3KF9 A;  1B7T Y;  1WDC B;  3OX6 A;  2O5G A;  3RZS A;  1K96 A;  2EC6 C;  5HYD A;  3PJI A;  1SRA A;  1XK4 C;  5JOL A;  1EG3 A;  4I5N B;  2F2P A;  2AMI A;  3NHT A;  5K89 A;  1KFU S;  1SCM C;  2F33 A;  1B7T Z;  1EJ3 A;  3I5I B;  2QAC A;  3TS5 B;  1CDL A;  4PE1 A;  1CFD A;  1IRJ A;  2IS9 A;  1OMR A;  1QV0 A;  4KYN A;  1A75 A;  2WOR A;  2M1U A;  1M45 A;  2D8N A;  3GK4 X;  1ZOT B;  4JQ0 D;  1YTZ C;  3CZ1 A;  1YR5 A;  3PLF B;  1DT7 B;  4GGF C;  4M2Q A;  4NDB A;  1XO5 A;  3BUM B;  3M0W A;  1G8I A;  2BE4 A;  1F55 A;  5CSI A;  4I5J A;  1R2U A;  1XVJ A;  4N1G A;  2JC2 A;  1EL4 A;  5AEQ A;  2JT0 A;  4I5L B;  4OVN F;  5CPV A;  4F7F A;  1GJY A;  1BOD A;  1TOP A;  3R72 A;  1AVS A;  1F4Q A;  4OR9 B;  4MRX A;  1DJZ A;  4PDZ A;  2VRG A;  1KK7 Y;  1WY9 A;  2H61 A;  1IH0 A;  2K0J A;  1LKJ A;  1FW4 A;  3OGN A;  4R1E A;  1BJF A;  1LXF C;  4YGB B;  4BY5 A;  2PQL A;  3AKA A;  1J1E A;  3E3R A;  1NX0 A;  2BCA A;  1PSR A;  2JWW A;  4USL A;  1CKK A;  2MAZ A;  4XYN A;  5AER A;  2JQ6 A;  1DEL A;  5F6T A;  1J55 A;  3I5G C;  1SW8 A;  2QEO A;  3WXA A;  1M63 B;  1SL9 A;  3CZ2 A;  3LCP C;  4YGC B;  2HF5 A;  2OS8 C;  1DJX A;  3DXL A;  3SS5 A;  2KFF A;  2EHB A;  2KAX A;  3B88 A;  2P70 A;  2LLS A;  1JFK A;  1SNL A;  1ODB A;  2M9G A;  2ZND A;  3JVT C;  4NDD A;  4YGA A;  5D3O A;  4C0L A;  1Y0V H;  4MZL A;  1KK8 B;  4MZJ A;  3DZT A;  5AXI A;  1SK6 D;  1XFV O;  1NCZ A;  2KLD A;  5J3X A;  5B8I B;  3BOW B;  3VRP A;  1MUX A;  1QIV A;  1SL7 A;  2MLE C;  3BUW B;  1CDP A;  3SIA A;  3JTD C;  5HKW A;  3PM8 A;  3B6X A;  3H4S E;  3LLE A;  3O78 A;  2L2E A;  1FPW A;  1FBV A;  2KI6 C;  3FIA A;  3I5F B;  1QVI Y;  1ZAC A;  1W7I B;  1JSA A;  1WLM A;  2KDH A;  2KQY A;  4ORC B;  1S5G Y;  3CGA A;  1OOG A;  3DY9 A;  1S3P A;  2PSR A;  3LL8 B;  2ZKM X;  1JFJ A;  3D0Y B;  1OZO A;  1B9A A;  4L9M A;  3IVT A;  1LA3 A;  1CFC A;  1OOI X;  3NSK A;  3O4X A;  4OZD A;  1B8C A;  3BJH A;  1SYM A;  1UHI A;  1ORG A;  3EKH A;  1DVI A;  2F3Y A;  1UHK A;  1J7O A;  3I5H C;  5AAN A;  2JT3 A;  1QTX A;  1F71 A;  3C1V A;  1JC2 A;  3AAK A;  2FCE A;  4ZCU A;  1IIO A;  5HLO A;  1GQM A;  1LA0 A;  4HRE E;  1NX1 A;  4IL1 A;  1JF2 A;  4GFT A;  2KI6 D;  4FQO A;  2V53 A;  4GBA A;  2NCP A;  3TS5 C;  3DVK A;  1C07 A;  4IJ7 A;  2K7D A;  1F4O A;  3CLN A;  2JNX A;  3I5G B;  1B8L A;  3SS4 A;  4PE7 A;  1PVB A;  1K9K A;  2OS8 B;  1YVL A;  1CB1 A;  1JUO A;  1UWO A;  3BQ3 A;  2M7N A;  1BMO A;  4N5X A;  3HX4 A;  3TUY B;  1CDM A;  2K60 A;  2COL B;  3UNW A;  2LV7 A;  2JU0 A;  1J7Q A;  2MHH A;  1UHH A;  1B8R A;  3JTD B;  1YRT B;  3CYZ A;  3RM1 A;  1J7P A;  2M8U A;  2WCF A;  1RWY A;  1IQ3 A;  3B86 A;  2ZFD A;  2AUC A;  2WCL A;  4GNK B;  4PHN A;  1HQV A;  1XK4 A;  5FI2 A;  4JD9 A;  1CLB A;  4OCI A;  4A4B A;  3NSI A;  2Q4U A;  2KYC A;  2OTG C;  1Y1X A;  1SR6 C;  3B87 A;  1FF1 A;  2JNF A;  1CFP A;  1K2H A;  1AJ4 A;  1W9Z A;  1WRK A;  1BU3 A;  3BFB A;  1EH2 A;  3KO0 A;  2LAP A;  2LLT A;  3I5H B;  4GGF A;  2F3Z A;  3WNX B;  2KFH A;  1NIW A;  1QIW A;  1V1F A;  1B4C A;  1KFX L;  4JWQ A;  2I94 A;  1KK8 C;  2MA2 A;  5EL2 A;  3CR2 A;  4OKH A;  1OE9 B;  4F0Z B;  1F54 A;  1Y1A A;  4C0J A;  1C7V A;  2LMV A;  1T14 A;  2SCP A;  3S0F A;  2P6B B;  4GPL B;  2MBX A;  4CFR A;  2KPH A;  3GK1 A;  1S6I A;  2DOQ A;  3NSO A;  2AAO A;  3SS3 A;  2BBM A;  3BUX B;  3I5F C;  2PYQ A;  1C7W A;  1QJT A;  4FTG A; 
#chains in the Genus database with same CATH homology
 5DKR A;  3BXK A;  2KNE A;  1X02 A;  1B1G A;  3DVE A;  4CID A;  1UUR A;  1CTR A;  2KI4 C;  4TNC A;  1ALV A;  1QX5 B;  3TDU A;  2RGI A;  3ICB A;  4YI8 A;  1EG4 A;  2TN4 A;  2QPT A;  2KQ6 A;  5KU1 A;  1WRZ A;  2JRF A;  2LLU A;  2ZN8 A;  1QLK A;  4P2Y B;  3LK1 A;  2PRU A;  1CMG A;  1TRF A;  4N1F A;  5IBW A;  1KCY A;  2K7O A;  1IQ5 A;  1N0Y A;  3PN7 B;  3WHU B;  1BG1 A;  2JXC A;  3OB2 B;  1RRO A;  2LM5 A;  1RTP 1;  2ZNE A;  3VRO A;  2OTG B;  3DF0 B;  1SR6 B;  2BCB A;  1BR4 B;  2LMU A;  1CLM A;  4MEW A;  1KK7 Z;  1UUS A;  2LVK A;  4QJ4 B;  1K90 D;  1L2O C;  2LVV A;  3MSE B;  3PAT A;  1A03 A;  1TTX A;  2HQW A;  4QJ3 B;  4C0K A;  1WLZ A;  4MRY A;  3TDZ A;  3EKJ A;  4PCW A;  5D69 A;  5FYX A;  1JF0 A;  2NZ0 A;  1XFZ O;  2MJW B;  4DIR A;  3TZ1 A;  4OV2 A;  2HQ8 A;  1TN4 A;  2JXL A;  2JTT A;  4YGE B;  3LK0 A;  5BPJ A;  1FI6 A;  3TUY C;  1EXR A;  4WQ2 A;  2Y5I A;  3F45 A;  4CLN A;  4DS7 A;  1CMF A;  1DGV A;  1IGV A;  1A2X A;  2L4H A;  2JT8 A;  1D1O A;  1QX2 A;  2BCX A;  2BL0 B;  5DKN A;  2F8P A;  1RK9 A;  1W7J B;  1KQM B;  4PE0 A;  2JZI A;  2LHL A;  2HET A;  2PVB A;  2OPO A;  3BUN B;  4ORA B;  1PRW A;  1NSH A;  2KI4 B;  2GGM A;  3PSR A;  1AUI B;  2L0P A;  5I2O A;  1KSM A;  1IJ6 A;  1HT9 A;  1QVI Z;  2M97 A;  1TNQ A;  4MSP A;  2M1K B;  1TIZ A;  2K2F A;  2KOT A;  1S5G Z;  4D1E A;  5I8N A;  1NUB A;  2FOT A;  3SJS A;  2PAS A;  1K95 A;  1SCV A;  2ZRT A;  2LAN A;  5CSJ A;  1NCY A;  4E68 A;  1S6C A;  1K9U A;  3CR4 X;  1NP8 A;  1KQV A;  1DGU A;  1KWO C;  2I18 A;  2KBI A;  2KAY A;  1K94 A;  1V1G A;  5CSN A;  1XFW O;  1AP4 A;  2Y4Q A;  5TNC A;  1YUT A;  3EVV A;  1L2O B;  1TNX A;  4P5O E;  3BYA A;  1MHO A;  1S6J A;  3VRQ A;  1PSB A;  3AKB A;  2LNK A;  3DD4 A;  3DF0 A;  3K21 A;  3FWC A;  2Y1N A;  2KYF A;  4ICB A;  2JOJ A;  1ZUZ A;  1N65 A;  2LHI A;  2I7A A;  1J1D A;  1XFU O;  1M31 A;  5KSZ A;  1A29 A;  4AOM A;  2K7B A;  2WCB A;  2E6W A;  2KSP A;  4U8D A;  1SKT A;  1QLS A;  5CSF A;  2BE6 A;  4WQ3 A;  3QRX A;  1M46 A;  2FCD A;  1PK0 D;  4ZCV A;  2M7L A;  3PN7 C;  1SPY A;  3CR5 X;  2R2I A;  3DVJ A;  1YX7 A;  2K8M B;  1ALW A;  1ZFS A;  4GGN A;  2KGR A;  1NX2 A;  2HPS A;  1DJG A;  2JUL A;  3BOW A;  2WND A;  2A4J A;  4M2P A;  1YUS A;  1H4B A;  2KGB C;  1B47 A;  2CBL A;  3O2P A;  1G4Y R;  3D10 A;  3EVU A;  1YUU A;  2BBN A;  1BOC A;  2ZN9 A;  4MLW A;  4MBE A;  1SMG A;  3D0Y A;  3GOF A;  5AFP A;  1KWO B;  4GAO A;  5I2Q A;  2WCE A;  2I2R E;  1YUR A;  4DCK A;  3ZNI A;  4CFQ A;  2BKI B;  1F70 A;  1K8U A;  1IWQ A;  4PHM A;  2E30 A;  2BL0 C;  1DTL A;  2LUX A;  1BT6 A;  1DF0 B;  1YRU B;  1MQ1 A;  1KQM C;  1YX8 A;  1SBJ A;  3BUO B;  3A4U B;  1GGZ A;  1CM4 A;  2B1U A;  1U5I B;  1JWD A;  4AQJ A;  3FWB A;  4AQI A;  1OMD A;  2JPT A;  1LVC D;  4QJ5 B;  3VRR A;  1BF5 A;  3O6B A;  3WHT B;  1M39 A;  1S36 A;  2PMY A;  5JJG A;  1FI5 A;  1K9P A;  1ZMZ A;  2KAV A;  1OSA A;  4M2O A;  1RFJ A;  1WRL A;  2LE9 B;  3NXA A;  1SY9 A;  4MVF A;  1TNW A;  3IQO A;  2GGZ A;  3OHM B;  4UPG A;  5ER5 A;  5ER4 X;  2MLF C;  2K61 A;  2CTN A;  3A8R A;  2L50 A;  2LP3 A;  3EVR A;  1BR1 B;  1MXL C;  2L51 A;  3SG4 A;  1NCX A;  1MXE A;  1JBA A;  2L5X B;  2LC5 A;  2CCM A;  3PFV A;  2M3W A;  3OB1 B;  4HSZ A;  1J7R A;  2Q91 A;  1UHJ A;  1XA5 A;  1VRK A;  3CS1 A;  4YBH B;  1OMV A;  3SG5 A;  1CLL A;  1CFF A;  1AK8 A;  2M0R A;  1XFX O;  1MF8 B;  2G9B A;  1PAL A;  2LMT A;  4PHK A;  1LIN A;  2ZRS A;  3DVM A;  4NQG A;  1DJI A;  4MN0 A;  2L4I A;  1TNP A;  2MRD A;  1E8A A;  1KFX S;  1IJ5 A;  1DJW A;  1AJ5 A;  1REC A;  2LCP A;  2EGD A;  2WOS A;  3IQQ A;  3NSL A;  1UP5 A;  1MWN A;  2EC6 B;  1S1E A;  4CPV A;  1Q80 A;  1DF0 A;  1L7Z A;  2H61 C;  2LUC A;  1SCM B;  3KEV A;  3SG7 A;  3VRN A;  2GV5 A;  4JPZ B;  4I5K A;  4MZK A;  1QXP A;  1U5I A;  1NX3 A;  3SIB A;  1SL8 A;  4PAL A;  4HRH A;  1N2D A;  1KSO A;  1PVA A;  4XJK B;  1QAT A;  2H2K A;  2M49 B;  2LP2 A;  3FS7 A;  5I2L A;  2KHN A;  1KFU L;  1AHR A;  2KFG A;  5G08 A;  3EK8 A;  2CXJ A;  4NDC A;  3EK7 A;  1TCO B;  4A4C A;  2LVI A;  4PHJ A;  3EK4 A;  1GGW A;  2BKH B;  1MR8 A;  3HCM A;  4YGD B;  4YRU A;  3O4Y A;  1NPQ A;  2F2O A;  1YVH A;  1OZS A;  4YI9 A;  2NXQ A;  3CWG A;  1A75 B;  1WDC C;  2K2A A;  2L98 A;  3AAJ A;  1G33 A;  2M29 A;  3CTN A;  2NCO A;  2Y1M A;  2BEC A;  3I5I C;  4HRG A;  5HKZ A;  1QS7 A;  1F8H A;  3CZT X;  5PAL A;  1RJV A;  1IG5 A;  1A4P A;  1UHN A;  2JTZ A;  3SG6 A;  5HKY A;  4DRW A;  3JVT B;  4PE4 A;  1XFY O;  1K93 D;  4ORB B;  4DUQ A;  3TDI A;  1R6P A;  4WRI A;  2O60 A;  1CDN A;  1TCF A;  2SAS A;  1OOJ A;  2CT9 A;  1H8B A;  3KPX A;  1DJH A;  2FJU B;  3OP0 A;  3VGO A;  2WC8 A;  1BLQ A;  4Q04 A;  1CM1 A;  3RLZ A;  3SG2 A;  2ISD A;  3GK2 A;  1IKU A;  1OQP A;  1QV1 A;  1S26 D;  5GQQ C;  1Y1U A;  2G2B A;  4BY4 A;  1PUL A;  2NLN A;  2CNP A;  2KBM A;  3PAL A;  5HLV A;  1NYA A;  4GUK A;  3KHE A;  1DMO A;  1NWD A;  3OX5 A;  1Y6W A;  2LVJ A;  1QAS A;  1QX7 A;  5D7F A;  1DJY A;  1XYD A;  3SG3 A;  4XJK A;  1CNP A;  4ETO A;  2PAL A;  2K7C A;  5KTY A;  3IF7 A;  3ZWH A;  5DKQ A;  3KF9 A;  1B7T Y;  1WDC B;  3OX6 A;  2O5G A;  1K96 A;  2EC6 C;  5HYD A;  1SRA A;  1XK4 C;  5JOL A;  1EG3 A;  4I5N B;  2F2P A;  2AMI A;  5K89 A;  1KFU S;  1SCM C;  2F33 A;  1B7T Z;  1EJ3 A;  3I5I B;  2QAC A;  3TS5 B;  1CDL A;  4PE1 A;  1CFD A;  1IRJ A;  2IS9 A;  1OMR A;  1QV0 A;  1A75 A;  2WOR A;  2M1U A;  1M45 A;  2D8N A;  3GK4 X;  1ZOT B;  4JQ0 D;  1YTZ C;  1YR5 A;  3PLF B;  4GGF C;  4M2Q A;  4NDB A;  1XO5 A;  3BUM B;  3M0W A;  1G8I A;  2BE4 A;  1F55 A;  5CSI A;  4I5J A;  1R2U A;  1XVJ A;  4N1G A;  2JC2 A;  1EL4 A;  5AEQ A;  2JT0 A;  4I5L B;  4OVN F;  5CPV A;  1GJY A;  1BOD A;  1TOP A;  1AVS A;  1F4Q A;  4OR9 B;  4MRX A;  1DJZ A;  4PDZ A;  2VRG A;  1KK7 Y;  1WY9 A;  2H61 A;  1IH0 A;  2K0J A;  1LKJ A;  1FW4 A;  4R1E A;  1BJF A;  1LXF C;  4YGB B;  4BY5 A;  3AKA A;  1J1E A;  3E3R A;  1NX0 A;  2BCA A;  1PSR A;  2JWW A;  4USL A;  1CKK A;  2MAZ A;  4XYN A;  5AER A;  2JQ6 A;  5F6T A;  1J55 A;  3I5G C;  1SW8 A;  3WXA A;  1M63 B;  1SL9 A;  3LCP C;  4YGC B;  2HF5 A;  2OS8 C;  1DJX A;  2KFF A;  2EHB A;  2KAX A;  4NDD A;  4YGA A;  2LLS A;  1JFK A;  1SNL A;  1ODB A;  2M9G A;  2ZND A;  3JVT C;  4C0L A;  1DT7 B;  1Y0V H;  4MZL A;  1KK8 B;  4MZJ A;  5AXI A;  1SK6 D;  1XFV O;  1NCZ A;  5J3X A;  5B8I B;  3BOW B;  3VRP A;  1MUX A;  1QIV A;  1SL7 A;  2MLE C;  3BUW B;  1CDP A;  3SIA A;  3JTD C;  5HKW A;  3PM8 A;  3H4S E;  3LLE A;  3O78 A;  2L2E A;  1FPW A;  1FBV A;  2KI6 C;  3FIA A;  3I5F B;  1QVI Y;  1ZAC A;  1W7I B;  1JSA A;  1WLM A;  2KDH A;  2KQY A;  4ORC B;  1S5G Y;  3CGA A;  1S3P A;  2PSR A;  3LL8 B;  2ZKM X;  1JFJ A;  3D0Y B;  1OZO A;  1B9A A;  4L9M A;  1LA3 A;  1CFC A;  3NSK A;  1B8C A;  1SYM A;  1UHI A;  3EKH A;  1DVI A;  2F3Y A;  1UHK A;  1J7O A;  3I5H C;  5AAN A;  2JT3 A;  1QTX A;  1F71 A;  3C1V A;  1JC2 A;  3AAK A;  2FCE A;  4ZCU A;  5HLO A;  1GQM A;  1LA0 A;  4HRE E;  1NX1 A;  4IL1 A;  1JF2 A;  4GFT A;  2KI6 D;  4FQO A;  2V53 A;  4GBA A;  2NCP A;  3TS5 C;  3DVK A;  1C07 A;  2K7D A;  1F4O A;  3CLN A;  2JNX A;  3I5G B;  1B8L A;  4PE7 A;  1PVB A;  1K9K A;  2OS8 B;  1YVL A;  1CB1 A;  1JUO A;  1UWO A;  3BQ3 A;  2M7N A;  1BMO A;  4N5X A;  3HX4 A;  3TUY B;  1CDM A;  2COL B;  2LV7 A;  2JU0 A;  1J7Q A;  2MHH A;  1UHH A;  1B8R A;  3JTD B;  1YRT B;  3RM1 A;  1J7P A;  2M8U A;  2WCF A;  1RWY A;  1IQ3 A;  2ZFD A;  2AUC A;  4GNK B;  4PHN A;  1HQV A;  1XK4 A;  1CLB A;  4OCI A;  4A4B A;  3NSI A;  2Q4U A;  2KYC A;  2OTG C;  1Y1X A;  1SR6 C;  1FF1 A;  2JNF A;  1CFP A;  1K2H A;  1AJ4 A;  1WRK A;  1BU3 A;  1EH2 A;  3KO0 A;  2LAP A;  2LLT A;  3I5H B;  4GGF A;  2F3Z A;  3WNX B;  2KFH A;  1NIW A;  1QIW A;  1V1F A;  1B4C A;  1KFX L;  4JWQ A;  2I94 A;  1KK8 C;  2MA2 A;  3CR2 A;  4OKH A;  1OE9 B;  4F0Z B;  1F54 A;  1Y1A A;  4C0J A;  1C7V A;  2LMV A;  2SCP A;  2P6B B;  4GPL B;  2MBX A;  4CFR A;  3GK1 A;  1S6I A;  2DOQ A;  3NSO A;  2AAO A;  2BBM A;  3BUX B;  3I5F C;  1C7W A;  1QJT A;  4FTG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...