3D78A

Dimeric crystal structure of a pheromone binding protein mutant d35n, from apis mellifera, at ph 7.0
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
119
structure length
119
Chain Sequence
APDWVPPEVFDLVAEDKARCMSEHGTTQAQIDDVNKGNLVNEPSITCYMYCLLEAFSLVDDEANVDEDIMLGLLPDQLQERAQSVMGKCLPTSGSDNCNKIYNLAKCVQESAPDVWFVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pheromone-binding protein ASP1
publication title Queen bee pheromone binding protein pH-induced domain swapping favors pheromone release
pubmed doi rcsb
source organism Apis mellifera
molecule tags Pheromone binding protein
total genus 43
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3d78A00
3L47A 3S0BA 2JPOA 1QWVA 2QEBA 1C3YA 4JD9A 3K1EA 3D74A 2QEVA 3FE8A 3D75A 3CZ1A 3B88A 2P70A 3DZTA 3S0DA 3NGVA 2WC6A 4OZDA 3FE6A 3BFAA 2ERBA 3R1PA 2WCKA 3PJIA 3BFHA 2WCHA 1OOFA 3S0GA 3L4LA 3NHIA 2QEOA 1TUJA 2WC5A 5DICA 3CZ0A 3S0FA 2H8VA 3R72A 2WCLA 3D77A 2WCMA 4FQTA 3N7HA 3B7AA 3D76A 3CZ2A 2KPHA 4INWA 3R1VA 1GM0A 1DQEA 3CABA 4INXA 2WCJA 1XFRA 1OOIX 4PT1A 2QEHA 3CYZA 3B6XA 1TWOA 1ORGA 2P71A 3VB1A 3DYEA 3D73A 2PQLA 3V2LA 3B86A 3FE9A 3QMEA 3BJHA 3S0AA 3R1OA 1OOGA 3NHTA 3L4AA 3OGNA 2FJYA 1P28A 1T14A 2L2CA 3BFBA 1OOHA 1OW4A 5EL2A 1LS8A 2QDIA 3B87A 3Q8IA 3CDNA 3RZSA 1C3ZA 3D78A 2GTEA 3DY9A 4F7FA 3S0EA 3DXLA
chains in the Genus database with same CATH superfamily
1JFKA 1B7TY 2PMYA 4MN0A 1DT7B 2JT0A 1PVAA 3S0BA 2LVKA 3DVMA 1CDLA 1FF1A 2YGUA 3SG7A 1DJHA 1X02A 4GGFC 2NCPA 1J55A 3TDZA 4YRUA 5DKQA 3EVRA 1C7VA 2LV7A 3D74A 3TZ1A 5KU1A 2LLTA 2L0PA 2KLDA 1M63B 2Y5IA 4PHJA 2ISDA 1C7WA 1AK8A 1QV0A 3DZTA 1IG5A 1OOJA 1SBJA 3VRNA 1F4QA 2JULA 4IL1A 4YI9A 1NCXA 2ZRSA 1J1DA 4M2OA 3FE6A 3PSRA 1F54A 2AAOA 3FWBA 5AANA 1TNPA 2BECA 3HX4A 4GUKA 4ICBA 3R1PA 1R6PA 2WCKA 4USLA 3A8RA 1XK4C 2MAZA 2WC8A 2WCHA 1L7ZA 3MSEB 4FTGA 4C0JA 1JBAA 3L4LA 3NHIA 1TUJA 2KFGA 1TCOB 1UHNA 4YGCB 1M46A 5DICA 1XFVO 2JU0A 1QX2A 2I2RE 1YX7A 3D77A 3OB2B 4U8DA 2BBMA 2WCMA 2KYCA 1Q80A 2PVBA 1KK8B 1TNXA 1XFYO 4ZCUA 2WOSA 1KQMB 1QVIZ 2JPTA 4R1EA 1MR8A 1QX5B 5D7FA 3WHUB 1DC1A 1CFFA 1BR4B 2LHLA 1OMDA 1CMFA 4A4CA 2WCEA 1OE9B 2LANA 3I5GC 4ORBB 1Y6WA 4PCWA 5HL1A 1E8AA 3DVJA 1S5GY 2EHBA 1QVIY 4INXA 1EG4A 1SMGA 4C0LA 1CKKA 2BL0B 2HQWA 5I2LA 5I2QA 2KDHA 1TNWA 3CYZA 1ALWA 2F8PA 3I5HC 1QLKA 3B6XA 1XO5A 3EVVA 1SRAA 2KBMA 1CLMA 1PRWA 2NZ0A 2KNEA 2OS8C 2ZNEA 2MRDA 2G9BA 1KFUS 3LCPC 3VB1A 1K9PA 1YUUA 1MUXA 2H61A 3FE9A 1SW8A 4N5XA 2K0JA 2LLSA 3VRQA 1KSOA 3BJHA 3CR4X 3QRXA 5GQQC 2PASA 1F4OA 2K2FA 4GBAA 1CDMA 1PALA 1WLMA 5J3XA 1SCVA 1J7QA 2AUCA 1BG1A 1KWOC 4JKTA 1TUZA 1YURA 2KAYA 3KF9A 3EKHA 2LUCA 4MRXA 3L4AA 1TRFA 2B1UA 3EK4A 2BKIB 1NX3A 1CNPA 3BQ3A 1SY9A 4BY5A 3BFBA 1WDCB 1OW4A 2AMIA 5AERA 4HRGA 5ER4X 1RWYA 3SS3A 2BCAA 1V1GA 2EC6B 2Y1NA 1EXRA 2KLEA 1B47A 1CM1A 1BMOA 2JC2A 2Y1MA 1XFWO 3IQOA 5F6TA 3Q8IA 3AAJA 5FI7A 2JTZA 2MJWB 1DVIA 3PATA 1SCMB 4MEWA 1A29A 1K93D 1LKJA 1S36A 2ZFDA 2JOJA 2M97A 4GGNA 3SIBA 1YUTA 2CTNA 1AJ4A 1XFXO 1WRLA 2WORA 1J1EA 3OX6A 4D1EA 4F7FA 3HCMA 1CB1A 2DOQA 1NX0A 1EG3A 3EVUA 2KQ6A 1CTRA 1OZSA 1IH0A 1XVJA 1SL8A 2JPOA 4MZLA 1W9ZA 3M0WA 5G08A 1C3YA 2JT3A 4JD9A 1K96A 1IIOA 2F2PA 2H2KA 1Y0VH 2K7DA 2WCFA 1JSAA 2QEVA 3FE8A 3D75A 2JNXA 1UHKA 3B88A 4UPGA 1DGVA 4FQOA 2P70A 3SG5A 3PN7B 2PYQA 3S0DA 5DKNA 1YTZC 1GJYA 4QJ5B 4WQ3A 2BCXA 3JVTC 2JXLA 2JT8A 2E6WA 1MHOA 3BFHA 1CFDA 1QIWA 2WNDA 1OOFA 2KI6C 5HKWA 3S0GA 4WRIA 1SL7A 1UUSA 1J7OA 1A2XA 4MRYA 3SIAA 2JTTA 3CZ0A 1NUBA 1WLZA 4DCKA 3S0FA 2H8VA 1B9AA 1DEKA 4WQ2A 2F2OA 1FBVA 1Y1AA 2NLNA 1DJZA 2MHHA 4FQTA 5CSJA 2OTGC 3B7AA 1NCZA 3D76A 1F70A 2L51A 1WRKA 1EL4A 1PSBA 1CFPA 2KPHA 2M7LA 4DRWA 1N2DA 1QASA 3RM1A 1AVSA 2QPTA 2I7AA 2HF5A 5AEQA 1ALVA 1YRUB 4M2PA 2KI4B 1TN4A 1L2OB 2PALA 4JPZB 4HRHA 5D3OA 2JXCA 1UHJA 1BF5A 1YVLA 1YRTB 4PT1A 4XJKB 5AFPA 1J7PA 5KTYA 1OSAA 2JNFA 4Q04A 1TIZA 4XJKA 1NPQA 2D8NA 5I8NA 1W7IB 4OKHA 1DJWA 4YGEB 2FOTA 4OR9B 1KK8C 1H4BA 4YGBB 1SKTA 4MSPA 1KQMC 1H8BA 4OCIA 3QMEA 1SR6B 4YGAA 1Z2CB 3OBVA 3DVKA 1QV1A 3S0AA 4PE4A 3NSLA 1KFXS 1FI6A 2FJUB 1JF2A 1PULA 1NX2A 2KYFA 3LK1A 5B8IB 1M31A 5CPVA 3FWCA 1QTXA 3KO0A 4ORCB 2LM5A 2BL0C 3PFVA 1IGVA 3GK2A 1DJGA 4N1GA 2P6BB 1SYMA 1CLBA 3CTNA 2KSPA 3SJSA 1DGUA 2JQ6A 2H61C 1KSMA 2MLEC 1BR1B 5JOLA 3VRRA 1BJFA 2KOTA 2K2AA 2I94A 1IQ5A 1ZACA 4QJ3B 3VGOA 2M29A 4GNKB 1ZMZA 2E30A 1RECA 5K89A 1A4PA 4PHKA 2A4JA 3CDNA 3EK8A 1JF0A 1Y1XA 1N65A 3RZSA 1IWQA 1MQ1A 1C3ZA 1TCFA 1Z4HA 2CT9A 3I5GB 1EH2A 3K21A 2JZIA 3ICBA 2K7BA 1KK7Z 1UHHA 3S0EA 2Q91A 1S6JA 2BBNA 3NSIA 3UO9A 1GQMA 1DF0B 1YX8A 2SASA 1S3PA 1QATA 4CIDA 3OP0A 1WDCC 1OQPA 3BYAA 2BE4A 1HT9A 1DF0A 1XA5A 3PM2A 2EC6C 4CFQA 2HPSA 1G33A 2L4IA 4PDZA 2M3WA 2EGDA 3JTDC 2KI6D 3OB1B 1ODBA 4KYNA 1UURA 4P2YB 3H4SE 2LMTA 3KHEA 4HREE 2PRUA 2K8MB 1Y1UA 5FYXA 4BY4A 1ZFSA 2LVJA 4ETOA 1UWOA 1NSHA 3NGVA 1AP4A 2WC6A 3DD4A 4OZDA 3PM8A 3BFAA 3CR2A 2COLB 1SK6D 2LCPA 2WCBA 3I5IC 1B4CA 2O5GA 1F8HA 1OMRA 3VRPA 1PSRA 4MZKA 3TUYB 2BKHB 4E68A 1N0YA 1QJTA 2MA2A 2WC5A 2K60A 1CM4A 1YUSA 1K2HA 3R72A 1MXLC 1FW4A 3TDIA 3PALA 3O78A 4MBEA 2FCEA 2CCMA 2BE6A 1J7RA 3N7HA 1RTP1 2M49B 3AKAA 2M1UA 1A75B 1QLSA 1K9UA 3IVTA 1LA3A 2FCDA 2GGZA 2KAVA 2R2IA 3SG6A 3BUNB 3PN7C 2QACA 4A4BA 2LMUA 3OX5A 1IQ3A 1JFJA 3I5FB 1A75A 1XFZO 1DTLA 3CABA 4XYNA 2F3ZA 1LVCD 4MVFA 5D69A 1YR5A 4GPLB 2WCJA 1XFRA 1OOIX 3O4XA 4NDDA 1B8LA 3SG3A 1KQVA 2JWWA 1UP5A 3NSOA 4ZCVA 2LE9B 3NXAA 3GOFA 1PK0D 3AAKA 1TWOA 5ER5A 1S26D 2BCBA 3WHTB 5CSFA 3DYEA 2GV5A 3D73A 1NIWA 3EK7A 5PALA 3TS5B 2PQLA 2M7NA 3O2PA 1AUIB 3B86A 1RROA 1EJ3A 3GK1A 3BUMB 1TNQA 5CSIA 1C07A 1IJ5A 1B7TZ 2JRFA 1V1FA 4YI8A 3O6BA 2LLUA 3DF0B 1R2UA 4NDBA 1BT6A 4PHNA 4MLWA 4I5KA 2LVVA 5JJGA 3BXKA 3CS1A 3DF0A 4DS7A 1S6IA 2KI4C 3R1OA 1L2OC 2Y4QA 4AQJA 1FI5A 3ZWHA 3JVTB 2M0RA 3D0YB 1NP8A 5I94A 1S6CA 1UHIA 4HSZA 3BOWB 1B8RA 3NHTA 4CLNA 1GGZA 3D10A 3LL8B 2FJYA 3D0YA 1P28A 1AJ5A 3OGNA 4YGDB 2ZRTA 1T14A 2L2CA 1NYAA 1OOHA 1WY9A 3BOWA 3CZTX 1G8IA 4M2QA 5HLOA 2LMVA 1LS8A 3BUOB 1IKUA 1S1EA 2QDIA 2OTGB 2RGIA 3EG5B 2K61A 2IS9A 4GGFA 3SS4A 3KEVA 3ZNIA 1SR6C 4DIRA 3A4UB 3SG2A 3C1VA 3WXAA 1XFUO 2L5YA 1CMGA 4NQGA 1QX7A 1NWDA 2GGMA 1KCYA 3WNXB 1JC2A 2F33A 2LP2A 4PE7A 4TNCA 1IRJA 2GTEA 3EKJA 1TOPA 2PSRA 1K95A 3GK4X 1XYDA 2K7OA 4IJ7A 1IJ6A 2LNKA 4PALA 1K8UA 3L47A 1BOCA 4L9MA 4ORAB 3UNWA 1G4YR 5I2OA 1F71A 1JUOA 1K94A 2O60A 3CGAA 1MXEA 3PLFB 3KPXA 1XK4A 1QWVA 1U5IB 2LAPA 2ZNDA 2QEBA 1NX1A 1K90D 2V53A 1DMOA 3CWGA 3K1EA 2CXJA 2KGBC 1U5IA 4CFRA 1AHRA 1S5GZ 5IBWA 1OZOA 4PE1A 2KHNA 1BU3A 5FI2A 3CZ1A 4I5LB 1DJIA 2ZN8A 1DELA 2BAPA 3RLZA 2NXQA 3E3RA 2BNXA 1MWNA 2LC5A 2M9GA 1LXFC 1W7JB 2L4HA 1RJVA 2ERBA 5HYDA 2L98A 1CFCA 2NCOA 4C0KA 2HQ8A 1OMVA 3PJIA 3FS7A 2OPOA 4OV2A 1LA0A 4PE0A 2QEOA 4JQ0D 4N1FA 3I5HB 2KFHA 2KGRA 1F55A 2WCLA 2OS8B 5HKYA 3SS5A 1DJXA 2HETA 4NDCA 2Q4UA 1QXPA 2LUXA 1KK7Y 5KSZA 3BUXB 1CDNA 2KBIA 3CZ2A 1WRZA 1BLQA 4INWA 4DUQA 1VRKA 3FIAA 3R1VA 5DKRA 2L5XB 1GM0A 3IQQA 1SCMC 3AKBA 4CPVA 1DQEA 2I18A 3SG4A 2LHIA 1PVBA 1MF8B 1KWOB 2KQYA 5FI6A 3TUYC 2QEHA 2TN4A 3CLNA 1FPWA 2KFFA 5TNCA 2F3YA 1ORGA 1NCYA 2MBXA 2P71A 1JWDA 1CLLA 1BODA 4JWQA 2LP3A 1A03A 3JTDB 3V2LA 1ZUZA 2L2EA 1SNLA 1SL9A 4YBHB 3TDUA 3I5FC 5BPJA 1KFXL 1D1OA 1B1GA 2L50A 2CBLA 1QIVA 4I5JA 3DVEA 2M1KB 1TTXA 3I5IB 1QS7A 2SCPA 3LLEA 3LK0A 1OOGA 1K9KA 2LVIA 5HLVA 3OHMB 1RFJA 3F45A 4I5NB 4OVNF 5CSNA 4GFTA 2K7CA 1YVHA 2M8UA 3O4YA 3NSKA 3VROA 4GAOA 2ZN9A 5EL2A 1M45A 2MLFC 1KFUL 3BUWB 2G2BA 3TS5C 3CR5X 1GGWA 3IF7A 3B87A 2KAXA 2ZKMX 1LINA 4PHMA 1RK9A 1ZOTB 4P5OE 2CNPA 1B8CA 5AXIA 2VRGA 4AQIA 1DJYA 1M39A 1HQVA 4QJ4B 1CDPA 3D78A 4F0ZB 5HKZA 4MZJA 3DY9A 1SSEB 1SPYA 4AOMA 3DXLA
chains in the Genus database with same CATH topology
3L47A 3S0BA 2JPOA 1QWVA 2QEBA 1C3YA 4JD9A 3K1EA 3D74A 2QEVA 3FE8A 3D75A 3CZ1A 3B88A 2P70A 3DZTA 3S0DA 3NGVA 2WC6A 4OZDA 3FE6A 3BFAA 2ERBA 3R1PA 2WCKA 3PJIA 3BFHA 2WCHA 1OOFA 3S0GA 3L4LA 3NHIA 2QEOA 1TUJA 2WC5A 5DICA 3CZ0A 3S0FA 2H8VA 3R72A 2WCLA 3D77A 2WCMA 4FQTA 3N7HA 3B7AA 3D76A 3CZ2A 2KPHA 4INWA 3R1VA 1GM0A 1DQEA 3CABA 4INXA 2WCJA 1XFRA 1OOIX 4PT1A 2QEHA 3CYZA 3B6XA 1TWOA 1ORGA 2P71A 3VB1A 3DYEA 3D73A 2PQLA 3V2LA 3B86A 3FE9A 3QMEA 3BJHA 3S0AA 3R1OA 1OOGA 3NHTA 3L4AA 3OGNA 2FJYA 1P28A 1T14A 2L2CA 3BFBA 1OOHA 1OW4A 5EL2A 1LS8A 2QDIA 3B87A 3Q8IA 3CDNA 3RZSA 1C3ZA 3D78A 2GTEA 3DY9A 4F7FA 3S0EA 3DXLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L47 A;  3S0B A;  2JPO A;  1QWV A;  2QEB A;  1C3Y A;  4JD9 A;  3K1E A;  3D74 A;  2QEV A;  3FE8 A;  3D75 A;  3CZ1 A;  3B88 A;  2P70 A;  3DZT A;  3S0D A;  3NGV A;  2WC6 A;  4OZD A;  3FE6 A;  3BFA A;  2ERB A;  3R1P A;  2WCK A;  3PJI A;  3BFH A;  2WCH A;  1OOF A;  3S0G A;  3L4L A;  3NHI A;  2QEO A;  1TUJ A;  2WC5 A;  5DIC A;  3CZ0 A;  3S0F A;  2H8V A;  3R72 A;  2WCL A;  3D77 A;  2WCM A;  4FQT A;  3N7H A;  3B7A A;  3D76 A;  3CZ2 A;  2KPH A;  4INW A;  3R1V A;  1GM0 A;  1DQE A;  3CAB A;  4INX A;  2WCJ A;  1XFR A;  1OOI X;  4PT1 A;  2QEH A;  3CYZ A;  3B6X A;  1TWO A;  1ORG A;  2P71 A;  3VB1 A;  3DYE A;  3D73 A;  2PQL A;  3V2L A;  3B86 A;  3FE9 A;  3QME A;  3BJH A;  3S0A A;  3R1O A;  1OOG A;  3NHT A;  3L4A A;  3OGN A;  2FJY A;  1P28 A;  1T14 A;  2L2C A;  3BFB A;  1OOH A;  1OW4 A;  5EL2 A;  1LS8 A;  2QDI A;  3B87 A;  3Q8I A;  3CDN A;  3RZS A;  1C3Z A;  3D78 A;  2GTE A;  3DY9 A;  4F7F A;  3S0E A;  3DXL A; 
#chains in the Genus database with same CATH topology
 1JFK A;  1B7T Y;  2PMY A;  4MN0 A;  1DT7 B;  2JT0 A;  1PVA A;  3S0B A;  2LVK A;  3DVM A;  1CDL A;  1FF1 A;  2YGU A;  3SG7 A;  1DJH A;  1X02 A;  4GGF C;  2NCP A;  1J55 A;  3TDZ A;  4YRU A;  5DKQ A;  3EVR A;  1C7V A;  2LV7 A;  3D74 A;  3TZ1 A;  5KU1 A;  2LLT A;  2L0P A;  2KLD A;  1M63 B;  2Y5I A;  4PHJ A;  2ISD A;  1C7W A;  1AK8 A;  1QV0 A;  3DZT A;  1IG5 A;  1OOJ A;  1SBJ A;  3VRN A;  1F4Q A;  2JUL A;  4IL1 A;  4YI9 A;  1NCX A;  2ZRS A;  1J1D A;  4M2O A;  3FE6 A;  3PSR A;  1F54 A;  2AAO A;  3FWB A;  5AAN A;  1TNP A;  2BEC A;  3HX4 A;  4GUK A;  4ICB A;  3R1P A;  1R6P A;  2WCK A;  4USL A;  3A8R A;  1XK4 C;  2MAZ A;  2WC8 A;  2WCH A;  1L7Z A;  3MSE B;  4FTG A;  4C0J A;  1JBA A;  3L4L A;  3NHI A;  1TUJ A;  2KFG A;  1TCO B;  1UHN A;  4YGC B;  1M46 A;  5DIC A;  1XFV O;  2JU0 A;  1QX2 A;  2I2R E;  1YX7 A;  3D77 A;  3OB2 B;  4U8D A;  2BBM A;  2WCM A;  2KYC A;  1Q80 A;  2PVB A;  1KK8 B;  1TNX A;  1XFY O;  4ZCU A;  2WOS A;  1KQM B;  1QVI Z;  2JPT A;  4R1E A;  1MR8 A;  1QX5 B;  5D7F A;  3WHU B;  1DC1 A;  1CFF A;  1BR4 B;  2LHL A;  1OMD A;  1CMF A;  4A4C A;  2WCE A;  1OE9 B;  2LAN A;  3I5G C;  4ORB B;  1Y6W A;  4PCW A;  5HL1 A;  1E8A A;  3DVJ A;  1S5G Y;  2EHB A;  1QVI Y;  4INX A;  1EG4 A;  1SMG A;  4C0L A;  1CKK A;  2BL0 B;  2HQW A;  5I2L A;  5I2Q A;  2KDH A;  1TNW A;  3CYZ A;  1ALW A;  2F8P A;  3I5H C;  1QLK A;  3B6X A;  1XO5 A;  3EVV A;  1SRA A;  2KBM A;  1CLM A;  1PRW A;  2NZ0 A;  2KNE A;  2OS8 C;  2ZNE A;  2MRD A;  2G9B A;  1KFU S;  3LCP C;  3VB1 A;  1K9P A;  1YUU A;  1MUX A;  2H61 A;  3FE9 A;  1SW8 A;  4N5X A;  2K0J A;  2LLS A;  3VRQ A;  1KSO A;  3BJH A;  3CR4 X;  3QRX A;  5GQQ C;  2PAS A;  1F4O A;  2K2F A;  4GBA A;  1CDM A;  1PAL A;  1WLM A;  5J3X A;  1SCV A;  1J7Q A;  2AUC A;  1BG1 A;  1KWO C;  4JKT A;  1TUZ A;  1YUR A;  2KAY A;  3KF9 A;  3EKH A;  2LUC A;  4MRX A;  3L4A A;  1TRF A;  2B1U A;  3EK4 A;  2BKI B;  1NX3 A;  1CNP A;  3BQ3 A;  1SY9 A;  4BY5 A;  3BFB A;  1WDC B;  1OW4 A;  2AMI A;  5AER A;  4HRG A;  5ER4 X;  1RWY A;  3SS3 A;  2BCA A;  1V1G A;  2EC6 B;  2Y1N A;  1EXR A;  2KLE A;  1B47 A;  1CM1 A;  1BMO A;  2JC2 A;  2Y1M A;  1XFW O;  3IQO A;  5F6T A;  3Q8I A;  3AAJ A;  5FI7 A;  2JTZ A;  2MJW B;  1DVI A;  3PAT A;  1SCM B;  4MEW A;  1A29 A;  1K93 D;  1LKJ A;  1S36 A;  2ZFD A;  2JOJ A;  2M97 A;  4GGN A;  3SIB A;  1YUT A;  2CTN A;  1AJ4 A;  1XFX O;  1WRL A;  2WOR A;  1J1E A;  3OX6 A;  4D1E A;  4F7F A;  3HCM A;  1CB1 A;  2DOQ A;  1NX0 A;  1EG3 A;  3EVU A;  2KQ6 A;  1CTR A;  1OZS A;  1IH0 A;  1XVJ A;  1SL8 A;  2JPO A;  4MZL A;  1W9Z A;  3M0W A;  5G08 A;  1C3Y A;  2JT3 A;  4JD9 A;  1K96 A;  1IIO A;  2F2P A;  2H2K A;  1Y0V H;  2K7D A;  2WCF A;  1JSA A;  2QEV A;  3FE8 A;  3D75 A;  2JNX A;  1UHK A;  3B88 A;  4UPG A;  1DGV A;  4FQO A;  2P70 A;  3SG5 A;  3PN7 B;  2PYQ A;  3S0D A;  5DKN A;  1YTZ C;  1GJY A;  4QJ5 B;  4WQ3 A;  2BCX A;  3JVT C;  2JXL A;  2JT8 A;  2E6W A;  1MHO A;  3BFH A;  1CFD A;  1QIW A;  2WND A;  1OOF A;  2KI6 C;  5HKW A;  3S0G A;  4WRI A;  1SL7 A;  1UUS A;  1J7O A;  1A2X A;  4MRY A;  3SIA A;  2JTT A;  3CZ0 A;  1NUB A;  1WLZ A;  4DCK A;  3S0F A;  2H8V A;  1B9A A;  1DEK A;  4WQ2 A;  2F2O A;  1FBV A;  1Y1A A;  2NLN A;  1DJZ A;  2MHH A;  4FQT A;  5CSJ A;  2OTG C;  3B7A A;  1NCZ A;  3D76 A;  1F70 A;  2L51 A;  1WRK A;  1EL4 A;  1PSB A;  1CFP A;  2KPH A;  2M7L A;  4DRW A;  1N2D A;  1QAS A;  3RM1 A;  1AVS A;  2QPT A;  2I7A A;  2HF5 A;  5AEQ A;  1ALV A;  1YRU B;  4M2P A;  2KI4 B;  1TN4 A;  1L2O B;  2PAL A;  4JPZ B;  4HRH A;  5D3O A;  2JXC A;  1UHJ A;  1BF5 A;  1YVL A;  1YRT B;  4PT1 A;  4XJK B;  5AFP A;  1J7P A;  5KTY A;  1OSA A;  2JNF A;  4Q04 A;  1TIZ A;  4XJK A;  1NPQ A;  2D8N A;  5I8N A;  1W7I B;  4OKH A;  1DJW A;  4YGE B;  2FOT A;  4OR9 B;  1KK8 C;  1H4B A;  4YGB B;  1SKT A;  4MSP A;  1KQM C;  1H8B A;  4OCI A;  3QME A;  1SR6 B;  4YGA A;  1Z2C B;  3OBV A;  3DVK A;  1QV1 A;  3S0A A;  4PE4 A;  3NSL A;  1KFX S;  1FI6 A;  2FJU B;  1JF2 A;  1PUL A;  1NX2 A;  2KYF A;  3LK1 A;  5B8I B;  1M31 A;  5CPV A;  3FWC A;  1QTX A;  3KO0 A;  4ORC B;  2LM5 A;  2BL0 C;  3PFV A;  1IGV A;  3GK2 A;  1DJG A;  4N1G A;  2P6B B;  1SYM A;  1CLB A;  3CTN A;  2KSP A;  3SJS A;  1DGU A;  2JQ6 A;  2H61 C;  1KSM A;  2MLE C;  1BR1 B;  5JOL A;  3VRR A;  1BJF A;  2KOT A;  2K2A A;  2I94 A;  1IQ5 A;  1ZAC A;  4QJ3 B;  3VGO A;  2M29 A;  4GNK B;  1ZMZ A;  2E30 A;  1REC A;  5K89 A;  1A4P A;  4PHK A;  2A4J A;  3CDN A;  3EK8 A;  1JF0 A;  1Y1X A;  1N65 A;  3RZS A;  1IWQ A;  1MQ1 A;  1C3Z A;  1TCF A;  1Z4H A;  2CT9 A;  3I5G B;  1EH2 A;  3K21 A;  2JZI A;  3ICB A;  2K7B A;  1KK7 Z;  1UHH A;  3S0E A;  2Q91 A;  1S6J A;  2BBN A;  3NSI A;  3UO9 A;  1GQM A;  1DF0 B;  1YX8 A;  2SAS A;  1S3P A;  1QAT A;  4CID A;  3OP0 A;  1WDC C;  1OQP A;  3BYA A;  2BE4 A;  1HT9 A;  1DF0 A;  1XA5 A;  3PM2 A;  2EC6 C;  4CFQ A;  2HPS A;  1G33 A;  2L4I A;  4PDZ A;  2M3W A;  2EGD A;  3JTD C;  2KI6 D;  3OB1 B;  1ODB A;  4KYN A;  1UUR A;  4P2Y B;  3H4S E;  2LMT A;  3KHE A;  4HRE E;  2PRU A;  2K8M B;  1Y1U A;  5FYX A;  4BY4 A;  1ZFS A;  2LVJ A;  4ETO A;  1UWO A;  1NSH A;  3NGV A;  1AP4 A;  2WC6 A;  3DD4 A;  4OZD A;  3PM8 A;  3BFA A;  3CR2 A;  2COL B;  1SK6 D;  2LCP A;  2WCB A;  3I5I C;  1B4C A;  2O5G A;  1F8H A;  1OMR A;  3VRP A;  1PSR A;  4MZK A;  3TUY B;  2BKH B;  4E68 A;  1N0Y A;  1QJT A;  2MA2 A;  2WC5 A;  2K60 A;  1CM4 A;  1YUS A;  1K2H A;  3R72 A;  1MXL C;  1FW4 A;  3TDI A;  3PAL A;  3O78 A;  4MBE A;  2FCE A;  2CCM A;  2BE6 A;  1J7R A;  3N7H A;  1RTP 1;  2M49 B;  3AKA A;  2M1U A;  1A75 B;  1QLS A;  1K9U A;  3IVT A;  1LA3 A;  2FCD A;  2GGZ A;  2KAV A;  2R2I A;  3SG6 A;  3BUN B;  3PN7 C;  2QAC A;  4A4B A;  2LMU A;  3OX5 A;  1IQ3 A;  1JFJ A;  3I5F B;  1A75 A;  1XFZ O;  1DTL A;  3CAB A;  4XYN A;  2F3Z A;  1LVC D;  4MVF A;  5D69 A;  1YR5 A;  4GPL B;  2WCJ A;  1XFR A;  1OOI X;  3O4X A;  4NDD A;  1B8L A;  3SG3 A;  1KQV A;  2JWW A;  1UP5 A;  3NSO A;  4ZCV A;  2LE9 B;  3NXA A;  3GOF A;  1PK0 D;  3AAK A;  1TWO A;  5ER5 A;  1S26 D;  2BCB A;  3WHT B;  5CSF A;  3DYE A;  2GV5 A;  3D73 A;  1NIW A;  3EK7 A;  5PAL A;  3TS5 B;  2PQL A;  2M7N A;  3O2P A;  1AUI B;  3B86 A;  1RRO A;  1EJ3 A;  3GK1 A;  3BUM B;  1TNQ A;  5CSI A;  1C07 A;  1IJ5 A;  1B7T Z;  2JRF A;  1V1F A;  4YI8 A;  3O6B A;  2LLU A;  3DF0 B;  1R2U A;  4NDB A;  1BT6 A;  4PHN A;  4MLW A;  4I5K A;  2LVV A;  5JJG A;  3BXK A;  3CS1 A;  3DF0 A;  4DS7 A;  1S6I A;  2KI4 C;  3R1O A;  1L2O C;  2Y4Q A;  4AQJ A;  1FI5 A;  3ZWH A;  3JVT B;  2M0R A;  3D0Y B;  1NP8 A;  5I94 A;  1S6C A;  1UHI A;  4HSZ A;  3BOW B;  1B8R A;  3NHT A;  4CLN A;  1GGZ A;  3D10 A;  3LL8 B;  2FJY A;  3D0Y A;  1P28 A;  1AJ5 A;  3OGN A;  4YGD B;  2ZRT A;  1T14 A;  2L2C A;  1NYA A;  1OOH A;  1WY9 A;  3BOW A;  3CZT X;  1G8I A;  4M2Q A;  5HLO A;  2LMV A;  1LS8 A;  3BUO B;  1IKU A;  1S1E A;  2QDI A;  2OTG B;  2RGI A;  3EG5 B;  2K61 A;  2IS9 A;  4GGF A;  3SS4 A;  3KEV A;  3ZNI A;  1SR6 C;  4DIR A;  3A4U B;  3SG2 A;  3C1V A;  3WXA A;  1XFU O;  2L5Y A;  1CMG A;  4NQG A;  1QX7 A;  1NWD A;  2GGM A;  1KCY A;  3WNX B;  1JC2 A;  2F33 A;  2LP2 A;  4PE7 A;  4TNC A;  1IRJ A;  2GTE A;  3EKJ A;  1TOP A;  2PSR A;  1K95 A;  3GK4 X;  1XYD A;  2K7O A;  4IJ7 A;  1IJ6 A;  2LNK A;  4PAL A;  1K8U A;  3L47 A;  1BOC A;  4L9M A;  4ORA B;  3UNW A;  1G4Y R;  5I2O A;  1F71 A;  1JUO A;  1K94 A;  2O60 A;  3CGA A;  1MXE A;  3PLF B;  3KPX A;  1XK4 A;  1QWV A;  1U5I B;  2LAP A;  2ZND A;  2QEB A;  1NX1 A;  1K90 D;  2V53 A;  1DMO A;  3CWG A;  3K1E A;  2CXJ A;  2KGB C;  1U5I A;  4CFR A;  1AHR A;  1S5G Z;  5IBW A;  1OZO A;  4PE1 A;  2KHN A;  1BU3 A;  5FI2 A;  3CZ1 A;  4I5L B;  1DJI A;  2ZN8 A;  1DEL A;  2BAP A;  3RLZ A;  2NXQ A;  3E3R A;  2BNX A;  1MWN A;  2LC5 A;  2M9G A;  1LXF C;  1W7J B;  2L4H A;  1RJV A;  2ERB A;  5HYD A;  2L98 A;  1CFC A;  2NCO A;  4C0K A;  2HQ8 A;  1OMV A;  3PJI A;  3FS7 A;  2OPO A;  4OV2 A;  1LA0 A;  4PE0 A;  2QEO A;  4JQ0 D;  4N1F A;  3I5H B;  2KFH A;  2KGR A;  1F55 A;  2WCL A;  2OS8 B;  5HKY A;  3SS5 A;  1DJX A;  2HET A;  4NDC A;  2Q4U A;  1QXP A;  2LUX A;  1KK7 Y;  5KSZ A;  3BUX B;  1CDN A;  2KBI A;  3CZ2 A;  1WRZ A;  1BLQ A;  4INW A;  4DUQ A;  1VRK A;  3FIA A;  3R1V A;  5DKR A;  2L5X B;  1GM0 A;  3IQQ A;  1SCM C;  3AKB A;  4CPV A;  1DQE A;  2I18 A;  3SG4 A;  2LHI A;  1PVB A;  1MF8 B;  1KWO B;  2KQY A;  5FI6 A;  3TUY C;  2QEH A;  2TN4 A;  3CLN A;  1FPW A;  2KFF A;  5TNC A;  2F3Y A;  1ORG A;  1NCY A;  2MBX A;  2P71 A;  1JWD A;  1CLL A;  1BOD A;  4JWQ A;  2LP3 A;  1A03 A;  3JTD B;  3V2L A;  1ZUZ A;  2L2E A;  1SNL A;  1SL9 A;  4YBH B;  3TDU A;  3I5F C;  5BPJ A;  1KFX L;  1D1O A;  1B1G A;  2L50 A;  2CBL A;  1QIV A;  4I5J A;  3DVE A;  2M1K B;  1TTX A;  3I5I B;  1QS7 A;  2SCP A;  3LLE A;  3LK0 A;  1OOG A;  1K9K A;  2LVI A;  5HLV A;  3OHM B;  1RFJ A;  3F45 A;  4I5N B;  4OVN F;  5CSN A;  4GFT A;  2K7C A;  1YVH A;  2M8U A;  3O4Y A;  3NSK A;  3VRO A;  4GAO A;  2ZN9 A;  5EL2 A;  1M45 A;  2MLF C;  1KFU L;  3BUW B;  2G2B A;  3TS5 C;  3CR5 X;  1GGW A;  3IF7 A;  3B87 A;  2KAX A;  2ZKM X;  1LIN A;  4PHM A;  1RK9 A;  1ZOT B;  4P5O E;  2CNP A;  1B8C A;  5AXI A;  2VRG A;  4AQI A;  1DJY A;  1M39 A;  1HQV A;  4QJ4 B;  1CDP A;  3D78 A;  4F0Z B;  5HKZ A;  4MZJ A;  3DY9 A;  1SSE B;  1SPY A;  4AOM A;  3DXL A; 
#chains in the Genus database with same CATH homology
 3L47 A;  3S0B A;  2JPO A;  1QWV A;  2QEB A;  1C3Y A;  4JD9 A;  3K1E A;  3D74 A;  2QEV A;  3FE8 A;  3D75 A;  3CZ1 A;  3B88 A;  2P70 A;  3DZT A;  3S0D A;  3NGV A;  2WC6 A;  4OZD A;  3FE6 A;  3BFA A;  2ERB A;  3R1P A;  2WCK A;  3PJI A;  3BFH A;  2WCH A;  1OOF A;  3S0G A;  3L4L A;  3NHI A;  2QEO A;  1TUJ A;  2WC5 A;  5DIC A;  3CZ0 A;  3S0F A;  2H8V A;  3R72 A;  2WCL A;  3D77 A;  2WCM A;  4FQT A;  3N7H A;  3B7A A;  3D76 A;  3CZ2 A;  2KPH A;  4INW A;  3R1V A;  1GM0 A;  1DQE A;  3CAB A;  4INX A;  2WCJ A;  1XFR A;  1OOI X;  4PT1 A;  2QEH A;  3CYZ A;  3B6X A;  1TWO A;  1ORG A;  2P71 A;  3VB1 A;  3DYE A;  3D73 A;  2PQL A;  3V2L A;  3B86 A;  3FE9 A;  3QME A;  3BJH A;  3S0A A;  3R1O A;  1OOG A;  3NHT A;  3L4A A;  3OGN A;  2FJY A;  1P28 A;  1T14 A;  2L2C A;  3BFB A;  1OOH A;  1OW4 A;  5EL2 A;  1LS8 A;  2QDI A;  3B87 A;  3Q8I A;  3CDN A;  3RZS A;  1C3Z A;  3D78 A;  2GTE A;  3DY9 A;  4F7F A;  3S0E A;  3DXL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...