3DF0B

Calcium-dependent complex between m-calpain and calpastatin
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
174
structure length
174
Chain Sequence
SEEERQFRKLFVQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKKWQGIYKRFDTDRSGTIGSNELPGAFEAAGFHLNQHIYSMIIRRYSDETGNMDFDNFISCLVRLDAMFRAFRSLDKNGTGQIQVNIQEWLQLTMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calpain-2 catalytic subunit
publication title Concerted multi-pronged attack by calpastatin to occlude the catalytic cleft of heterodimeric calpains.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 63
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2008-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3df0B00
1DJHA 2HETA 2COLB 2WC8A 4GUKA 3BUXB 5HKYA 5CSFA 1YUTA 3OX5A 1FI5A 2G2BA 1B47A 2LMUA 3PALA 1LXFC 2L4IA 3NXAA 3ICBA 2JU0A 1CDPA 1CMFA 3SIBA 1NP8A 4P5OE 4BY5A 1SY9A 3PM8A 4M2PA 1XK4A 1XA5A 5CPVA 2F2OA 1IQ3A 2LLUA 3DF0A 1SCMB 1OMRA 1ZUZA 1QIWA 4PE4A 5TNCA 2MBXA 3C1VA 1KFXS 1XVJA 3KHEA 2LV7A 3SG4A 1QVIY 2K7DA 2ZFDA 4JQ0D 1CLBA 2JT8A 1S5GY 1D1OA 1V1GA 4NDDA 3CLNA 1SKTA 4GNKB 3TS5C 1FW4A 2PRUA 1QVIZ 1JUOA 1M46A 1DJYA 1MHOA 2KAVA 3AAKA 4ICBA 4CFRA 1BF5A 1DMOA 1WDCB 2JC2A 2KBIA 5IBWA 2JULA 4PE0A 1QIVA 3OHMB 1IH0A 2AUCA 1QX5B 2QPTA 4ETOA 1UUSA 2D8NA 2KI4C 4M2QA 1K93D 2BKIB 1XYDA 1K90D 2NLNA 3DVEA 1Y0VH 1ZFSA 1CM1A 1QLKA 2JNFA 3M0WA 4ORCB 5KU1A 1SCMC 3BYAA 5D69A 1UHKA 4GAOA 3HCMA 4QJ5B 5I2LA 4UPGA 1DJIA 1TCFA 1AJ5A 2JNXA 5PALA 2MAZA 3GOFA 4C0KA 1J7OA 2JT0A 1J7PA 1JFJA 1CFFA 1GGWA 1EG3A 1N0YA 2HF5A 5I8NA 1RECA 2L51A 4GFTA 1TN4A 3CWGA 3SG6A 3ZWHA 1K9PA 3GK1A 2LMTA 1WDCC 1QX2A 1CFPA 1PVAA 1PULA 2H61A 3KPXA 1XO5A 2LC5A 4N5XA 1IKUA 1RWYA 1K94A 1YVLA 1EL4A 1W7JB 3WHUB 2BCXA 1NCXA 2H2KA 2KGBC 3SG3A 1SR6C 3NSIA 5JOLA 2E30A 2M1KB 1J7RA 1OZSA 1IG5A 3O78A 2JPTA 1B9AA 1KFUS 3CGAA 1DF0B 2NCPA 1JF2A 1JF0A 1KK7Y 3BUNB 3F45A 3CTNA 2LUXA 4L9MA 3WHTB 1FF1A 1F8HA 2NCOA 1XFVO 1RK9A 1C07A 1B8RA 2MHHA 4HRGA 2LE9B 1B8LA 2P6BB 2WOSA 4MSPA 1KK7Z 1QLSA 2M0RA 5KSZA 1XFYO 1Y1XA 2PASA 1EH2A 1UHNA 3CR2A 4U8DA 2BE6A 1SL7A 4I5KA 4XJKA 1DT7B 3FS7A 2OTGB 2R2IA 3RLZA 1S3PA 1BU3A 3TZ1A 4OCIA 1SL8A 3D0YA 1QV1A 1RTP1 3A4UB 2L0PA 2MLFC 3IQOA 3TUYC 3FIAA 3PLFB 4WQ2A 4MZJA 2KFHA 2ZRTA 3O2PA 1F4OA 1UHJA 5AXIA 3CS1A 4DS7A 5HYDA 1EXRA 1KK8B 1YX7A 2Y4QA 1A29A 1H4BA 4FTGA 1IGVA 2LNKA 3TS5B 2LHLA 1SRAA 2O60A 2LVVA 2HPSA 1SK6D 1U5IB 2AMIA 3EK8A 1ZMZA 5G08A 2F2PA 4YI8A 2SASA 1BLQA 2KQ6A 3LCPC 2JOJA 2PSRA 1WRKA 1DJWA 1QTXA 1QV0A 2OTGC 3VRQA 2KI4B 1A2XA 4NDBA 4GBAA 1IJ6A 4OV2A 2KFFA 3BOWA 2CXJA 1K2HA 5CSJA 1LA3A 2BL0B 2BCBA 1TNXA 1A75B 3TDIA 1CB1A 1MXLC 3K21A 3EK4A 5D7FA 4OKHA 4OR9B 3VGOA 1UHIA 3SG2A 2Y5IA 4CIDA 1XFZO 2NXQA 4BY4A 1DGUA 4I5LB 4R1EA 1PALA 2TN4A 1KK8C 1F54A 2LMVA 2LVKA 1PSRA 5AEQA 2NZ0A 1Y6WA 2F3ZA 1XFXO 2KSPA 3FWCA 4GPLB 2K7BA 1S5GZ 2Q91A 3KF9A 3DF0B 4JPZB 2ZN9A 1AHRA 3OX6A 4PDZA 1CLLA 1E8AA 1M63B 5CSIA 1PRWA 1W7IB 2M7NA 1MR8A 4MN0A 2LVJA 1BR1B 4QJ3B 1K95A 2JXCA 2LP3A 1QASA 2FOTA 2G9BA 1SR6B 2M9GA 1KCYA 3CR4X 2FCEA 2BL0C 3KEVA 1K8UA 4ZCUA 2OS8C 4GGFC 2FJUB 1KFUL 2EC6C 4Q04A 1X02A 3KO0A 2WORA 4USLA 1M39A 5AANA 1WY9A 1F70A 2BECA 1S6JA 3SG7A 1CKKA 1CDNA 2O5GA 4OVNF 1TNQA 3E3RA 1TIZA 4MBEA 2BKHB 1IQ5A 2KFGA 2WCBA 3NSOA 4TNCA 1XK4C 2RGIA 5B8IB 2L98A 4GGNA 1LVCD 1NSHA 2M29A 3WNXB 1AK8A 4ORBB 3PATA 1JFKA 1S6CA 1BT6A 3IF7A 4AQJA 1PK0D 1PVBA 3ZNIA 4CFQA 1RFJA 4P2YB 1K9UA 2LUCA 1UWOA 2SCPA 5J3XA 2JXLA 2BE4A 4HSZA 4PE7A 1NUBA 3TUYB 3CR5X 2L2EA 1SCVA 5FYXA 2K2AA 2PMYA 3I5GB 2I18A 1R2UA 2I7AA 2LM5A 2ZRSA 1J1EA 1PSBA 1DGVA 5AERA 1BMOA 1G33A 4I5NB 4YGCB 5I2OA 4E68A 5HLVA 4MZKA 3FWBA 1TNWA 2LHIA 4JWQA 4HRHA 4PHKA 2BCAA 4I5JA 1DVIA 3PFVA 2ZNDA 5GQQC 1CTRA 1BG1A 1BODA 1V1FA 2CT9A 2JTTA 2KAYA 3DD4A 4A4CA 2MA2A 2ISDA 1NX3A 2EHBA 1ZOTB 1NCYA 1N2DA 1AJ4A 1SBJA 1YRUB 1OMVA 3LK1A 2IS9A 3DVMA 1TCOB 1A03A 2K61A 2E6WA 2LAPA 2F33A 3WXAA 1DJZA 1EJ3A 5DKQA 1NCZA 1KSMA 2K0JA 2LVIA 4QJ4B 3I5GC 1CLMA 1MF8B 1VRKA 1CFCA 3O6BA 3DVJA 2JWWA 4YGBB 2VRGA 5F6TA 4DRWA 1B7TY 1QS7A 2WCEA 2KGRA 5BPJA 4C0JA 2PVBA 2M7LA 1F71A 2H61C 4MLWA 1NX2A 3OB2B 1U5IA 3VRPA 1Q80A 5DKNA 4DCKA 3VROA 1RROA 1XFUO 3TDUA 1B7TZ 1OE9B 1N65A 1M31A 3NSLA 3TDZA 2KYCA 1ODBA 1F55A 1MXEA 4N1GA 1HQVA 3GK4X 1CNPA 4MRYA 1YTZC 4ZCVA 3SJSA 3DVKA 2I94A 5HKZA 2JT3A 4NQGA 4HREE 1A75A 1MWNA 2L4HA 2WCFA 2OS8B 2M3WA 2GGMA 3I5FB 1LA0A 2LLSA 4NDCA 3VRRA 4MZLA 2EC6B 4F0ZB 3I5IB 5ER4X 1KWOC 2M97A 1TNPA 1WLMA 4DIRA 2K2FA 3BQ3A 4YGEB 1YUUA 1HT9A 1NX0A 1IRJA 1KSOA 1OQPA 3BUOB 1KQMB 1XFWO 2BBMA 2JTZA 3EK7A 1J55A 5DKRA 4A4BA 2HQWA 4PE1A 3LL8B 4PHJA 1TOPA 1B4CA 1QATA 1FBVA 1QXPA 4D1EA 3BOWB 3RM1A 3AKBA 2CBLA 2F8PA 1TRFA 3PN7C 3JTDB 1IJ5A 3O4YA 1FPWA 4YBHB 2KDHA 2MLEC 1ALVA 4CLNA 2I2RE 1NX1A 2CNPA 1JSAA 2Q4UA 2F3YA 4PALA 2OPOA 1UP5A 2MJWB 3OP0A 3I5FC 3LK0A 4CPVA 2GV5A 2V53A 3I5IC 1CDLA 1GQMA 5HKWA 1DJXA 1CMGA 3GK2A 5KTYA 1K96A 2KI6C 3CZTX 4IL1A 1YVHA 3AAJA 4PHNA 1KQMC 3H4SE 1YURA 1WRLA 2WNDA 2QACA 1B8CA 3PSRA 2L50A 3A8RA 1SPYA 2K7CA 1YUSA 2ZN8A 4AOMA 1OMDA 2KHNA 1CDMA 4MRXA 3JTDC 1MQ1A 2M49B 1H8BA 1C7VA 1YX8A 5AFPA 1NYAA 2KYFA 3BUWB 1Y1UA 1YRTB 1K9KA 3BXKA 1J1DA 1NWDA 1L2OB 1RJVA 1GGZA 3AKAA 1SMGA 3SG5A 1C7WA 2Y1NA 3MSEB 1FI6A 1DF0A 5CSNA 4YRUA 1S26D 1LKJA 1KQVA 1AP4A 2KAXA 1BOCA 1OOJA 1BJFA 2JZIA 3I5HB 1ZACA 4PCWA 4PHMA 2LANA 1R6PA 3EVUA 1Y1AA 3VRNA 1GJYA 2JRFA 2A4JA 2PALA 3EKHA 2KNEA 1SW8A 1OSAA 2KBMA 4MEWA 1CFDA 1DTLA 5HLOA 1S1EA 2LP2A 3EVVA 1JC2A 4YGDB 1AVSA 1G8IA 2GGZA 2K7OA 3QRXA 1BR4B 3LLEA 5K89A 1S6IA 1J7QA 1MUXA 1UHHA 1SL9A 1B1GA 2L5XB 3D10A 1UURA 2FCDA 1SYMA 2M1UA 4AQIA 3JVTB 4WQ3A 1L2OC 2ZKMX 2AAOA 2ZNEA 2JQ6A 2HQ8A 2EGDA 2DOQA 1CM4A 2K8MB 4MVFA 1EG4A 1IWQA 1G4YR 1L7ZA 1NIWA 1KWOB 2LLTA 2KI6D 4N1FA 1S36A 3IQQA 2M8UA 1F4QA 3I5HC 1WRZA 3NSKA 4DUQA 1LINA 1AUIB 4YI9A 5I2QA 1TTXA 2Y1MA 4XJKB 4ORAB 1JBAA 1OZOA 1WLZA 3EVRA 1SNLA 2CCMA 3HX4A 4C0LA 2LCPA 1M45A 1QX7A 1JWDA 3D0YB 4XYNA 2KOTA 2KQYA 2CTNA 2MRDA 3EKJA 4FQOA 3PN7B 1DJGA 3SIAA 2BBNA 3BUMB 1A4PA 4YGAA 3OB1B 5JJGA 1KFXL 4WRIA 1YR5A 1QJTA 3JVTC 5ER5A 1ALWA 4M2OA 1NPQA 4GGFA 2B1UA
chains in the Genus database with same CATH superfamily
1DJHA 2HETA 2COLB 2WC8A 4GUKA 3BUXB 5HKYA 5CSFA 1YUTA 3S0GA 3OX5A 1FI5A 2G2BA 1B47A 2LMUA 3PALA 1LXFC 2L4IA 3NXAA 3ICBA 1OOIX 2JU0A 1CDPA 1CMFA 3SIBA 1NP8A 4P5OE 3VB1A 4BY5A 2KLEA 1SY9A 3PM8A 4M2PA 1XK4A 1XA5A 5CPVA 2F2OA 1IQ3A 2LLUA 2QEHA 3DF0A 1SCMB 1OMRA 1ZUZA 1QIWA 4PE4A 5TNCA 5EL2A 3DY9A 3R1OA 2MBXA 4OZDA 3RZSA 3C1VA 1KFXS 3B7AA 1XVJA 3KHEA 2LV7A 3SG4A 1QVIY 2K7DA 2ZFDA 4JQ0D 1CLBA 2JT8A 1S5GY 1D1OA 1V1GA 4NDDA 3CLNA 1SKTA 4GNKB 3TS5C 1FW4A 2PRUA 3N7HA 1QVIZ 1JUOA 1M46A 1DJYA 1MHOA 2KAVA 3AAKA 4ICBA 4CFRA 1BF5A 1DMOA 1WDCB 2JC2A 2KBIA 5IBWA 2JULA 4PE0A 1QIVA 5D3OA 3OHMB 1IH0A 2AUCA 1QX5B 2QPTA 4ETOA 1UUSA 2D8NA 2KI4C 4M2QA 1K93D 2BKIB 1XYDA 1K90D 2NLNA 3DVEA 1Y0VH 1ZFSA 1CM1A 1QLKA 2JNFA 3M0WA 4ORCB 4F7FA 5KU1A 1SCMC 3BYAA 5D69A 1UHKA 4GAOA 3HCMA 3CZ0A 4QJ5B 5I2LA 4UPGA 4JD9A 1DJIA 1TCFA 1AJ5A 2JNXA 5PALA 2MAZA 1DEKA 3GOFA 4C0KA 1J7OA 2JT0A 1J7PA 1JFJA 1CFFA 1GGWA 1EG3A 1N0YA 2HF5A 5I8NA 1RECA 2L51A 4GFTA 1TN4A 3CWGA 3SG6A 1OOGA 3ZWHA 1K9PA 3GK1A 2LMTA 2KLDA 3NHTA 1WDCC 1QX2A 1CFPA 1PVAA 2WC6A 1PULA 2H61A 3KPXA 1XO5A 2LC5A 4N5XA 1IKUA 3CABA 1RWYA 1K94A 1YVLA 1EL4A 1W7JB 3D78A 3WHUB 2BCXA 1NCXA 2H2KA 2KGBC 3SG3A 1SR6C 3NSIA 5JOLA 2E30A 2M1KB 1J7RA 1OZSA 1IG5A 3O78A 3FE6A 2JPTA 1B9AA 1KFUS 3CGAA 1DF0B 3B6XA 2NCPA 1JF2A 4FQTA 1JF0A 1KK7Y 3BUNB 3F45A 3CTNA 2LUXA 4L9MA 3R1PA 3WHTB 1FF1A 1F8HA 2NCOA 2WCHA 1XFVO 1RK9A 1C07A 1B8RA 2MHHA 4HRGA 2LE9B 1B8LA 2P6BB 2WOSA 4MSPA 1KK7Z 1QLSA 2M0RA 5KSZA 1XFYO 1Y1XA 2PASA 1EH2A 1UHNA 3CR2A 4U8DA 2BE6A 1SL7A 4I5KA 4XJKA 1DT7B 3FS7A 2OTGB 2R2IA 3RLZA 1S3PA 2P70A 1BU3A 3TZ1A 3B86A 2QEVA 3BFAA 4OCIA 1SL8A 3D0YA 1QV1A 1RTP1 3A4UB 1XFRA 2L0PA 2MLFC 3IQOA 3TUYC 3FIAA 3PLFB 4WQ2A 4MZJA 2KFHA 2ZRTA 4INXA 3O2PA 1F4OA 1UHJA 5AXIA 3CS1A 4DS7A 5HYDA 1EXRA 1KK8B 1YX7A 2Y4QA 1A29A 3BJHA 1H4BA 4FTGA 2WCMA 1IGVA 2LNKA 3TS5B 2LHLA 1SRAA 2O60A 2LVVA 3S0EA 2HPSA 1SK6D 1U5IB 2AMIA 3EK8A 2KPHA 1ZMZA 3CZ1A 5G08A 2F2PA 4YI8A 3UO9A 2SASA 1BLQA 2KQ6A 3LCPC 3S0DA 2JOJA 2PSRA 1WRKA 1DJWA 1QTXA 1QV0A 2OTGC 3VRQA 2KI4B 1A2XA 4NDBA 4GBAA 1IJ6A 3D74A 4OV2A 2KFFA 3BOWA 2CXJA 1K2HA 5CSJA 1LA3A 2BL0B 2BCBA 5HL1A 1TNXA 1A75B 3TDIA 1CB1A 1GM0A 1MXLC 3K21A 3EK4A 2BAPA 5D7FA 4OKHA 4OR9B 3VGOA 2L5YA 1UHIA 3SG2A 2Y5IA 4CIDA 1XFZO 2NXQA 4BY4A 1DGUA 2WCLA 4I5LB 4R1EA 1PALA 2TN4A 1KK8C 3NHIA 3O4XA 1F54A 2LMVA 2LVKA 1PSRA 5AEQA 4IJ7A 1W9ZA 2NZ0A 1Y6WA 2F3ZA 1XFXO 2KSPA 3FWCA 4GPLB 2H8VA 2K7BA 1S5GZ 2Q91A 3KF9A 3B88A 3DF0B 4JPZB 2ZN9A 1AHRA 3CZ2A 1DQEA 3OX6A 4PDZA 1CLLA 1E8AA 1M63B 5CSIA 1PRWA 1W7IB 2M7NA 1MR8A 4MN0A 2LVJA 1BR1B 4QJ3B 1K95A 2JXCA 2LP3A 1QASA 2FOTA 2G9BA 1SR6B 2M9GA 3Q8IA 5FI6A 1KCYA 1TUZA 3CR4X 2FCEA 2BL0C 3KEVA 1K8UA 4ZCUA 2OS8C 3FE8A 3CDNA 3DZTA 4GGFC 1OW4A 2FJUB 1KFUL 2EC6C 4Q04A 1X02A 3KO0A 4JKTA 2WORA 4USLA 2QDIA 1M39A 5AANA 1WY9A 1F70A 2BECA 2GTEA 1S6JA 3SG7A 3SS4A 1CKKA 1CDNA 2O5GA 4OVNF 1TNQA 2WCJA 3E3RA 1TIZA 4MBEA 2BKHB 1IQ5A 2KFGA 2WCBA 3NSOA 4TNCA 1XK4C 2RGIA 5B8IB 2L98A 4GGNA 3NGVA 1LVCD 1NSHA 1T14A 2M29A 3WNXB 1AK8A 4ORBB 3PATA 1JFKA 1S6CA 1BT6A 3IF7A 1ORGA 4AQJA 1PK0D 1PVBA 3ZNIA 4CFQA 1RFJA 4P2YB 1K9UA 2LUCA 1UWOA 2SCPA 5J3XA 2JXLA 1C3YA 2BE4A 4HSZA 4PE7A 1NUBA 3TUYB 3CR5X 2L2EA 1SCVA 3D73A 5FYXA 2K2AA 2PMYA 3I5GB 2I18A 1R2UA 2I7AA 2LM5A 2ZRSA 3BFBA 1J1EA 1PSBA 1DGVA 5AERA 1BMOA 3S0AA 1G33A 4I5NB 4YGCB 5I2OA 4E68A 5HLVA 4MZKA 3FWBA 1TNWA 2LHIA 4JWQA 4HRHA 4PHKA 2BCAA 4I5JA 1DVIA 3PFVA 1QWVA 2L2CA 2WC5A 2ZNDA 5GQQC 3R72A 3SS5A 1CTRA 3L4LA 1Z2CB 1BG1A 1BODA 1V1FA 1SSEB 2CT9A 2JTTA 2KAYA 3DD4A 4A4CA 2MA2A 1Z4HA 1NX3A 2ISDA 2EHBA 1ZOTB 1NCYA 3FE9A 1N2DA 1AJ4A 5DICA 1LS8A 1SBJA 1YRUB 1OMVA 4KYNA 3LK1A 2IS9A 3DVMA 1TCOB 1A03A 2FJYA 3PM2A 1DC1A 2K61A 2E6WA 2LAPA 2F33A 3WXAA 1DJZA 1EJ3A 3K1EA 5DKQA 1NCZA 1KSMA 2K0JA 2LVIA 4QJ4B 3I5GC 1CLMA 1MF8B 1VRKA 3IVTA 3O6BA 5FI7A 3DVJA 2JWWA 4YGBB 2VRGA 5F6TA 4DRWA 1B7TY 1QS7A 2WCEA 2KGRA 5BPJA 4C0JA 2PVBA 2M7LA 1F71A 1IIOA 2H61C 4MLWA 1NX2A 3OB2B 1U5IA 3VRPA 1Q80A 5DKNA 4DCKA 3VROA 1RROA 1XFUO 3TDUA 1B7TZ 1OE9B 1N65A 1M31A 2PYQA 3NSLA 3TDZA 2KYCA 1ODBA 3SS3A 1F55A 1MXEA 4N1GA 1HQVA 3DYEA 3GK4X 1CNPA 4MRYA 1YTZC 4ZCVA 3SJSA 3DVKA 2I94A 5HKZA 2JT3A 4NQGA 4HREE 1A75A 1MWNA 2L4HA 2WCFA 2OS8B 2M3WA 2GGMA 3I5FB 1LA0A 2LLSA 4NDCA 3VRRA 4MZLA 5FI2A 2EC6B 4F0ZB 3I5IB 3QMEA 1KWOC 5ER4X 2M97A 2QEOA 1TNPA 1WLMA 4DIRA 2K2FA 3BQ3A 4YGEB 1YUUA 1HT9A 1NX0A 1IRJA 1KSOA 1OQPA 3BUOB 1KQMB 1XFWO 2BBMA 2JTZA 3EK7A 1J55A 1DELA 5DKRA 4A4BA 2HQWA 4PE1A 3LL8B 4PHJA 1TOPA 1B4CA 4INWA 1QATA 3B87A 1FBVA 1QXPA 4D1EA 3BOWB 3D76A 3AKBA 3RM1A 2ERBA 2CBLA 2F8PA 1TRFA 3PN7C 3JTDB 1IJ5A 3O4YA 3OBVA 1FPWA 4YBHB 3D75A 2KDHA 2MLEC 1ALVA 4CLNA 2I2RE 1NX1A 2CNPA 1JSAA 2Q4UA 2F3YA 4PALA 2OPOA 1UP5A 2MJWB 3OP0A 3R1VA 3I5FC 3LK0A 4CPVA 2GV5A 2V53A 3OGNA 3I5IC 1CDLA 1GQMA 5HKWA 1DJXA 3V2LA 1CMGA 3GK2A 5KTYA 1K96A 2KI6C 3CZTX 4IL1A 1YVHA 3S0BA 3AAJA 4PHNA 1KQMC 3H4SE 1OOFA 1YURA 3UNWA 1WRLA 2WNDA 2QACA 1B8CA 3PSRA 2L50A 3A8RA 1SPYA 2K7CA 1YUSA 2ZN8A 4AOMA 1OMDA 2KHNA 1CDMA 3CYZA 4MRXA 3JTDC 1MQ1A 2M49B 1H8BA 1C7VA 1YX8A 5AFPA 1NYAA 2KYFA 3BUWB 1Y1UA 1YRTB 1K9KA 3BXKA 1J1DA 1NWDA 1L2OB 1RJVA 1GGZA 3AKAA 3S0FA 1TUJA 1SMGA 1C7WA 2Y1NA 3MSEB 3SG5A 1FI6A 1DF0A 5CSNA 4YRUA 1S26D 1LKJA 3L47A 2K60A 1AP4A 1KQVA 2KAXA 1BOCA 1OOJA 1BJFA 5I94A 2JZIA 3I5HB 1ZACA 4PCWA 1CFCA 3DXLA 4PHMA 2PQLA 2LANA 1R6PA 3EVUA 1Y1AA 3VRNA 1GJYA 2JRFA 2A4JA 2PALA 3EKHA 2KNEA 1SW8A 1OSAA 2KBMA 2P71A 1CFDA 4MEWA 1DTLA 5HLOA 1S1EA 2LP2A 3EVVA 1JC2A 4YGDB 2BNXA 1AVSA 1G8IA 2GGZA 2K7OA 3QRXA 1BR4B 3LLEA 5K89A 1S6IA 1J7QA 1MUXA 1UHHA 1SL9A 1B1GA 2L5XB 3D10A 1UURA 3PJIA 2FCDA 1SYMA 2M1UA 4AQIA 3JVTB 4WQ3A 1L2OC 2ZKMX 2AAOA 2ZNEA 2JQ6A 2HQ8A 2EGDA 2DOQA 1CM4A 2QEBA 2K8MB 3L4AA 1EG4A 1IWQA 4MVFA 1G4YR 1L7ZA 1NIWA 1KWOB 2LLTA 1C3ZA 2KI6D 4N1FA 1P28A 1S36A 3D77A 3IQQA 2M8UA 1F4QA 3I5HC 1WRZA 2WCKA 2YGUA 3NSKA 4DUQA 1LINA 1AUIB 1TWOA 4YI9A 5I2QA 1TTXA 2Y1MA 4XJKB 4ORAB 1JBAA 1OZOA 1WLZA 3EVRA 1SNLA 2CCMA 3HX4A 4C0LA 2LCPA 1M45A 1QX7A 1JWDA 3D0YB 4XYNA 1OOHA 2KOTA 2KQYA 2CTNA 3EG5B 2MRDA 3EKJA 4FQOA 3PN7B 1DJGA 3SIAA 2BBNA 3BUMB 1A4PA 4YGAA 3OB1B 5JJGA 1KFXL 4WRIA 3BFHA 1YR5A 1QJTA 2JPOA 3JVTC 4PT1A 5ER5A 1ALWA 4M2OA 1NPQA 4GGFA 2B1UA
chains in the Genus database with same CATH topology
1DJHA 2HETA 2COLB 2WC8A 4GUKA 3BUXB 5HKYA 5CSFA 1YUTA 3OX5A 1FI5A 2G2BA 1B47A 2LMUA 3PALA 1LXFC 2L4IA 3NXAA 3ICBA 2JU0A 1CDPA 1CMFA 3SIBA 1NP8A 4P5OE 4BY5A 1SY9A 3PM8A 4M2PA 1XK4A 1XA5A 5CPVA 2F2OA 1IQ3A 2LLUA 3DF0A 1SCMB 1OMRA 1ZUZA 1QIWA 4PE4A 5TNCA 2MBXA 3C1VA 1KFXS 1XVJA 3KHEA 2LV7A 3SG4A 1QVIY 2K7DA 2ZFDA 4JQ0D 1CLBA 2JT8A 1S5GY 1D1OA 1V1GA 4NDDA 3CLNA 1SKTA 4GNKB 3TS5C 1FW4A 2PRUA 1QVIZ 1JUOA 1M46A 1DJYA 1MHOA 2KAVA 3AAKA 4ICBA 4CFRA 1BF5A 1DMOA 1WDCB 2JC2A 2KBIA 5IBWA 2JULA 4PE0A 1QIVA 3OHMB 1IH0A 2AUCA 1QX5B 2QPTA 4ETOA 1UUSA 2D8NA 2KI4C 4M2QA 1K93D 2BKIB 1XYDA 1K90D 2NLNA 3DVEA 1Y0VH 1ZFSA 1CM1A 1QLKA 2JNFA 3M0WA 4ORCB 5KU1A 1SCMC 3BYAA 5D69A 1UHKA 4GAOA 3HCMA 4QJ5B 5I2LA 4UPGA 1DJIA 1TCFA 1AJ5A 2JNXA 5PALA 2MAZA 3GOFA 4C0KA 1J7OA 2JT0A 1J7PA 1JFJA 1CFFA 1GGWA 1EG3A 1N0YA 2HF5A 5I8NA 1RECA 2L51A 4GFTA 1TN4A 3CWGA 3SG6A 3ZWHA 1K9PA 3GK1A 2LMTA 1WDCC 1QX2A 1CFPA 1PVAA 1PULA 2H61A 3KPXA 1XO5A 2LC5A 4N5XA 1IKUA 1RWYA 1K94A 1YVLA 1EL4A 1W7JB 3WHUB 2BCXA 1NCXA 2H2KA 2KGBC 3SG3A 1SR6C 3NSIA 5JOLA 2E30A 2M1KB 1J7RA 1OZSA 1IG5A 3O78A 2JPTA 1B9AA 1KFUS 3CGAA 1DF0B 2NCPA 1JF2A 1JF0A 1KK7Y 3BUNB 3F45A 3CTNA 2LUXA 4L9MA 3WHTB 1FF1A 1F8HA 2NCOA 1XFVO 1RK9A 1C07A 1B8RA 2MHHA 4HRGA 2LE9B 1B8LA 2P6BB 2WOSA 4MSPA 1KK7Z 1QLSA 2M0RA 5KSZA 1XFYO 1Y1XA 2PASA 1EH2A 1UHNA 3CR2A 4U8DA 2BE6A 1SL7A 4I5KA 4XJKA 1DT7B 3FS7A 2OTGB 2R2IA 3RLZA 1S3PA 1BU3A 3TZ1A 4OCIA 1SL8A 3D0YA 1QV1A 1RTP1 3A4UB 2L0PA 2MLFC 3IQOA 3TUYC 3FIAA 3PLFB 4WQ2A 4MZJA 2KFHA 2ZRTA 3O2PA 1F4OA 1UHJA 5AXIA 3CS1A 4DS7A 5HYDA 1EXRA 1KK8B 1YX7A 2Y4QA 1A29A 1H4BA 4FTGA 1IGVA 2LNKA 3TS5B 2LHLA 1SRAA 2O60A 2LVVA 2HPSA 1SK6D 1U5IB 2AMIA 3EK8A 1ZMZA 5G08A 2F2PA 4YI8A 2SASA 1BLQA 2KQ6A 3LCPC 2JOJA 2PSRA 1WRKA 1DJWA 1QTXA 1QV0A 2OTGC 3VRQA 2KI4B 1A2XA 4NDBA 4GBAA 1IJ6A 4OV2A 2KFFA 3BOWA 2CXJA 1K2HA 5CSJA 1LA3A 2BL0B 2BCBA 1TNXA 1A75B 3TDIA 1CB1A 1MXLC 3K21A 3EK4A 5D7FA 4OKHA 4OR9B 3VGOA 1UHIA 3SG2A 2Y5IA 4CIDA 1XFZO 2NXQA 4BY4A 1DGUA 4I5LB 4R1EA 1PALA 2TN4A 1KK8C 1F54A 2LMVA 2LVKA 1PSRA 5AEQA 2NZ0A 1Y6WA 2F3ZA 1XFXO 2KSPA 3FWCA 4GPLB 2K7BA 1S5GZ 2Q91A 3KF9A 3DF0B 4JPZB 2ZN9A 1AHRA 3OX6A 4PDZA 1CLLA 1E8AA 1M63B 5CSIA 1PRWA 1W7IB 2M7NA 1MR8A 4MN0A 2LVJA 1BR1B 4QJ3B 1K95A 2JXCA 2LP3A 1QASA 2FOTA 2G9BA 1SR6B 2M9GA 1KCYA 3CR4X 2FCEA 2BL0C 3KEVA 1K8UA 4ZCUA 2OS8C 4GGFC 2FJUB 1KFUL 2EC6C 4Q04A 1X02A 3KO0A 2WORA 4USLA 1M39A 5AANA 1WY9A 1F70A 2BECA 1S6JA 3SG7A 1CKKA 1CDNA 2O5GA 4OVNF 1TNQA 3E3RA 1TIZA 4MBEA 2BKHB 1IQ5A 2KFGA 2WCBA 3NSOA 4TNCA 1XK4C 2RGIA 5B8IB 2L98A 4GGNA 1LVCD 1NSHA 2M29A 3WNXB 1AK8A 4ORBB 3PATA 1JFKA 1S6CA 1BT6A 3IF7A 4AQJA 1PK0D 1PVBA 3ZNIA 4CFQA 1RFJA 4P2YB 1K9UA 2LUCA 1UWOA 2SCPA 5J3XA 2JXLA 2BE4A 4HSZA 4PE7A 1NUBA 3TUYB 3CR5X 2L2EA 1SCVA 5FYXA 2K2AA 2PMYA 3I5GB 2I18A 1R2UA 2I7AA 2LM5A 2ZRSA 1J1EA 1PSBA 1DGVA 5AERA 1BMOA 1G33A 4I5NB 4YGCB 5I2OA 4E68A 5HLVA 4MZKA 3FWBA 1TNWA 2LHIA 4JWQA 4HRHA 4PHKA 2BCAA 4I5JA 1DVIA 3PFVA 2ZNDA 5GQQC 1CTRA 1BG1A 1BODA 1V1FA 2CT9A 2JTTA 2KAYA 3DD4A 4A4CA 2MA2A 2ISDA 1NX3A 2EHBA 1ZOTB 1NCYA 1N2DA 1AJ4A 1SBJA 1YRUB 1OMVA 3LK1A 2IS9A 3DVMA 1TCOB 1A03A 2K61A 2E6WA 2LAPA 2F33A 3WXAA 1DJZA 1EJ3A 5DKQA 1NCZA 1KSMA 2K0JA 2LVIA 4QJ4B 3I5GC 1CLMA 1MF8B 1VRKA 1CFCA 3O6BA 3DVJA 2JWWA 4YGBB 2VRGA 5F6TA 4DRWA 1B7TY 1QS7A 2WCEA 2KGRA 5BPJA 4C0JA 2PVBA 2M7LA 1F71A 2H61C 4MLWA 1NX2A 3OB2B 1U5IA 3VRPA 1Q80A 5DKNA 4DCKA 3VROA 1RROA 1XFUO 3TDUA 1B7TZ 1OE9B 1N65A 1M31A 3NSLA 3TDZA 2KYCA 1ODBA 1F55A 1MXEA 4N1GA 1HQVA 3GK4X 1CNPA 4MRYA 1YTZC 4ZCVA 3SJSA 3DVKA 2I94A 5HKZA 2JT3A 4NQGA 4HREE 1A75A 1MWNA 2L4HA 2WCFA 2OS8B 2M3WA 2GGMA 3I5FB 1LA0A 2LLSA 4NDCA 3VRRA 4MZLA 2EC6B 4F0ZB 3I5IB 5ER4X 1KWOC 2M97A 1TNPA 1WLMA 4DIRA 2K2FA 3BQ3A 4YGEB 1YUUA 1HT9A 1NX0A 1IRJA 1KSOA 1OQPA 3BUOB 1KQMB 1XFWO 2BBMA 2JTZA 3EK7A 1J55A 5DKRA 4A4BA 2HQWA 4PE1A 3LL8B 4PHJA 1TOPA 1B4CA 1QATA 1FBVA 1QXPA 4D1EA 3BOWB 3RM1A 3AKBA 2CBLA 2F8PA 1TRFA 3PN7C 3JTDB 1IJ5A 3O4YA 1FPWA 4YBHB 2KDHA 2MLEC 1ALVA 4CLNA 2I2RE 1NX1A 2CNPA 1JSAA 2Q4UA 2F3YA 4PALA 2OPOA 1UP5A 2MJWB 3OP0A 3I5FC 3LK0A 4CPVA 2GV5A 2V53A 3I5IC 1CDLA 1GQMA 5HKWA 1DJXA 1CMGA 3GK2A 5KTYA 1K96A 2KI6C 3CZTX 4IL1A 1YVHA 3AAJA 4PHNA 1KQMC 3H4SE 1YURA 1WRLA 2WNDA 2QACA 1B8CA 3PSRA 2L50A 3A8RA 1SPYA 2K7CA 1YUSA 2ZN8A 4AOMA 1OMDA 2KHNA 1CDMA 4MRXA 3JTDC 1MQ1A 2M49B 1H8BA 1C7VA 1YX8A 5AFPA 1NYAA 2KYFA 3BUWB 1Y1UA 1YRTB 1K9KA 3BXKA 1J1DA 1NWDA 1L2OB 1RJVA 1GGZA 3AKAA 1SMGA 3SG5A 1C7WA 2Y1NA 3MSEB 1FI6A 1DF0A 5CSNA 4YRUA 1S26D 1LKJA 1KQVA 1AP4A 2KAXA 1BOCA 1OOJA 1BJFA 2JZIA 3I5HB 1ZACA 4PCWA 4PHMA 2LANA 1R6PA 3EVUA 1Y1AA 3VRNA 1GJYA 2JRFA 2A4JA 2PALA 3EKHA 2KNEA 1SW8A 1OSAA 2KBMA 4MEWA 1CFDA 1DTLA 5HLOA 1S1EA 2LP2A 3EVVA 1JC2A 4YGDB 1AVSA 1G8IA 2GGZA 2K7OA 3QRXA 1BR4B 3LLEA 5K89A 1S6IA 1J7QA 1MUXA 1UHHA 1SL9A 1B1GA 2L5XB 3D10A 1UURA 2FCDA 1SYMA 2M1UA 4AQIA 3JVTB 4WQ3A 1L2OC 2ZKMX 2AAOA 2ZNEA 2JQ6A 2HQ8A 2EGDA 2DOQA 1CM4A 2K8MB 4MVFA 1EG4A 1IWQA 1G4YR 1L7ZA 1NIWA 1KWOB 2LLTA 2KI6D 4N1FA 1S36A 3IQQA 2M8UA 1F4QA 3I5HC 1WRZA 3NSKA 4DUQA 1LINA 1AUIB 4YI9A 5I2QA 1TTXA 2Y1MA 4XJKB 4ORAB 1JBAA 1OZOA 1WLZA 3EVRA 1SNLA 2CCMA 3HX4A 4C0LA 2LCPA 1M45A 1QX7A 1JWDA 3D0YB 4XYNA 2KOTA 2KQYA 2CTNA 2MRDA 3EKJA 4FQOA 3PN7B 1DJGA 3SIAA 2BBNA 3BUMB 1A4PA 4YGAA 3OB1B 5JJGA 1KFXL 4WRIA 1YR5A 1QJTA 3JVTC 5ER5A 1ALWA 4M2OA 1NPQA 4GGFA 2B1UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DJH A;  2HET A;  2COL B;  2WC8 A;  4GUK A;  3BUX B;  5HKY A;  5CSF A;  1YUT A;  3OX5 A;  1FI5 A;  2G2B A;  1B47 A;  2LMU A;  3PAL A;  1LXF C;  2L4I A;  3NXA A;  3ICB A;  2JU0 A;  1CDP A;  1CMF A;  3SIB A;  1NP8 A;  4P5O E;  4BY5 A;  1SY9 A;  3PM8 A;  4M2P A;  1XK4 A;  1XA5 A;  5CPV A;  2F2O A;  1IQ3 A;  2LLU A;  3DF0 A;  1SCM B;  1OMR A;  1ZUZ A;  1QIW A;  4PE4 A;  5TNC A;  2MBX A;  3C1V A;  1KFX S;  1XVJ A;  3KHE A;  2LV7 A;  3SG4 A;  1QVI Y;  2K7D A;  2ZFD A;  4JQ0 D;  1CLB A;  2JT8 A;  1S5G Y;  1D1O A;  1V1G A;  4NDD A;  3CLN A;  1SKT A;  4GNK B;  3TS5 C;  1FW4 A;  2PRU A;  1QVI Z;  1JUO A;  1M46 A;  1DJY A;  1MHO A;  2KAV A;  3AAK A;  4ICB A;  4CFR A;  1BF5 A;  1DMO A;  1WDC B;  2JC2 A;  2KBI A;  5IBW A;  2JUL A;  4PE0 A;  1QIV A;  3OHM B;  1IH0 A;  2AUC A;  1QX5 B;  2QPT A;  4ETO A;  1UUS A;  2D8N A;  2KI4 C;  4M2Q A;  1K93 D;  2BKI B;  1XYD A;  1K90 D;  2NLN A;  3DVE A;  1Y0V H;  1ZFS A;  1CM1 A;  1QLK A;  2JNF A;  3M0W A;  4ORC B;  5KU1 A;  1SCM C;  3BYA A;  5D69 A;  1UHK A;  4GAO A;  3HCM A;  4QJ5 B;  5I2L A;  4UPG A;  1DJI A;  1TCF A;  1AJ5 A;  2JNX A;  5PAL A;  2MAZ A;  3GOF A;  4C0K A;  1J7O A;  2JT0 A;  1J7P A;  1JFJ A;  1CFF A;  1GGW A;  1EG3 A;  1N0Y A;  2HF5 A;  5I8N A;  1REC A;  2L51 A;  4GFT A;  1TN4 A;  3CWG A;  3SG6 A;  3ZWH A;  1K9P A;  3GK1 A;  2LMT A;  1WDC C;  1QX2 A;  1CFP A;  1PVA A;  1PUL A;  2H61 A;  3KPX A;  1XO5 A;  2LC5 A;  4N5X A;  1IKU A;  1RWY A;  1K94 A;  1YVL A;  1EL4 A;  1W7J B;  3WHU B;  2BCX A;  1NCX A;  2H2K A;  2KGB C;  3SG3 A;  1SR6 C;  3NSI A;  5JOL A;  2E30 A;  2M1K B;  1J7R A;  1OZS A;  1IG5 A;  3O78 A;  2JPT A;  1B9A A;  1KFU S;  3CGA A;  1DF0 B;  2NCP A;  1JF2 A;  1JF0 A;  1KK7 Y;  3BUN B;  3F45 A;  3CTN A;  2LUX A;  4L9M A;  3WHT B;  1FF1 A;  1F8H A;  2NCO A;  1XFV O;  1RK9 A;  1C07 A;  1B8R A;  2MHH A;  4HRG A;  2LE9 B;  1B8L A;  2P6B B;  2WOS A;  4MSP A;  1KK7 Z;  1QLS A;  2M0R A;  5KSZ A;  1XFY O;  1Y1X A;  2PAS A;  1EH2 A;  1UHN A;  3CR2 A;  4U8D A;  2BE6 A;  1SL7 A;  4I5K A;  4XJK A;  1DT7 B;  3FS7 A;  2OTG B;  2R2I A;  3RLZ A;  1S3P A;  1BU3 A;  3TZ1 A;  4OCI A;  1SL8 A;  3D0Y A;  1QV1 A;  1RTP 1;  3A4U B;  2L0P A;  2MLF C;  3IQO A;  3TUY C;  3FIA A;  3PLF B;  4WQ2 A;  4MZJ A;  2KFH A;  2ZRT A;  3O2P A;  1F4O A;  1UHJ A;  5AXI A;  3CS1 A;  4DS7 A;  5HYD A;  1EXR A;  1KK8 B;  1YX7 A;  2Y4Q A;  1A29 A;  1H4B A;  4FTG A;  1IGV A;  2LNK A;  3TS5 B;  2LHL A;  1SRA A;  2O60 A;  2LVV A;  2HPS A;  1SK6 D;  1U5I B;  2AMI A;  3EK8 A;  1ZMZ A;  5G08 A;  2F2P A;  4YI8 A;  2SAS A;  1BLQ A;  2KQ6 A;  3LCP C;  2JOJ A;  2PSR A;  1WRK A;  1DJW A;  1QTX A;  1QV0 A;  2OTG C;  3VRQ A;  2KI4 B;  1A2X A;  4NDB A;  4GBA A;  1IJ6 A;  4OV2 A;  2KFF A;  3BOW A;  2CXJ A;  1K2H A;  5CSJ A;  1LA3 A;  2BL0 B;  2BCB A;  1TNX A;  1A75 B;  3TDI A;  1CB1 A;  1MXL C;  3K21 A;  3EK4 A;  5D7F A;  4OKH A;  4OR9 B;  3VGO A;  1UHI A;  3SG2 A;  2Y5I A;  4CID A;  1XFZ O;  2NXQ A;  4BY4 A;  1DGU A;  4I5L B;  4R1E A;  1PAL A;  2TN4 A;  1KK8 C;  1F54 A;  2LMV A;  2LVK A;  1PSR A;  5AEQ A;  2NZ0 A;  1Y6W A;  2F3Z A;  1XFX O;  2KSP A;  3FWC A;  4GPL B;  2K7B A;  1S5G Z;  2Q91 A;  3KF9 A;  3DF0 B;  4JPZ B;  2ZN9 A;  1AHR A;  3OX6 A;  4PDZ A;  1CLL A;  1E8A A;  1M63 B;  5CSI A;  1PRW A;  1W7I B;  2M7N A;  1MR8 A;  4MN0 A;  2LVJ A;  1BR1 B;  4QJ3 B;  1K95 A;  2JXC A;  2LP3 A;  1QAS A;  2FOT A;  2G9B A;  1SR6 B;  2M9G A;  1KCY A;  3CR4 X;  2FCE A;  2BL0 C;  3KEV A;  1K8U A;  4ZCU A;  2OS8 C;  4GGF C;  2FJU B;  1KFU L;  2EC6 C;  4Q04 A;  1X02 A;  3KO0 A;  2WOR A;  4USL A;  1M39 A;  5AAN A;  1WY9 A;  1F70 A;  2BEC A;  1S6J A;  3SG7 A;  1CKK A;  1CDN A;  2O5G A;  4OVN F;  1TNQ A;  3E3R A;  1TIZ A;  4MBE A;  2BKH B;  1IQ5 A;  2KFG A;  2WCB A;  3NSO A;  4TNC A;  1XK4 C;  2RGI A;  5B8I B;  2L98 A;  4GGN A;  1LVC D;  1NSH A;  2M29 A;  3WNX B;  1AK8 A;  4ORB B;  3PAT A;  1JFK A;  1S6C A;  1BT6 A;  3IF7 A;  4AQJ A;  1PK0 D;  1PVB A;  3ZNI A;  4CFQ A;  1RFJ A;  4P2Y B;  1K9U A;  2LUC A;  1UWO A;  2SCP A;  5J3X A;  2JXL A;  2BE4 A;  4HSZ A;  4PE7 A;  1NUB A;  3TUY B;  3CR5 X;  2L2E A;  1SCV A;  5FYX A;  2K2A A;  2PMY A;  3I5G B;  2I18 A;  1R2U A;  2I7A A;  2LM5 A;  2ZRS A;  1J1E A;  1PSB A;  1DGV A;  5AER A;  1BMO A;  1G33 A;  4I5N B;  4YGC B;  5I2O A;  4E68 A;  5HLV A;  4MZK A;  3FWB A;  1TNW A;  2LHI A;  4JWQ A;  4HRH A;  4PHK A;  2BCA A;  4I5J A;  1DVI A;  3PFV A;  2ZND A;  5GQQ C;  1CTR A;  1BG1 A;  1BOD A;  1V1F A;  2CT9 A;  2JTT A;  2KAY A;  3DD4 A;  4A4C A;  2MA2 A;  2ISD A;  1NX3 A;  2EHB A;  1ZOT B;  1NCY A;  1N2D A;  1AJ4 A;  1SBJ A;  1YRU B;  1OMV A;  3LK1 A;  2IS9 A;  3DVM A;  1TCO B;  1A03 A;  2K61 A;  2E6W A;  2LAP A;  2F33 A;  3WXA A;  1DJZ A;  1EJ3 A;  5DKQ A;  1NCZ A;  1KSM A;  2K0J A;  2LVI A;  4QJ4 B;  3I5G C;  1CLM A;  1MF8 B;  1VRK A;  1CFC A;  3O6B A;  3DVJ A;  2JWW A;  4YGB B;  2VRG A;  5F6T A;  4DRW A;  1B7T Y;  1QS7 A;  2WCE A;  2KGR A;  5BPJ A;  4C0J A;  2PVB A;  2M7L A;  1F71 A;  2H61 C;  4MLW A;  1NX2 A;  3OB2 B;  1U5I A;  3VRP A;  1Q80 A;  5DKN A;  4DCK A;  3VRO A;  1RRO A;  1XFU O;  3TDU A;  1B7T Z;  1OE9 B;  1N65 A;  1M31 A;  3NSL A;  3TDZ A;  2KYC A;  1ODB A;  1F55 A;  1MXE A;  4N1G A;  1HQV A;  3GK4 X;  1CNP A;  4MRY A;  1YTZ C;  4ZCV A;  3SJS A;  3DVK A;  2I94 A;  5HKZ A;  2JT3 A;  4NQG A;  4HRE E;  1A75 A;  1MWN A;  2L4H A;  2WCF A;  2OS8 B;  2M3W A;  2GGM A;  3I5F B;  1LA0 A;  2LLS A;  4NDC A;  3VRR A;  4MZL A;  2EC6 B;  4F0Z B;  3I5I B;  5ER4 X;  1KWO C;  2M97 A;  1TNP A;  1WLM A;  4DIR A;  2K2F A;  3BQ3 A;  4YGE B;  1YUU A;  1HT9 A;  1NX0 A;  1IRJ A;  1KSO A;  1OQP A;  3BUO B;  1KQM B;  1XFW O;  2BBM A;  2JTZ A;  3EK7 A;  1J55 A;  5DKR A;  4A4B A;  2HQW A;  4PE1 A;  3LL8 B;  4PHJ A;  1TOP A;  1B4C A;  1QAT A;  1FBV A;  1QXP A;  4D1E A;  3BOW B;  3RM1 A;  3AKB A;  2CBL A;  2F8P A;  1TRF A;  3PN7 C;  3JTD B;  1IJ5 A;  3O4Y A;  1FPW A;  4YBH B;  2KDH A;  2MLE C;  1ALV A;  4CLN A;  2I2R E;  1NX1 A;  2CNP A;  1JSA A;  2Q4U A;  2F3Y A;  4PAL A;  2OPO A;  1UP5 A;  2MJW B;  3OP0 A;  3I5F C;  3LK0 A;  4CPV A;  2GV5 A;  2V53 A;  3I5I C;  1CDL A;  1GQM A;  5HKW A;  1DJX A;  1CMG A;  3GK2 A;  5KTY A;  1K96 A;  2KI6 C;  3CZT X;  4IL1 A;  1YVH A;  3AAJ A;  4PHN A;  1KQM C;  3H4S E;  1YUR A;  1WRL A;  2WND A;  2QAC A;  1B8C A;  3PSR A;  2L50 A;  3A8R A;  1SPY A;  2K7C A;  1YUS A;  2ZN8 A;  4AOM A;  1OMD A;  2KHN A;  1CDM A;  4MRX A;  3JTD C;  1MQ1 A;  2M49 B;  1H8B A;  1C7V A;  1YX8 A;  5AFP A;  1NYA A;  2KYF A;  3BUW B;  1Y1U A;  1YRT B;  1K9K A;  3BXK A;  1J1D A;  1NWD A;  1L2O B;  1RJV A;  1GGZ A;  3AKA A;  1SMG A;  3SG5 A;  1C7W A;  2Y1N A;  3MSE B;  1FI6 A;  1DF0 A;  5CSN A;  4YRU A;  1S26 D;  1LKJ A;  1KQV A;  1AP4 A;  2KAX A;  1BOC A;  1OOJ A;  1BJF A;  2JZI A;  3I5H B;  1ZAC A;  4PCW A;  4PHM A;  2LAN A;  1R6P A;  3EVU A;  1Y1A A;  3VRN A;  1GJY A;  2JRF A;  2A4J A;  2PAL A;  3EKH A;  2KNE A;  1SW8 A;  1OSA A;  2KBM A;  4MEW A;  1CFD A;  1DTL A;  5HLO A;  1S1E A;  2LP2 A;  3EVV A;  1JC2 A;  4YGD B;  1AVS A;  1G8I A;  2GGZ A;  2K7O A;  3QRX A;  1BR4 B;  3LLE A;  5K89 A;  1S6I A;  1J7Q A;  1MUX A;  1UHH A;  1SL9 A;  1B1G A;  2L5X B;  3D10 A;  1UUR A;  2FCD A;  1SYM A;  2M1U A;  4AQI A;  3JVT B;  4WQ3 A;  1L2O C;  2ZKM X;  2AAO A;  2ZNE A;  2JQ6 A;  2HQ8 A;  2EGD A;  2DOQ A;  1CM4 A;  2K8M B;  4MVF A;  1EG4 A;  1IWQ A;  1G4Y R;  1L7Z A;  1NIW A;  1KWO B;  2LLT A;  2KI6 D;  4N1F A;  1S36 A;  3IQQ A;  2M8U A;  1F4Q A;  3I5H C;  1WRZ A;  3NSK A;  4DUQ A;  1LIN A;  1AUI B;  4YI9 A;  5I2Q A;  1TTX A;  2Y1M A;  4XJK B;  4ORA B;  1JBA A;  1OZO A;  1WLZ A;  3EVR A;  1SNL A;  2CCM A;  3HX4 A;  4C0L A;  2LCP A;  1M45 A;  1QX7 A;  1JWD A;  3D0Y B;  4XYN A;  2KOT A;  2KQY A;  2CTN A;  2MRD A;  3EKJ A;  4FQO A;  3PN7 B;  1DJG A;  3SIA A;  2BBN A;  3BUM B;  1A4P A;  4YGA A;  3OB1 B;  5JJG A;  1KFX L;  4WRI A;  1YR5 A;  1QJT A;  3JVT C;  5ER5 A;  1ALW A;  4M2O A;  1NPQ A;  4GGF A;  2B1U A; 
#chains in the Genus database with same CATH topology
 1DJH A;  2HET A;  2COL B;  2WC8 A;  4GUK A;  3BUX B;  5HKY A;  5CSF A;  1YUT A;  3S0G A;  3OX5 A;  1FI5 A;  2G2B A;  1B47 A;  2LMU A;  3PAL A;  1LXF C;  2L4I A;  3NXA A;  3ICB A;  1OOI X;  2JU0 A;  1CDP A;  1CMF A;  3SIB A;  1NP8 A;  4P5O E;  3VB1 A;  4BY5 A;  2KLE A;  1SY9 A;  3PM8 A;  4M2P A;  1XK4 A;  1XA5 A;  5CPV A;  2F2O A;  1IQ3 A;  2LLU A;  2QEH A;  3DF0 A;  1SCM B;  1OMR A;  1ZUZ A;  1QIW A;  4PE4 A;  5TNC A;  5EL2 A;  3DY9 A;  3R1O A;  2MBX A;  4OZD A;  3RZS A;  3C1V A;  1KFX S;  3B7A A;  1XVJ A;  3KHE A;  2LV7 A;  3SG4 A;  1QVI Y;  2K7D A;  2ZFD A;  4JQ0 D;  1CLB A;  2JT8 A;  1S5G Y;  1D1O A;  1V1G A;  4NDD A;  3CLN A;  1SKT A;  4GNK B;  3TS5 C;  1FW4 A;  2PRU A;  3N7H A;  1QVI Z;  1JUO A;  1M46 A;  1DJY A;  1MHO A;  2KAV A;  3AAK A;  4ICB A;  4CFR A;  1BF5 A;  1DMO A;  1WDC B;  2JC2 A;  2KBI A;  5IBW A;  2JUL A;  4PE0 A;  1QIV A;  5D3O A;  3OHM B;  1IH0 A;  2AUC A;  1QX5 B;  2QPT A;  4ETO A;  1UUS A;  2D8N A;  2KI4 C;  4M2Q A;  1K93 D;  2BKI B;  1XYD A;  1K90 D;  2NLN A;  3DVE A;  1Y0V H;  1ZFS A;  1CM1 A;  1QLK A;  2JNF A;  3M0W A;  4ORC B;  4F7F A;  5KU1 A;  1SCM C;  3BYA A;  5D69 A;  1UHK A;  4GAO A;  3HCM A;  3CZ0 A;  4QJ5 B;  5I2L A;  4UPG A;  4JD9 A;  1DJI A;  1TCF A;  1AJ5 A;  2JNX A;  5PAL A;  2MAZ A;  1DEK A;  3GOF A;  4C0K A;  1J7O A;  2JT0 A;  1J7P A;  1JFJ A;  1CFF A;  1GGW A;  1EG3 A;  1N0Y A;  2HF5 A;  5I8N A;  1REC A;  2L51 A;  4GFT A;  1TN4 A;  3CWG A;  3SG6 A;  1OOG A;  3ZWH A;  1K9P A;  3GK1 A;  2LMT A;  2KLD A;  3NHT A;  1WDC C;  1QX2 A;  1CFP A;  1PVA A;  2WC6 A;  1PUL A;  2H61 A;  3KPX A;  1XO5 A;  2LC5 A;  4N5X A;  1IKU A;  3CAB A;  1RWY A;  1K94 A;  1YVL A;  1EL4 A;  1W7J B;  3D78 A;  3WHU B;  2BCX A;  1NCX A;  2H2K A;  2KGB C;  3SG3 A;  1SR6 C;  3NSI A;  5JOL A;  2E30 A;  2M1K B;  1J7R A;  1OZS A;  1IG5 A;  3O78 A;  3FE6 A;  2JPT A;  1B9A A;  1KFU S;  3CGA A;  1DF0 B;  3B6X A;  2NCP A;  1JF2 A;  4FQT A;  1JF0 A;  1KK7 Y;  3BUN B;  3F45 A;  3CTN A;  2LUX A;  4L9M A;  3R1P A;  3WHT B;  1FF1 A;  1F8H A;  2NCO A;  2WCH A;  1XFV O;  1RK9 A;  1C07 A;  1B8R A;  2MHH A;  4HRG A;  2LE9 B;  1B8L A;  2P6B B;  2WOS A;  4MSP A;  1KK7 Z;  1QLS A;  2M0R A;  5KSZ A;  1XFY O;  1Y1X A;  2PAS A;  1EH2 A;  1UHN A;  3CR2 A;  4U8D A;  2BE6 A;  1SL7 A;  4I5K A;  4XJK A;  1DT7 B;  3FS7 A;  2OTG B;  2R2I A;  3RLZ A;  1S3P A;  2P70 A;  1BU3 A;  3TZ1 A;  3B86 A;  2QEV A;  3BFA A;  4OCI A;  1SL8 A;  3D0Y A;  1QV1 A;  1RTP 1;  3A4U B;  1XFR A;  2L0P A;  2MLF C;  3IQO A;  3TUY C;  3FIA A;  3PLF B;  4WQ2 A;  4MZJ A;  2KFH A;  2ZRT A;  4INX A;  3O2P A;  1F4O A;  1UHJ A;  5AXI A;  3CS1 A;  4DS7 A;  5HYD A;  1EXR A;  1KK8 B;  1YX7 A;  2Y4Q A;  1A29 A;  3BJH A;  1H4B A;  4FTG A;  2WCM A;  1IGV A;  2LNK A;  3TS5 B;  2LHL A;  1SRA A;  2O60 A;  2LVV A;  3S0E A;  2HPS A;  1SK6 D;  1U5I B;  2AMI A;  3EK8 A;  2KPH A;  1ZMZ A;  3CZ1 A;  5G08 A;  2F2P A;  4YI8 A;  3UO9 A;  2SAS A;  1BLQ A;  2KQ6 A;  3LCP C;  3S0D A;  2JOJ A;  2PSR A;  1WRK A;  1DJW A;  1QTX A;  1QV0 A;  2OTG C;  3VRQ A;  2KI4 B;  1A2X A;  4NDB A;  4GBA A;  1IJ6 A;  3D74 A;  4OV2 A;  2KFF A;  3BOW A;  2CXJ A;  1K2H A;  5CSJ A;  1LA3 A;  2BL0 B;  2BCB A;  5HL1 A;  1TNX A;  1A75 B;  3TDI A;  1CB1 A;  1GM0 A;  1MXL C;  3K21 A;  3EK4 A;  2BAP A;  5D7F A;  4OKH A;  4OR9 B;  3VGO A;  2L5Y A;  1UHI A;  3SG2 A;  2Y5I A;  4CID A;  1XFZ O;  2NXQ A;  4BY4 A;  1DGU A;  2WCL A;  4I5L B;  4R1E A;  1PAL A;  2TN4 A;  1KK8 C;  3NHI A;  3O4X A;  1F54 A;  2LMV A;  2LVK A;  1PSR A;  5AEQ A;  4IJ7 A;  1W9Z A;  2NZ0 A;  1Y6W A;  2F3Z A;  1XFX O;  2KSP A;  3FWC A;  4GPL B;  2H8V A;  2K7B A;  1S5G Z;  2Q91 A;  3KF9 A;  3B88 A;  3DF0 B;  4JPZ B;  2ZN9 A;  1AHR A;  3CZ2 A;  1DQE A;  3OX6 A;  4PDZ A;  1CLL A;  1E8A A;  1M63 B;  5CSI A;  1PRW A;  1W7I B;  2M7N A;  1MR8 A;  4MN0 A;  2LVJ A;  1BR1 B;  4QJ3 B;  1K95 A;  2JXC A;  2LP3 A;  1QAS A;  2FOT A;  2G9B A;  1SR6 B;  2M9G A;  3Q8I A;  5FI6 A;  1KCY A;  1TUZ A;  3CR4 X;  2FCE A;  2BL0 C;  3KEV A;  1K8U A;  4ZCU A;  2OS8 C;  3FE8 A;  3CDN A;  3DZT A;  4GGF C;  1OW4 A;  2FJU B;  1KFU L;  2EC6 C;  4Q04 A;  1X02 A;  3KO0 A;  4JKT A;  2WOR A;  4USL A;  2QDI A;  1M39 A;  5AAN A;  1WY9 A;  1F70 A;  2BEC A;  2GTE A;  1S6J A;  3SG7 A;  3SS4 A;  1CKK A;  1CDN A;  2O5G A;  4OVN F;  1TNQ A;  2WCJ A;  3E3R A;  1TIZ A;  4MBE A;  2BKH B;  1IQ5 A;  2KFG A;  2WCB A;  3NSO A;  4TNC A;  1XK4 C;  2RGI A;  5B8I B;  2L98 A;  4GGN A;  3NGV A;  1LVC D;  1NSH A;  1T14 A;  2M29 A;  3WNX B;  1AK8 A;  4ORB B;  3PAT A;  1JFK A;  1S6C A;  1BT6 A;  3IF7 A;  1ORG A;  4AQJ A;  1PK0 D;  1PVB A;  3ZNI A;  4CFQ A;  1RFJ A;  4P2Y B;  1K9U A;  2LUC A;  1UWO A;  2SCP A;  5J3X A;  2JXL A;  1C3Y A;  2BE4 A;  4HSZ A;  4PE7 A;  1NUB A;  3TUY B;  3CR5 X;  2L2E A;  1SCV A;  3D73 A;  5FYX A;  2K2A A;  2PMY A;  3I5G B;  2I18 A;  1R2U A;  2I7A A;  2LM5 A;  2ZRS A;  3BFB A;  1J1E A;  1PSB A;  1DGV A;  5AER A;  1BMO A;  3S0A A;  1G33 A;  4I5N B;  4YGC B;  5I2O A;  4E68 A;  5HLV A;  4MZK A;  3FWB A;  1TNW A;  2LHI A;  4JWQ A;  4HRH A;  4PHK A;  2BCA A;  4I5J A;  1DVI A;  3PFV A;  1QWV A;  2L2C A;  2WC5 A;  2ZND A;  5GQQ C;  3R72 A;  3SS5 A;  1CTR A;  3L4L A;  1Z2C B;  1BG1 A;  1BOD A;  1V1F A;  1SSE B;  2CT9 A;  2JTT A;  2KAY A;  3DD4 A;  4A4C A;  2MA2 A;  1Z4H A;  1NX3 A;  2ISD A;  2EHB A;  1ZOT B;  1NCY A;  3FE9 A;  1N2D A;  1AJ4 A;  5DIC A;  1LS8 A;  1SBJ A;  1YRU B;  1OMV A;  4KYN A;  3LK1 A;  2IS9 A;  3DVM A;  1TCO B;  1A03 A;  2FJY A;  3PM2 A;  1DC1 A;  2K61 A;  2E6W A;  2LAP A;  2F33 A;  3WXA A;  1DJZ A;  1EJ3 A;  3K1E A;  5DKQ A;  1NCZ A;  1KSM A;  2K0J A;  2LVI A;  4QJ4 B;  3I5G C;  1CLM A;  1MF8 B;  1VRK A;  3IVT A;  3O6B A;  5FI7 A;  3DVJ A;  2JWW A;  4YGB B;  2VRG A;  5F6T A;  4DRW A;  1B7T Y;  1QS7 A;  2WCE A;  2KGR A;  5BPJ A;  4C0J A;  2PVB A;  2M7L A;  1F71 A;  1IIO A;  2H61 C;  4MLW A;  1NX2 A;  3OB2 B;  1U5I A;  3VRP A;  1Q80 A;  5DKN A;  4DCK A;  3VRO A;  1RRO A;  1XFU O;  3TDU A;  1B7T Z;  1OE9 B;  1N65 A;  1M31 A;  2PYQ A;  3NSL A;  3TDZ A;  2KYC A;  1ODB A;  3SS3 A;  1F55 A;  1MXE A;  4N1G A;  1HQV A;  3DYE A;  3GK4 X;  1CNP A;  4MRY A;  1YTZ C;  4ZCV A;  3SJS A;  3DVK A;  2I94 A;  5HKZ A;  2JT3 A;  4NQG A;  4HRE E;  1A75 A;  1MWN A;  2L4H A;  2WCF A;  2OS8 B;  2M3W A;  2GGM A;  3I5F B;  1LA0 A;  2LLS A;  4NDC A;  3VRR A;  4MZL A;  5FI2 A;  2EC6 B;  4F0Z B;  3I5I B;  3QME A;  1KWO C;  5ER4 X;  2M97 A;  2QEO A;  1TNP A;  1WLM A;  4DIR A;  2K2F A;  3BQ3 A;  4YGE B;  1YUU A;  1HT9 A;  1NX0 A;  1IRJ A;  1KSO A;  1OQP A;  3BUO B;  1KQM B;  1XFW O;  2BBM A;  2JTZ A;  3EK7 A;  1J55 A;  1DEL A;  5DKR A;  4A4B A;  2HQW A;  4PE1 A;  3LL8 B;  4PHJ A;  1TOP A;  1B4C A;  4INW A;  1QAT A;  3B87 A;  1FBV A;  1QXP A;  4D1E A;  3BOW B;  3D76 A;  3AKB A;  3RM1 A;  2ERB A;  2CBL A;  2F8P A;  1TRF A;  3PN7 C;  3JTD B;  1IJ5 A;  3O4Y A;  3OBV A;  1FPW A;  4YBH B;  3D75 A;  2KDH A;  2MLE C;  1ALV A;  4CLN A;  2I2R E;  1NX1 A;  2CNP A;  1JSA A;  2Q4U A;  2F3Y A;  4PAL A;  2OPO A;  1UP5 A;  2MJW B;  3OP0 A;  3R1V A;  3I5F C;  3LK0 A;  4CPV A;  2GV5 A;  2V53 A;  3OGN A;  3I5I C;  1CDL A;  1GQM A;  5HKW A;  1DJX A;  3V2L A;  1CMG A;  3GK2 A;  5KTY A;  1K96 A;  2KI6 C;  3CZT X;  4IL1 A;  1YVH A;  3S0B A;  3AAJ A;  4PHN A;  1KQM C;  3H4S E;  1OOF A;  1YUR A;  3UNW A;  1WRL A;  2WND A;  2QAC A;  1B8C A;  3PSR A;  2L50 A;  3A8R A;  1SPY A;  2K7C A;  1YUS A;  2ZN8 A;  4AOM A;  1OMD A;  2KHN A;  1CDM A;  3CYZ A;  4MRX A;  3JTD C;  1MQ1 A;  2M49 B;  1H8B A;  1C7V A;  1YX8 A;  5AFP A;  1NYA A;  2KYF A;  3BUW B;  1Y1U A;  1YRT B;  1K9K A;  3BXK A;  1J1D A;  1NWD A;  1L2O B;  1RJV A;  1GGZ A;  3AKA A;  3S0F A;  1TUJ A;  1SMG A;  1C7W A;  2Y1N A;  3MSE B;  3SG5 A;  1FI6 A;  1DF0 A;  5CSN A;  4YRU A;  1S26 D;  1LKJ A;  3L47 A;  2K60 A;  1AP4 A;  1KQV A;  2KAX A;  1BOC A;  1OOJ A;  1BJF A;  5I94 A;  2JZI A;  3I5H B;  1ZAC A;  4PCW A;  1CFC A;  3DXL A;  4PHM A;  2PQL A;  2LAN A;  1R6P A;  3EVU A;  1Y1A A;  3VRN A;  1GJY A;  2JRF A;  2A4J A;  2PAL A;  3EKH A;  2KNE A;  1SW8 A;  1OSA A;  2KBM A;  2P71 A;  1CFD A;  4MEW A;  1DTL A;  5HLO A;  1S1E A;  2LP2 A;  3EVV A;  1JC2 A;  4YGD B;  2BNX A;  1AVS A;  1G8I A;  2GGZ A;  2K7O A;  3QRX A;  1BR4 B;  3LLE A;  5K89 A;  1S6I A;  1J7Q A;  1MUX A;  1UHH A;  1SL9 A;  1B1G A;  2L5X B;  3D10 A;  1UUR A;  3PJI A;  2FCD A;  1SYM A;  2M1U A;  4AQI A;  3JVT B;  4WQ3 A;  1L2O C;  2ZKM X;  2AAO A;  2ZNE A;  2JQ6 A;  2HQ8 A;  2EGD A;  2DOQ A;  1CM4 A;  2QEB A;  2K8M B;  3L4A A;  1EG4 A;  1IWQ A;  4MVF A;  1G4Y R;  1L7Z A;  1NIW A;  1KWO B;  2LLT A;  1C3Z A;  2KI6 D;  4N1F A;  1P28 A;  1S36 A;  3D77 A;  3IQQ A;  2M8U A;  1F4Q A;  3I5H C;  1WRZ A;  2WCK A;  2YGU A;  3NSK A;  4DUQ A;  1LIN A;  1AUI B;  1TWO A;  4YI9 A;  5I2Q A;  1TTX A;  2Y1M A;  4XJK B;  4ORA B;  1JBA A;  1OZO A;  1WLZ A;  3EVR A;  1SNL A;  2CCM A;  3HX4 A;  4C0L A;  2LCP A;  1M45 A;  1QX7 A;  1JWD A;  3D0Y B;  4XYN A;  1OOH A;  2KOT A;  2KQY A;  2CTN A;  3EG5 B;  2MRD A;  3EKJ A;  4FQO A;  3PN7 B;  1DJG A;  3SIA A;  2BBN A;  3BUM B;  1A4P A;  4YGA A;  3OB1 B;  5JJG A;  1KFX L;  4WRI A;  3BFH A;  1YR5 A;  1QJT A;  2JPO A;  3JVT C;  4PT1 A;  5ER5 A;  1ALW A;  4M2O A;  1NPQ A;  4GGF A;  2B1U A; 
#chains in the Genus database with same CATH homology
 1DJH A;  2HET A;  2COL B;  2WC8 A;  4GUK A;  3BUX B;  5HKY A;  5CSF A;  1YUT A;  3OX5 A;  1FI5 A;  2G2B A;  1B47 A;  2LMU A;  3PAL A;  1LXF C;  2L4I A;  3NXA A;  3ICB A;  2JU0 A;  1CDP A;  1CMF A;  3SIB A;  1NP8 A;  4P5O E;  4BY5 A;  1SY9 A;  3PM8 A;  4M2P A;  1XK4 A;  1XA5 A;  5CPV A;  2F2O A;  1IQ3 A;  2LLU A;  3DF0 A;  1SCM B;  1OMR A;  1ZUZ A;  1QIW A;  4PE4 A;  5TNC A;  2MBX A;  3C1V A;  1KFX S;  1XVJ A;  3KHE A;  2LV7 A;  3SG4 A;  1QVI Y;  2K7D A;  2ZFD A;  4JQ0 D;  1CLB A;  2JT8 A;  1S5G Y;  1D1O A;  1V1G A;  4NDD A;  3CLN A;  1SKT A;  4GNK B;  3TS5 C;  1FW4 A;  2PRU A;  1QVI Z;  1JUO A;  1M46 A;  1DJY A;  1MHO A;  2KAV A;  3AAK A;  4ICB A;  4CFR A;  1BF5 A;  1DMO A;  1WDC B;  2JC2 A;  2KBI A;  5IBW A;  2JUL A;  4PE0 A;  1QIV A;  3OHM B;  1IH0 A;  2AUC A;  1QX5 B;  2QPT A;  4ETO A;  1UUS A;  2D8N A;  2KI4 C;  4M2Q A;  1K93 D;  2BKI B;  1XYD A;  1K90 D;  2NLN A;  3DVE A;  1Y0V H;  1ZFS A;  1CM1 A;  1QLK A;  2JNF A;  3M0W A;  4ORC B;  5KU1 A;  1SCM C;  3BYA A;  5D69 A;  1UHK A;  4GAO A;  3HCM A;  4QJ5 B;  5I2L A;  4UPG A;  1DJI A;  1TCF A;  1AJ5 A;  2JNX A;  5PAL A;  2MAZ A;  3GOF A;  4C0K A;  1J7O A;  2JT0 A;  1J7P A;  1JFJ A;  1CFF A;  1GGW A;  1EG3 A;  1N0Y A;  2HF5 A;  5I8N A;  1REC A;  2L51 A;  4GFT A;  1TN4 A;  3CWG A;  3SG6 A;  3ZWH A;  1K9P A;  3GK1 A;  2LMT A;  1WDC C;  1QX2 A;  1CFP A;  1PVA A;  1PUL A;  2H61 A;  3KPX A;  1XO5 A;  2LC5 A;  4N5X A;  1IKU A;  1RWY A;  1K94 A;  1YVL A;  1EL4 A;  1W7J B;  3WHU B;  2BCX A;  1NCX A;  2H2K A;  2KGB C;  3SG3 A;  1SR6 C;  3NSI A;  5JOL A;  2E30 A;  2M1K B;  1J7R A;  1OZS A;  1IG5 A;  3O78 A;  2JPT A;  1B9A A;  1KFU S;  3CGA A;  1DF0 B;  2NCP A;  1JF2 A;  1JF0 A;  1KK7 Y;  3BUN B;  3F45 A;  3CTN A;  2LUX A;  4L9M A;  3WHT B;  1FF1 A;  1F8H A;  2NCO A;  1XFV O;  1RK9 A;  1C07 A;  1B8R A;  2MHH A;  4HRG A;  2LE9 B;  1B8L A;  2P6B B;  2WOS A;  4MSP A;  1KK7 Z;  1QLS A;  2M0R A;  5KSZ A;  1XFY O;  1Y1X A;  2PAS A;  1EH2 A;  1UHN A;  3CR2 A;  4U8D A;  2BE6 A;  1SL7 A;  4I5K A;  4XJK A;  1DT7 B;  3FS7 A;  2OTG B;  2R2I A;  3RLZ A;  1S3P A;  1BU3 A;  3TZ1 A;  4OCI A;  1SL8 A;  3D0Y A;  1QV1 A;  1RTP 1;  3A4U B;  2L0P A;  2MLF C;  3IQO A;  3TUY C;  3FIA A;  3PLF B;  4WQ2 A;  4MZJ A;  2KFH A;  2ZRT A;  3O2P A;  1F4O A;  1UHJ A;  5AXI A;  3CS1 A;  4DS7 A;  5HYD A;  1EXR A;  1KK8 B;  1YX7 A;  2Y4Q A;  1A29 A;  1H4B A;  4FTG A;  1IGV A;  2LNK A;  3TS5 B;  2LHL A;  1SRA A;  2O60 A;  2LVV A;  2HPS A;  1SK6 D;  1U5I B;  2AMI A;  3EK8 A;  1ZMZ A;  5G08 A;  2F2P A;  4YI8 A;  2SAS A;  1BLQ A;  2KQ6 A;  3LCP C;  2JOJ A;  2PSR A;  1WRK A;  1DJW A;  1QTX A;  1QV0 A;  2OTG C;  3VRQ A;  2KI4 B;  1A2X A;  4NDB A;  4GBA A;  1IJ6 A;  4OV2 A;  2KFF A;  3BOW A;  2CXJ A;  1K2H A;  5CSJ A;  1LA3 A;  2BL0 B;  2BCB A;  1TNX A;  1A75 B;  3TDI A;  1CB1 A;  1MXL C;  3K21 A;  3EK4 A;  5D7F A;  4OKH A;  4OR9 B;  3VGO A;  1UHI A;  3SG2 A;  2Y5I A;  4CID A;  1XFZ O;  2NXQ A;  4BY4 A;  1DGU A;  4I5L B;  4R1E A;  1PAL A;  2TN4 A;  1KK8 C;  1F54 A;  2LMV A;  2LVK A;  1PSR A;  5AEQ A;  2NZ0 A;  1Y6W A;  2F3Z A;  1XFX O;  2KSP A;  3FWC A;  4GPL B;  2K7B A;  1S5G Z;  2Q91 A;  3KF9 A;  3DF0 B;  4JPZ B;  2ZN9 A;  1AHR A;  3OX6 A;  4PDZ A;  1CLL A;  1E8A A;  1M63 B;  5CSI A;  1PRW A;  1W7I B;  2M7N A;  1MR8 A;  4MN0 A;  2LVJ A;  1BR1 B;  4QJ3 B;  1K95 A;  2JXC A;  2LP3 A;  1QAS A;  2FOT A;  2G9B A;  1SR6 B;  2M9G A;  1KCY A;  3CR4 X;  2FCE A;  2BL0 C;  3KEV A;  1K8U A;  4ZCU A;  2OS8 C;  4GGF C;  2FJU B;  1KFU L;  2EC6 C;  4Q04 A;  1X02 A;  3KO0 A;  2WOR A;  4USL A;  1M39 A;  5AAN A;  1WY9 A;  1F70 A;  2BEC A;  1S6J A;  3SG7 A;  1CKK A;  1CDN A;  2O5G A;  4OVN F;  1TNQ A;  3E3R A;  1TIZ A;  4MBE A;  2BKH B;  1IQ5 A;  2KFG A;  2WCB A;  3NSO A;  4TNC A;  1XK4 C;  2RGI A;  5B8I B;  2L98 A;  4GGN A;  1LVC D;  1NSH A;  2M29 A;  3WNX B;  1AK8 A;  4ORB B;  3PAT A;  1JFK A;  1S6C A;  1BT6 A;  3IF7 A;  4AQJ A;  1PK0 D;  1PVB A;  3ZNI A;  4CFQ A;  1RFJ A;  4P2Y B;  1K9U A;  2LUC A;  1UWO A;  2SCP A;  5J3X A;  2JXL A;  2BE4 A;  4HSZ A;  4PE7 A;  1NUB A;  3TUY B;  3CR5 X;  2L2E A;  1SCV A;  5FYX A;  2K2A A;  2PMY A;  3I5G B;  2I18 A;  1R2U A;  2I7A A;  2LM5 A;  2ZRS A;  1J1E A;  1PSB A;  1DGV A;  5AER A;  1BMO A;  1G33 A;  4I5N B;  4YGC B;  5I2O A;  4E68 A;  5HLV A;  4MZK A;  3FWB A;  1TNW A;  2LHI A;  4JWQ A;  4HRH A;  4PHK A;  2BCA A;  4I5J A;  1DVI A;  3PFV A;  2ZND A;  5GQQ C;  1CTR A;  1BG1 A;  1BOD A;  1V1F A;  2CT9 A;  2JTT A;  2KAY A;  3DD4 A;  4A4C A;  2MA2 A;  2ISD A;  1NX3 A;  2EHB A;  1ZOT B;  1NCY A;  1N2D A;  1AJ4 A;  1SBJ A;  1YRU B;  1OMV A;  3LK1 A;  2IS9 A;  3DVM A;  1TCO B;  1A03 A;  2K61 A;  2E6W A;  2LAP A;  2F33 A;  3WXA A;  1DJZ A;  1EJ3 A;  5DKQ A;  1NCZ A;  1KSM A;  2K0J A;  2LVI A;  4QJ4 B;  3I5G C;  1CLM A;  1MF8 B;  1VRK A;  1CFC A;  3O6B A;  3DVJ A;  2JWW A;  4YGB B;  2VRG A;  5F6T A;  4DRW A;  1B7T Y;  1QS7 A;  2WCE A;  2KGR A;  5BPJ A;  4C0J A;  2PVB A;  2M7L A;  1F71 A;  2H61 C;  4MLW A;  1NX2 A;  3OB2 B;  1U5I A;  3VRP A;  1Q80 A;  5DKN A;  4DCK A;  3VRO A;  1RRO A;  1XFU O;  3TDU A;  1B7T Z;  1OE9 B;  1N65 A;  1M31 A;  3NSL A;  3TDZ A;  2KYC A;  1ODB A;  1F55 A;  1MXE A;  4N1G A;  1HQV A;  3GK4 X;  1CNP A;  4MRY A;  1YTZ C;  4ZCV A;  3SJS A;  3DVK A;  2I94 A;  5HKZ A;  2JT3 A;  4NQG A;  4HRE E;  1A75 A;  1MWN A;  2L4H A;  2WCF A;  2OS8 B;  2M3W A;  2GGM A;  3I5F B;  1LA0 A;  2LLS A;  4NDC A;  3VRR A;  4MZL A;  2EC6 B;  4F0Z B;  3I5I B;  5ER4 X;  1KWO C;  2M97 A;  1TNP A;  1WLM A;  4DIR A;  2K2F A;  3BQ3 A;  4YGE B;  1YUU A;  1HT9 A;  1NX0 A;  1IRJ A;  1KSO A;  1OQP A;  3BUO B;  1KQM B;  1XFW O;  2BBM A;  2JTZ A;  3EK7 A;  1J55 A;  5DKR A;  4A4B A;  2HQW A;  4PE1 A;  3LL8 B;  4PHJ A;  1TOP A;  1B4C A;  1QAT A;  1FBV A;  1QXP A;  4D1E A;  3BOW B;  3RM1 A;  3AKB A;  2CBL A;  2F8P A;  1TRF A;  3PN7 C;  3JTD B;  1IJ5 A;  3O4Y A;  1FPW A;  4YBH B;  2KDH A;  2MLE C;  1ALV A;  4CLN A;  2I2R E;  1NX1 A;  2CNP A;  1JSA A;  2Q4U A;  2F3Y A;  4PAL A;  2OPO A;  1UP5 A;  2MJW B;  3OP0 A;  3I5F C;  3LK0 A;  4CPV A;  2GV5 A;  2V53 A;  3I5I C;  1CDL A;  1GQM A;  5HKW A;  1DJX A;  1CMG A;  3GK2 A;  5KTY A;  1K96 A;  2KI6 C;  3CZT X;  4IL1 A;  1YVH A;  3AAJ A;  4PHN A;  1KQM C;  3H4S E;  1YUR A;  1WRL A;  2WND A;  2QAC A;  1B8C A;  3PSR A;  2L50 A;  3A8R A;  1SPY A;  2K7C A;  1YUS A;  2ZN8 A;  4AOM A;  1OMD A;  2KHN A;  1CDM A;  4MRX A;  3JTD C;  1MQ1 A;  2M49 B;  1H8B A;  1C7V A;  1YX8 A;  5AFP A;  1NYA A;  2KYF A;  3BUW B;  1Y1U A;  1YRT B;  1K9K A;  3BXK A;  1J1D A;  1NWD A;  1L2O B;  1RJV A;  1GGZ A;  3AKA A;  1SMG A;  3SG5 A;  1C7W A;  2Y1N A;  3MSE B;  1FI6 A;  1DF0 A;  5CSN A;  4YRU A;  1S26 D;  1LKJ A;  1KQV A;  1AP4 A;  2KAX A;  1BOC A;  1OOJ A;  1BJF A;  2JZI A;  3I5H B;  1ZAC A;  4PCW A;  4PHM A;  2LAN A;  1R6P A;  3EVU A;  1Y1A A;  3VRN A;  1GJY A;  2JRF A;  2A4J A;  2PAL A;  3EKH A;  2KNE A;  1SW8 A;  1OSA A;  2KBM A;  4MEW A;  1CFD A;  1DTL A;  5HLO A;  1S1E A;  2LP2 A;  3EVV A;  1JC2 A;  4YGD B;  1AVS A;  1G8I A;  2GGZ A;  2K7O A;  3QRX A;  1BR4 B;  3LLE A;  5K89 A;  1S6I A;  1J7Q A;  1MUX A;  1UHH A;  1SL9 A;  1B1G A;  2L5X B;  3D10 A;  1UUR A;  2FCD A;  1SYM A;  2M1U A;  4AQI A;  3JVT B;  4WQ3 A;  1L2O C;  2ZKM X;  2AAO A;  2ZNE A;  2JQ6 A;  2HQ8 A;  2EGD A;  2DOQ A;  1CM4 A;  2K8M B;  4MVF A;  1EG4 A;  1IWQ A;  1G4Y R;  1L7Z A;  1NIW A;  1KWO B;  2LLT A;  2KI6 D;  4N1F A;  1S36 A;  3IQQ A;  2M8U A;  1F4Q A;  3I5H C;  1WRZ A;  3NSK A;  4DUQ A;  1LIN A;  1AUI B;  4YI9 A;  5I2Q A;  1TTX A;  2Y1M A;  4XJK B;  4ORA B;  1JBA A;  1OZO A;  1WLZ A;  3EVR A;  1SNL A;  2CCM A;  3HX4 A;  4C0L A;  2LCP A;  1M45 A;  1QX7 A;  1JWD A;  3D0Y B;  4XYN A;  2KOT A;  2KQY A;  2CTN A;  2MRD A;  3EKJ A;  4FQO A;  3PN7 B;  1DJG A;  3SIA A;  2BBN A;  3BUM B;  1A4P A;  4YGA A;  3OB1 B;  5JJG A;  1KFX L;  4WRI A;  1YR5 A;  1QJT A;  3JVT C;  5ER5 A;  1ALW A;  4M2O A;  1NPQ A;  4GGF A;  2B1U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...