3D78A

Dimeric crystal structure of a pheromone binding protein mutant d35n, from apis mellifera, at ph 7.0
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
119
structure length
119
Chain Sequence
APDWVPPEVFDLVAEDKARCMSEHGTTQAQIDDVNKGNLVNEPSITCYMYCLLEAFSLVDDEANVDEDIMLGLLPDQLQERAQSVMGKCLPTSGSDNCNKIYNLAKCVQESAPDVWFVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Pheromone binding protein
molecule keywords Pheromone-binding protein ASP1
publication title Queen bee pheromone binding protein pH-induced domain swapping favors pheromone release
pubmed doi rcsb
source organism Apis mellifera
total genus 43
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3d78A00
3BJHA 5EL2A 3PJIA 3DXLA 2ERBA 2WCHA 2QDIA 3CZ0A 2PQLA 3D78A 3D76A 3V2LA 3B87A 3NGVA 2WCKA 3R1OA 3L4LA 3RZSA 3Q8IA 3BFHA 3CDNA 2QEVA 3DYEA 4JD9A 3FE8A 3L4AA 3B88A 1OOFA 1OOGA 3DZTA 3B6XA 2WCLA 4OZDA 5DICA 1OOIX 3D77A 3DY9A 1DQEA 1OW4A 4INXA 3CZ1A 2WCJA 3R72A 2QEBA 2QEHA 3S0EA 3B86A 4INWA 3VB1A 1XFRA 1C3YA 4PT1A 2L2CA 3S0BA 2QEOA 3CZ2A 3R1PA 3L47A 3FE6A 3D74A 4F7FA 3BFBA 2GTEA 3S0AA 3NHTA 1P28A 3CABA 3S0DA 1ORGA 3B7AA 1LS8A 3S0GA 1TWOA 2P71A 3BFAA 2WCMA 1T14A 2KPHA 1TUJA 3NHIA 1C3ZA 2P70A 3OGNA 2WC5A 3D73A 3K1EA 1GM0A 1QWVA 2H8VA 2WC6A 2FJYA 4FQTA 3CYZA 3QMEA 3R1VA 3S0FA 3FE9A 3D75A 1OOHA 3N7HA 2JPOA
chains in the Genus database with same CATH superfamily
3FIAA 2WNDA 2KFFA 4OVNF 4ZCVA 3CWGA 4NDDA 2K60A 1GGWA 1KFXL 2PSRA 2K0JA 1BR4B 1J1EA 2CTNA 1TNQA 3DD4A 3CZ0A 1UHIA 4YGCB 1WRLA 2ZN8A 3AKAA 2K2FA 2MRDA 1R2UA 1EH2A 1KK8C 1F55A 3NSOA 1NX2A 3DVJA 3WHUB 1SW8A 5KU1A 3DVEA 1NX1A 1DJYA 3EK8A 3CZTX 4P2YB 2K7BA 1XFZO 1IJ5A 1S6IA 1JUOA 2KLEA 2LCPA 1CDMA 1DJHA 3D10A 3BYAA 3JTDC 3KPXA 2ZNEA 3L4LA 1DF0B 4P5OE 3TS5B 3KEVA 5HL1A 3BFHA 3CDNA 3RZSA 1IKUA 4JD9A 3KHEA 4GAOA 3FE8A 2QACA 4N1FA 3B88A 1PALA 3DZTA 1EG4A 4QJ5B 1LKJA 1N2DA 3I5FB 4OR9B 1KSMA 2KLDA 4PE4A 3WXAA 3D0YB 1UP5A 1NCZA 4PDZA 2K61A 1J55A 2JWWA 3D77A 3SS3A 1H8BA 3VRNA 3KO0A 4I5KA 3ICBA 2F3ZA 5HLVA 1WDCB 1YVHA 3SJSA 3OB2B 2K2AA 3DF0B 4CFQA 1J7QA 2QEHA 1RK9A 1KFUS 3BUWB 1EJ3A 1MUXA 2KFHA 3OHMB 1SCMB 4MRXA 4INWA 1QX5B 4FTGA 1SNLA 4USLA 1AVSA 5I2OA 1XA5A 2M1UA 1VRKA 1YR5A 2H61C 3IQOA 2BKIB 1MR8A 1YX8A 1CLLA 2JXLA 4PT1A 1NX0A 2L2CA 3SG6A 2JOJA 3S0BA 1KCYA 1K93D 2BL0C 1J1DA 4HSZA 1CKKA 1FPWA 1Y1AA 2CBLA 3PM2A 1NP8A 3L47A 4HREE 1BOCA 1J7PA 1Y6WA 4NQGA 1BF5A 1CDNA 1NYAA 4F7FA 3IF7A 3IVTA 1S6CA 3VGOA 1ZMZA 2LV7A 1SPYA 2GTEA 2NLNA 2LUXA 3O6BA 1KQMC 4MBEA 4XYNA 3SG2A 3S0AA 1TNXA 2M97A 3VRRA 5HYDA 1B8CA 1P28A 3CABA 4I5JA 1LS8A 2WCBA 1L2OB 2LHIA 5J3XA 2BBNA 2LC5A 3BFAA 2WCMA 1OQPA 2JU0A 1LA0A 4YBHB 4I5NB 1IQ3A 2FCEA 3EK7A 1TTXA 2P70A 1EL4A 2HQWA 1CM4A 1IH0A 5I2LA 5ER5A 2KNEA 2OTGC 1L7ZA 2WORA 3OBVA 4WRIA 2LAPA 3D73A 5DKRA 1CFDA 2KI4C 1W7JB 1N65A 2L4HA 2Q91A 4GFTA 2HQ8A 1TNWA 2KQYA 1DJXA 1WLMA 1F54A 2G2BA 2MLFC 1YUUA 2BE6A 4DS7A 2WC6A 2ZN9A 1GQMA 2BBMA 1B8LA 1G8IA 2KAXA 3GK4X 1XFWO 1SK6D 1B8RA 2VRGA 3GK2A 3QRXA 3R1VA 4JKTA 4NDBA 1DJZA 2CXJA 2EGDA 4CIDA 4C0JA 4M2QA 3EVUA 1QTXA 1UWOA 5FI7A 4HRHA 1DELA 2CNPA 2M7LA 5AFPA 1DF0A 1AUIB 4OV2A 2LLUA 3DXLA 2LVJA 2WCHA 2LANA 2PYQA 2BKHB 1ZACA 1M45A 2G9BA 1OMVA 3OP0A 4GPLB 1EG3A 1WRZA 2QPTA 1RROA 3PN7B 3EKJA 3NGVA 2CT9A 2LHLA 1AHRA 1ZUZA 2LP2A 4ZCUA 1DC1A 2L5YA 5TNCA 1KK7Y 1QATA 1B4CA 3L4AA 1QLSA 2KI6C 1OOGA 3AKBA 5D69A 1ODBA 2KBMA 5BPJA 1TUZA 1JBAA 1PSRA 1LINA 1S36A 1BR1B 2JTTA 3B6XA 1MHOA 1XO5A 1SCVA 2Y5IA 1UHNA 1JFKA 1OW4A 4ORCB 5FI2A 1OE9B 1M46A 2LLSA 3CZ1A 1UHJA 1SRAA 2WCJA 5DKNA 1PSBA 3R72A 1BT6A 1KWOB 1XVJA 3S0EA 1F8HA 1SL8A 2LMVA 1OSAA 2M0RA 3I5HB 2KYFA 1ALWA 1QJTA 1YURA 4PALA 4YGBB 1XYDA 1E8AA 3LLEA 3TS5C 1MXEA 2MJWB 1HQVA 1XFRA 1C3YA 3RLZA 2P6BB 4XJKA 1DJWA 3SG5A 1S3PA 3I5GB 2QEOA 3BUXB 1LXFC 3HCMA 2GGZA 3CR4X 1YUTA 1C7WA 2NCPA 3I5FC 3IQQA 3CZ2A 5HKZA 1IG5A 2E6WA 3PM8A 2FJUB 2KYCA 3SS5A 2K7OA 3FE6A 5FYXA 1TOPA 1KK8B 1DEKA 3CR5X 2M1KB 2NCOA 4TNCA 3ZNIA 1BMOA 1WDCC 1NCXA 1SYMA 3FWCA 1KFXS 5G08A 2Q4UA 1R6PA 3PSRA 4L9MA 1OMRA 3CTNA 1XFUO 3RM1A 3S0DA 1AP4A 4JPZB 1SCMC 2PMYA 2ZFDA 1FW4A 2B1UA 2OS8B 1F4QA 1SSEB 1UHKA 1AJ4A 3OX5A 2KGBC 1IIOA 1K8UA 1IRJA 4GBAA 2MBXA 1WRKA 3GK1A 2O60A 2BE4A 4MSPA 2JC2A 1QS7A 2OPOA 1QV0A 1HT9A 1V1FA 2JPTA 2KGRA 3K1EA 3DVKA 4PCWA 1J7OA 4QJ4B 1GM0A 4MZLA 5IBWA 2ZRSA 2LMTA 5I8NA 2TN4A 1JC2A 5DKQA 1GGZA 1Y1UA 4E68A 4UPGA 1QWVA 5KSZA 2CCMA 2K7DA 2LVVA 4FQTA 2MLEC 2F2OA 2GV5A 4YI9A 2I94A 1NIWA 4N5XA 1A75B 4HRGA 1L2OC 3E3RA 1D1OA 3JVTB 3BUNB 2AUCA 2PVBA 3D75A 3FE9A 1XK4A 4GGFA 2JNFA 3N7HA 3UO9A 5CSFA 3LL8B 1SR6B 4C0KA 1SBJA 1LA3A 5D3OA 1CDLA 5EL2A 2Y4QA 4PE7A 3FS7A 1A4PA 3SIAA 1K9UA 1PVBA 1OZOA 2GGMA 3SIBA 2DOQA 3D78A 3NSLA 1TCFA 2KFGA 5CPVA 2L0PA 3V2LA 1PRWA 1YUSA 4MEWA 1RJVA 1QVIZ 2MAZA 2MHHA 1X02A 4M2PA 1IWQA 1SY9A 2BCXA 1CB1A 2PASA 1S5GZ 3Q8IA 4A4BA 2JRFA 2FCDA 4BY5A 2F8PA 4ORBB 1K2HA 5I94A 1DT7B 1K9PA 1K96A 1OOFA 2F2PA 1B47A 1G4YR 2ZNDA 4DUQA 3LK1A 1NWDA 2KAVA 2KI4B 4PHMA 2Y1MA 1OOIX 3A8RA 1B1GA 3DY9A 1CDPA 2SCPA 1DQEA 2LVKA 4PHJA 1BLQA 1NX3A 2L98A 2WCEA 3BUMB 2JT8A 1CFCA 1CMGA 1QIVA 5CSNA 1H4BA 1AJ5A 2D8NA 3D0YA 1XFYO 1Y1XA 1YRUB 2KAYA 1Z4HA 3DF0A 1NSHA 4GGFC 1XK4C 1IQ5A 3BUOB 5HKYA 3I5IB 3CS1A 4AOMA 1QIWA 3O2PA 1BG1A 1TNPA 3VB1A 2M9GA 4N1GA 4OCIA 1DTLA 2H2KA 2EC6B 1NPQA 3PALA 4GGNA 1AK8A 3NXAA 5HKWA 3SG4A 2PRUA 1JSAA 3O78A 4F0ZB 2M29A 2COLB 3R1PA 2YGUA 1B9AA 2BAPA 3NSIA 1F71A 2HETA 4GUKA 3D74A 3VROA 3PATA 1Q80A 1QX2A 4WQ3A 3BFBA 3TUYB 2WCFA 2EHBA 1GJYA 3NHTA 1CMFA 5HLOA 1KWOC 4R1EA 3CGAA 1TRFA 3S0GA 2LP3A 1WY9A 2PALA 2LUCA 3I5HC 3SG3A 4YGDB 1CTRA 1G33A 3DVMA 1SMGA 2O5GA 3MSEB 3TDIA 5AEQA 1Z2CB 1MWNA 1A75A 1CFFA 2NXQA 1N0YA 3OGNA 3BXKA 2M49B 3I5GC 3SG7A 1YVLA 4MRYA 1U5IB 1KFUL 2WOSA 2WC8A 5CSJA 1YTZC 2F3YA 2Y1NA 1W9ZA 2BNXA 2H8VA 4I5LB 4AQIA 3F45A 1TCOB 2FJYA 2I2RE 1WLZA 4JWQA 1YX7A 1UURA 3CYZA 2ISDA 3FWBA 3QMEA 3JTDB 1FI5A 2L4IA 3S0FA 2M8UA 4OKHA 2BCAA 1DGVA 2OS8C 3GOFA 3NSKA 1NCYA 2M3WA 4KYNA 4U8DA 5KTYA 1QX7A 5B8IB 1K90D 3TDZA 5K89A 1FI6A 1A03A 2JPOA 3PLFB 1B7TZ 3OB1B 4ICBA 5FI6A 2JT3A 3BJHA 2KBIA 1IJ6A 3PJIA 2JTZA 3HX4A 4MZJA 3C1VA 2ERBA 2QDIA 3BOWB 1RFJA 4PE0A 2PQLA 3ZWHA 1MQ1A 2I7AA 3KF9A 1RECA 2AAOA 1S6JA 3CR2A 2FOTA 4A4CA 5AERA 3K21A 1M63B 3D76A 1TN4A 2F33A 2LMUA 3A4UB 3EVRA 2L50A 3TZ1A 5JJGA 2LNKA 2K7CA 2L5XB 3B87A 2SASA 1JF0A 1K94A 3EG5B 2IS9A 2WCKA 3EVVA 4M2OA 3R1OA 1YRTB 4JQ0D 4YRUA 3H4SE 2V53A 2QEVA 3DYEA 3JVTC 1IGVA 1EXRA 1F70A 2NZ0A 3OX6A 4PHKA 4ORAB 4ETOA 2LE9B 1BODA 4PHNA 3LK0A 1SR6C 2BL0B 4MN0A 1OMDA 2WCLA 5I2QA 4OZDA 1BJFA 5DICA 4GNKB 4C0LA 3O4YA 3BQ3A 2BECA 1RTP1 5GQQC 1KQMB 1S26D 4INXA 5CSIA 1DGUA 4BY4A 1ZFSA 1OZSA 2LLTA 1QLKA 1SL9A 2QEBA 4NDCA 1DMOA 3AAJA 1Y0VH 4PE1A 1NUBA 4XJKB 2M7NA 3B86A 1M39A 1PK0D 2JQ6A 1CM1A 1XFXO 1KK7Z 1C07A 4MZKA 2ZRTA 1JWDA 5PALA 3O4XA 1CLBA 2JZIA 2LM5A 1FF1A 4YGAA 1OOJA 5D7FA 4IL1A 1J7RA 2JULA 1FBVA 2OTGB 1B7TY 2JXCA 2ZKMX 4CPVA 2MA2A 3M0WA 4DCKA 1A29A 1QXPA 4DIRA 3VRQA 1PVAA 2I18A 1JF2A 4FQOA 1U5IA 1ZOTB 2LVIA 4WQ2A 4CFRA 1A2XA 2BCBA 3CLNA 2KSPA 5F6TA 1K9KA 1ORGA 3B7AA 1QV1A 5AXIA 1CNPA 1W7IB 2A4JA 2L2EA 1TWOA 1M31A 3PN7C 3UNWA 1BU3A 1MF8B 2P71A 2KHNA 3I5IC 4CLNA 1T14A 2HF5A 3VRPA 1MXLC 3EK4A 2KPHA 1TUJA 2HPSA 4IJ7A 1TIZA 3NHIA 1CLMA 2EC6C 1C3ZA 4YI8A 5ER4X 2KQ6A 1UUSA 4D1EA 3WNXB 2WC5A 2KOTA 3PFVA 4YGEB 4QJ3B 2KI6D 1UHHA 1KSOA 1KQVA 1SL7A 1CFPA 1C7VA 1QASA 3BOWA 3TUYC 1DVIA 1PULA 2L51A 1SKTA 4Q04A 3LCPC 1DJGA 1F4OA 1RWYA 1XFVO 1K95A 1DJIA 2K8MB 2JT0A 4DRWA 1ALVA 2JNXA 1S1EA 5JOLA 4MVFA 2E30A 2RGIA 1QVIY 2KDHA 1V1GA 1LVCD 4MLWA 1JFJA 2R2IA 3AAKA 1OOHA 3WHTB 3TDUA 3SS4A 4AQJA 1S5GY 5AANA 2H61A 2AMIA 3EKHA
chains in the Genus database with same CATH topology
3BJHA 5EL2A 3PJIA 3DXLA 2ERBA 2WCHA 2QDIA 3CZ0A 2PQLA 3D78A 3D76A 3V2LA 3B87A 3NGVA 2WCKA 3R1OA 3L4LA 3RZSA 3Q8IA 3BFHA 3CDNA 2QEVA 3DYEA 4JD9A 3FE8A 3L4AA 3B88A 1OOFA 1OOGA 3DZTA 3B6XA 2WCLA 4OZDA 5DICA 1OOIX 3D77A 3DY9A 1DQEA 1OW4A 4INXA 3CZ1A 2WCJA 3R72A 2QEBA 2QEHA 3S0EA 3B86A 4INWA 3VB1A 1XFRA 1C3YA 4PT1A 2L2CA 3S0BA 2QEOA 3CZ2A 3R1PA 3L47A 3FE6A 3D74A 4F7FA 3BFBA 2GTEA 3S0AA 3NHTA 1P28A 3CABA 3S0DA 1ORGA 3B7AA 1LS8A 3S0GA 1TWOA 2P71A 3BFAA 2WCMA 1T14A 2KPHA 1TUJA 3NHIA 1C3ZA 2P70A 3OGNA 2WC5A 3D73A 3K1EA 1GM0A 1QWVA 2H8VA 2WC6A 2FJYA 4FQTA 3CYZA 3QMEA 3R1VA 3S0FA 3FE9A 3D75A 1OOHA 3N7HA 2JPOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BJH A;  5EL2 A;  3PJI A;  3DXL A;  2ERB A;  2WCH A;  2QDI A;  3CZ0 A;  2PQL A;  3D78 A;  3D76 A;  3V2L A;  3B87 A;  3NGV A;  2WCK A;  3R1O A;  3L4L A;  3RZS A;  3Q8I A;  3BFH A;  3CDN A;  2QEV A;  3DYE A;  4JD9 A;  3FE8 A;  3L4A A;  3B88 A;  1OOF A;  1OOG A;  3DZT A;  3B6X A;  2WCL A;  4OZD A;  5DIC A;  1OOI X;  3D77 A;  3DY9 A;  1DQE A;  1OW4 A;  4INX A;  3CZ1 A;  2WCJ A;  3R72 A;  2QEB A;  2QEH A;  3S0E A;  3B86 A;  4INW A;  3VB1 A;  1XFR A;  1C3Y A;  4PT1 A;  2L2C A;  3S0B A;  2QEO A;  3CZ2 A;  3R1P A;  3L47 A;  3FE6 A;  3D74 A;  4F7F A;  3BFB A;  2GTE A;  3S0A A;  3NHT A;  1P28 A;  3CAB A;  3S0D A;  1ORG A;  3B7A A;  1LS8 A;  3S0G A;  1TWO A;  2P71 A;  3BFA A;  2WCM A;  1T14 A;  2KPH A;  1TUJ A;  3NHI A;  1C3Z A;  2P70 A;  3OGN A;  2WC5 A;  3D73 A;  3K1E A;  1GM0 A;  1QWV A;  2H8V A;  2WC6 A;  2FJY A;  4FQT A;  3CYZ A;  3QME A;  3R1V A;  3S0F A;  3FE9 A;  3D75 A;  1OOH A;  3N7H A;  2JPO A; 
#chains in the Genus database with same CATH topology
 3FIA A;  2WND A;  2KFF A;  4OVN F;  4ZCV A;  3CWG A;  4NDD A;  2K60 A;  1GGW A;  1KFX L;  2PSR A;  2K0J A;  1BR4 B;  1J1E A;  2CTN A;  1TNQ A;  3DD4 A;  3CZ0 A;  1UHI A;  4YGC B;  1WRL A;  2ZN8 A;  3AKA A;  2K2F A;  2MRD A;  1R2U A;  1EH2 A;  1KK8 C;  1F55 A;  3NSO A;  1NX2 A;  3DVJ A;  3WHU B;  1SW8 A;  5KU1 A;  3DVE A;  1NX1 A;  1DJY A;  3EK8 A;  3CZT X;  4P2Y B;  2K7B A;  1XFZ O;  1IJ5 A;  1S6I A;  1JUO A;  2KLE A;  2LCP A;  1CDM A;  1DJH A;  3D10 A;  3BYA A;  3JTD C;  3KPX A;  2ZNE A;  3L4L A;  1DF0 B;  4P5O E;  3TS5 B;  3KEV A;  5HL1 A;  3BFH A;  3CDN A;  3RZS A;  1IKU A;  4JD9 A;  3KHE A;  4GAO A;  3FE8 A;  2QAC A;  4N1F A;  3B88 A;  1PAL A;  3DZT A;  1EG4 A;  4QJ5 B;  1LKJ A;  1N2D A;  3I5F B;  4OR9 B;  1KSM A;  2KLD A;  4PE4 A;  3WXA A;  3D0Y B;  1UP5 A;  1NCZ A;  4PDZ A;  2K61 A;  1J55 A;  2JWW A;  3D77 A;  3SS3 A;  1H8B A;  3VRN A;  3KO0 A;  4I5K A;  3ICB A;  2F3Z A;  5HLV A;  1WDC B;  1YVH A;  3SJS A;  3OB2 B;  2K2A A;  3DF0 B;  4CFQ A;  1J7Q A;  2QEH A;  1RK9 A;  1KFU S;  3BUW B;  1EJ3 A;  1MUX A;  2KFH A;  3OHM B;  1SCM B;  4MRX A;  4INW A;  1QX5 B;  4FTG A;  1SNL A;  4USL A;  1AVS A;  5I2O A;  1XA5 A;  2M1U A;  1VRK A;  1YR5 A;  2H61 C;  3IQO A;  2BKI B;  1MR8 A;  1YX8 A;  1CLL A;  2JXL A;  4PT1 A;  1NX0 A;  2L2C A;  3SG6 A;  2JOJ A;  3S0B A;  1KCY A;  1K93 D;  2BL0 C;  1J1D A;  4HSZ A;  1CKK A;  1FPW A;  1Y1A A;  2CBL A;  3PM2 A;  1NP8 A;  3L47 A;  4HRE E;  1BOC A;  1J7P A;  1Y6W A;  4NQG A;  1BF5 A;  1CDN A;  1NYA A;  4F7F A;  3IF7 A;  3IVT A;  1S6C A;  3VGO A;  1ZMZ A;  2LV7 A;  1SPY A;  2GTE A;  2NLN A;  2LUX A;  3O6B A;  1KQM C;  4MBE A;  4XYN A;  3SG2 A;  3S0A A;  1TNX A;  2M97 A;  3VRR A;  5HYD A;  1B8C A;  1P28 A;  3CAB A;  4I5J A;  1LS8 A;  2WCB A;  1L2O B;  2LHI A;  5J3X A;  2BBN A;  2LC5 A;  3BFA A;  2WCM A;  1OQP A;  2JU0 A;  1LA0 A;  4YBH B;  4I5N B;  1IQ3 A;  2FCE A;  3EK7 A;  1TTX A;  2P70 A;  1EL4 A;  2HQW A;  1CM4 A;  1IH0 A;  5I2L A;  5ER5 A;  2KNE A;  2OTG C;  1L7Z A;  2WOR A;  3OBV A;  4WRI A;  2LAP A;  3D73 A;  5DKR A;  1CFD A;  2KI4 C;  1W7J B;  1N65 A;  2L4H A;  2Q91 A;  4GFT A;  2HQ8 A;  1TNW A;  2KQY A;  1DJX A;  1WLM A;  1F54 A;  2G2B A;  2MLF C;  1YUU A;  2BE6 A;  4DS7 A;  2WC6 A;  2ZN9 A;  1GQM A;  2BBM A;  1B8L A;  1G8I A;  2KAX A;  3GK4 X;  1XFW O;  1SK6 D;  1B8R A;  2VRG A;  3GK2 A;  3QRX A;  3R1V A;  4JKT A;  4NDB A;  1DJZ A;  2CXJ A;  2EGD A;  4CID A;  4C0J A;  4M2Q A;  3EVU A;  1QTX A;  1UWO A;  5FI7 A;  4HRH A;  1DEL A;  2CNP A;  2M7L A;  5AFP A;  1DF0 A;  1AUI B;  4OV2 A;  2LLU A;  3DXL A;  2LVJ A;  2WCH A;  2LAN A;  2PYQ A;  2BKH B;  1ZAC A;  1M45 A;  2G9B A;  1OMV A;  3OP0 A;  4GPL B;  1EG3 A;  1WRZ A;  2QPT A;  1RRO A;  3PN7 B;  3EKJ A;  3NGV A;  2CT9 A;  2LHL A;  1AHR A;  1ZUZ A;  2LP2 A;  4ZCU A;  1DC1 A;  2L5Y A;  5TNC A;  1KK7 Y;  1QAT A;  1B4C A;  3L4A A;  1QLS A;  2KI6 C;  1OOG A;  3AKB A;  5D69 A;  1ODB A;  2KBM A;  5BPJ A;  1TUZ A;  1JBA A;  1PSR A;  1LIN A;  1S36 A;  1BR1 B;  2JTT A;  3B6X A;  1MHO A;  1XO5 A;  1SCV A;  2Y5I A;  1UHN A;  1JFK A;  1OW4 A;  4ORC B;  5FI2 A;  1OE9 B;  1M46 A;  2LLS A;  3CZ1 A;  1UHJ A;  1SRA A;  2WCJ A;  5DKN A;  1PSB A;  3R72 A;  1BT6 A;  1KWO B;  1XVJ A;  3S0E A;  1F8H A;  1SL8 A;  2LMV A;  1OSA A;  2M0R A;  3I5H B;  2KYF A;  1ALW A;  1QJT A;  1YUR A;  4PAL A;  4YGB B;  1XYD A;  1E8A A;  3LLE A;  3TS5 C;  1MXE A;  2MJW B;  1HQV A;  1XFR A;  1C3Y A;  3RLZ A;  2P6B B;  4XJK A;  1DJW A;  3SG5 A;  1S3P A;  3I5G B;  2QEO A;  3BUX B;  1LXF C;  3HCM A;  2GGZ A;  3CR4 X;  1YUT A;  1C7W A;  2NCP A;  3I5F C;  3IQQ A;  3CZ2 A;  5HKZ A;  1IG5 A;  2E6W A;  3PM8 A;  2FJU B;  2KYC A;  3SS5 A;  2K7O A;  3FE6 A;  5FYX A;  1TOP A;  1KK8 B;  1DEK A;  3CR5 X;  2M1K B;  2NCO A;  4TNC A;  3ZNI A;  1BMO A;  1WDC C;  1NCX A;  1SYM A;  3FWC A;  1KFX S;  5G08 A;  2Q4U A;  1R6P A;  3PSR A;  4L9M A;  1OMR A;  3CTN A;  1XFU O;  3RM1 A;  3S0D A;  1AP4 A;  4JPZ B;  1SCM C;  2PMY A;  2ZFD A;  1FW4 A;  2B1U A;  2OS8 B;  1F4Q A;  1SSE B;  1UHK A;  1AJ4 A;  3OX5 A;  2KGB C;  1IIO A;  1K8U A;  1IRJ A;  4GBA A;  2MBX A;  1WRK A;  3GK1 A;  2O60 A;  2BE4 A;  4MSP A;  2JC2 A;  1QS7 A;  2OPO A;  1QV0 A;  1HT9 A;  1V1F A;  2JPT A;  2KGR A;  3K1E A;  3DVK A;  4PCW A;  1J7O A;  4QJ4 B;  1GM0 A;  4MZL A;  5IBW A;  2ZRS A;  2LMT A;  5I8N A;  2TN4 A;  1JC2 A;  5DKQ A;  1GGZ A;  1Y1U A;  4E68 A;  4UPG A;  1QWV A;  5KSZ A;  2CCM A;  2K7D A;  2LVV A;  4FQT A;  2MLE C;  2F2O A;  2GV5 A;  4YI9 A;  2I94 A;  1NIW A;  4N5X A;  1A75 B;  4HRG A;  1L2O C;  3E3R A;  1D1O A;  3JVT B;  3BUN B;  2AUC A;  2PVB A;  3D75 A;  3FE9 A;  1XK4 A;  4GGF A;  2JNF A;  3N7H A;  3UO9 A;  5CSF A;  3LL8 B;  1SR6 B;  4C0K A;  1SBJ A;  1LA3 A;  5D3O A;  1CDL A;  5EL2 A;  2Y4Q A;  4PE7 A;  3FS7 A;  1A4P A;  3SIA A;  1K9U A;  1PVB A;  1OZO A;  2GGM A;  3SIB A;  2DOQ A;  3D78 A;  3NSL A;  1TCF A;  2KFG A;  5CPV A;  2L0P A;  3V2L A;  1PRW A;  1YUS A;  4MEW A;  1RJV A;  1QVI Z;  2MAZ A;  2MHH A;  1X02 A;  4M2P A;  1IWQ A;  1SY9 A;  2BCX A;  1CB1 A;  2PAS A;  1S5G Z;  3Q8I A;  4A4B A;  2JRF A;  2FCD A;  4BY5 A;  2F8P A;  4ORB B;  1K2H A;  5I94 A;  1DT7 B;  1K9P A;  1K96 A;  1OOF A;  2F2P A;  1B47 A;  1G4Y R;  2ZND A;  4DUQ A;  3LK1 A;  1NWD A;  2KAV A;  2KI4 B;  4PHM A;  2Y1M A;  1OOI X;  3A8R A;  1B1G A;  3DY9 A;  1CDP A;  2SCP A;  1DQE A;  2LVK A;  4PHJ A;  1BLQ A;  1NX3 A;  2L98 A;  2WCE A;  3BUM B;  2JT8 A;  1CFC A;  1CMG A;  1QIV A;  5CSN A;  1H4B A;  1AJ5 A;  2D8N A;  3D0Y A;  1XFY O;  1Y1X A;  1YRU B;  2KAY A;  1Z4H A;  3DF0 A;  1NSH A;  4GGF C;  1XK4 C;  1IQ5 A;  3BUO B;  5HKY A;  3I5I B;  3CS1 A;  4AOM A;  1QIW A;  3O2P A;  1BG1 A;  1TNP A;  3VB1 A;  2M9G A;  4N1G A;  4OCI A;  1DTL A;  2H2K A;  2EC6 B;  1NPQ A;  3PAL A;  4GGN A;  1AK8 A;  3NXA A;  5HKW A;  3SG4 A;  2PRU A;  1JSA A;  3O78 A;  4F0Z B;  2M29 A;  2COL B;  3R1P A;  2YGU A;  1B9A A;  2BAP A;  3NSI A;  1F71 A;  2HET A;  4GUK A;  3D74 A;  3VRO A;  3PAT A;  1Q80 A;  1QX2 A;  4WQ3 A;  3BFB A;  3TUY B;  2WCF A;  2EHB A;  1GJY A;  3NHT A;  1CMF A;  5HLO A;  1KWO C;  4R1E A;  3CGA A;  1TRF A;  3S0G A;  2LP3 A;  1WY9 A;  2PAL A;  2LUC A;  3I5H C;  3SG3 A;  4YGD B;  1CTR A;  1G33 A;  3DVM A;  1SMG A;  2O5G A;  3MSE B;  3TDI A;  5AEQ A;  1Z2C B;  1MWN A;  1A75 A;  1CFF A;  2NXQ A;  1N0Y A;  3OGN A;  3BXK A;  2M49 B;  3I5G C;  3SG7 A;  1YVL A;  4MRY A;  1U5I B;  1KFU L;  2WOS A;  2WC8 A;  5CSJ A;  1YTZ C;  2F3Y A;  2Y1N A;  1W9Z A;  2BNX A;  2H8V A;  4I5L B;  4AQI A;  3F45 A;  1TCO B;  2FJY A;  2I2R E;  1WLZ A;  4JWQ A;  1YX7 A;  1UUR A;  3CYZ A;  2ISD A;  3FWB A;  3QME A;  3JTD B;  1FI5 A;  2L4I A;  3S0F A;  2M8U A;  4OKH A;  2BCA A;  1DGV A;  2OS8 C;  3GOF A;  3NSK A;  1NCY A;  2M3W A;  4KYN A;  4U8D A;  5KTY A;  1QX7 A;  5B8I B;  1K90 D;  3TDZ A;  5K89 A;  1FI6 A;  1A03 A;  2JPO A;  3PLF B;  1B7T Z;  3OB1 B;  4ICB A;  5FI6 A;  2JT3 A;  3BJH A;  2KBI A;  1IJ6 A;  3PJI A;  2JTZ A;  3HX4 A;  4MZJ A;  3C1V A;  2ERB A;  2QDI A;  3BOW B;  1RFJ A;  4PE0 A;  2PQL A;  3ZWH A;  1MQ1 A;  2I7A A;  3KF9 A;  1REC A;  2AAO A;  1S6J A;  3CR2 A;  2FOT A;  4A4C A;  5AER A;  3K21 A;  1M63 B;  3D76 A;  1TN4 A;  2F33 A;  2LMU A;  3A4U B;  3EVR A;  2L50 A;  3TZ1 A;  5JJG A;  2LNK A;  2K7C A;  2L5X B;  3B87 A;  2SAS A;  1JF0 A;  1K94 A;  3EG5 B;  2IS9 A;  2WCK A;  3EVV A;  4M2O A;  3R1O A;  1YRT B;  4JQ0 D;  4YRU A;  3H4S E;  2V53 A;  2QEV A;  3DYE A;  3JVT C;  1IGV A;  1EXR A;  1F70 A;  2NZ0 A;  3OX6 A;  4PHK A;  4ORA B;  4ETO A;  2LE9 B;  1BOD A;  4PHN A;  3LK0 A;  1SR6 C;  2BL0 B;  4MN0 A;  1OMD A;  2WCL A;  5I2Q A;  4OZD A;  1BJF A;  5DIC A;  4GNK B;  4C0L A;  3O4Y A;  3BQ3 A;  2BEC A;  1RTP 1;  5GQQ C;  1KQM B;  1S26 D;  4INX A;  5CSI A;  1DGU A;  4BY4 A;  1ZFS A;  1OZS A;  2LLT A;  1QLK A;  1SL9 A;  2QEB A;  4NDC A;  1DMO A;  3AAJ A;  1Y0V H;  4PE1 A;  1NUB A;  4XJK B;  2M7N A;  3B86 A;  1M39 A;  1PK0 D;  2JQ6 A;  1CM1 A;  1XFX O;  1KK7 Z;  1C07 A;  4MZK A;  2ZRT A;  1JWD A;  5PAL A;  3O4X A;  1CLB A;  2JZI A;  2LM5 A;  1FF1 A;  4YGA A;  1OOJ A;  5D7F A;  4IL1 A;  1J7R A;  2JUL A;  1FBV A;  2OTG B;  1B7T Y;  2JXC A;  2ZKM X;  4CPV A;  2MA2 A;  3M0W A;  4DCK A;  1A29 A;  1QXP A;  4DIR A;  3VRQ A;  1PVA A;  2I18 A;  1JF2 A;  4FQO A;  1U5I A;  1ZOT B;  2LVI A;  4WQ2 A;  4CFR A;  1A2X A;  2BCB A;  3CLN A;  2KSP A;  5F6T A;  1K9K A;  1ORG A;  3B7A A;  1QV1 A;  5AXI A;  1CNP A;  1W7I B;  2A4J A;  2L2E A;  1TWO A;  1M31 A;  3PN7 C;  3UNW A;  1BU3 A;  1MF8 B;  2P71 A;  2KHN A;  3I5I C;  4CLN A;  1T14 A;  2HF5 A;  3VRP A;  1MXL C;  3EK4 A;  2KPH A;  1TUJ A;  2HPS A;  4IJ7 A;  1TIZ A;  3NHI A;  1CLM A;  2EC6 C;  1C3Z A;  4YI8 A;  5ER4 X;  2KQ6 A;  1UUS A;  4D1E A;  3WNX B;  2WC5 A;  2KOT A;  3PFV A;  4YGE B;  4QJ3 B;  2KI6 D;  1UHH A;  1KSO A;  1KQV A;  1SL7 A;  1CFP A;  1C7V A;  1QAS A;  3BOW A;  3TUY C;  1DVI A;  1PUL A;  2L51 A;  1SKT A;  4Q04 A;  3LCP C;  1DJG A;  1F4O A;  1RWY A;  1XFV O;  1K95 A;  1DJI A;  2K8M B;  2JT0 A;  4DRW A;  1ALV A;  2JNX A;  1S1E A;  5JOL A;  4MVF A;  2E30 A;  2RGI A;  1QVI Y;  2KDH A;  1V1G A;  1LVC D;  4MLW A;  1JFJ A;  2R2I A;  3AAK A;  1OOH A;  3WHT B;  3TDU A;  3SS4 A;  4AQJ A;  1S5G Y;  5AAN A;  2H61 A;  2AMI A;  3EKH A; 
#chains in the Genus database with same CATH homology
 3BJH A;  5EL2 A;  3PJI A;  3DXL A;  2ERB A;  2WCH A;  2QDI A;  3CZ0 A;  2PQL A;  3D78 A;  3D76 A;  3V2L A;  3B87 A;  3NGV A;  2WCK A;  3R1O A;  3L4L A;  3RZS A;  3Q8I A;  3BFH A;  3CDN A;  2QEV A;  3DYE A;  4JD9 A;  3FE8 A;  3L4A A;  3B88 A;  1OOF A;  1OOG A;  3DZT A;  3B6X A;  2WCL A;  4OZD A;  5DIC A;  1OOI X;  3D77 A;  3DY9 A;  1DQE A;  1OW4 A;  4INX A;  3CZ1 A;  2WCJ A;  3R72 A;  2QEB A;  2QEH A;  3S0E A;  3B86 A;  4INW A;  3VB1 A;  1XFR A;  1C3Y A;  4PT1 A;  2L2C A;  3S0B A;  2QEO A;  3CZ2 A;  3R1P A;  3L47 A;  3FE6 A;  3D74 A;  4F7F A;  3BFB A;  2GTE A;  3S0A A;  3NHT A;  1P28 A;  3CAB A;  3S0D A;  1ORG A;  3B7A A;  1LS8 A;  3S0G A;  1TWO A;  2P71 A;  3BFA A;  2WCM A;  1T14 A;  2KPH A;  1TUJ A;  3NHI A;  1C3Z A;  2P70 A;  3OGN A;  2WC5 A;  3D73 A;  3K1E A;  1GM0 A;  1QWV A;  2H8V A;  2WC6 A;  2FJY A;  4FQT A;  3CYZ A;  3QME A;  3R1V A;  3S0F A;  3FE9 A;  3D75 A;  1OOH A;  3N7H A;  2JPO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...