1R2UA

Nmr structure of the n domain of trout cardiac troponin c at 30 c
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
89
structure length
89
Chain Sequence
MNDIYKAAVEQLTDEQKNEFKAAFDIFIQDAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords troponin C
publication title Effect of temperature on the structure of trout troponin C
pubmed doi rcsb
source organism Oncorhynchus mykiss
molecule tags Metal binding protein
total genus 21
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2003-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1r2uA00
2OS8B 2I7AA 5CSJA 1YX7A 1UHNA 4A4CA 2LUCA 3JTDC 1UURA 1S6JA 4I5LB 2M7LA 1QIWA 2CTNA 3PN7C 3IF7A 2JULA 4YGCB 2GGZA 4MZKA 1CB1A 1DJZA 2BKHB 4M2PA 1KWOC 2HPSA 2HQ8A 1NX0A 1DMOA 1SL9A 2WC8A 1A75B 2JT8A 2BCBA 3EKHA 5AFPA 1IH0A 2HQWA 1F4QA 1OZSA 3BUXB 2WORA 3TS5C 1SK6D 1SPYA 4F0ZB 2CNPA 1S26D 3VRQA 1LA0A 2K2FA 2LMUA 4MLWA 4CIDA 1K90D 3OB1B 1OZOA 1DJYA 1SMGA 2LLUA 1X02A 4GGFA 1KK8B 1BLQA 1FBVA 1SYMA 1QASA 2PALA 1NYAA 1TNPA 3CWGA 1R6PA 1CDLA 2M1UA 2OTGC 2M49B 1AVSA 2Y1MA 1Y1UA 2KNEA 1JC2A 2MHHA 3TDUA 2BCAA 4JWQA 2KFHA 3EVUA 1BODA 3PM8A 5I8NA 2FJUB 3EKJA 4JQ0D 1BJFA 4NQGA 4PHNA 1K9KA 2KQ6A 3RLZA 1WRLA 5I2QA 1TCOB 4XJKA 2E30A 4QJ3B 1CDPA 1OMVA 2KGRA 1DT7B 2BKIB 1EG4A 3OX6A 1PK0D 5I2LA 5GQQC 2PVBA 2M3WA 1EH2A 2D8NA 2DOQA 1A4PA 1AHRA 2ZN8A 1S6IA 3PLFB 3A8RA 3WHUB 4YGEB 4PHKA 1A03A 2JQ6A 1XFUO 3BOWA 3I5GC 3JTDB 4GGFC 1DJWA 4L9MA 4PHMA 2KI4C 1TNQA 1EXRA 1TNXA 2L98A 3PN7B 2KAVA 2Q4UA 2KFFA 1XFVO 2QACA 4YGBB 1KWOB 5IBWA 4OCIA 3E3RA 4MEWA 3QRXA 1QIVA 2KAXA 3SG6A 1QV0A 2ZNDA 5K89A 3VRNA 1B7TY 1UHKA 1TTXA 3EVRA 2VRGA 1NP8A 2LLTA 3TS5B 2LUXA 1F55A 1YTZC 1YURA 3VRRA 1WDCC 1ZFSA 2LNKA 3IQQA 3M0WA 4C0JA 1IJ6A 1J7PA 1S1EA 1VRKA 3I5HB 4AOMA 1PALA 2CCMA 1MXLC 2KSPA 1DGUA 2AMIA 1S6CA 3AKBA 1IRJA 2I18A 4PE4A 4GGNA 3TUYC 2OTGB 1IGVA 1UHIA 2CBLA 1SR6B 1B4CA 1JF2A 1YVHA 4IL1A 2H61C 1JUOA 1KK7Y 3BQ3A 3DVJA 1QVIZ 1KQMC 1J7OA 1CKKA 1CMGA 2L5XB 1JFKA 3GK4X 1NX2A 2WCFA 4P5OE 1XYDA 2F33A 5AANA 1NSHA 1DF0A 2GGMA 1IJ5A 3VGOA 2Y5IA 4MRXA 1XFXO 1JFJA 1S5GY 3GOFA 3KO0A 1G33A 1QX2A 1DJIA 1GQMA 3DVKA 1U5IB 5JJGA 3NSLA 3A4UB 2JPTA 5TNCA 4ORBB 2MBXA 1H8BA 4CFRA 1ZACA 2CXJA 2FOTA 2LP3A 2NZ0A 1NWDA 1SCVA 1PULA 2O5GA 3EK7A 3WHTB 1NUBA 2JZIA 1IWQA 1FI5A 2KI4B 2BBNA 2LCPA 4YRUA 4M2OA 3FIAA 3LCPC 2LVJA 4D1EA 1G4YR 2RGIA 5F6TA 5FYXA 1OQPA 2R2IA 1B8LA 1FI6A 3TZ1A 1U5IA 2I94A 3PATA 1NPQA 4BY4A 4N1FA 1PSBA 1XK4C 2HF5A 2BE6A 3FWCA 1K95A 1SL8A 2JRFA 1K94A 3I5FC 2WNDA 4MRYA 4I5KA 1MUXA 5HLOA 3GK2A 3KF9A 3TDZA 1PSRA 4OKHA 4UPGA 1SCMC 2ZFDA 4PDZA 1WDCB 4XJKB 1A2XA 1MXEA 1QV1A 2HETA 1KFUS 3NXAA 5CPVA 2JT0A 1QLKA 3O2PA 4YI9A 1RROA 2JU0A 2ZRTA 1JBAA 2LV7A 4YGAA 2F2PA 3AAKA 1JSAA 1DTLA 3TUYB 3O6BA 1CM1A 2L0PA 4GPLB 3BYAA 1QLSA 2BL0B 4HRHA 2EGDA 3CTNA 5JOLA 3BOWB 4ORCB 5DKRA 1IQ3A 2LVKA 4HSZA 2LE9B 2O60A 1AJ4A 2LMTA 3DVEA 2I2RE 4OV2A 2A4JA 3HX4A 5J3XA 3VROA 4PHJA 1L7ZA 4Q04A 1LKJA 5CSFA 1WRKA 3VRPA 1B8RA 1XFZO 3LLEA 2BCXA 5HKWA 2EC6C 2WCBA 1BR4B 3LL8B 3AKAA 1MHOA 1W7IB 3ZNIA 2MRDA 4WQ2A 1F70A 1M46A 2H61A 2JTZA 4CFQA 1CLMA 3FS7A 4GFTA 4HREE 2NCOA 2WCEA 3PSRA 1CDNA 5HKZA 1EL4A 2LMVA 5I2OA 3ZWHA 1GJYA 5BPJA 4WRIA 1R2UA 1BF5A 2ZN9A 4PALA 5HYDA 4I5JA 4M2QA 1RWYA 2KI6C 2QPTA 1OE9B 1KSOA 1WLMA 2LM5A 4E68A 3IQOA 5HLVA 2KOTA 1IQ5A 1LXFC 3CS1A 1CLLA 3O78A 3KPXA 1M39A 2KQYA 1XO5A 5KTYA 2Y4QA 1N65A 1YUSA 4ICBA 1UWOA 4DCKA 3BUOB 4NDDA 2KGBC 1BT6A 3SIBA 1SBJA 2G2BA 1DJGA 1MQ1A 5PALA 3BUMB 5ER4X 1J1EA 2K7CA 1DF0B 2JC2A 3MSEB 1Y0VH 3SG7A 2WOSA 1NIWA 4GBAA 1J55A 1DVIA 1TCFA 2KAYA 2LVIA 1QS7A 4P2YB 1KFXS 1AUIB 2K0JA 2M0RA 1V1GA 4WQ3A 1WLZA 2FCDA 2KBIA 3D10A 4USLA 5D69A 1OMDA 4GUKA 1AK8A 2K2AA 1XVJA 2JNXA 4YI8A 1YRUB 2G9BA 3SG2A 4R1EA 1XK4A 2F3ZA 3TDIA 1L2OC 1CFFA 1BOCA 2KBMA 1MWNA 1NX3A 3D0YA 3NSIA 4FTGA 3F45A 1KK8C 1FW4A 1M31A 3DVMA 1KFUL 3DF0A 1CFDA 1J1DA 1CFPA 2JT3A 1K93D 1YUTA 1UHHA 1Q80A 2EHBA 1ODBA 3SJSA 1AP4A 1ZMZA 4GNKB 2P6BB 1QVIY 2EC6B 2JXLA 2Q91A 1TRFA 1Y6WA 1W7JB 4U8DA 2KI6D 4DIRA 1K8UA 2PSRA 2IS9A 3I5GB 2PASA 2JTTA 1F4OA 2KFGA 5CSNA 1XFYO 4TNCA 1BR1B 3OHMB 1F8HA 1QXPA 1UP5A 1E8AA 3LK1A 2PMYA 1SNLA 3PFVA 5DKNA 1HQVA 2F3YA 1AJ5A 1B47A 1F54A 1QATA 1K2HA 1V1FA 2MAZA 4OVNF 1TNWA 1RTP1 2NCPA 1OSAA 1IG5A 5G08A 1G8IA 2MLFC 3KEVA 3JVTC 3O4YA 4MBEA 1ZOTB 5KU1A 1OOJA 1XA5A 2F2OA 2ZNEA 2JNFA 2KYFA 1NCYA 2K7BA 4YBHB 1IKUA 4N5XA 1UHJA 2K7OA 1C7WA 1B1GA 2MA2A 4XYNA 1JWDA 1D1OA 2SASA 1OMRA 2LVVA 4C0LA 1CFCA 1F71A 1DJXA 1TIZA 4ZCUA 3CZTX 1KQMB 1GGWA 1A29A 4I5NB 1EG3A 1L2OB 3OX5A 5HKYA 4MVFA 3NSKA 3I5HC 4FQOA 2M1KB 2JXCA 2BECA 2E6WA 2M29A 2KHNA 5AEQA 1FF1A 2BBMA 1PRWA 1YUUA 2Y1NA 4NDCA 1MR8A 2L51A 2KDHA 1RK9A 2MLEC 2CT9A 1KFXL 1SRAA 2M97A 1DJHA 1NX1A 1SR6C 2TN4A 1A75A 3LK0A 1ALVA 4AQIA 2ZKMX 1MF8B 1QJTA 2L2EA 5B8IB 2H2KA 1UUSA 1K96A 2L4HA 2M9GA 3HCMA 2LHIA 1CNPA 1LINA 2AAOA 3SG5A 4N1GA 1CLBA 1EJ3A 1TN4A 1YVLA 4CPVA 4DS7A 1KCYA 2ISDA 3FWBA 1LVCD 2K8MB 2F8PA 1K9PA 1CTRA 1N0YA 1SKTA 1FPWA 4JPZB 3BUNB 4ORAB 5KSZA 5CSIA 4NDBA 2AUCA 3H4SE 2BE4A 1DGVA 1S36A 3I5IC 1B9AA 1CM4A 2JOJA 4QJ5B 2PRUA 2OS8C 1ALWA 1B7TZ 4AQJA 4MZLA 1YX8A 3SIAA 2ZRSA 3I5FB 3AAJA 4DUQA 1SW8A 1J7QA 3EK4A 1QX5B 1SCMB 1XFWO 3D0YB 3JVTB 2L4IA 4PE0A 2GV5A 4PE1A 5DKQA 1SY9A 2LP2A 1CDMA 3EVVA 3ICBA 3DD4A 3BUWB 3DF0B 4PCWA 2LHLA 3CR2A 1NCZA 4DRWA 1M45A 1BG1A 4ETOA 2LLSA 3CR4X 2COLB 1CMFA 5AXIA 1S3PA 4YGDB 1C07A 4GAOA 1WY9A 1YRTB 2KYCA 1KK7Z 1RFJA 4ZCVA 3SG3A 3EK8A 4QJ4B 1KSMA 1H4BA 1K9UA 2JWWA 2LAPA 1RECA 1C7VA 1BU3A 2K61A 5AERA 1TOPA 3GK1A 1J7RA 3SG4A 4A4BA 1PVAA 3WNXB 4CLNA 3PALA 1B8CA 1RJVA 4C0KA 1LA3A 1KQVA 1WRZA 1Y1XA 1S5GZ 3WXAA 3CGAA 1M63B 1Y1AA 2LANA 1SL7A 2BL0C 3KHEA 2M8UA 2NXQA 2L50A 3NSOA 4HRGA 5ER5A 3BXKA 1NCXA 4BY5A 5D7FA 1ZUZA 3CLNA 2MJWB 4MN0A 2FCEA 2K7DA 3C1VA 4MZJA 4PE7A 1QX7A 2M7NA 3CR5X 4MSPA 2LC5A 2NLNA 2OPOA 1GGZA 2SCPA 1N2DA 2B1UA 2V53A 3OB2B 1YR5A 1PVBA 3K21A 1JF0A 1QTXA 3RM1A 3I5IB 1BMOA 1HT9A 3OP0A 4OR9B
chains in the Genus database with same CATH superfamily
2OS8B 2I7AA 5CSJA 1YX7A 1UHNA 4A4CA 2LUCA 3JTDC 2BNXA 1UURA 1S6JA 4I5LB 2M7LA 1QIWA 2CTNA 3PN7C 3IF7A 2JULA 4YGCB 3DXLA 2GGZA 4MZKA 1CB1A 1DJZA 2BKHB 4M2PA 1KWOC 2HPSA 2HQ8A 1NX0A 1DMOA 1SL9A 2WC8A 1A75B 2JT8A 2BCBA 3EKHA 5AFPA 1IH0A 2HQWA 1F4QA 2QEVA 1OZSA 3BUXB 2WORA 3TS5C 1SK6D 1SPYA 2L2CA 4F0ZB 2CNPA 1S26D 3VRQA 1LA0A 2K2FA 2LMUA 4MLWA 4CIDA 1K90D 3OB1B 1OZOA 1DJYA 1SMGA 2LLUA 2WCJA 2GTEA 1X02A 4GGFA 1KK8B 1BLQA 1P28A 1FBVA 1SYMA 1QASA 2PALA 2YGUA 1NYAA 1TNPA 3CWGA 1R6PA 1CDLA 2M1UA 3PM2A 2OTGC 2M49B 1AVSA 5FI7A 2Y1MA 1Y1UA 2KNEA 1JC2A 2MHHA 5PALA 3TDUA 2BCAA 4JWQA 2KFHA 3S0AA 3EVUA 1BODA 3PM8A 5I8NA 2FJUB 3EKJA 3QMEA 4JQ0D 1BJFA 4NQGA 2PYQA 4PHNA 1K9KA 3FE9A 3S0BA 2KQ6A 3RLZA 1WRLA 5I2QA 3EG5B 1TCOB 4XJKA 2E30A 4QJ3B 3L4AA 1CDPA 3N7HA 1OMVA 2KGRA 1DT7B 3R1VA 2BKIB 1EG4A 3OX6A 1PK0D 5I2LA 5GQQC 2PVBA 2M3WA 1EH2A 2D8NA 2DOQA 1A4PA 1AHRA 3B86A 2ZN8A 1S6IA 3PLFB 3A8RA 3WHUB 4YGEB 3SS5A 4PHKA 1A03A 2JQ6A 1XFUO 3BOWA 3I5GC 3JTDB 4GGFC 1DJWA 4L9MA 4PHMA 2KI4C 1TNQA 1EXRA 1TNXA 2L98A 3PN7B 2KAVA 2Q4UA 2KFFA 1XFVO 2QACA 4YGBB 1KWOB 5IBWA 4OCIA 3E3RA 4MEWA 3QRXA 1QIVA 2KAXA 3SG6A 1QV0A 2ZNDA 5K89A 3VRNA 1B7TY 1UHKA 1TTXA 3EVRA 2VRGA 1NP8A 2LLTA 3TS5B 2LUXA 1F55A 1Z2CB 1YTZC 1YURA 3VRRA 1WDCC 1ZFSA 2LNKA 3IQQA 3M0WA 4C0JA 1IJ6A 2WCLA 1J7PA 1S1EA 1VRKA 3I5HB 4AOMA 1PALA 2CCMA 1MXLC 2KSPA 1DGUA 2AMIA 1S6CA 3AKBA 1IRJA 2I18A 4PE4A 4GGNA 3TUYC 2OTGB 1IGVA 1UHIA 2CBLA 1SR6B 1B4CA 1JF2A 1YVHA 3CZ2A 4IL1A 2H61C 1JUOA 1KK7Y 3BQ3A 3DVJA 1QVIZ 1KQMC 1J7OA 1CKKA 1CMGA 2L5XB 1JFKA 3GK4X 1NX2A 2WCFA 4P5OE 5HLOA 1XYDA 2F33A 5AANA 1NSHA 1DF0A 2GGMA 1IJ5A 3VGOA 5I94A 2Y5IA 4MRXA 1XFXO 1JFJA 1S5GY 3GOFA 3KO0A 1G33A 1QX2A 3RZSA 1DJIA 1GQMA 3DVKA 3UNWA 1U5IB 5JJGA 3NSLA 3A4UB 2JPTA 5TNCA 4ORBB 2MBXA 3BFAA 1H8BA 3S0EA 4CFRA 1ZACA 5EL2A 2CXJA 2P70A 2FOTA 3PJIA 2LP3A 2NZ0A 1NWDA 1SCVA 1PULA 2O5GA 3EK7A 3WHTB 1NUBA 2JZIA 1IWQA 3V2LA 2KI4B 1FI5A 2BBNA 2LCPA 4YRUA 4M2OA 3FIAA 3LCPC 2LVJA 3B6XA 4D1EA 1G4YR 2RGIA 5F6TA 5FYXA 1OQPA 2R2IA 1B8LA 1FI6A 2K60A 3TZ1A 1U5IA 2I94A 3PATA 1NPQA 4BY4A 4N1FA 1PSBA 1XK4C 2HF5A 2BE6A 3FWCA 1K95A 1SL8A 2JRFA 1K94A 3BFHA 2WNDA 3I5FC 1TWOA 1MUXA 4I5KA 3GK2A 3KF9A 3TDZA 1PSRA 4OKHA 3BJHA 1SCMC 2ZFDA 4PDZA 4UPGA 1WDCB 4XJKB 1A2XA 1MXEA 1QV1A 2HETA 1KFUS 3NXAA 5CPVA 2JT0A 1QLKA 3O2PA 4YI9A 1RROA 2JU0A 1DELA 2ZRTA 2LV7A 4YGAA 2F2PA 3AAKA 1JBAA 1JSAA 1DTLA 2H8VA 3TUYB 3O6BA 1CM1A 2L0PA 4GPLB 3BYAA 3D74A 1QLSA 1C3YA 2BL0B 2KLDA 4HRHA 2EGDA 3CTNA 5JOLA 3BOWB 4ORCB 5DKRA 3S0GA 1IQ3A 3SS3A 2LVKA 4HSZA 2LE9B 2O60A 1AJ4A 2LMTA 3DVEA 3NGVA 2I2RE 4OV2A 2A4JA 3HX4A 5J3XA 3VROA 4PHJA 3FE6A 3O4XA 1L7ZA 4Q04A 4PT1A 1LKJA 2P71A 5CSFA 1WRKA 3VRPA 1B8RA 1XFZO 3CYZA 2BCXA 3LLEA 5HKWA 3UO9A 2EC6C 2WCBA 1BR4B 3LL8B 3AKAA 1MHOA 3B88A 4F7FA 1W7IB 3ZNIA 2MRDA 4WQ2A 1F70A 1M46A 2H61A 2JTZA 4CFQA 1CLMA 3FS7A 4GFTA 5DICA 4HREE 2NCOA 2WCEA 3PSRA 5FI6A 1CDNA 5HKZA 3S0FA 1EL4A 2LMVA 5I2OA 3ZWHA 1GJYA 5BPJA 4WRIA 1R2UA 1BF5A 2ZN9A 4PALA 5HYDA 4I5JA 4M2QA 1RWYA 2KI6C 2QPTA 1QWVA 1OE9B 3R72A 1KSOA 1WLMA 2LM5A 4E68A 3IQOA 1W9ZA 5HLVA 2KOTA 1IQ5A 1LXFC 3CS1A 1CLLA 3O78A 3KPXA 1OOHA 1M39A 2KQYA 1XFRA 1XO5A 3NHTA 2Y4QA 5KTYA 1N65A 1YUSA 4ICBA 1UWOA 4DCKA 3BUOB 4NDDA 2KGBC 1BT6A 3SIBA 1SBJA 2G2BA 1DJGA 1MQ1A 4INWA 3BUMB 5ER4X 1J1EA 2K7CA 1DF0B 2JC2A 3MSEB 1Y0VH 3SG7A 2WOSA 3IVTA 1NIWA 4GBAA 1J55A 1DVIA 1TCFA 3CDNA 2KAYA 2LVIA 1QS7A 4P2YB 3DZTA 1KFXS 1AUIB 2QEOA 2K0JA 2M0RA 1V1GA 4WQ3A 1WLZA 2FCDA 2KBIA 3D10A 4USLA 5D69A 1OMDA 4GUKA 1AK8A 2K2AA 4JD9A 1XVJA 2JNXA 4YI8A 1YRUB 2G9BA 3SG2A 4R1EA 1XK4A 2F3ZA 3TDIA 1L2OC 1CFFA 1BOCA 3R1PA 3OGNA 2KBMA 1MWNA 1NX3A 3D0YA 3NSIA 4FTGA 3F45A 1KK8C 1FW4A 1M31A 3DVMA 1KFUL 3DF0A 1CFDA 1TUZA 1J1DA 1CFPA 1GM0A 2JT3A 2WC5A 1K93D 1YUTA 1UHHA 1Q80A 2EHBA 5FI2A 3SS4A 1ODBA 3SJSA 1AP4A 1ZMZA 4GNKB 3K1EA 2P6BB 1QVIY 2EC6B 2JXLA 2Q91A 1TRFA 1Y6WA 1W7JB 4U8DA 2KI6D 3CABA 4DIRA 1K8UA 2PSRA 2IS9A 3I5GB 1ORGA 2JTTA 1F4OA 2KFGA 2PASA 5CSNA 1XFYO 4TNCA 1BR1B 3OHMB 1DQEA 1QXPA 1UP5A 1F8HA 3S0DA 1E8AA 3LK1A 3R1OA 2PMYA 1SNLA 3PFVA 5DKNA 1HQVA 2F3YA 1AJ5A 1B47A 1F54A 3FE8A 1QATA 1K2HA 2ERBA 2JPOA 2WCKA 1V1FA 2MAZA 4OVNF 1TNWA 1RTP1 2NCPA 1OSAA 1IG5A 2KPHA 5G08A 1G8IA 2MLFC 3KEVA 3JVTC 3B87A 3O4YA 4MBEA 1ZOTB 5KU1A 1OOJA 1XA5A 2F2OA 2ZNEA 2JNFA 2KYFA 1NCYA 2K7BA 2WCHA 4YBHB 1IKUA 1IIOA 4N5XA 1UHJA 4JKTA 2K7OA 1C7WA 1B1GA 2MA2A 4XYNA 1JWDA 2WCMA 1D1OA 3D77A 2SASA 1OMRA 4KYNA 2LVVA 4C0LA 1CFCA 1F71A 1DJXA 1TIZA 1SSEB 1OOGA 4ZCUA 3CZTX 2QEBA 2WC6A 1KQMB 4MRYA 1GGWA 1A29A 3D73A 1EG3A 4I5NB 1L2OB 3NHIA 3L4LA 3OX5A 1TUJA 5HKYA 4MVFA 3NSKA 3I5HC 4FQOA 2M1KB 2JXCA 2BECA 1OOIX 2E6WA 2KHNA 2M29A 5AEQA 1FF1A 2BBMA 1PRWA 1YUUA 2Y1NA 4NDCA 1MR8A 2L51A 2KDHA 1RK9A 2MLEC 2CT9A 1KFXL 1SRAA 2PQLA 2M97A 1DJHA 1NX1A 1SR6C 2TN4A 1A75A 3LK0A 1ALVA 4AQIA 2ZKMX 1MF8B 1QJTA 2L2EA 5B8IB 2H2KA 1UUSA 1K96A 4IJ7A 2L4HA 2M9GA 3DYEA 3HCMA 2QEHA 2KLEA 2LHIA 1CNPA 1LINA 2AAOA 3Q8IA 3SG5A 4N1GA 1CLBA 5D3OA 1EJ3A 1TN4A 1YVLA 4CPVA 4DS7A 1KCYA 2ISDA 3FWBA 1LVCD 2K8MB 2F8PA 1K9PA 1CTRA 1N0YA 1SKTA 1FPWA 4JPZB 3BUNB 4ORAB 5KSZA 3D78A 5CSIA 4NDBA 2AUCA 3H4SE 2BE4A 1DGVA 1S36A 3CZ0A 3I5IC 1B9AA 1CM4A 2JOJA 4QJ5B 1DEKA 2PRUA 2OS8C 1ALWA 1B7TZ 4AQJA 4MZLA 1YX8A 3SIAA 4OZDA 2ZRSA 3I5FB 3AAJA 4DUQA 1SW8A 1J7QA 3DY9A 3EK4A 1QX5B 1SCMB 1XFWO 3D0YB 3JVTB 2L4IA 4PE0A 2GV5A 4PE1A 5DKQA 1SY9A 2LP2A 1CDMA 3EVVA 3ICBA 3DD4A 3BUWB 3DF0B 4PCWA 2LHLA 1OW4A 3CR2A 1NCZA 4INXA 4DRWA 1M45A 1BG1A 3D76A 4ETOA 2LLSA 3CR4X 2COLB 1CMFA 5AXIA 2L5YA 1S3PA 4YGDB 1C07A 4GAOA 1WY9A 1YRTB 2KYCA 1KK7Z 1RFJA 4ZCVA 3SG3A 3EK8A 3D75A 1T14A 4QJ4B 1KSMA 1H4BA 1K9UA 2JWWA 2LAPA 2FJYA 1RECA 1C7VA 1BU3A 2K61A 5AERA 1TOPA 3GK1A 1J7RA 3SG4A 4A4BA 1PVAA 3WNXB 4CLNA 3PALA 1Z4HA 1B8CA 3CZ1A 1RJVA 4C0KA 3BFBA 1LA3A 1KQVA 1WRZA 1Y1XA 1S5GZ 3WXAA 1LS8A 3CGAA 1OOFA 2BAPA 1M63B 1Y1AA 2LANA 1SL7A 2BL0C 3KHEA 2M8UA 2NXQA 2L50A 3NSOA 4HRGA 3B7AA 5ER5A 3VB1A 3BXKA 1NCXA 4BY5A 5D7FA 1ZUZA 3CLNA 2MJWB 2QDIA 2FCEA 2K7DA 3C1VA 4MN0A 4MZJA 4PE7A 1QX7A 2M7NA 3CR5X 3OBVA 4MSPA 2LC5A 2NLNA 2OPOA 4FQTA 1GGZA 2SCPA 1N2DA 2B1UA 5HL1A 2V53A 3OB2B 1YR5A 1PVBA 3K21A 1JF0A 1C3ZA 1QTXA 3RM1A 3I5IB 1DC1A 3L47A 1BMOA 1HT9A 3OP0A 4OR9B
chains in the Genus database with same CATH topology
2OS8B 2I7AA 5CSJA 1YX7A 1UHNA 4A4CA 2LUCA 3JTDC 1UURA 1S6JA 4I5LB 2M7LA 1QIWA 2CTNA 3PN7C 3IF7A 2JULA 4YGCB 2GGZA 4MZKA 1CB1A 1DJZA 2BKHB 4M2PA 1KWOC 2HPSA 2HQ8A 1NX0A 1DMOA 1SL9A 2WC8A 1A75B 2JT8A 2BCBA 3EKHA 5AFPA 1IH0A 2HQWA 1F4QA 1OZSA 3BUXB 2WORA 3TS5C 1SK6D 1SPYA 4F0ZB 2CNPA 1S26D 3VRQA 1LA0A 2K2FA 2LMUA 4MLWA 4CIDA 1K90D 3OB1B 1OZOA 1DJYA 1SMGA 2LLUA 1X02A 4GGFA 1KK8B 1BLQA 1FBVA 1SYMA 1QASA 2PALA 1NYAA 1TNPA 3CWGA 1R6PA 1CDLA 2M1UA 2OTGC 2M49B 1AVSA 2Y1MA 1Y1UA 2KNEA 1JC2A 2MHHA 3TDUA 2BCAA 4JWQA 2KFHA 3EVUA 1BODA 3PM8A 5I8NA 2FJUB 3EKJA 4JQ0D 1BJFA 4NQGA 4PHNA 1K9KA 2KQ6A 3RLZA 1WRLA 5I2QA 1TCOB 4XJKA 2E30A 4QJ3B 1CDPA 1OMVA 2KGRA 1DT7B 2BKIB 1EG4A 3OX6A 1PK0D 5I2LA 5GQQC 2PVBA 2M3WA 1EH2A 2D8NA 2DOQA 1A4PA 1AHRA 2ZN8A 1S6IA 3PLFB 3A8RA 3WHUB 4YGEB 4PHKA 1A03A 2JQ6A 1XFUO 3BOWA 3I5GC 3JTDB 4GGFC 1DJWA 4L9MA 4PHMA 2KI4C 1TNQA 1EXRA 1TNXA 2L98A 3PN7B 2KAVA 2Q4UA 2KFFA 1XFVO 2QACA 4YGBB 1KWOB 5IBWA 4OCIA 3E3RA 4MEWA 3QRXA 1QIVA 2KAXA 3SG6A 1QV0A 2ZNDA 5K89A 3VRNA 1B7TY 1UHKA 1TTXA 3EVRA 2VRGA 1NP8A 2LLTA 3TS5B 2LUXA 1F55A 1YTZC 1YURA 3VRRA 1WDCC 1ZFSA 2LNKA 3IQQA 3M0WA 4C0JA 1IJ6A 1J7PA 1S1EA 1VRKA 3I5HB 4AOMA 1PALA 2CCMA 1MXLC 2KSPA 1DGUA 2AMIA 1S6CA 3AKBA 1IRJA 2I18A 4PE4A 4GGNA 3TUYC 2OTGB 1IGVA 1UHIA 2CBLA 1SR6B 1B4CA 1JF2A 1YVHA 4IL1A 2H61C 1JUOA 1KK7Y 3BQ3A 3DVJA 1QVIZ 1KQMC 1J7OA 1CKKA 1CMGA 2L5XB 1JFKA 3GK4X 1NX2A 2WCFA 4P5OE 1XYDA 2F33A 5AANA 1NSHA 1DF0A 2GGMA 1IJ5A 3VGOA 2Y5IA 4MRXA 1XFXO 1JFJA 1S5GY 3GOFA 3KO0A 1G33A 1QX2A 1DJIA 1GQMA 3DVKA 1U5IB 5JJGA 3NSLA 3A4UB 2JPTA 5TNCA 4ORBB 2MBXA 1H8BA 4CFRA 1ZACA 2CXJA 2FOTA 2LP3A 2NZ0A 1NWDA 1SCVA 1PULA 2O5GA 3EK7A 3WHTB 1NUBA 2JZIA 1IWQA 1FI5A 2KI4B 2BBNA 2LCPA 4YRUA 4M2OA 3FIAA 3LCPC 2LVJA 4D1EA 1G4YR 2RGIA 5F6TA 5FYXA 1OQPA 2R2IA 1B8LA 1FI6A 3TZ1A 1U5IA 2I94A 3PATA 1NPQA 4BY4A 4N1FA 1PSBA 1XK4C 2HF5A 2BE6A 3FWCA 1K95A 1SL8A 2JRFA 1K94A 3I5FC 2WNDA 4MRYA 4I5KA 1MUXA 5HLOA 3GK2A 3KF9A 3TDZA 1PSRA 4OKHA 4UPGA 1SCMC 2ZFDA 4PDZA 1WDCB 4XJKB 1A2XA 1MXEA 1QV1A 2HETA 1KFUS 3NXAA 5CPVA 2JT0A 1QLKA 3O2PA 4YI9A 1RROA 2JU0A 2ZRTA 1JBAA 2LV7A 4YGAA 2F2PA 3AAKA 1JSAA 1DTLA 3TUYB 3O6BA 1CM1A 2L0PA 4GPLB 3BYAA 1QLSA 2BL0B 4HRHA 2EGDA 3CTNA 5JOLA 3BOWB 4ORCB 5DKRA 1IQ3A 2LVKA 4HSZA 2LE9B 2O60A 1AJ4A 2LMTA 3DVEA 2I2RE 4OV2A 2A4JA 3HX4A 5J3XA 3VROA 4PHJA 1L7ZA 4Q04A 1LKJA 5CSFA 1WRKA 3VRPA 1B8RA 1XFZO 3LLEA 2BCXA 5HKWA 2EC6C 2WCBA 1BR4B 3LL8B 3AKAA 1MHOA 1W7IB 3ZNIA 2MRDA 4WQ2A 1F70A 1M46A 2H61A 2JTZA 4CFQA 1CLMA 3FS7A 4GFTA 4HREE 2NCOA 2WCEA 3PSRA 1CDNA 5HKZA 1EL4A 2LMVA 5I2OA 3ZWHA 1GJYA 5BPJA 4WRIA 1R2UA 1BF5A 2ZN9A 4PALA 5HYDA 4I5JA 4M2QA 1RWYA 2KI6C 2QPTA 1OE9B 1KSOA 1WLMA 2LM5A 4E68A 3IQOA 5HLVA 2KOTA 1IQ5A 1LXFC 3CS1A 1CLLA 3O78A 3KPXA 1M39A 2KQYA 1XO5A 5KTYA 2Y4QA 1N65A 1YUSA 4ICBA 1UWOA 4DCKA 3BUOB 4NDDA 2KGBC 1BT6A 3SIBA 1SBJA 2G2BA 1DJGA 1MQ1A 5PALA 3BUMB 5ER4X 1J1EA 2K7CA 1DF0B 2JC2A 3MSEB 1Y0VH 3SG7A 2WOSA 1NIWA 4GBAA 1J55A 1DVIA 1TCFA 2KAYA 2LVIA 1QS7A 4P2YB 1KFXS 1AUIB 2K0JA 2M0RA 1V1GA 4WQ3A 1WLZA 2FCDA 2KBIA 3D10A 4USLA 5D69A 1OMDA 4GUKA 1AK8A 2K2AA 1XVJA 2JNXA 4YI8A 1YRUB 2G9BA 3SG2A 4R1EA 1XK4A 2F3ZA 3TDIA 1L2OC 1CFFA 1BOCA 2KBMA 1MWNA 1NX3A 3D0YA 3NSIA 4FTGA 3F45A 1KK8C 1FW4A 1M31A 3DVMA 1KFUL 3DF0A 1CFDA 1J1DA 1CFPA 2JT3A 1K93D 1YUTA 1UHHA 1Q80A 2EHBA 1ODBA 3SJSA 1AP4A 1ZMZA 4GNKB 2P6BB 1QVIY 2EC6B 2JXLA 2Q91A 1TRFA 1Y6WA 1W7JB 4U8DA 2KI6D 4DIRA 1K8UA 2PSRA 2IS9A 3I5GB 2PASA 2JTTA 1F4OA 2KFGA 5CSNA 1XFYO 4TNCA 1BR1B 3OHMB 1F8HA 1QXPA 1UP5A 1E8AA 3LK1A 2PMYA 1SNLA 3PFVA 5DKNA 1HQVA 2F3YA 1AJ5A 1B47A 1F54A 1QATA 1K2HA 1V1FA 2MAZA 4OVNF 1TNWA 1RTP1 2NCPA 1OSAA 1IG5A 5G08A 1G8IA 2MLFC 3KEVA 3JVTC 3O4YA 4MBEA 1ZOTB 5KU1A 1OOJA 1XA5A 2F2OA 2ZNEA 2JNFA 2KYFA 1NCYA 2K7BA 4YBHB 1IKUA 4N5XA 1UHJA 2K7OA 1C7WA 1B1GA 2MA2A 4XYNA 1JWDA 1D1OA 2SASA 1OMRA 2LVVA 4C0LA 1CFCA 1F71A 1DJXA 1TIZA 4ZCUA 3CZTX 1KQMB 1GGWA 1A29A 4I5NB 1EG3A 1L2OB 3OX5A 5HKYA 4MVFA 3NSKA 3I5HC 4FQOA 2M1KB 2JXCA 2BECA 2E6WA 2M29A 2KHNA 5AEQA 1FF1A 2BBMA 1PRWA 1YUUA 2Y1NA 4NDCA 1MR8A 2L51A 2KDHA 1RK9A 2MLEC 2CT9A 1KFXL 1SRAA 2M97A 1DJHA 1NX1A 1SR6C 2TN4A 1A75A 3LK0A 1ALVA 4AQIA 2ZKMX 1MF8B 1QJTA 2L2EA 5B8IB 2H2KA 1UUSA 1K96A 2L4HA 2M9GA 3HCMA 2LHIA 1CNPA 1LINA 2AAOA 3SG5A 4N1GA 1CLBA 1EJ3A 1TN4A 1YVLA 4CPVA 4DS7A 1KCYA 2ISDA 3FWBA 1LVCD 2K8MB 2F8PA 1K9PA 1CTRA 1N0YA 1SKTA 1FPWA 4JPZB 3BUNB 4ORAB 5KSZA 5CSIA 4NDBA 2AUCA 3H4SE 2BE4A 1DGVA 1S36A 3I5IC 1B9AA 1CM4A 2JOJA 4QJ5B 2PRUA 2OS8C 1ALWA 1B7TZ 4AQJA 4MZLA 1YX8A 3SIAA 2ZRSA 3I5FB 3AAJA 4DUQA 1SW8A 1J7QA 3EK4A 1QX5B 1SCMB 1XFWO 3D0YB 3JVTB 2L4IA 4PE0A 2GV5A 4PE1A 5DKQA 1SY9A 2LP2A 1CDMA 3EVVA 3ICBA 3DD4A 3BUWB 3DF0B 4PCWA 2LHLA 3CR2A 1NCZA 4DRWA 1M45A 1BG1A 4ETOA 2LLSA 3CR4X 2COLB 1CMFA 5AXIA 1S3PA 4YGDB 1C07A 4GAOA 1WY9A 1YRTB 2KYCA 1KK7Z 1RFJA 4ZCVA 3SG3A 3EK8A 4QJ4B 1KSMA 1H4BA 1K9UA 2JWWA 2LAPA 1RECA 1C7VA 1BU3A 2K61A 5AERA 1TOPA 3GK1A 1J7RA 3SG4A 4A4BA 1PVAA 3WNXB 4CLNA 3PALA 1B8CA 1RJVA 4C0KA 1LA3A 1KQVA 1WRZA 1Y1XA 1S5GZ 3WXAA 3CGAA 1M63B 1Y1AA 2LANA 1SL7A 2BL0C 3KHEA 2M8UA 2NXQA 2L50A 3NSOA 4HRGA 5ER5A 3BXKA 1NCXA 4BY5A 5D7FA 1ZUZA 3CLNA 2MJWB 4MN0A 2FCEA 2K7DA 3C1VA 4MZJA 4PE7A 1QX7A 2M7NA 3CR5X 4MSPA 2LC5A 2NLNA 2OPOA 1GGZA 2SCPA 1N2DA 2B1UA 2V53A 3OB2B 1YR5A 1PVBA 3K21A 1JF0A 1QTXA 3RM1A 3I5IB 1BMOA 1HT9A 3OP0A 4OR9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OS8 B;  2I7A A;  5CSJ A;  1YX7 A;  1UHN A;  4A4C A;  2LUC A;  3JTD C;  1UUR A;  1S6J A;  4I5L B;  2M7L A;  1QIW A;  2CTN A;  3PN7 C;  3IF7 A;  2JUL A;  4YGC B;  2GGZ A;  4MZK A;  1CB1 A;  1DJZ A;  2BKH B;  4M2P A;  1KWO C;  2HPS A;  2HQ8 A;  1NX0 A;  1DMO A;  1SL9 A;  2WC8 A;  1A75 B;  2JT8 A;  2BCB A;  3EKH A;  5AFP A;  1IH0 A;  2HQW A;  1F4Q A;  1OZS A;  3BUX B;  2WOR A;  3TS5 C;  1SK6 D;  1SPY A;  4F0Z B;  2CNP A;  1S26 D;  3VRQ A;  1LA0 A;  2K2F A;  2LMU A;  4MLW A;  4CID A;  1K90 D;  3OB1 B;  1OZO A;  1DJY A;  1SMG A;  2LLU A;  1X02 A;  4GGF A;  1KK8 B;  1BLQ A;  1FBV A;  1SYM A;  1QAS A;  2PAL A;  1NYA A;  1TNP A;  3CWG A;  1R6P A;  1CDL A;  2M1U A;  2OTG C;  2M49 B;  1AVS A;  2Y1M A;  1Y1U A;  2KNE A;  1JC2 A;  2MHH A;  3TDU A;  2BCA A;  4JWQ A;  2KFH A;  3EVU A;  1BOD A;  3PM8 A;  5I8N A;  2FJU B;  3EKJ A;  4JQ0 D;  1BJF A;  4NQG A;  4PHN A;  1K9K A;  2KQ6 A;  3RLZ A;  1WRL A;  5I2Q A;  1TCO B;  4XJK A;  2E30 A;  4QJ3 B;  1CDP A;  1OMV A;  2KGR A;  1DT7 B;  2BKI B;  1EG4 A;  3OX6 A;  1PK0 D;  5I2L A;  5GQQ C;  2PVB A;  2M3W A;  1EH2 A;  2D8N A;  2DOQ A;  1A4P A;  1AHR A;  2ZN8 A;  1S6I A;  3PLF B;  3A8R A;  3WHU B;  4YGE B;  4PHK A;  1A03 A;  2JQ6 A;  1XFU O;  3BOW A;  3I5G C;  3JTD B;  4GGF C;  1DJW A;  4L9M A;  4PHM A;  2KI4 C;  1TNQ A;  1EXR A;  1TNX A;  2L98 A;  3PN7 B;  2KAV A;  2Q4U A;  2KFF A;  1XFV O;  2QAC A;  4YGB B;  1KWO B;  5IBW A;  4OCI A;  3E3R A;  4MEW A;  3QRX A;  1QIV A;  2KAX A;  3SG6 A;  1QV0 A;  2ZND A;  5K89 A;  3VRN A;  1B7T Y;  1UHK A;  1TTX A;  3EVR A;  2VRG A;  1NP8 A;  2LLT A;  3TS5 B;  2LUX A;  1F55 A;  1YTZ C;  1YUR A;  3VRR A;  1WDC C;  1ZFS A;  2LNK A;  3IQQ A;  3M0W A;  4C0J A;  1IJ6 A;  1J7P A;  1S1E A;  1VRK A;  3I5H B;  4AOM A;  1PAL A;  2CCM A;  1MXL C;  2KSP A;  1DGU A;  2AMI A;  1S6C A;  3AKB A;  1IRJ A;  2I18 A;  4PE4 A;  4GGN A;  3TUY C;  2OTG B;  1IGV A;  1UHI A;  2CBL A;  1SR6 B;  1B4C A;  1JF2 A;  1YVH A;  4IL1 A;  2H61 C;  1JUO A;  1KK7 Y;  3BQ3 A;  3DVJ A;  1QVI Z;  1KQM C;  1J7O A;  1CKK A;  1CMG A;  2L5X B;  1JFK A;  3GK4 X;  1NX2 A;  2WCF A;  4P5O E;  1XYD A;  2F33 A;  5AAN A;  1NSH A;  1DF0 A;  2GGM A;  1IJ5 A;  3VGO A;  2Y5I A;  4MRX A;  1XFX O;  1JFJ A;  1S5G Y;  3GOF A;  3KO0 A;  1G33 A;  1QX2 A;  1DJI A;  1GQM A;  3DVK A;  1U5I B;  5JJG A;  3NSL A;  3A4U B;  2JPT A;  5TNC A;  4ORB B;  2MBX A;  1H8B A;  4CFR A;  1ZAC A;  2CXJ A;  2FOT A;  2LP3 A;  2NZ0 A;  1NWD A;  1SCV A;  1PUL A;  2O5G A;  3EK7 A;  3WHT B;  1NUB A;  2JZI A;  1IWQ A;  1FI5 A;  2KI4 B;  2BBN A;  2LCP A;  4YRU A;  4M2O A;  3FIA A;  3LCP C;  2LVJ A;  4D1E A;  1G4Y R;  2RGI A;  5F6T A;  5FYX A;  1OQP A;  2R2I A;  1B8L A;  1FI6 A;  3TZ1 A;  1U5I A;  2I94 A;  3PAT A;  1NPQ A;  4BY4 A;  4N1F A;  1PSB A;  1XK4 C;  2HF5 A;  2BE6 A;  3FWC A;  1K95 A;  1SL8 A;  2JRF A;  1K94 A;  3I5F C;  2WND A;  4MRY A;  4I5K A;  1MUX A;  5HLO A;  3GK2 A;  3KF9 A;  3TDZ A;  1PSR A;  4OKH A;  4UPG A;  1SCM C;  2ZFD A;  4PDZ A;  1WDC B;  4XJK B;  1A2X A;  1MXE A;  1QV1 A;  2HET A;  1KFU S;  3NXA A;  5CPV A;  2JT0 A;  1QLK A;  3O2P A;  4YI9 A;  1RRO A;  2JU0 A;  2ZRT A;  1JBA A;  2LV7 A;  4YGA A;  2F2P A;  3AAK A;  1JSA A;  1DTL A;  3TUY B;  3O6B A;  1CM1 A;  2L0P A;  4GPL B;  3BYA A;  1QLS A;  2BL0 B;  4HRH A;  2EGD A;  3CTN A;  5JOL A;  3BOW B;  4ORC B;  5DKR A;  1IQ3 A;  2LVK A;  4HSZ A;  2LE9 B;  2O60 A;  1AJ4 A;  2LMT A;  3DVE A;  2I2R E;  4OV2 A;  2A4J A;  3HX4 A;  5J3X A;  3VRO A;  4PHJ A;  1L7Z A;  4Q04 A;  1LKJ A;  5CSF A;  1WRK A;  3VRP A;  1B8R A;  1XFZ O;  3LLE A;  2BCX A;  5HKW A;  2EC6 C;  2WCB A;  1BR4 B;  3LL8 B;  3AKA A;  1MHO A;  1W7I B;  3ZNI A;  2MRD A;  4WQ2 A;  1F70 A;  1M46 A;  2H61 A;  2JTZ A;  4CFQ A;  1CLM A;  3FS7 A;  4GFT A;  4HRE E;  2NCO A;  2WCE A;  3PSR A;  1CDN A;  5HKZ A;  1EL4 A;  2LMV A;  5I2O A;  3ZWH A;  1GJY A;  5BPJ A;  4WRI A;  1R2U A;  1BF5 A;  2ZN9 A;  4PAL A;  5HYD A;  4I5J A;  4M2Q A;  1RWY A;  2KI6 C;  2QPT A;  1OE9 B;  1KSO A;  1WLM A;  2LM5 A;  4E68 A;  3IQO A;  5HLV A;  2KOT A;  1IQ5 A;  1LXF C;  3CS1 A;  1CLL A;  3O78 A;  3KPX A;  1M39 A;  2KQY A;  1XO5 A;  5KTY A;  2Y4Q A;  1N65 A;  1YUS A;  4ICB A;  1UWO A;  4DCK A;  3BUO B;  4NDD A;  2KGB C;  1BT6 A;  3SIB A;  1SBJ A;  2G2B A;  1DJG A;  1MQ1 A;  5PAL A;  3BUM B;  5ER4 X;  1J1E A;  2K7C A;  1DF0 B;  2JC2 A;  3MSE B;  1Y0V H;  3SG7 A;  2WOS A;  1NIW A;  4GBA A;  1J55 A;  1DVI A;  1TCF A;  2KAY A;  2LVI A;  1QS7 A;  4P2Y B;  1KFX S;  1AUI B;  2K0J A;  2M0R A;  1V1G A;  4WQ3 A;  1WLZ A;  2FCD A;  2KBI A;  3D10 A;  4USL A;  5D69 A;  1OMD A;  4GUK A;  1AK8 A;  2K2A A;  1XVJ A;  2JNX A;  4YI8 A;  1YRU B;  2G9B A;  3SG2 A;  4R1E A;  1XK4 A;  2F3Z A;  3TDI A;  1L2O C;  1CFF A;  1BOC A;  2KBM A;  1MWN A;  1NX3 A;  3D0Y A;  3NSI A;  4FTG A;  3F45 A;  1KK8 C;  1FW4 A;  1M31 A;  3DVM A;  1KFU L;  3DF0 A;  1CFD A;  1J1D A;  1CFP A;  2JT3 A;  1K93 D;  1YUT A;  1UHH A;  1Q80 A;  2EHB A;  1ODB A;  3SJS A;  1AP4 A;  1ZMZ A;  4GNK B;  2P6B B;  1QVI Y;  2EC6 B;  2JXL A;  2Q91 A;  1TRF A;  1Y6W A;  1W7J B;  4U8D A;  2KI6 D;  4DIR A;  1K8U A;  2PSR A;  2IS9 A;  3I5G B;  2PAS A;  2JTT A;  1F4O A;  2KFG A;  5CSN A;  1XFY O;  4TNC A;  1BR1 B;  3OHM B;  1F8H A;  1QXP A;  1UP5 A;  1E8A A;  3LK1 A;  2PMY A;  1SNL A;  3PFV A;  5DKN A;  1HQV A;  2F3Y A;  1AJ5 A;  1B47 A;  1F54 A;  1QAT A;  1K2H A;  1V1F A;  2MAZ A;  4OVN F;  1TNW A;  1RTP 1;  2NCP A;  1OSA A;  1IG5 A;  5G08 A;  1G8I A;  2MLF C;  3KEV A;  3JVT C;  3O4Y A;  4MBE A;  1ZOT B;  5KU1 A;  1OOJ A;  1XA5 A;  2F2O A;  2ZNE A;  2JNF A;  2KYF A;  1NCY A;  2K7B A;  4YBH B;  1IKU A;  4N5X A;  1UHJ A;  2K7O A;  1C7W A;  1B1G A;  2MA2 A;  4XYN A;  1JWD A;  1D1O A;  2SAS A;  1OMR A;  2LVV A;  4C0L A;  1CFC A;  1F71 A;  1DJX A;  1TIZ A;  4ZCU A;  3CZT X;  1KQM B;  1GGW A;  1A29 A;  4I5N B;  1EG3 A;  1L2O B;  3OX5 A;  5HKY A;  4MVF A;  3NSK A;  3I5H C;  4FQO A;  2M1K B;  2JXC A;  2BEC A;  2E6W A;  2M29 A;  2KHN A;  5AEQ A;  1FF1 A;  2BBM A;  1PRW A;  1YUU A;  2Y1N A;  4NDC A;  1MR8 A;  2L51 A;  2KDH A;  1RK9 A;  2MLE C;  2CT9 A;  1KFX L;  1SRA A;  2M97 A;  1DJH A;  1NX1 A;  1SR6 C;  2TN4 A;  1A75 A;  3LK0 A;  1ALV A;  4AQI A;  2ZKM X;  1MF8 B;  1QJT A;  2L2E A;  5B8I B;  2H2K A;  1UUS A;  1K96 A;  2L4H A;  2M9G A;  3HCM A;  2LHI A;  1CNP A;  1LIN A;  2AAO A;  3SG5 A;  4N1G A;  1CLB A;  1EJ3 A;  1TN4 A;  1YVL A;  4CPV A;  4DS7 A;  1KCY A;  2ISD A;  3FWB A;  1LVC D;  2K8M B;  2F8P A;  1K9P A;  1CTR A;  1N0Y A;  1SKT A;  1FPW A;  4JPZ B;  3BUN B;  4ORA B;  5KSZ A;  5CSI A;  4NDB A;  2AUC A;  3H4S E;  2BE4 A;  1DGV A;  1S36 A;  3I5I C;  1B9A A;  1CM4 A;  2JOJ A;  4QJ5 B;  2PRU A;  2OS8 C;  1ALW A;  1B7T Z;  4AQJ A;  4MZL A;  1YX8 A;  3SIA A;  2ZRS A;  3I5F B;  3AAJ A;  4DUQ A;  1SW8 A;  1J7Q A;  3EK4 A;  1QX5 B;  1SCM B;  1XFW O;  3D0Y B;  3JVT B;  2L4I A;  4PE0 A;  2GV5 A;  4PE1 A;  5DKQ A;  1SY9 A;  2LP2 A;  1CDM A;  3EVV A;  3ICB A;  3DD4 A;  3BUW B;  3DF0 B;  4PCW A;  2LHL A;  3CR2 A;  1NCZ A;  4DRW A;  1M45 A;  1BG1 A;  4ETO A;  2LLS A;  3CR4 X;  2COL B;  1CMF A;  5AXI A;  1S3P A;  4YGD B;  1C07 A;  4GAO A;  1WY9 A;  1YRT B;  2KYC A;  1KK7 Z;  1RFJ A;  4ZCV A;  3SG3 A;  3EK8 A;  4QJ4 B;  1KSM A;  1H4B A;  1K9U A;  2JWW A;  2LAP A;  1REC A;  1C7V A;  1BU3 A;  2K61 A;  5AER A;  1TOP A;  3GK1 A;  1J7R A;  3SG4 A;  4A4B A;  1PVA A;  3WNX B;  4CLN A;  3PAL A;  1B8C A;  1RJV A;  4C0K A;  1LA3 A;  1KQV A;  1WRZ A;  1Y1X A;  1S5G Z;  3WXA A;  3CGA A;  1M63 B;  1Y1A A;  2LAN A;  1SL7 A;  2BL0 C;  3KHE A;  2M8U A;  2NXQ A;  2L50 A;  3NSO A;  4HRG A;  5ER5 A;  3BXK A;  1NCX A;  4BY5 A;  5D7F A;  1ZUZ A;  3CLN A;  2MJW B;  4MN0 A;  2FCE A;  2K7D A;  3C1V A;  4MZJ A;  4PE7 A;  1QX7 A;  2M7N A;  3CR5 X;  4MSP A;  2LC5 A;  2NLN A;  2OPO A;  1GGZ A;  2SCP A;  1N2D A;  2B1U A;  2V53 A;  3OB2 B;  1YR5 A;  1PVB A;  3K21 A;  1JF0 A;  1QTX A;  3RM1 A;  3I5I B;  1BMO A;  1HT9 A;  3OP0 A;  4OR9 B; 
#chains in the Genus database with same CATH topology
 2OS8 B;  2I7A A;  5CSJ A;  1YX7 A;  1UHN A;  4A4C A;  2LUC A;  3JTD C;  2BNX A;  1UUR A;  1S6J A;  4I5L B;  2M7L A;  1QIW A;  2CTN A;  3PN7 C;  3IF7 A;  2JUL A;  4YGC B;  3DXL A;  2GGZ A;  4MZK A;  1CB1 A;  1DJZ A;  2BKH B;  4M2P A;  1KWO C;  2HPS A;  2HQ8 A;  1NX0 A;  1DMO A;  1SL9 A;  2WC8 A;  1A75 B;  2JT8 A;  2BCB A;  3EKH A;  5AFP A;  1IH0 A;  2HQW A;  1F4Q A;  2QEV A;  1OZS A;  3BUX B;  2WOR A;  3TS5 C;  1SK6 D;  1SPY A;  2L2C A;  4F0Z B;  2CNP A;  1S26 D;  3VRQ A;  1LA0 A;  2K2F A;  2LMU A;  4MLW A;  4CID A;  1K90 D;  3OB1 B;  1OZO A;  1DJY A;  1SMG A;  2LLU A;  2WCJ A;  2GTE A;  1X02 A;  4GGF A;  1KK8 B;  1BLQ A;  1P28 A;  1FBV A;  1SYM A;  1QAS A;  2PAL A;  2YGU A;  1NYA A;  1TNP A;  3CWG A;  1R6P A;  1CDL A;  2M1U A;  3PM2 A;  2OTG C;  2M49 B;  1AVS A;  5FI7 A;  2Y1M A;  1Y1U A;  2KNE A;  1JC2 A;  2MHH A;  5PAL A;  3TDU A;  2BCA A;  4JWQ A;  2KFH A;  3S0A A;  3EVU A;  1BOD A;  3PM8 A;  5I8N A;  2FJU B;  3EKJ A;  3QME A;  4JQ0 D;  1BJF A;  4NQG A;  2PYQ A;  4PHN A;  1K9K A;  3FE9 A;  3S0B A;  2KQ6 A;  3RLZ A;  1WRL A;  5I2Q A;  3EG5 B;  1TCO B;  4XJK A;  2E30 A;  4QJ3 B;  3L4A A;  1CDP A;  3N7H A;  1OMV A;  2KGR A;  1DT7 B;  3R1V A;  2BKI B;  1EG4 A;  3OX6 A;  1PK0 D;  5I2L A;  5GQQ C;  2PVB A;  2M3W A;  1EH2 A;  2D8N A;  2DOQ A;  1A4P A;  1AHR A;  3B86 A;  2ZN8 A;  1S6I A;  3PLF B;  3A8R A;  3WHU B;  4YGE B;  3SS5 A;  4PHK A;  1A03 A;  2JQ6 A;  1XFU O;  3BOW A;  3I5G C;  3JTD B;  4GGF C;  1DJW A;  4L9M A;  4PHM A;  2KI4 C;  1TNQ A;  1EXR A;  1TNX A;  2L98 A;  3PN7 B;  2KAV A;  2Q4U A;  2KFF A;  1XFV O;  2QAC A;  4YGB B;  1KWO B;  5IBW A;  4OCI A;  3E3R A;  4MEW A;  3QRX A;  1QIV A;  2KAX A;  3SG6 A;  1QV0 A;  2ZND A;  5K89 A;  3VRN A;  1B7T Y;  1UHK A;  1TTX A;  3EVR A;  2VRG A;  1NP8 A;  2LLT A;  3TS5 B;  2LUX A;  1F55 A;  1Z2C B;  1YTZ C;  1YUR A;  3VRR A;  1WDC C;  1ZFS A;  2LNK A;  3IQQ A;  3M0W A;  4C0J A;  1IJ6 A;  2WCL A;  1J7P A;  1S1E A;  1VRK A;  3I5H B;  4AOM A;  1PAL A;  2CCM A;  1MXL C;  2KSP A;  1DGU A;  2AMI A;  1S6C A;  3AKB A;  1IRJ A;  2I18 A;  4PE4 A;  4GGN A;  3TUY C;  2OTG B;  1IGV A;  1UHI A;  2CBL A;  1SR6 B;  1B4C A;  1JF2 A;  1YVH A;  3CZ2 A;  4IL1 A;  2H61 C;  1JUO A;  1KK7 Y;  3BQ3 A;  3DVJ A;  1QVI Z;  1KQM C;  1J7O A;  1CKK A;  1CMG A;  2L5X B;  1JFK A;  3GK4 X;  1NX2 A;  2WCF A;  4P5O E;  5HLO A;  1XYD A;  2F33 A;  5AAN A;  1NSH A;  1DF0 A;  2GGM A;  1IJ5 A;  3VGO A;  5I94 A;  2Y5I A;  4MRX A;  1XFX O;  1JFJ A;  1S5G Y;  3GOF A;  3KO0 A;  1G33 A;  1QX2 A;  3RZS A;  1DJI A;  1GQM A;  3DVK A;  3UNW A;  1U5I B;  5JJG A;  3NSL A;  3A4U B;  2JPT A;  5TNC A;  4ORB B;  2MBX A;  3BFA A;  1H8B A;  3S0E A;  4CFR A;  1ZAC A;  5EL2 A;  2CXJ A;  2P70 A;  2FOT A;  3PJI A;  2LP3 A;  2NZ0 A;  1NWD A;  1SCV A;  1PUL A;  2O5G A;  3EK7 A;  3WHT B;  1NUB A;  2JZI A;  1IWQ A;  3V2L A;  2KI4 B;  1FI5 A;  2BBN A;  2LCP A;  4YRU A;  4M2O A;  3FIA A;  3LCP C;  2LVJ A;  3B6X A;  4D1E A;  1G4Y R;  2RGI A;  5F6T A;  5FYX A;  1OQP A;  2R2I A;  1B8L A;  1FI6 A;  2K60 A;  3TZ1 A;  1U5I A;  2I94 A;  3PAT A;  1NPQ A;  4BY4 A;  4N1F A;  1PSB A;  1XK4 C;  2HF5 A;  2BE6 A;  3FWC A;  1K95 A;  1SL8 A;  2JRF A;  1K94 A;  3BFH A;  2WND A;  3I5F C;  1TWO A;  1MUX A;  4I5K A;  3GK2 A;  3KF9 A;  3TDZ A;  1PSR A;  4OKH A;  3BJH A;  1SCM C;  2ZFD A;  4PDZ A;  4UPG A;  1WDC B;  4XJK B;  1A2X A;  1MXE A;  1QV1 A;  2HET A;  1KFU S;  3NXA A;  5CPV A;  2JT0 A;  1QLK A;  3O2P A;  4YI9 A;  1RRO A;  2JU0 A;  1DEL A;  2ZRT A;  2LV7 A;  4YGA A;  2F2P A;  3AAK A;  1JBA A;  1JSA A;  1DTL A;  2H8V A;  3TUY B;  3O6B A;  1CM1 A;  2L0P A;  4GPL B;  3BYA A;  3D74 A;  1QLS A;  1C3Y A;  2BL0 B;  2KLD A;  4HRH A;  2EGD A;  3CTN A;  5JOL A;  3BOW B;  4ORC B;  5DKR A;  3S0G A;  1IQ3 A;  3SS3 A;  2LVK A;  4HSZ A;  2LE9 B;  2O60 A;  1AJ4 A;  2LMT A;  3DVE A;  3NGV A;  2I2R E;  4OV2 A;  2A4J A;  3HX4 A;  5J3X A;  3VRO A;  4PHJ A;  3FE6 A;  3O4X A;  1L7Z A;  4Q04 A;  4PT1 A;  1LKJ A;  2P71 A;  5CSF A;  1WRK A;  3VRP A;  1B8R A;  1XFZ O;  3CYZ A;  2BCX A;  3LLE A;  5HKW A;  3UO9 A;  2EC6 C;  2WCB A;  1BR4 B;  3LL8 B;  3AKA A;  1MHO A;  3B88 A;  4F7F A;  1W7I B;  3ZNI A;  2MRD A;  4WQ2 A;  1F70 A;  1M46 A;  2H61 A;  2JTZ A;  4CFQ A;  1CLM A;  3FS7 A;  4GFT A;  5DIC A;  4HRE E;  2NCO A;  2WCE A;  3PSR A;  5FI6 A;  1CDN A;  5HKZ A;  3S0F A;  1EL4 A;  2LMV A;  5I2O A;  3ZWH A;  1GJY A;  5BPJ A;  4WRI A;  1R2U A;  1BF5 A;  2ZN9 A;  4PAL A;  5HYD A;  4I5J A;  4M2Q A;  1RWY A;  2KI6 C;  2QPT A;  1QWV A;  1OE9 B;  3R72 A;  1KSO A;  1WLM A;  2LM5 A;  4E68 A;  3IQO A;  1W9Z A;  5HLV A;  2KOT A;  1IQ5 A;  1LXF C;  3CS1 A;  1CLL A;  3O78 A;  3KPX A;  1OOH A;  1M39 A;  2KQY A;  1XFR A;  1XO5 A;  3NHT A;  2Y4Q A;  5KTY A;  1N65 A;  1YUS A;  4ICB A;  1UWO A;  4DCK A;  3BUO B;  4NDD A;  2KGB C;  1BT6 A;  3SIB A;  1SBJ A;  2G2B A;  1DJG A;  1MQ1 A;  4INW A;  3BUM B;  5ER4 X;  1J1E A;  2K7C A;  1DF0 B;  2JC2 A;  3MSE B;  1Y0V H;  3SG7 A;  2WOS A;  3IVT A;  1NIW A;  4GBA A;  1J55 A;  1DVI A;  1TCF A;  3CDN A;  2KAY A;  2LVI A;  1QS7 A;  4P2Y B;  3DZT A;  1KFX S;  1AUI B;  2QEO A;  2K0J A;  2M0R A;  1V1G A;  4WQ3 A;  1WLZ A;  2FCD A;  2KBI A;  3D10 A;  4USL A;  5D69 A;  1OMD A;  4GUK A;  1AK8 A;  2K2A A;  4JD9 A;  1XVJ A;  2JNX A;  4YI8 A;  1YRU B;  2G9B A;  3SG2 A;  4R1E A;  1XK4 A;  2F3Z A;  3TDI A;  1L2O C;  1CFF A;  1BOC A;  3R1P A;  3OGN A;  2KBM A;  1MWN A;  1NX3 A;  3D0Y A;  3NSI A;  4FTG A;  3F45 A;  1KK8 C;  1FW4 A;  1M31 A;  3DVM A;  1KFU L;  3DF0 A;  1CFD A;  1TUZ A;  1J1D A;  1CFP A;  1GM0 A;  2JT3 A;  2WC5 A;  1K93 D;  1YUT A;  1UHH A;  1Q80 A;  2EHB A;  5FI2 A;  3SS4 A;  1ODB A;  3SJS A;  1AP4 A;  1ZMZ A;  4GNK B;  3K1E A;  2P6B B;  1QVI Y;  2EC6 B;  2JXL A;  2Q91 A;  1TRF A;  1Y6W A;  1W7J B;  4U8D A;  2KI6 D;  3CAB A;  4DIR A;  1K8U A;  2PSR A;  2IS9 A;  3I5G B;  1ORG A;  2JTT A;  1F4O A;  2KFG A;  2PAS A;  5CSN A;  1XFY O;  4TNC A;  1BR1 B;  3OHM B;  1DQE A;  1QXP A;  1UP5 A;  1F8H A;  3S0D A;  1E8A A;  3LK1 A;  3R1O A;  2PMY A;  1SNL A;  3PFV A;  5DKN A;  1HQV A;  2F3Y A;  1AJ5 A;  1B47 A;  1F54 A;  3FE8 A;  1QAT A;  1K2H A;  2ERB A;  2JPO A;  2WCK A;  1V1F A;  2MAZ A;  4OVN F;  1TNW A;  1RTP 1;  2NCP A;  1OSA A;  1IG5 A;  2KPH A;  5G08 A;  1G8I A;  2MLF C;  3KEV A;  3JVT C;  3B87 A;  3O4Y A;  4MBE A;  1ZOT B;  5KU1 A;  1OOJ A;  1XA5 A;  2F2O A;  2ZNE A;  2JNF A;  2KYF A;  1NCY A;  2K7B A;  2WCH A;  4YBH B;  1IKU A;  1IIO A;  4N5X A;  1UHJ A;  4JKT A;  2K7O A;  1C7W A;  1B1G A;  2MA2 A;  4XYN A;  1JWD A;  2WCM A;  1D1O A;  3D77 A;  2SAS A;  1OMR A;  4KYN A;  2LVV A;  4C0L A;  1CFC A;  1F71 A;  1DJX A;  1TIZ A;  1SSE B;  1OOG A;  4ZCU A;  3CZT X;  2QEB A;  2WC6 A;  1KQM B;  4MRY A;  1GGW A;  1A29 A;  3D73 A;  1EG3 A;  4I5N B;  1L2O B;  3NHI A;  3L4L A;  3OX5 A;  1TUJ A;  5HKY A;  4MVF A;  3NSK A;  3I5H C;  4FQO A;  2M1K B;  2JXC A;  2BEC A;  1OOI X;  2E6W A;  2KHN A;  2M29 A;  5AEQ A;  1FF1 A;  2BBM A;  1PRW A;  1YUU A;  2Y1N A;  4NDC A;  1MR8 A;  2L51 A;  2KDH A;  1RK9 A;  2MLE C;  2CT9 A;  1KFX L;  1SRA A;  2PQL A;  2M97 A;  1DJH A;  1NX1 A;  1SR6 C;  2TN4 A;  1A75 A;  3LK0 A;  1ALV A;  4AQI A;  2ZKM X;  1MF8 B;  1QJT A;  2L2E A;  5B8I B;  2H2K A;  1UUS A;  1K96 A;  4IJ7 A;  2L4H A;  2M9G A;  3DYE A;  3HCM A;  2QEH A;  2KLE A;  2LHI A;  1CNP A;  1LIN A;  2AAO A;  3Q8I A;  3SG5 A;  4N1G A;  1CLB A;  5D3O A;  1EJ3 A;  1TN4 A;  1YVL A;  4CPV A;  4DS7 A;  1KCY A;  2ISD A;  3FWB A;  1LVC D;  2K8M B;  2F8P A;  1K9P A;  1CTR A;  1N0Y A;  1SKT A;  1FPW A;  4JPZ B;  3BUN B;  4ORA B;  5KSZ A;  3D78 A;  5CSI A;  4NDB A;  2AUC A;  3H4S E;  2BE4 A;  1DGV A;  1S36 A;  3CZ0 A;  3I5I C;  1B9A A;  1CM4 A;  2JOJ A;  4QJ5 B;  1DEK A;  2PRU A;  2OS8 C;  1ALW A;  1B7T Z;  4AQJ A;  4MZL A;  1YX8 A;  3SIA A;  4OZD A;  2ZRS A;  3I5F B;  3AAJ A;  4DUQ A;  1SW8 A;  1J7Q A;  3DY9 A;  3EK4 A;  1QX5 B;  1SCM B;  1XFW O;  3D0Y B;  3JVT B;  2L4I A;  4PE0 A;  2GV5 A;  4PE1 A;  5DKQ A;  1SY9 A;  2LP2 A;  1CDM A;  3EVV A;  3ICB A;  3DD4 A;  3BUW B;  3DF0 B;  4PCW A;  2LHL A;  1OW4 A;  3CR2 A;  1NCZ A;  4INX A;  4DRW A;  1M45 A;  1BG1 A;  3D76 A;  4ETO A;  2LLS A;  3CR4 X;  2COL B;  1CMF A;  5AXI A;  2L5Y A;  1S3P A;  4YGD B;  1C07 A;  4GAO A;  1WY9 A;  1YRT B;  2KYC A;  1KK7 Z;  1RFJ A;  4ZCV A;  3SG3 A;  3EK8 A;  3D75 A;  1T14 A;  4QJ4 B;  1KSM A;  1H4B A;  1K9U A;  2JWW A;  2LAP A;  2FJY A;  1REC A;  1C7V A;  1BU3 A;  2K61 A;  5AER A;  1TOP A;  3GK1 A;  1J7R A;  3SG4 A;  4A4B A;  1PVA A;  3WNX B;  4CLN A;  3PAL A;  1Z4H A;  1B8C A;  3CZ1 A;  1RJV A;  4C0K A;  3BFB A;  1LA3 A;  1KQV A;  1WRZ A;  1Y1X A;  1S5G Z;  3WXA A;  1LS8 A;  3CGA A;  1OOF A;  2BAP A;  1M63 B;  1Y1A A;  2LAN A;  1SL7 A;  2BL0 C;  3KHE A;  2M8U A;  2NXQ A;  2L50 A;  3NSO A;  4HRG A;  3B7A A;  5ER5 A;  3VB1 A;  3BXK A;  1NCX A;  4BY5 A;  5D7F A;  1ZUZ A;  3CLN A;  2MJW B;  2QDI A;  2FCE A;  2K7D A;  3C1V A;  4MN0 A;  4MZJ A;  4PE7 A;  1QX7 A;  2M7N A;  3CR5 X;  3OBV A;  4MSP A;  2LC5 A;  2NLN A;  2OPO A;  4FQT A;  1GGZ A;  2SCP A;  1N2D A;  2B1U A;  5HL1 A;  2V53 A;  3OB2 B;  1YR5 A;  1PVB A;  3K21 A;  1JF0 A;  1C3Z A;  1QTX A;  3RM1 A;  3I5I B;  1DC1 A;  3L47 A;  1BMO A;  1HT9 A;  3OP0 A;  4OR9 B; 
#chains in the Genus database with same CATH homology
 2OS8 B;  2I7A A;  5CSJ A;  1YX7 A;  1UHN A;  4A4C A;  2LUC A;  3JTD C;  1UUR A;  1S6J A;  4I5L B;  2M7L A;  1QIW A;  2CTN A;  3PN7 C;  3IF7 A;  2JUL A;  4YGC B;  2GGZ A;  4MZK A;  1CB1 A;  1DJZ A;  2BKH B;  4M2P A;  1KWO C;  2HPS A;  2HQ8 A;  1NX0 A;  1DMO A;  1SL9 A;  2WC8 A;  1A75 B;  2JT8 A;  2BCB A;  3EKH A;  5AFP A;  1IH0 A;  2HQW A;  1F4Q A;  1OZS A;  3BUX B;  2WOR A;  3TS5 C;  1SK6 D;  1SPY A;  4F0Z B;  2CNP A;  1S26 D;  3VRQ A;  1LA0 A;  2K2F A;  2LMU A;  4MLW A;  4CID A;  1K90 D;  3OB1 B;  1OZO A;  1DJY A;  1SMG A;  2LLU A;  1X02 A;  4GGF A;  1KK8 B;  1BLQ A;  1FBV A;  1SYM A;  1QAS A;  2PAL A;  1NYA A;  1TNP A;  3CWG A;  1R6P A;  1CDL A;  2M1U A;  2OTG C;  2M49 B;  1AVS A;  2Y1M A;  1Y1U A;  2KNE A;  1JC2 A;  2MHH A;  3TDU A;  2BCA A;  4JWQ A;  2KFH A;  3EVU A;  1BOD A;  3PM8 A;  5I8N A;  2FJU B;  3EKJ A;  4JQ0 D;  1BJF A;  4NQG A;  4PHN A;  1K9K A;  2KQ6 A;  3RLZ A;  1WRL A;  5I2Q A;  1TCO B;  4XJK A;  2E30 A;  4QJ3 B;  1CDP A;  1OMV A;  2KGR A;  1DT7 B;  2BKI B;  1EG4 A;  3OX6 A;  1PK0 D;  5I2L A;  5GQQ C;  2PVB A;  2M3W A;  1EH2 A;  2D8N A;  2DOQ A;  1A4P A;  1AHR A;  2ZN8 A;  1S6I A;  3PLF B;  3A8R A;  3WHU B;  4YGE B;  4PHK A;  1A03 A;  2JQ6 A;  1XFU O;  3BOW A;  3I5G C;  3JTD B;  4GGF C;  1DJW A;  4L9M A;  4PHM A;  2KI4 C;  1TNQ A;  1EXR A;  1TNX A;  2L98 A;  3PN7 B;  2KAV A;  2Q4U A;  2KFF A;  1XFV O;  2QAC A;  4YGB B;  1KWO B;  5IBW A;  4OCI A;  3E3R A;  4MEW A;  3QRX A;  1QIV A;  2KAX A;  3SG6 A;  1QV0 A;  2ZND A;  5K89 A;  3VRN A;  1B7T Y;  1UHK A;  1TTX A;  3EVR A;  2VRG A;  1NP8 A;  2LLT A;  3TS5 B;  2LUX A;  1F55 A;  1YTZ C;  1YUR A;  3VRR A;  1WDC C;  1ZFS A;  2LNK A;  3IQQ A;  3M0W A;  4C0J A;  1IJ6 A;  1J7P A;  1S1E A;  1VRK A;  3I5H B;  4AOM A;  1PAL A;  2CCM A;  1MXL C;  2KSP A;  1DGU A;  2AMI A;  1S6C A;  3AKB A;  1IRJ A;  2I18 A;  4PE4 A;  4GGN A;  3TUY C;  2OTG B;  1IGV A;  1UHI A;  2CBL A;  1SR6 B;  1B4C A;  1JF2 A;  1YVH A;  4IL1 A;  2H61 C;  1JUO A;  1KK7 Y;  3BQ3 A;  3DVJ A;  1QVI Z;  1KQM C;  1J7O A;  1CKK A;  1CMG A;  2L5X B;  1JFK A;  3GK4 X;  1NX2 A;  2WCF A;  4P5O E;  1XYD A;  2F33 A;  5AAN A;  1NSH A;  1DF0 A;  2GGM A;  1IJ5 A;  3VGO A;  2Y5I A;  4MRX A;  1XFX O;  1JFJ A;  1S5G Y;  3GOF A;  3KO0 A;  1G33 A;  1QX2 A;  1DJI A;  1GQM A;  3DVK A;  1U5I B;  5JJG A;  3NSL A;  3A4U B;  2JPT A;  5TNC A;  4ORB B;  2MBX A;  1H8B A;  4CFR A;  1ZAC A;  2CXJ A;  2FOT A;  2LP3 A;  2NZ0 A;  1NWD A;  1SCV A;  1PUL A;  2O5G A;  3EK7 A;  3WHT B;  1NUB A;  2JZI A;  1IWQ A;  1FI5 A;  2KI4 B;  2BBN A;  2LCP A;  4YRU A;  4M2O A;  3FIA A;  3LCP C;  2LVJ A;  4D1E A;  1G4Y R;  2RGI A;  5F6T A;  5FYX A;  1OQP A;  2R2I A;  1B8L A;  1FI6 A;  3TZ1 A;  1U5I A;  2I94 A;  3PAT A;  1NPQ A;  4BY4 A;  4N1F A;  1PSB A;  1XK4 C;  2HF5 A;  2BE6 A;  3FWC A;  1K95 A;  1SL8 A;  2JRF A;  1K94 A;  3I5F C;  2WND A;  4MRY A;  4I5K A;  1MUX A;  5HLO A;  3GK2 A;  3KF9 A;  3TDZ A;  1PSR A;  4OKH A;  4UPG A;  1SCM C;  2ZFD A;  4PDZ A;  1WDC B;  4XJK B;  1A2X A;  1MXE A;  1QV1 A;  2HET A;  1KFU S;  3NXA A;  5CPV A;  2JT0 A;  1QLK A;  3O2P A;  4YI9 A;  1RRO A;  2JU0 A;  2ZRT A;  1JBA A;  2LV7 A;  4YGA A;  2F2P A;  3AAK A;  1JSA A;  1DTL A;  3TUY B;  3O6B A;  1CM1 A;  2L0P A;  4GPL B;  3BYA A;  1QLS A;  2BL0 B;  4HRH A;  2EGD A;  3CTN A;  5JOL A;  3BOW B;  4ORC B;  5DKR A;  1IQ3 A;  2LVK A;  4HSZ A;  2LE9 B;  2O60 A;  1AJ4 A;  2LMT A;  3DVE A;  2I2R E;  4OV2 A;  2A4J A;  3HX4 A;  5J3X A;  3VRO A;  4PHJ A;  1L7Z A;  4Q04 A;  1LKJ A;  5CSF A;  1WRK A;  3VRP A;  1B8R A;  1XFZ O;  3LLE A;  2BCX A;  5HKW A;  2EC6 C;  2WCB A;  1BR4 B;  3LL8 B;  3AKA A;  1MHO A;  1W7I B;  3ZNI A;  2MRD A;  4WQ2 A;  1F70 A;  1M46 A;  2H61 A;  2JTZ A;  4CFQ A;  1CLM A;  3FS7 A;  4GFT A;  4HRE E;  2NCO A;  2WCE A;  3PSR A;  1CDN A;  5HKZ A;  1EL4 A;  2LMV A;  5I2O A;  3ZWH A;  1GJY A;  5BPJ A;  4WRI A;  1R2U A;  1BF5 A;  2ZN9 A;  4PAL A;  5HYD A;  4I5J A;  4M2Q A;  1RWY A;  2KI6 C;  2QPT A;  1OE9 B;  1KSO A;  1WLM A;  2LM5 A;  4E68 A;  3IQO A;  5HLV A;  2KOT A;  1IQ5 A;  1LXF C;  3CS1 A;  1CLL A;  3O78 A;  3KPX A;  1M39 A;  2KQY A;  1XO5 A;  5KTY A;  2Y4Q A;  1N65 A;  1YUS A;  4ICB A;  1UWO A;  4DCK A;  3BUO B;  4NDD A;  2KGB C;  1BT6 A;  3SIB A;  1SBJ A;  2G2B A;  1DJG A;  1MQ1 A;  5PAL A;  3BUM B;  5ER4 X;  1J1E A;  2K7C A;  1DF0 B;  2JC2 A;  3MSE B;  1Y0V H;  3SG7 A;  2WOS A;  1NIW A;  4GBA A;  1J55 A;  1DVI A;  1TCF A;  2KAY A;  2LVI A;  1QS7 A;  4P2Y B;  1KFX S;  1AUI B;  2K0J A;  2M0R A;  1V1G A;  4WQ3 A;  1WLZ A;  2FCD A;  2KBI A;  3D10 A;  4USL A;  5D69 A;  1OMD A;  4GUK A;  1AK8 A;  2K2A A;  1XVJ A;  2JNX A;  4YI8 A;  1YRU B;  2G9B A;  3SG2 A;  4R1E A;  1XK4 A;  2F3Z A;  3TDI A;  1L2O C;  1CFF A;  1BOC A;  2KBM A;  1MWN A;  1NX3 A;  3D0Y A;  3NSI A;  4FTG A;  3F45 A;  1KK8 C;  1FW4 A;  1M31 A;  3DVM A;  1KFU L;  3DF0 A;  1CFD A;  1J1D A;  1CFP A;  2JT3 A;  1K93 D;  1YUT A;  1UHH A;  1Q80 A;  2EHB A;  1ODB A;  3SJS A;  1AP4 A;  1ZMZ A;  4GNK B;  2P6B B;  1QVI Y;  2EC6 B;  2JXL A;  2Q91 A;  1TRF A;  1Y6W A;  1W7J B;  4U8D A;  2KI6 D;  4DIR A;  1K8U A;  2PSR A;  2IS9 A;  3I5G B;  2PAS A;  2JTT A;  1F4O A;  2KFG A;  5CSN A;  1XFY O;  4TNC A;  1BR1 B;  3OHM B;  1F8H A;  1QXP A;  1UP5 A;  1E8A A;  3LK1 A;  2PMY A;  1SNL A;  3PFV A;  5DKN A;  1HQV A;  2F3Y A;  1AJ5 A;  1B47 A;  1F54 A;  1QAT A;  1K2H A;  1V1F A;  2MAZ A;  4OVN F;  1TNW A;  1RTP 1;  2NCP A;  1OSA A;  1IG5 A;  5G08 A;  1G8I A;  2MLF C;  3KEV A;  3JVT C;  3O4Y A;  4MBE A;  1ZOT B;  5KU1 A;  1OOJ A;  1XA5 A;  2F2O A;  2ZNE A;  2JNF A;  2KYF A;  1NCY A;  2K7B A;  4YBH B;  1IKU A;  4N5X A;  1UHJ A;  2K7O A;  1C7W A;  1B1G A;  2MA2 A;  4XYN A;  1JWD A;  1D1O A;  2SAS A;  1OMR A;  2LVV A;  4C0L A;  1CFC A;  1F71 A;  1DJX A;  1TIZ A;  4ZCU A;  3CZT X;  1KQM B;  1GGW A;  1A29 A;  4I5N B;  1EG3 A;  1L2O B;  3OX5 A;  5HKY A;  4MVF A;  3NSK A;  3I5H C;  4FQO A;  2M1K B;  2JXC A;  2BEC A;  2E6W A;  2M29 A;  2KHN A;  5AEQ A;  1FF1 A;  2BBM A;  1PRW A;  1YUU A;  2Y1N A;  4NDC A;  1MR8 A;  2L51 A;  2KDH A;  1RK9 A;  2MLE C;  2CT9 A;  1KFX L;  1SRA A;  2M97 A;  1DJH A;  1NX1 A;  1SR6 C;  2TN4 A;  1A75 A;  3LK0 A;  1ALV A;  4AQI A;  2ZKM X;  1MF8 B;  1QJT A;  2L2E A;  5B8I B;  2H2K A;  1UUS A;  1K96 A;  2L4H A;  2M9G A;  3HCM A;  2LHI A;  1CNP A;  1LIN A;  2AAO A;  3SG5 A;  4N1G A;  1CLB A;  1EJ3 A;  1TN4 A;  1YVL A;  4CPV A;  4DS7 A;  1KCY A;  2ISD A;  3FWB A;  1LVC D;  2K8M B;  2F8P A;  1K9P A;  1CTR A;  1N0Y A;  1SKT A;  1FPW A;  4JPZ B;  3BUN B;  4ORA B;  5KSZ A;  5CSI A;  4NDB A;  2AUC A;  3H4S E;  2BE4 A;  1DGV A;  1S36 A;  3I5I C;  1B9A A;  1CM4 A;  2JOJ A;  4QJ5 B;  2PRU A;  2OS8 C;  1ALW A;  1B7T Z;  4AQJ A;  4MZL A;  1YX8 A;  3SIA A;  2ZRS A;  3I5F B;  3AAJ A;  4DUQ A;  1SW8 A;  1J7Q A;  3EK4 A;  1QX5 B;  1SCM B;  1XFW O;  3D0Y B;  3JVT B;  2L4I A;  4PE0 A;  2GV5 A;  4PE1 A;  5DKQ A;  1SY9 A;  2LP2 A;  1CDM A;  3EVV A;  3ICB A;  3DD4 A;  3BUW B;  3DF0 B;  4PCW A;  2LHL A;  3CR2 A;  1NCZ A;  4DRW A;  1M45 A;  1BG1 A;  4ETO A;  2LLS A;  3CR4 X;  2COL B;  1CMF A;  5AXI A;  1S3P A;  4YGD B;  1C07 A;  4GAO A;  1WY9 A;  1YRT B;  2KYC A;  1KK7 Z;  1RFJ A;  4ZCV A;  3SG3 A;  3EK8 A;  4QJ4 B;  1KSM A;  1H4B A;  1K9U A;  2JWW A;  2LAP A;  1REC A;  1C7V A;  1BU3 A;  2K61 A;  5AER A;  1TOP A;  3GK1 A;  1J7R A;  3SG4 A;  4A4B A;  1PVA A;  3WNX B;  4CLN A;  3PAL A;  1B8C A;  1RJV A;  4C0K A;  1LA3 A;  1KQV A;  1WRZ A;  1Y1X A;  1S5G Z;  3WXA A;  3CGA A;  1M63 B;  1Y1A A;  2LAN A;  1SL7 A;  2BL0 C;  3KHE A;  2M8U A;  2NXQ A;  2L50 A;  3NSO A;  4HRG A;  5ER5 A;  3BXK A;  1NCX A;  4BY5 A;  5D7F A;  1ZUZ A;  3CLN A;  2MJW B;  4MN0 A;  2FCE A;  2K7D A;  3C1V A;  4MZJ A;  4PE7 A;  1QX7 A;  2M7N A;  3CR5 X;  4MSP A;  2LC5 A;  2NLN A;  2OPO A;  1GGZ A;  2SCP A;  1N2D A;  2B1U A;  2V53 A;  3OB2 B;  1YR5 A;  1PVB A;  3K21 A;  1JF0 A;  1QTX A;  3RM1 A;  3I5I B;  1BMO A;  1HT9 A;  3OP0 A;  4OR9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...